2H7EA

Solution structure of the talin f3 domain in complex with a chimeric beta3 integrin-pip kinase peptide- minimized average structure
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
101
structure length
101
Chain Sequence
PLGSGVSFFLVKEKMKGKNKLVPRLLGITKESVMRVDEKTKEVIQEWSLTNIKRWAASPKSFTLDFGDYQDGYYSVQTTEGEQIAQLIAGYIDIILKKKKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural basis of integrin activation by talin
pubmed doi rcsb
source organism Gallus gallus
molecule tags Structural protein
molecule keywords Talin-1
total genus 17
structure length 101
sequence length 101
ec nomenclature
pdb deposition date 2006-06-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2h7eA00
5FI1A 1AWEA 1RJ2A 4HB0B 2DHJA 2D9YA 5HE3A 5JP4A 2L2IA 4DX90 4GPTB 2DFKA 1MKEA 3PEGA 3WA0A 3NSUA 3A98B 2I1KA 4A6FB 4B6HA 5C5BA 5KCVA 4DBBA 2MWNB 4ZRIA 2JP2A 4PQ0A 1DDWA 1FAOA 1KZ7A 3CXBB 2Y8GA 2CRFA 4YONA 3PZDA 2DYNA 1K5DB 3ZVRA 3P7ZA 2AEHA 5L81A 2H7DA 4KHBB 1WVHA 3TCAA 2CODA 2YS3A 5D3XA 2EMSA 3DXDA 2G35A 1V5UA 1MAIA 4BBKA 1LW3A 4KVGB 2OTXA 1DYNA 4HHVA 2ROZB 4YL8A 5HE0A 1TQZA 2H7EA 1EAZA 1WGQA 1FGZA 2K2JA 4K17A 3HQCA 4A6HA 3FM8C 1AQCA 3PVWA 3PVUA 3M1IB 2DLWA 1OY2A 2RNRB 4HB2B 2EMTA 1FGYA 3AJ4A 4MY6A 2COFA 2R0DA 2FJLA 3SYXA 2E2XA 5D3WA 1PLSA 4HDQA 2RVBB 3PP2A 3FEHA 5HE1A 3SNHA 1SHCA 1XCGA 1FOEA 4D0NB 2Z0PA 1XODA 2YS1A 2RSGA 1P6SA 4P7IA 2J0JA 1LB1A 1WG7A 2R09A 2LOZA 1X86A 1UNPA 2MKRA 2RUKB 1XD4A 2GS0A 1UEFA 3KY9A 2CY5A 2DYQA 5C6RA 1V5PA 2D4QA 5J3QA 1Q67A 1ZSQA 1V61A 4HAXB 4EMOA 2YS5A 2UVMA 2DX5A 5C79A 2J59M 1K5GB 3AU5A 1ISNA 3GYPA 4Y94A 1ZVRA 3O96A 5DH9B 4HAUB 4K2PA 3KRWA 1WJMA 5D27A 5LOPB 1UNQA 1UNRA 3PSCA 2PZ1A 2DHKA 2DKPA 4IAPA 2J0MA 1XR0B 2GCLA 4CHMA 1I2HA 4GMXB 5C16A 2KGXB 1X05A 3BINA 2GJYA 4Z2NA 1ZC4B 4F7HA 1PFJA 2CAYA 2J0KA 2ZPYA 1EVHA 1X1FA 3LJUX 1X11A 1MK9B 2KUPA 1SGHA 2LOXA 1B55A 1W1GA 2D9VA 3VOQA 2P0FA 1MPHA 1XKEA 1J0WA 2YVCA 1KZGA 1MK7B 5JLJB 3SV1A 4KAXB 4GN1A 3ML4A 3ZDTA 3DXCA 3SUZA 3F0WA 5DI9B 4PNKA 2ADZA 4MK0A 1GC6A 1W1HA 4HB3B 5HE2A 1ZC3B 5LONB 2YF0A 2KCJA 1DDMA 4GMVA 3MPXA 3G9WA 3GYOA 5CLQB 2BCJA 1Y5OA 3T06A 2LULA 4XWXA 5GOWB 3ULBA 3IVFA 4WJ7A 5D3VA 4Z2MB 4GXBA 3OANA 3BJIA 5DHAB 3ODXA 1M7RA 2D11A 4HAZB 4NSWA 4HATB 3DXEA 2M14A 1PMSA 4HAWB 3PVLA 4EJNA 2OQBA 3TO1A 1EF1A 3N7CA 1U27A 2D9XA 3QWMA 2L1CA 5DIFB 1P5TA 2Z0QA 1OMWA 2N23A 2Y7BA 1NTVA 1FHXA 3HK0A 4MT7A 2YT1A 3TFMA 4A5KA 2D9WA 1UPQA 2ROVA 5EFXA 2V76A 1U5EA 1GC7A 3KRXA 3TVVA 3QIJA 1OQNA 3P6AA 2HTHB 2VKIA 4F7GA 1U5FA 3MDBC 1KI1B 1TXDA 3QBVB 4H8SA 1ZM0A 2M38A 3PG7A 3AU4A 2CY4A 2RGNB 2Y8FA 5J3YA 5CLLB 1WGUA 2K00A 2UZSA 1H10A 5D3YA 2NMBA 5DHFB 2ELBA 4KHAA 2W2XC 4F7UP 2VSZA 1NI2A 1BTNA 5FI0A 1TJ6A 1U2BA 1WJ1A 1EGXA 1QQGA 2P8VA 5C5BB 4L6EA 4ZRKA 4K2OA 4A6FA 2I5FA 2W2XD 2P0HA 2YSZA 2HE7A 2AL6A 1N3HA 2DN6A 1I7AA 5J3TA 4IFSA 3UZTA 2IFSA 1W1DA 1WI1A 2QKLA 3WYFB 2W2WA 3ODWA 5KQ4A 2GCJA 3X23A 2MFQA 4ZRJA 3D8DA 2DTCA 5JHGA 4K81A 2MDXA 1U29A 2LYDA 2LKOA 4EKUA 2DHIA 1Z87A 2QKMA 2DA0A 3RCPA 1P3RA 2K2UA 4DX8A 1QC6A 1H4RA 2X18A 1NTYA 1GG3A 2Z0OA 2EJ8A 3ODOA 5JHHA 2Q13A 2N0YA 4HDOA 1BAKA 2I1JA 1FHWA 2YRYA 4DXAB 3HW2B 5KQ1A 3U8ZA 4CYEA 4KHOA 1FHOA 1MIXA 1DBHA 2IYBA 2LG1A 2P0DA 3D8EA 1U5DA 2NZ8B 3F5RA 1FB8A 1BWNA 1J19A 3A8QA 3TW1A 1BTKA 2COAA 4WSFA 3SO6A 3V5WA 3A8PA 4C0AA 3ULCA 2VRWB 4A6KA 2D9ZA 1X1GA 4WVFB 3KZ1A 1U5GA 1NU2A 2XQNM 1DROA 1V89A 2YT0A 2DX1A 3D8FA 2DKQA 1MIZB 2RLOA 1V88A 2I5CA 1M7EA 1XX0A 3FSSA 1V5MA 4HAYB 3VIAA 1IRSA 3U7DA 4GZUA 3KSYA 4HB4B 4IOYX 1RRPB 4CHJA 1E5WA 4TKNA 2D10A 1UPRA 3CIKA 1Y19B 2EC1A 2D2QA 2ELAA 4NY0A 1DDVA 2COCA 2UZRA 4TYZA 4HAVB
chains in the Genus database with same CATH superfamily
5FI1A 1AWEA 1RJ2A 4HB0B 2DHJA 2D9YA 5HE3A 5JP4A 2L2IA 4DX90 4GPTB 2DFKA 1MKEA 3PEGA 3WA0A 3NSUA 3A98B 2I1KA 4A6FB 4B6HA 5C5BA 5KCVA 4DBBA 2MWNB 4ZRIA 2JP2A 4PQ0A 1DDWA 1FAOA 1KZ7A 3CXBB 2Y8GA 2CRFA 4YONA 3PZDA 2DYNA 1K5DB 3ZVRA 3P7ZA 2YT2A 2AEHA 5L81A 2H7DA 4KHBB 1WVHA 3TCAA 2CODA 2YS3A 5D3XA 2EMSA 3DXDA 2G35A 3DCXA 2Z13A 1V5UA 1MAIA 4BBKA 1LW3A 2ZKMX 4KVGB 2OTXA 1DYNA 4HHVA 2ROZB 4YL8A 5HE0A 1T77A 1TQZA 2H7EA 1EAZA 1WGQA 1FGZA 2K2JA 4K17A 3HQCA 4A6HA 3FM8C 1AQCA 3PVWA 3NW8A 3PVUA 3M1IB 3FVCA 2DLWA 1OY2A 2RNRB 4HB2B 2EMTA 1FGYA 3A58A 3AJ4A 4MY6A 2COFA 2R0DA 2FJLA 3SYXA 2E2XA 3NWDA 5D3WA 1PLSA 4HDQA 2RVBB 3PP2A 3FEHA 5HE1A 5M4YB 3SNHA 1SHCA 1XCGA 1FOEA 4D0NB 2Z0PA 1XODA 2YS1A 2RSGA 1P6SA 4P7IA 2J0JA 4GNKB 1LB1A 1WG7A 2R09A 2LOZA 1X86A 1UNPA 2MKRA 2RUKB 1XD4A 2GS0A 1UEFA 3KY9A 2CY5A 2DYQA 5C6RA 1V5PA 2KIGA 2D4QA 5J3QA 1Q67A 5LG4B 1ZSQA 1V61A 4HAXB 4EMOA 2YS5A 2UVMA 2DX5A 5C79A 2J59M 1K5GB 3AU5A 1ISNA 3HSAA 3GYPA 4Y94A 1ZVRA 3O96A 5DH9B 4HAUB 4K2PA 3KRWA 1WJMA 2R2YA 5D27A 5LOPB 1UNQA 1UNRA 3PSCA 2PZ1A 2DHKA 2DKPA 4IAPA 2J0MA 1XR0B 2GCLA 4CHMA 1I2HA 4GMXB 5C16A 2KGXB 1X05A 3BINA 2GJYA 4Z2NA 1ZC4B 3NWFA 4F7HA 1PFJA 2CAYA 2J0KA 2ZPYA 1EVHA 1X1FA 3LJUX 1X11A 1MK9B 2KUPA 1SGHA 2LOXA 1B55A 1W1GA 2D9VA 3VOQA 2P0FA 1ZYIA 1MPHA 1XKEA 3U12A 1J0WA 2YVCA 1KZGA 1MK7B 5JLJB 3SV1A 4KAXB 4GN1A 3ML4A 2KUQA 3ZDTA 4D6WA 3DXCA 3SUZA 3F0WA 5DI9B 4PNKA 2ADZA 4MK0A 1GC6A 1W1HA 4HB3B 2NBVA 5HE2A 1ZC3B 5LONB 2YF0A 2KCJA 1DDMA 4GMVA 3MPXA 3G9WA 3GYOA 5CLQB 2BCJA 1Y5OA 3T06A 2LULA 4QJ5B 4XWXA 5GOWB 3ULBA 3IVFA 4WJ7A 5D3VA 4Z2MB 5IRSA 4GXBA 3OANA 3BJIA 5DHAB 3ODXA 1M7RA 2D11A 4HAZB 4NSWA 4HATB 3DXEA 2M14A 1PMSA 4HAWB 3PVLA 4EJNA 2OQBA 3TO1A 1EF1A 3N7CA 1U27A 2D9XA 3QWMA 2L1CA 2Z4DA 5DIFB 3OHMB 1P5TA 2Z0QA 1OMWA 2N23A 2Y7BA 1NTVA 1FHXA 3HK0A 4MT7A 2GUMA 2YT1A 3TFMA 4A5KA 2D9WA 1UPQA 2ROVA 5EFXA 2V76A 1U5EA 1GC7A 3KRXA 3TVVA 3QIJA 3HIEA 1OQNA 3P6AA 2HTHB 2VKIA 4F7GA 1U5FA 3MDBC 1KI1B 4CSQA 1TXDA 3QBVB 4H8SA 1ZM0A 2M38A 3PG7A 3AU4A 2CY4A 2RGNB 4KHBA 3B77A 2Y8FA 2Z59A 5J3YA 4DIXA 5CLLB 1WGUA 2K00A 4L1RA 2UZSA 1H10A 5D3YA 2NMBA 5DHFB 2ELBA 4KHAA 2W2XC 4F7UP 2VSZA 1MI1A 1NI2A 1BTNA 5FI0A 1TJ6A 1U2BA 1WJ1A 1EGXA 4GOUA 1QQGA 2P8VA 5C5BB 4L6EA 4ZRKA 4K2OA 4A6FA 2RRFA 2I5FA 2W2XD 2P0HA 2KR0A 2YSZA 2FJUB 2HE7A 2AL6A 1N3HA 2DN6A 1I7AA 4OT1A 5J3TA 4IFSA 3UZTA 2IFSA 1W1DA 1WI1A 2QKLA 3WYFB 2K49A 2W2WA 3ODWA 5KQ4A 2GCJA 3X23A 2MFQA 4ZRJA 3D8DA 2DTCA 5JHGA 2MDXA 1U29A 2LYDA 4K81A 2LKOA 4EKUA 2DHIA 1Z87A 2QKMA 2DA0A 3RCPA 1P3RA 2K2UA 4DX8A 1QC6A 1H4RA 2X18A 1NTYA 1GG3A 2Z0OA 2EJ8A 3ODOA 5JHHA 2Q13A 2N0YA 4HDOA 1BAKA 2I1JA 2KIEA 1FHWA 2YRYA 4DXAB 3HW2B 5KQ1A 3U8ZA 4HSIA 4CYEA 4KHOA 1FHOA 1MIXA 1DBHA 2IYBA 2LG1A 2P0DA 5I2SA 3D8EA 4OSNA 1U5DA 2NZ8B 3F5RA 1FB8A 1BWNA 1J19A 3A8QA 3TW1A 1BTKA 2COAA 4WSFA 3SO6A 3V5WA 3A8PA 4C0AA 3ULCA 2VRWB 4A6KA 2D9ZA 5I2MA 1X1GA 4WVFB 3KZ1A 4QXAB 1U5GA 1NU2A 2XQNM 1DROA 1V89A 2YT0A 3NWAA 2DX1A 3D8FA 2DKQA 1MIZB 2RLOA 1V88A 2K8EA 2I5CA 1M7EA 1XX0A 3FSSA 1V5MA 4HAYB 4QJ3B 3VIAA 1IRSA 3U7DA 4GZUA 3KSYA 4HB4B 4IOYX 1RRPB 4CHJA 1E5WA 4TKNA 2D10A 1UPRA 3CIKA 1Y19B 2EC1A 2D2QA 2ELAA 4NY0A 1DDVA 2COCA 2Z14A 2UZRA 4TYZA 4QJ4B 4HAVB
chains in the Genus database with same CATH topology
5FI1A 1AWEA 1RJ2A 4HB0B 2DHJA 2D9YA 5HE3A 5JP4A 2L2IA 4DX90 4GPTB 2DFKA 1MKEA 3PEGA 3WA0A 3NSUA 3A98B 2I1KA 4A6FB 4B6HA 5C5BA 5KCVA 4DBBA 2MWNB 4ZRIA 2JP2A 4PQ0A 1DDWA 1FAOA 1KZ7A 3CXBB 2Y8GA 2CRFA 4YONA 3PZDA 2DYNA 1K5DB 3ZVRA 3P7ZA 2AEHA 5L81A 2H7DA 4KHBB 1WVHA 3TCAA 2CODA 2YS3A 5D3XA 2EMSA 3DXDA 2G35A 1V5UA 1MAIA 4BBKA 1LW3A 4KVGB 2OTXA 1DYNA 4HHVA 2ROZB 4YL8A 5HE0A 1TQZA 2H7EA 1EAZA 1WGQA 1FGZA 2K2JA 4K17A 3HQCA 4A6HA 3FM8C 1AQCA 3PVWA 3PVUA 3M1IB 2DLWA 1OY2A 2RNRB 4HB2B 2EMTA 1FGYA 3AJ4A 4MY6A 2COFA 2R0DA 2FJLA 3SYXA 2E2XA 5D3WA 1PLSA 4HDQA 2RVBB 3PP2A 3FEHA 5HE1A 3SNHA 1SHCA 1XCGA 1FOEA 4D0NB 2Z0PA 1XODA 2YS1A 2RSGA 1P6SA 4P7IA 2J0JA 1LB1A 1WG7A 2R09A 2LOZA 1X86A 1UNPA 2MKRA 2RUKB 1XD4A 2GS0A 1UEFA 3KY9A 2CY5A 2DYQA 5C6RA 1V5PA 2D4QA 5J3QA 1Q67A 1ZSQA 1V61A 4HAXB 4EMOA 2YS5A 2UVMA 2DX5A 5C79A 2J59M 1K5GB 3AU5A 1ISNA 3GYPA 4Y94A 1ZVRA 3O96A 5DH9B 4HAUB 4K2PA 3KRWA 1WJMA 5D27A 5LOPB 1UNQA 1UNRA 3PSCA 2PZ1A 2DHKA 2DKPA 4IAPA 2J0MA 1XR0B 2GCLA 4CHMA 1I2HA 4GMXB 5C16A 2KGXB 1X05A 3BINA 2GJYA 4Z2NA 1ZC4B 4F7HA 1PFJA 2CAYA 2J0KA 2ZPYA 1EVHA 1X1FA 3LJUX 1X11A 1MK9B 2KUPA 1SGHA 2LOXA 1B55A 1W1GA 2D9VA 3VOQA 2P0FA 1MPHA 1XKEA 1J0WA 2YVCA 1KZGA 1MK7B 5JLJB 3SV1A 4KAXB 4GN1A 3ML4A 3ZDTA 3DXCA 3SUZA 3F0WA 5DI9B 4PNKA 2ADZA 4MK0A 1GC6A 1W1HA 4HB3B 5HE2A 1ZC3B 5LONB 2YF0A 2KCJA 1DDMA 4GMVA 3MPXA 3G9WA 3GYOA 5CLQB 2BCJA 1Y5OA 3T06A 2LULA 4XWXA 5GOWB 3ULBA 3IVFA 4WJ7A 5D3VA 4Z2MB 4GXBA 3OANA 3BJIA 5DHAB 3ODXA 1M7RA 2D11A 4HAZB 4NSWA 4HATB 3DXEA 2M14A 1PMSA 4HAWB 3PVLA 4EJNA 2OQBA 3TO1A 1EF1A 3N7CA 1U27A 2D9XA 3QWMA 2L1CA 5DIFB 1P5TA 2Z0QA 1OMWA 2N23A 2Y7BA 1NTVA 1FHXA 3HK0A 4MT7A 2YT1A 3TFMA 4A5KA 2D9WA 1UPQA 2ROVA 5EFXA 2V76A 1U5EA 1GC7A 3KRXA 3TVVA 3QIJA 1OQNA 3P6AA 2HTHB 2VKIA 4F7GA 1U5FA 3MDBC 1KI1B 1TXDA 3QBVB 4H8SA 1ZM0A 2M38A 3PG7A 3AU4A 2CY4A 2RGNB 2Y8FA 5J3YA 5CLLB 1WGUA 2K00A 2UZSA 1H10A 5D3YA 2NMBA 5DHFB 2ELBA 4KHAA 2W2XC 4F7UP 2VSZA 1NI2A 1BTNA 5FI0A 1TJ6A 1U2BA 1WJ1A 1EGXA 1QQGA 2P8VA 5C5BB 4L6EA 4ZRKA 4K2OA 4A6FA 2I5FA 2W2XD 2P0HA 2YSZA 2HE7A 2AL6A 1N3HA 2DN6A 1I7AA 5J3TA 4IFSA 3UZTA 2IFSA 1W1DA 1WI1A 2QKLA 3WYFB 2W2WA 3ODWA 5KQ4A 2GCJA 3X23A 2MFQA 4ZRJA 3D8DA 2DTCA 5JHGA 4K81A 2MDXA 1U29A 2LYDA 2LKOA 4EKUA 2DHIA 1Z87A 2QKMA 2DA0A 3RCPA 1P3RA 2K2UA 4DX8A 1QC6A 1H4RA 2X18A 1NTYA 1GG3A 2Z0OA 2EJ8A 3ODOA 5JHHA 2Q13A 2N0YA 4HDOA 1BAKA 2I1JA 1FHWA 2YRYA 4DXAB 3HW2B 5KQ1A 3U8ZA 4CYEA 4KHOA 1FHOA 1MIXA 1DBHA 2IYBA 2LG1A 2P0DA 3D8EA 1U5DA 2NZ8B 3F5RA 1FB8A 1BWNA 1J19A 3A8QA 3TW1A 1BTKA 2COAA 4WSFA 3SO6A 3V5WA 3A8PA 4C0AA 3ULCA 2VRWB 4A6KA 2D9ZA 1X1GA 4WVFB 3KZ1A 1U5GA 1NU2A 2XQNM 1DROA 1V89A 2YT0A 2DX1A 3D8FA 2DKQA 1MIZB 2RLOA 1V88A 2I5CA 1M7EA 1XX0A 3FSSA 1V5MA 4HAYB 3VIAA 1IRSA 3U7DA 4GZUA 3KSYA 4HB4B 4IOYX 1RRPB 4CHJA 1E5WA 4TKNA 2D10A 1UPRA 3CIKA 1Y19B 2EC1A 2D2QA 2ELAA 4NY0A 1DDVA 2COCA 2UZRA 4TYZA 4HAVB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FI1 A;  1AWE A;  1RJ2 A;  4HB0 B;  2DHJ A;  2D9Y A;  5HE3 A;  5JP4 A;  2L2I A;  4DX9 0;  4GPT B;  2DFK A;  1MKE A;  3PEG A;  3WA0 A;  3NSU A;  3A98 B;  2I1K A;  4A6F B;  4B6H A;  5C5B A;  5KCV A;  4DBB A;  2MWN B;  4ZRI A;  2JP2 A;  4PQ0 A;  1DDW A;  1FAO A;  1KZ7 A;  3CXB B;  2Y8G A;  2CRF A;  4YON A;  3PZD A;  2DYN A;  1K5D B;  3ZVR A;  3P7Z A;  2AEH A;  5L81 A;  2H7D A;  4KHB B;  1WVH A;  3TCA A;  2COD A;  2YS3 A;  5D3X A;  2EMS A;  3DXD A;  2G35 A;  1V5U A;  1MAI A;  4BBK A;  1LW3 A;  4KVG B;  2OTX A;  1DYN A;  4HHV A;  2ROZ B;  4YL8 A;  5HE0 A;  1TQZ A;  2H7E A;  1EAZ A;  1WGQ A;  1FGZ A;  2K2J A;  4K17 A;  3HQC A;  4A6H A;  3FM8 C;  1AQC A;  3PVW A;  3PVU A;  3M1I B;  2DLW A;  1OY2 A;  2RNR B;  4HB2 B;  2EMT A;  1FGY A;  3AJ4 A;  4MY6 A;  2COF A;  2R0D A;  2FJL A;  3SYX A;  2E2X A;  5D3W A;  1PLS A;  4HDQ A;  2RVB B;  3PP2 A;  3FEH A;  5HE1 A;  3SNH A;  1SHC A;  1XCG A;  1FOE A;  4D0N B;  2Z0P A;  1XOD A;  2YS1 A;  2RSG A;  1P6S A;  4P7I A;  2J0J A;  1LB1 A;  1WG7 A;  2R09 A;  2LOZ A;  1X86 A;  1UNP A;  2MKR A;  2RUK B;  1XD4 A;  2GS0 A;  1UEF A;  3KY9 A;  2CY5 A;  2DYQ A;  5C6R A;  1V5P A;  2D4Q A;  5J3Q A;  1Q67 A;  1ZSQ A;  1V61 A;  4HAX B;  4EMO A;  2YS5 A;  2UVM A;  2DX5 A;  5C79 A;  2J59 M;  1K5G B;  3AU5 A;  1ISN A;  3GYP A;  4Y94 A;  1ZVR A;  3O96 A;  5DH9 B;  4HAU B;  4K2P A;  3KRW A;  1WJM A;  5D27 A;  5LOP B;  1UNQ A;  1UNR A;  3PSC A;  2PZ1 A;  2DHK A;  2DKP A;  4IAP A;  2J0M A;  1XR0 B;  2GCL A;  4CHM A;  1I2H A;  4GMX B;  5C16 A;  2KGX B;  1X05 A;  3BIN A;  2GJY A;  4Z2N A;  1ZC4 B;  4F7H A;  1PFJ A;  2CAY A;  2J0K A;  2ZPY A;  1EVH A;  1X1F A;  3LJU X;  1X11 A;  1MK9 B;  2KUP A;  1SGH A;  2LOX A;  1B55 A;  1W1G A;  2D9V A;  3VOQ A;  2P0F A;  1MPH A;  1XKE A;  1J0W A;  2YVC A;  1KZG A;  1MK7 B;  5JLJ B;  3SV1 A;  4KAX B;  4GN1 A;  3ML4 A;  3ZDT A;  3DXC A;  3SUZ A;  3F0W A;  5DI9 B;  4PNK A;  2ADZ A;  4MK0 A;  1GC6 A;  1W1H A;  4HB3 B;  5HE2 A;  1ZC3 B;  5LON B;  2YF0 A;  2KCJ A;  1DDM A;  4GMV A;  3MPX A;  3G9W A;  3GYO A;  5CLQ B;  2BCJ A;  1Y5O A;  3T06 A;  2LUL A;  4XWX A;  5GOW B;  3ULB A;  3IVF A;  4WJ7 A;  5D3V A;  4Z2M B;  4GXB A;  3OAN A;  3BJI A;  5DHA B;  3ODX A;  1M7R A;  2D11 A;  4HAZ B;  4NSW A;  4HAT B;  3DXE A;  2M14 A;  1PMS A;  4HAW B;  3PVL A;  4EJN A;  2OQB A;  3TO1 A;  1EF1 A;  3N7C A;  1U27 A;  2D9X A;  3QWM A;  2L1C A;  5DIF B;  1P5T A;  2Z0Q A;  1OMW A;  2N23 A;  2Y7B A;  1NTV A;  1FHX A;  3HK0 A;  4MT7 A;  2YT1 A;  3TFM A;  4A5K A;  2D9W A;  1UPQ A;  2ROV A;  5EFX A;  2V76 A;  1U5E A;  1GC7 A;  3KRX A;  3TVV A;  3QIJ A;  1OQN A;  3P6A A;  2HTH B;  2VKI A;  4F7G A;  1U5F A;  3MDB C;  1KI1 B;  1TXD A;  3QBV B;  4H8S A;  1ZM0 A;  2M38 A;  3PG7 A;  3AU4 A;  2CY4 A;  2RGN B;  2Y8F A;  5J3Y A;  5CLL B;  1WGU A;  2K00 A;  2UZS A;  1H10 A;  5D3Y A;  2NMB A;  5DHF B;  2ELB A;  4KHA A;  2W2X C;  4F7U P;  2VSZ A;  1NI2 A;  1BTN A;  5FI0 A;  1TJ6 A;  1U2B A;  1WJ1 A;  1EGX A;  1QQG A;  2P8V A;  5C5B B;  4L6E A;  4ZRK A;  4K2O A;  4A6F A;  2I5F A;  2W2X D;  2P0H A;  2YSZ A;  2HE7 A;  2AL6 A;  1N3H A;  2DN6 A;  1I7A A;  5J3T A;  4IFS A;  3UZT A;  2IFS A;  1W1D A;  1WI1 A;  2QKL A;  3WYF B;  2W2W A;  3ODW A;  5KQ4 A;  2GCJ A;  3X23 A;  2MFQ A;  4ZRJ A;  3D8D A;  2DTC A;  5JHG A;  4K81 A;  2MDX A;  1U29 A;  2LYD A;  2LKO A;  4EKU A;  2DHI A;  1Z87 A;  2QKM A;  2DA0 A;  3RCP A;  1P3R A;  2K2U A;  4DX8 A;  1QC6 A;  1H4R A;  2X18 A;  1NTY A;  1GG3 A;  2Z0O A;  2EJ8 A;  3ODO A;  5JHH A;  2Q13 A;  2N0Y A;  4HDO A;  1BAK A;  2I1J A;  1FHW A;  2YRY A;  4DXA B;  3HW2 B;  5KQ1 A;  3U8Z A;  4CYE A;  4KHO A;  1FHO A;  1MIX A;  1DBH A;  2IYB A;  2LG1 A;  2P0D A;  3D8E A;  1U5D A;  2NZ8 B;  3F5R A;  1FB8 A;  1BWN A;  1J19 A;  3A8Q A;  3TW1 A;  1BTK A;  2COA A;  4WSF A;  3SO6 A;  3V5W A;  3A8P A;  4C0A A;  3ULC A;  2VRW B;  4A6K A;  2D9Z A;  1X1G A;  4WVF B;  3KZ1 A;  1U5G A;  1NU2 A;  2XQN M;  1DRO A;  1V89 A;  2YT0 A;  2DX1 A;  3D8F A;  2DKQ A;  1MIZ B;  2RLO A;  1V88 A;  2I5C A;  1M7E A;  1XX0 A;  3FSS A;  1V5M A;  4HAY B;  3VIA A;  1IRS A;  3U7D A;  4GZU A;  3KSY A;  4HB4 B;  4IOY X;  1RRP B;  4CHJ A;  1E5W A;  4TKN A;  2D10 A;  1UPR A;  3CIK A;  1Y19 B;  2EC1 A;  2D2Q A;  2ELA A;  4NY0 A;  1DDV A;  2COC A;  2UZR A;  4TYZ A;  4HAV B; 
#chains in the Genus database with same CATH topology
 5FI1 A;  1AWE A;  1RJ2 A;  4HB0 B;  2DHJ A;  2D9Y A;  5HE3 A;  5JP4 A;  2L2I A;  4DX9 0;  4GPT B;  2DFK A;  1MKE A;  3PEG A;  3WA0 A;  3NSU A;  3A98 B;  2I1K A;  4A6F B;  4B6H A;  5C5B A;  5KCV A;  4DBB A;  2MWN B;  4ZRI A;  2JP2 A;  4PQ0 A;  1DDW A;  1FAO A;  1KZ7 A;  3CXB B;  2Y8G A;  2CRF A;  4YON A;  3PZD A;  2DYN A;  1K5D B;  3ZVR A;  3P7Z A;  2YT2 A;  2AEH A;  5L81 A;  2H7D A;  4KHB B;  1WVH A;  3TCA A;  2COD A;  2YS3 A;  5D3X A;  2EMS A;  3DXD A;  2G35 A;  3DCX A;  2Z13 A;  1V5U A;  1MAI A;  4BBK A;  1LW3 A;  2ZKM X;  4KVG B;  2OTX A;  1DYN A;  4HHV A;  2ROZ B;  4YL8 A;  5HE0 A;  1T77 A;  1TQZ A;  2H7E A;  1EAZ A;  1WGQ A;  1FGZ A;  2K2J A;  4K17 A;  3HQC A;  4A6H A;  3FM8 C;  1AQC A;  3PVW A;  3NW8 A;  3PVU A;  3M1I B;  3FVC A;  2DLW A;  1OY2 A;  2RNR B;  4HB2 B;  2EMT A;  1FGY A;  3A58 A;  3AJ4 A;  4MY6 A;  2COF A;  2R0D A;  2FJL A;  3SYX A;  2E2X A;  3NWD A;  5D3W A;  1PLS A;  4HDQ A;  2RVB B;  3PP2 A;  3FEH A;  5HE1 A;  5M4Y B;  3SNH A;  1SHC A;  1XCG A;  1FOE A;  4D0N B;  2Z0P A;  1XOD A;  2YS1 A;  2RSG A;  1P6S A;  4P7I A;  2J0J A;  4GNK B;  1LB1 A;  1WG7 A;  2R09 A;  2LOZ A;  1X86 A;  1UNP A;  2MKR A;  2RUK B;  1XD4 A;  2GS0 A;  1UEF A;  3KY9 A;  2CY5 A;  2DYQ A;  5C6R A;  1V5P A;  2KIG A;  2D4Q A;  5J3Q A;  1Q67 A;  5LG4 B;  1ZSQ A;  1V61 A;  4HAX B;  4EMO A;  2YS5 A;  2UVM A;  2DX5 A;  5C79 A;  2J59 M;  1K5G B;  3AU5 A;  1ISN A;  3HSA A;  3GYP A;  4Y94 A;  1ZVR A;  3O96 A;  5DH9 B;  4HAU B;  4K2P A;  3KRW A;  1WJM A;  2R2Y A;  5D27 A;  5LOP B;  1UNQ A;  1UNR A;  3PSC A;  2PZ1 A;  2DHK A;  2DKP A;  4IAP A;  2J0M A;  1XR0 B;  2GCL A;  4CHM A;  1I2H A;  4GMX B;  5C16 A;  2KGX B;  1X05 A;  3BIN A;  2GJY A;  4Z2N A;  1ZC4 B;  3NWF A;  4F7H A;  1PFJ A;  2CAY A;  2J0K A;  2ZPY A;  1EVH A;  1X1F A;  3LJU X;  1X11 A;  1MK9 B;  2KUP A;  1SGH A;  2LOX A;  1B55 A;  1W1G A;  2D9V A;  3VOQ A;  2P0F A;  1ZYI A;  1MPH A;  1XKE A;  3U12 A;  1J0W A;  2YVC A;  1KZG A;  1MK7 B;  5JLJ B;  3SV1 A;  4KAX B;  4GN1 A;  3ML4 A;  2KUQ A;  3ZDT A;  4D6W A;  3DXC A;  3SUZ A;  3F0W A;  5DI9 B;  4PNK A;  2ADZ A;  4MK0 A;  1GC6 A;  1W1H A;  4HB3 B;  2NBV A;  5HE2 A;  1ZC3 B;  5LON B;  2YF0 A;  2KCJ A;  1DDM A;  4GMV A;  3MPX A;  3G9W A;  3GYO A;  5CLQ B;  2BCJ A;  1Y5O A;  3T06 A;  2LUL A;  4QJ5 B;  4XWX A;  5GOW B;  3ULB A;  3IVF A;  4WJ7 A;  5D3V A;  4Z2M B;  5IRS A;  4GXB A;  3OAN A;  3BJI A;  5DHA B;  3ODX A;  1M7R A;  2D11 A;  4HAZ B;  4NSW A;  4HAT B;  3DXE A;  2M14 A;  1PMS A;  4HAW B;  3PVL A;  4EJN A;  2OQB A;  3TO1 A;  1EF1 A;  3N7C A;  1U27 A;  2D9X A;  3QWM A;  2L1C A;  2Z4D A;  5DIF B;  3OHM B;  1P5T A;  2Z0Q A;  1OMW A;  2N23 A;  2Y7B A;  1NTV A;  1FHX A;  3HK0 A;  4MT7 A;  2GUM A;  2YT1 A;  3TFM A;  4A5K A;  2D9W A;  1UPQ A;  2ROV A;  5EFX A;  2V76 A;  1U5E A;  1GC7 A;  3KRX A;  3TVV A;  3QIJ A;  3HIE A;  1OQN A;  3P6A A;  2HTH B;  2VKI A;  4F7G A;  1U5F A;  3MDB C;  1KI1 B;  4CSQ A;  1TXD A;  3QBV B;  4H8S A;  1ZM0 A;  2M38 A;  3PG7 A;  3AU4 A;  2CY4 A;  2RGN B;  4KHB A;  3B77 A;  2Y8F A;  2Z59 A;  5J3Y A;  4DIX A;  5CLL B;  1WGU A;  2K00 A;  4L1R A;  2UZS A;  1H10 A;  5D3Y A;  2NMB A;  5DHF B;  2ELB A;  4KHA A;  2W2X C;  4F7U P;  2VSZ A;  1MI1 A;  1NI2 A;  1BTN A;  5FI0 A;  1TJ6 A;  1U2B A;  1WJ1 A;  1EGX A;  4GOU A;  1QQG A;  2P8V A;  5C5B B;  4L6E A;  4ZRK A;  4K2O A;  4A6F A;  2RRF A;  2I5F A;  2W2X D;  2P0H A;  2KR0 A;  2YSZ A;  2FJU B;  2HE7 A;  2AL6 A;  1N3H A;  2DN6 A;  1I7A A;  4OT1 A;  5J3T A;  4IFS A;  3UZT A;  2IFS A;  1W1D A;  1WI1 A;  2QKL A;  3WYF B;  2K49 A;  2W2W A;  3ODW A;  5KQ4 A;  2GCJ A;  3X23 A;  2MFQ A;  4ZRJ A;  3D8D A;  2DTC A;  5JHG A;  2MDX A;  1U29 A;  2LYD A;  4K81 A;  2LKO A;  4EKU A;  2DHI A;  1Z87 A;  2QKM A;  2DA0 A;  3RCP A;  1P3R A;  2K2U A;  4DX8 A;  1QC6 A;  1H4R A;  2X18 A;  1NTY A;  1GG3 A;  2Z0O A;  2EJ8 A;  3ODO A;  5JHH A;  2Q13 A;  2N0Y A;  4HDO A;  1BAK A;  2I1J A;  2KIE A;  1FHW A;  2YRY A;  4DXA B;  3HW2 B;  5KQ1 A;  3U8Z A;  4HSI A;  4CYE A;  4KHO A;  1FHO A;  1MIX A;  1DBH A;  2IYB A;  2LG1 A;  2P0D A;  5I2S A;  3D8E A;  4OSN A;  1U5D A;  2NZ8 B;  3F5R A;  1FB8 A;  1BWN A;  1J19 A;  3A8Q A;  3TW1 A;  1BTK A;  2COA A;  4WSF A;  3SO6 A;  3V5W A;  3A8P A;  4C0A A;  3ULC A;  2VRW B;  4A6K A;  2D9Z A;  5I2M A;  1X1G A;  4WVF B;  3KZ1 A;  4QXA B;  1U5G A;  1NU2 A;  2XQN M;  1DRO A;  1V89 A;  2YT0 A;  3NWA A;  2DX1 A;  3D8F A;  2DKQ A;  1MIZ B;  2RLO A;  1V88 A;  2K8E A;  2I5C A;  1M7E A;  1XX0 A;  3FSS A;  1V5M A;  4HAY B;  4QJ3 B;  3VIA A;  1IRS A;  3U7D A;  4GZU A;  3KSY A;  4HB4 B;  4IOY X;  1RRP B;  4CHJ A;  1E5W A;  4TKN A;  2D10 A;  1UPR A;  3CIK A;  1Y19 B;  2EC1 A;  2D2Q A;  2ELA A;  4NY0 A;  1DDV A;  2COC A;  2Z14 A;  2UZR A;  4TYZ A;  4QJ4 B;  4HAV B; 
#chains in the Genus database with same CATH homology
 5FI1 A;  1AWE A;  1RJ2 A;  4HB0 B;  2DHJ A;  2D9Y A;  5HE3 A;  5JP4 A;  2L2I A;  4DX9 0;  4GPT B;  2DFK A;  1MKE A;  3PEG A;  3WA0 A;  3NSU A;  3A98 B;  2I1K A;  4A6F B;  4B6H A;  5C5B A;  5KCV A;  4DBB A;  2MWN B;  4ZRI A;  2JP2 A;  4PQ0 A;  1DDW A;  1FAO A;  1KZ7 A;  3CXB B;  2Y8G A;  2CRF A;  4YON A;  3PZD A;  2DYN A;  1K5D B;  3ZVR A;  3P7Z A;  2AEH A;  5L81 A;  2H7D A;  4KHB B;  1WVH A;  3TCA A;  2COD A;  2YS3 A;  5D3X A;  2EMS A;  3DXD A;  2G35 A;  1V5U A;  1MAI A;  4BBK A;  1LW3 A;  4KVG B;  2OTX A;  1DYN A;  4HHV A;  2ROZ B;  4YL8 A;  5HE0 A;  1TQZ A;  2H7E A;  1EAZ A;  1WGQ A;  1FGZ A;  2K2J A;  4K17 A;  3HQC A;  4A6H A;  3FM8 C;  1AQC A;  3PVW A;  3PVU A;  3M1I B;  2DLW A;  1OY2 A;  2RNR B;  4HB2 B;  2EMT A;  1FGY A;  3AJ4 A;  4MY6 A;  2COF A;  2R0D A;  2FJL A;  3SYX A;  2E2X A;  5D3W A;  1PLS A;  4HDQ A;  2RVB B;  3PP2 A;  3FEH A;  5HE1 A;  3SNH A;  1SHC A;  1XCG A;  1FOE A;  4D0N B;  2Z0P A;  1XOD A;  2YS1 A;  2RSG A;  1P6S A;  4P7I A;  2J0J A;  1LB1 A;  1WG7 A;  2R09 A;  2LOZ A;  1X86 A;  1UNP A;  2MKR A;  2RUK B;  1XD4 A;  2GS0 A;  1UEF A;  3KY9 A;  2CY5 A;  2DYQ A;  5C6R A;  1V5P A;  2D4Q A;  5J3Q A;  1Q67 A;  1ZSQ A;  1V61 A;  4HAX B;  4EMO A;  2YS5 A;  2UVM A;  2DX5 A;  5C79 A;  2J59 M;  1K5G B;  3AU5 A;  1ISN A;  3GYP A;  4Y94 A;  1ZVR A;  3O96 A;  5DH9 B;  4HAU B;  4K2P A;  3KRW A;  1WJM A;  5D27 A;  5LOP B;  1UNQ A;  1UNR A;  3PSC A;  2PZ1 A;  2DHK A;  2DKP A;  4IAP A;  2J0M A;  1XR0 B;  2GCL A;  4CHM A;  1I2H A;  4GMX B;  5C16 A;  2KGX B;  1X05 A;  3BIN A;  2GJY A;  4Z2N A;  1ZC4 B;  4F7H A;  1PFJ A;  2CAY A;  2J0K A;  2ZPY A;  1EVH A;  1X1F A;  3LJU X;  1X11 A;  1MK9 B;  2KUP A;  1SGH A;  2LOX A;  1B55 A;  1W1G A;  2D9V A;  3VOQ A;  2P0F A;  1MPH A;  1XKE A;  1J0W A;  2YVC A;  1KZG A;  1MK7 B;  5JLJ B;  3SV1 A;  4KAX B;  4GN1 A;  3ML4 A;  3ZDT A;  3DXC A;  3SUZ A;  3F0W A;  5DI9 B;  4PNK A;  2ADZ A;  4MK0 A;  1GC6 A;  1W1H A;  4HB3 B;  5HE2 A;  1ZC3 B;  5LON B;  2YF0 A;  2KCJ A;  1DDM A;  4GMV A;  3MPX A;  3G9W A;  3GYO A;  5CLQ B;  2BCJ A;  1Y5O A;  3T06 A;  2LUL A;  4XWX A;  5GOW B;  3ULB A;  3IVF A;  4WJ7 A;  5D3V A;  4Z2M B;  4GXB A;  3OAN A;  3BJI A;  5DHA B;  3ODX A;  1M7R A;  2D11 A;  4HAZ B;  4NSW A;  4HAT B;  3DXE A;  2M14 A;  1PMS A;  4HAW B;  3PVL A;  4EJN A;  2OQB A;  3TO1 A;  1EF1 A;  3N7C A;  1U27 A;  2D9X A;  3QWM A;  2L1C A;  5DIF B;  1P5T A;  2Z0Q A;  1OMW A;  2N23 A;  2Y7B A;  1NTV A;  1FHX A;  3HK0 A;  4MT7 A;  2YT1 A;  3TFM A;  4A5K A;  2D9W A;  1UPQ A;  2ROV A;  5EFX A;  2V76 A;  1U5E A;  1GC7 A;  3KRX A;  3TVV A;  3QIJ A;  1OQN A;  3P6A A;  2HTH B;  2VKI A;  4F7G A;  1U5F A;  3MDB C;  1KI1 B;  1TXD A;  3QBV B;  4H8S A;  1ZM0 A;  2M38 A;  3PG7 A;  3AU4 A;  2CY4 A;  2RGN B;  2Y8F A;  5J3Y A;  5CLL B;  1WGU A;  2K00 A;  2UZS A;  1H10 A;  5D3Y A;  2NMB A;  5DHF B;  2ELB A;  4KHA A;  2W2X C;  4F7U P;  2VSZ A;  1NI2 A;  1BTN A;  5FI0 A;  1TJ6 A;  1U2B A;  1WJ1 A;  1EGX A;  1QQG A;  2P8V A;  5C5B B;  4L6E A;  4ZRK A;  4K2O A;  4A6F A;  2I5F A;  2W2X D;  2P0H A;  2YSZ A;  2HE7 A;  2AL6 A;  1N3H A;  2DN6 A;  1I7A A;  5J3T A;  4IFS A;  3UZT A;  2IFS A;  1W1D A;  1WI1 A;  2QKL A;  3WYF B;  2W2W A;  3ODW A;  5KQ4 A;  2GCJ A;  3X23 A;  2MFQ A;  4ZRJ A;  3D8D A;  2DTC A;  5JHG A;  4K81 A;  2MDX A;  1U29 A;  2LYD A;  2LKO A;  4EKU A;  2DHI A;  1Z87 A;  2QKM A;  2DA0 A;  3RCP A;  1P3R A;  2K2U A;  4DX8 A;  1QC6 A;  1H4R A;  2X18 A;  1NTY A;  1GG3 A;  2Z0O A;  2EJ8 A;  3ODO A;  5JHH A;  2Q13 A;  2N0Y A;  4HDO A;  1BAK A;  2I1J A;  1FHW A;  2YRY A;  4DXA B;  3HW2 B;  5KQ1 A;  3U8Z A;  4CYE A;  4KHO A;  1FHO A;  1MIX A;  1DBH A;  2IYB A;  2LG1 A;  2P0D A;  3D8E A;  1U5D A;  2NZ8 B;  3F5R A;  1FB8 A;  1BWN A;  1J19 A;  3A8Q A;  3TW1 A;  1BTK A;  2COA A;  4WSF A;  3SO6 A;  3V5W A;  3A8P A;  4C0A A;  3ULC A;  2VRW B;  4A6K A;  2D9Z A;  1X1G A;  4WVF B;  3KZ1 A;  1U5G A;  1NU2 A;  2XQN M;  1DRO A;  1V89 A;  2YT0 A;  2DX1 A;  3D8F A;  2DKQ A;  1MIZ B;  2RLO A;  1V88 A;  2I5C A;  1M7E A;  1XX0 A;  3FSS A;  1V5M A;  4HAY B;  3VIA A;  1IRS A;  3U7D A;  4GZU A;  3KSY A;  4HB4 B;  4IOY X;  1RRP B;  4CHJ A;  1E5W A;  4TKN A;  2D10 A;  1UPR A;  3CIK A;  1Y19 B;  2EC1 A;  2D2Q A;  2ELA A;  4NY0 A;  1DDV A;  2COC A;  2UZR A;  4TYZ A;  4HAV B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...