2H7EA

Solution structure of the talin f3 domain in complex with a chimeric beta3 integrin-pip kinase peptide- minimized average structure
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
101
structure length
101
Chain Sequence
PLGSGVSFFLVKEKMKGKNKLVPRLLGITKESVMRVDEKTKEVIQEWSLTNIKRWAASPKSFTLDFGDYQDGYYSVQTTEGEQIAQLIAGYIDIILKKKKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Structural protein
molecule keywords Talin-1
publication title Structural basis of integrin activation by talin
pubmed doi rcsb
source organism Gallus gallus
total genus 17
structure length 101
sequence length 101
ec nomenclature
pdb deposition date 2006-06-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2h7eA00
4A6HA 5C5BA 1IRSA 1U29A 1OQNA 1RJ2A 1I7AA 3TO1A 4EMOA 3ODXA 2RVBB 5GOWB 1X1GA 2XQNM 2OQBA 4F7GA 2Y8FA 2RNRB 3O96A 4GZUA 1WJ1A 4IOYX 3TW1A 2ADZA 1TXDA 5JHGA 3D8FA 1XR0B 3ODWA 5DH9B 2YRYA 1DDVA 1SGHA 1PLSA 4A6KA 1P5TA 1GC6A 1EF1A 3NSUA 3PZDA 2Z0QA 1J19A 1UPQA 2V76A 2VSZA 1U2BA 1QQGA 2KGXB 4A5KA 2J0KA 1UNRA 3QIJA 5DI9B 1I2HA 3TVVA 4EJNA 2YS3A 3VIAA 1MKEA 2CRFA 4P7IA 1BTNA 1WGUA 1E5WA 1DDWA 2W2WA 5C16A 1NTYA 2HTHB 1OMWA 3G9WA 3LJUX 3V5WA 3BJIA 4A6FA 2P0DA 1BWNA 1UEFA 2RLOA 3IVFA 4C0AA 1NU2A 5C5BB 1FHWA 1X86A 3PSCA 2RUKB 5C79A 1BTKA 2D9YA 4K2PA 1NTVA 2X18A 3DXCA 1J0WA 4GPTB 3FEHA 3UZTA 2JP2A 2RGNB 2H7DA 5C6RA 3ULCA 2DN6A 2OTXA 3KZ1A 2GS0A 4WSFA 2M38A 4GN1A 2EJ8A 2AEHA 5J3TA 1DDMA 2L2IA 4EKUA 4YL8A 2IFSA 5D3XA 1ZSQA 2R09A 5JP4A 5CLQB 1Y5OA 2LYDA 3ULBA 1FAOA 4MK0A 1UNPA 4F7HA 1K5DB 4Z2MB 3PG7A 3F5RA 2MWNB 2CODA 3CIKA 1MAIA 1K5GB 2YVCA 2P8VA 5L81A 2CY5A 1OY2A 2MFQA 4A6FB 3PP2A 5HE0A 1U5DA 3KSYA 2Y8GA 1P3RA 1MK7B 1X11A 2P0FA 2CY4A 2N23A 4HAWB 2J59M 1FGYA 5CLLB 5JHHA 3SYXA 3ML4A 3ZDTA 3ZVRA 3CXBB 3AJ4A 5FI1A 5HE3A 4Z2NA 2RSGA 4HAYB 3U7DA 1KI1B 2Y7BA 3AU5A 2YS1A 5KQ1A 1FB8A 2Z0PA 4MY6A 2YT1A 2D10A 1DYNA 4GXBA 1Z87A 2KUPA 2DX5A 1WI1A 4DX90 1QC6A 4HATB 2COCA 4CHMA 1UPRA 4HDOA 4K81A 2M14A 1FGZA 3DXDA 4L6EA 2K2UA 2YSZA 2D9ZA 3HK0A 4HAUB 1PFJA 1KZGA 1XX0A 2LG1A 2G35A 4GMXB 2DTCA 2I1KA 2GCJA 2EMSA 3P7ZA 5EFXA 2D9WA 2P0HA 3VOQA 4HB4B 2Z0OA 5D3YA 1ZM0A 2NMBA 4D0NB 1FHOA 2BCJA 2D4QA 2FJLA 1TQZA 5JLJB 2HE7A 1RRPB 1FOEA 2YT0A 2DHKA 3PVWA 2AL6A 2D11A 2GJYA 1WVHA 4DBBA 3KY9A 2DHIA 4PQ0A 2J0JA 3MPXA 5HE2A 4DXAB 1X05A 3N7CA 1H10A 1H4RA 2DKQA 3BINA 3TFMA 3KRXA 1V89A 3KRWA 2ZPYA 3FSSA 4IAPA 2EMTA 2GCLA 1Q67A 2K2JA 4CHJA 1ZVRA 2PZ1A 2I5CA 5KCVA 2J0MA 5HE1A 1XKEA 3SNHA 1V5UA 1V5PA 3PEGA 4MT7A 3PVUA 3A8PA 4ZRJA 3QBVB 2I5FA 2IYBA 2UZSA 1U5GA 1MK9B 1GG3A 5D3WA 2DLWA 4KHBB 1LB1A 5DHAB 4KHAA 4ZRIA 1XD4A 1M7EA 3GYOA 1AWEA 2LOZA 4K17A 4WVFB 2CAYA 1U5FA 2EC1A 2UZRA 2KCJA 2D9VA 2H7EA 5DIFB 2LKOA 5LONB 4NY0A 3AU4A 2COFA 2DHJA 4ZRKA 1TJ6A 4YONA 1SHCA 3X23A 1MIXA 2ROVA 5D3VA 3M1IB 5FI0A 1GC7A 3P6AA 5KQ4A 3SO6A 1DBHA 2D2QA 1KZ7A 2D9XA 4HHVA 1MIZB 1NI2A 1Y19B 1XCGA 1ZC3B 1V61A 4K2OA 2LULA 2VRWB 4HAZB 1EGXA 3GYPA 1W1GA 2ROZB 2LOXA 4GMVA 1EAZA 3DXEA 2DYQA 2I1JA 4WJ7A 1V5MA 1ISNA 2MDXA 4KAXB 3MDBC 1M7RA 1XODA 1P6SA 3ODOA 3SV1A 2QKLA 5D27A 3QWMA 3D8DA 3T06A 3TCAA 5LOPB 2ELBA 3PVLA 4CYEA 2MKRA 1U5EA 2DX1A 4PNKA 1B55A 2K00A 1N3HA 4H8SA 4HB3B 4B6HA 1AQCA 4HDQA 3A8QA 5J3YA 1DROA 1X1FA 2COAA 2UVMA 1WG7A 1LW3A 3OANA 1MPHA 2DFKA 1EVHA 1PMSA 4HAVB 2NZ8B 4DX8A 2YS5A 2QKMA 4XWXA 4BBKA 4KHOA 4Y94A 3HQCA 1FHXA 4HB2B 3WA0A 4HB0B 4TYZA 2R0DA 4HAXB 4TKNA 4KVGB 1U27A 2DKPA 4NSWA 5DHFB 1V88A 2L1CA 1ZC4B 4IFSA 1UNQA 2W2XC 2VKIA 3F0WA 3HW2B 3D8EA 2ELAA 3RCPA 2DYNA 2DA0A 3WYFB 4F7UP 5J3QA 3SUZA 1BAKA 1WJMA 2N0YA 1W1DA 3A98B 3U8ZA 2YF0A 3FM8C 1WGQA 2W2XD 1W1HA 2E2XA 2Q13A
chains in the Genus database with same CATH superfamily
4A6HA 2K8EA 5C5BA 1IRSA 1U29A 1OQNA 1RJ2A 1I7AA 3TO1A 4EMOA 3ODXA 2RVBB 5GOWB 1X1GA 2XQNM 2OQBA 4F7GA 2Y8FA 2RNRB 3O96A 4GZUA 1WJ1A 4IOYX 3TW1A 2ADZA 1TXDA 5JHGA 3D8FA 1XR0B 3ODWA 5DH9B 2YRYA 1DDVA 1SGHA 1PLSA 4A6KA 1P5TA 1GC6A 4D6WA 1EF1A 3NSUA 3PZDA 2Z0QA 1J19A 1UPQA 2V76A 2VSZA 1U2BA 1QQGA 2KGXB 4A5KA 2J0KA 1UNRA 3QIJA 5DI9B 2KIGA 1I2HA 3TVVA 4EJNA 3B77A 2YS3A 3VIAA 1MKEA 2CRFA 4P7IA 1BTNA 1WGUA 1E5WA 1DDWA 2W2WA 2YT2A 5C16A 1NTYA 2HTHB 1OMWA 3NWDA 3G9WA 3LJUX 3V5WA 3BJIA 4A6FA 2P0DA 1BWNA 1UEFA 2RLOA 3IVFA 4C0AA 1NU2A 5C5BB 1FHWA 5M4YB 1X86A 3PSCA 2RUKB 5C79A 1BTKA 2D9YA 4GOUA 4K2PA 1NTVA 2X18A 3DXCA 3NWAA 1J0WA 4GPTB 3FEHA 3UZTA 2JP2A 2RGNB 2H7DA 5C6RA 3ULCA 2DN6A 2OTXA 3KZ1A 2GS0A 4WSFA 2M38A 4GN1A 2EJ8A 2AEHA 5J3TA 1DDMA 2L2IA 4EKUA 4YL8A 2IFSA 2NBVA 5D3XA 1ZSQA 2R09A 5JP4A 5CLQB 1Y5OA 2LYDA 4L1RA 3ULBA 1FAOA 4MK0A 1UNPA 4F7HA 1K5DB 4Z2MB 3PG7A 3F5RA 2KUQA 2MWNB 4DIXA 2CODA 3CIKA 5IRSA 1MAIA 1K5GB 2YVCA 2P8VA 5L81A 2CY5A 1OY2A 2MFQA 4A6FB 3PP2A 5HE0A 1U5DA 3KSYA 2Y8GA 1P3RA 1MK7B 1X11A 2P0FA 2CY4A 2N23A 4HAWB 2J59M 1FGYA 5CLLB 5JHHA 3SYXA 3ML4A 3ZDTA 3ZVRA 3CXBB 3AJ4A 5FI1A 5HE3A 2Z13A 4Z2NA 2RSGA 4HAYB 3U7DA 1KI1B 2Y7BA 3AU5A 4QXAB 2YS1A 1T77A 5KQ1A 1FB8A 3FVCA 2Z0PA 4MY6A 2YT1A 2D10A 1DYNA 4QJ5B 4GXBA 1Z87A 2KUPA 2DX5A 1WI1A 4DX90 1QC6A 4HATB 3NWFA 3U12A 2COCA 4CHMA 1UPRA 4HDOA 4K81A 2M14A 1FGZA 3DXDA 4L6EA 2K2UA 2YSZA 2D9ZA 3HK0A 4HAUB 1PFJA 1KZGA 1XX0A 2LG1A 2KR0A 2G35A 4GMXB 2DTCA 2I1KA 2GCJA 4KHBA 2EMSA 3P7ZA 5LG4B 5EFXA 2D9WA 2P0HA 3VOQA 4HB4B 2Z0OA 5D3YA 1ZM0A 2NMBA 4D0NB 1FHOA 2BCJA 2D4QA 2FJLA 1TQZA 4GNKB 5JLJB 2HE7A 1RRPB 1FOEA 2YT0A 2DHKA 3PVWA 2AL6A 2D11A 2GJYA 1WVHA 4DBBA 3KY9A 2DHIA 4PQ0A 2J0JA 3MPXA 5HE2A 4DXAB 1X05A 3N7CA 1H10A 1H4RA 2DKQA 3BINA 3TFMA 2Z59A 3KRXA 3HIEA 1V89A 3KRWA 2ZPYA 3FSSA 4IAPA 2EMTA 2GCLA 1Q67A 2GUMA 2K2JA 4CHJA 1ZVRA 2PZ1A 2I5CA 5KCVA 2J0MA 5HE1A 1XKEA 1ZYIA 2Z4DA 3SNHA 1V5UA 1V5PA 3PEGA 4MT7A 3PVUA 3A8PA 4ZRJA 4QJ4B 3QBVB 2I5FA 2IYBA 2UZSA 1U5GA 1MK9B 1GG3A 2ZKMX 5D3WA 2DLWA 4KHBB 1LB1A 5DHAB 4KHAA 4OT1A 4ZRIA 1XD4A 1M7EA 3GYOA 1AWEA 2LOZA 4K17A 4WVFB 2CAYA 1U5FA 2EC1A 2UZRA 2KCJA 2D9VA 2H7EA 5DIFB 2LKOA 5LONB 4NY0A 4OSNA 3AU4A 2COFA 2DHJA 4ZRKA 1TJ6A 4YONA 1SHCA 3X23A 1MIXA 3A58A 2ROVA 4QJ3B 5D3VA 3M1IB 5FI0A 1GC7A 3P6AA 5KQ4A 3SO6A 1DBHA 2D2QA 1KZ7A 2D9XA 4HHVA 1MIZB 1NI2A 1Y19B 1XCGA 1ZC3B 2R2YA 1V61A 4K2OA 2LULA 2VRWB 4HAZB 1EGXA 3GYPA 1W1GA 2ROZB 2LOXA 4GMVA 2KIEA 1EAZA 3DXEA 2DYQA 2I1JA 4WJ7A 1V5MA 1ISNA 3NW8A 2MDXA 4KAXB 3MDBC 1M7RA 1XODA 1P6SA 3ODOA 3SV1A 2QKLA 5D27A 3QWMA 3D8DA 3T06A 3TCAA 5LOPB 2ELBA 3PVLA 4CYEA 2MKRA 1U5EA 2DX1A 4PNKA 1B55A 2K00A 1N3HA 4H8SA 1MI1A 4HB3B 4HSIA 4B6HA 1AQCA 4HDQA 3A8QA 5J3YA 2Z14A 1DROA 3OHMB 1X1FA 2COAA 2UVMA 1WG7A 1LW3A 3OANA 1MPHA 2DFKA 1EVHA 1PMSA 4HAVB 2NZ8B 4DX8A 2YS5A 2QKMA 4XWXA 4BBKA 4KHOA 4Y94A 3HQCA 1FHXA 4HB2B 4CSQA 3WA0A 4HB0B 4TYZA 2R0DA 4HAXB 5I2SA 4TKNA 4KVGB 1U27A 2DKPA 5I2MA 4NSWA 5DHFB 1V88A 2L1CA 1ZC4B 4IFSA 1UNQA 2W2XC 2VKIA 3F0WA 3HW2B 3HSAA 3D8EA 2RRFA 2ELAA 3DCXA 3RCPA 2DYNA 2DA0A 3WYFB 4F7UP 5J3QA 2FJUB 3SUZA 1BAKA 1WJMA 2N0YA 1W1DA 3A98B 2K49A 3U8ZA 2YF0A 3FM8C 1WGQA 2W2XD 1W1HA 2E2XA 2Q13A
chains in the Genus database with same CATH topology
4A6HA 5C5BA 1IRSA 1U29A 1OQNA 1RJ2A 1I7AA 3TO1A 4EMOA 3ODXA 2RVBB 5GOWB 1X1GA 2XQNM 2OQBA 4F7GA 2Y8FA 2RNRB 3O96A 4GZUA 1WJ1A 4IOYX 3TW1A 2ADZA 1TXDA 5JHGA 3D8FA 1XR0B 3ODWA 5DH9B 2YRYA 1DDVA 1SGHA 1PLSA 4A6KA 1P5TA 1GC6A 1EF1A 3NSUA 3PZDA 2Z0QA 1J19A 1UPQA 2V76A 2VSZA 1U2BA 1QQGA 2KGXB 4A5KA 2J0KA 1UNRA 3QIJA 5DI9B 1I2HA 3TVVA 4EJNA 2YS3A 3VIAA 1MKEA 2CRFA 4P7IA 1BTNA 1WGUA 1E5WA 1DDWA 2W2WA 5C16A 1NTYA 2HTHB 1OMWA 3G9WA 3LJUX 3V5WA 3BJIA 4A6FA 2P0DA 1BWNA 1UEFA 2RLOA 3IVFA 4C0AA 1NU2A 5C5BB 1FHWA 1X86A 3PSCA 2RUKB 5C79A 1BTKA 2D9YA 4K2PA 1NTVA 2X18A 3DXCA 1J0WA 4GPTB 3FEHA 3UZTA 2JP2A 2RGNB 2H7DA 5C6RA 3ULCA 2DN6A 2OTXA 3KZ1A 2GS0A 4WSFA 2M38A 4GN1A 2EJ8A 2AEHA 5J3TA 1DDMA 2L2IA 4EKUA 4YL8A 2IFSA 5D3XA 1ZSQA 2R09A 5JP4A 5CLQB 1Y5OA 2LYDA 3ULBA 1FAOA 4MK0A 1UNPA 4F7HA 1K5DB 4Z2MB 3PG7A 3F5RA 2MWNB 2CODA 3CIKA 1MAIA 1K5GB 2YVCA 2P8VA 5L81A 2CY5A 1OY2A 2MFQA 4A6FB 3PP2A 5HE0A 1U5DA 3KSYA 2Y8GA 1P3RA 1MK7B 1X11A 2P0FA 2CY4A 2N23A 4HAWB 2J59M 1FGYA 5CLLB 5JHHA 3SYXA 3ML4A 3ZDTA 3ZVRA 3CXBB 3AJ4A 5FI1A 5HE3A 4Z2NA 2RSGA 4HAYB 3U7DA 1KI1B 2Y7BA 3AU5A 2YS1A 5KQ1A 1FB8A 2Z0PA 4MY6A 2YT1A 2D10A 1DYNA 4GXBA 1Z87A 2KUPA 2DX5A 1WI1A 4DX90 1QC6A 4HATB 2COCA 4CHMA 1UPRA 4HDOA 4K81A 2M14A 1FGZA 3DXDA 4L6EA 2K2UA 2YSZA 2D9ZA 3HK0A 4HAUB 1PFJA 1KZGA 1XX0A 2LG1A 2G35A 4GMXB 2DTCA 2I1KA 2GCJA 2EMSA 3P7ZA 5EFXA 2D9WA 2P0HA 3VOQA 4HB4B 2Z0OA 5D3YA 1ZM0A 2NMBA 4D0NB 1FHOA 2BCJA 2D4QA 2FJLA 1TQZA 5JLJB 2HE7A 1RRPB 1FOEA 2YT0A 2DHKA 3PVWA 2AL6A 2D11A 2GJYA 1WVHA 4DBBA 3KY9A 2DHIA 4PQ0A 2J0JA 3MPXA 5HE2A 4DXAB 1X05A 3N7CA 1H10A 1H4RA 2DKQA 3BINA 3TFMA 3KRXA 1V89A 3KRWA 2ZPYA 3FSSA 4IAPA 2EMTA 2GCLA 1Q67A 2K2JA 4CHJA 1ZVRA 2PZ1A 2I5CA 5KCVA 2J0MA 5HE1A 1XKEA 3SNHA 1V5UA 1V5PA 3PEGA 4MT7A 3PVUA 3A8PA 4ZRJA 3QBVB 2I5FA 2IYBA 2UZSA 1U5GA 1MK9B 1GG3A 5D3WA 2DLWA 4KHBB 1LB1A 5DHAB 4KHAA 4ZRIA 1XD4A 1M7EA 3GYOA 1AWEA 2LOZA 4K17A 4WVFB 2CAYA 1U5FA 2EC1A 2UZRA 2KCJA 2D9VA 2H7EA 5DIFB 2LKOA 5LONB 4NY0A 3AU4A 2COFA 2DHJA 4ZRKA 1TJ6A 4YONA 1SHCA 3X23A 1MIXA 2ROVA 5D3VA 3M1IB 5FI0A 1GC7A 3P6AA 5KQ4A 3SO6A 1DBHA 2D2QA 1KZ7A 2D9XA 4HHVA 1MIZB 1NI2A 1Y19B 1XCGA 1ZC3B 1V61A 4K2OA 2LULA 2VRWB 4HAZB 1EGXA 3GYPA 1W1GA 2ROZB 2LOXA 4GMVA 1EAZA 3DXEA 2DYQA 2I1JA 4WJ7A 1V5MA 1ISNA 2MDXA 4KAXB 3MDBC 1M7RA 1XODA 1P6SA 3ODOA 3SV1A 2QKLA 5D27A 3QWMA 3D8DA 3T06A 3TCAA 5LOPB 2ELBA 3PVLA 4CYEA 2MKRA 1U5EA 2DX1A 4PNKA 1B55A 2K00A 1N3HA 4H8SA 4HB3B 4B6HA 1AQCA 4HDQA 3A8QA 5J3YA 1DROA 1X1FA 2COAA 2UVMA 1WG7A 1LW3A 3OANA 1MPHA 2DFKA 1EVHA 1PMSA 4HAVB 2NZ8B 4DX8A 2YS5A 2QKMA 4XWXA 4BBKA 4KHOA 4Y94A 3HQCA 1FHXA 4HB2B 3WA0A 4HB0B 4TYZA 2R0DA 4HAXB 4TKNA 4KVGB 1U27A 2DKPA 4NSWA 5DHFB 1V88A 2L1CA 1ZC4B 4IFSA 1UNQA 2W2XC 2VKIA 3F0WA 3HW2B 3D8EA 2ELAA 3RCPA 2DYNA 2DA0A 3WYFB 4F7UP 5J3QA 3SUZA 1BAKA 1WJMA 2N0YA 1W1DA 3A98B 3U8ZA 2YF0A 3FM8C 1WGQA 2W2XD 1W1HA 2E2XA 2Q13A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4A6H A;  5C5B A;  1IRS A;  1U29 A;  1OQN A;  1RJ2 A;  1I7A A;  3TO1 A;  4EMO A;  3ODX A;  2RVB B;  5GOW B;  1X1G A;  2XQN M;  2OQB A;  4F7G A;  2Y8F A;  2RNR B;  3O96 A;  4GZU A;  1WJ1 A;  4IOY X;  3TW1 A;  2ADZ A;  1TXD A;  5JHG A;  3D8F A;  1XR0 B;  3ODW A;  5DH9 B;  2YRY A;  1DDV A;  1SGH A;  1PLS A;  4A6K A;  1P5T A;  1GC6 A;  1EF1 A;  3NSU A;  3PZD A;  2Z0Q A;  1J19 A;  1UPQ A;  2V76 A;  2VSZ A;  1U2B A;  1QQG A;  2KGX B;  4A5K A;  2J0K A;  1UNR A;  3QIJ A;  5DI9 B;  1I2H A;  3TVV A;  4EJN A;  2YS3 A;  3VIA A;  1MKE A;  2CRF A;  4P7I A;  1BTN A;  1WGU A;  1E5W A;  1DDW A;  2W2W A;  5C16 A;  1NTY A;  2HTH B;  1OMW A;  3G9W A;  3LJU X;  3V5W A;  3BJI A;  4A6F A;  2P0D A;  1BWN A;  1UEF A;  2RLO A;  3IVF A;  4C0A A;  1NU2 A;  5C5B B;  1FHW A;  1X86 A;  3PSC A;  2RUK B;  5C79 A;  1BTK A;  2D9Y A;  4K2P A;  1NTV A;  2X18 A;  3DXC A;  1J0W A;  4GPT B;  3FEH A;  3UZT A;  2JP2 A;  2RGN B;  2H7D A;  5C6R A;  3ULC A;  2DN6 A;  2OTX A;  3KZ1 A;  2GS0 A;  4WSF A;  2M38 A;  4GN1 A;  2EJ8 A;  2AEH A;  5J3T A;  1DDM A;  2L2I A;  4EKU A;  4YL8 A;  2IFS A;  5D3X A;  1ZSQ A;  2R09 A;  5JP4 A;  5CLQ B;  1Y5O A;  2LYD A;  3ULB A;  1FAO A;  4MK0 A;  1UNP A;  4F7H A;  1K5D B;  4Z2M B;  3PG7 A;  3F5R A;  2MWN B;  2COD A;  3CIK A;  1MAI A;  1K5G B;  2YVC A;  2P8V A;  5L81 A;  2CY5 A;  1OY2 A;  2MFQ A;  4A6F B;  3PP2 A;  5HE0 A;  1U5D A;  3KSY A;  2Y8G A;  1P3R A;  1MK7 B;  1X11 A;  2P0F A;  2CY4 A;  2N23 A;  4HAW B;  2J59 M;  1FGY A;  5CLL B;  5JHH A;  3SYX A;  3ML4 A;  3ZDT A;  3ZVR A;  3CXB B;  3AJ4 A;  5FI1 A;  5HE3 A;  4Z2N A;  2RSG A;  4HAY B;  3U7D A;  1KI1 B;  2Y7B A;  3AU5 A;  2YS1 A;  5KQ1 A;  1FB8 A;  2Z0P A;  4MY6 A;  2YT1 A;  2D10 A;  1DYN A;  4GXB A;  1Z87 A;  2KUP A;  2DX5 A;  1WI1 A;  4DX9 0;  1QC6 A;  4HAT B;  2COC A;  4CHM A;  1UPR A;  4HDO A;  4K81 A;  2M14 A;  1FGZ A;  3DXD A;  4L6E A;  2K2U A;  2YSZ A;  2D9Z A;  3HK0 A;  4HAU B;  1PFJ A;  1KZG A;  1XX0 A;  2LG1 A;  2G35 A;  4GMX B;  2DTC A;  2I1K A;  2GCJ A;  2EMS A;  3P7Z A;  5EFX A;  2D9W A;  2P0H A;  3VOQ A;  4HB4 B;  2Z0O A;  5D3Y A;  1ZM0 A;  2NMB A;  4D0N B;  1FHO A;  2BCJ A;  2D4Q A;  2FJL A;  1TQZ A;  5JLJ B;  2HE7 A;  1RRP B;  1FOE A;  2YT0 A;  2DHK A;  3PVW A;  2AL6 A;  2D11 A;  2GJY A;  1WVH A;  4DBB A;  3KY9 A;  2DHI A;  4PQ0 A;  2J0J A;  3MPX A;  5HE2 A;  4DXA B;  1X05 A;  3N7C A;  1H10 A;  1H4R A;  2DKQ A;  3BIN A;  3TFM A;  3KRX A;  1V89 A;  3KRW A;  2ZPY A;  3FSS A;  4IAP A;  2EMT A;  2GCL A;  1Q67 A;  2K2J A;  4CHJ A;  1ZVR A;  2PZ1 A;  2I5C A;  5KCV A;  2J0M A;  5HE1 A;  1XKE A;  3SNH A;  1V5U A;  1V5P A;  3PEG A;  4MT7 A;  3PVU A;  3A8P A;  4ZRJ A;  3QBV B;  2I5F A;  2IYB A;  2UZS A;  1U5G A;  1MK9 B;  1GG3 A;  5D3W A;  2DLW A;  4KHB B;  1LB1 A;  5DHA B;  4KHA A;  4ZRI A;  1XD4 A;  1M7E A;  3GYO A;  1AWE A;  2LOZ A;  4K17 A;  4WVF B;  2CAY A;  1U5F A;  2EC1 A;  2UZR A;  2KCJ A;  2D9V A;  2H7E A;  5DIF B;  2LKO A;  5LON B;  4NY0 A;  3AU4 A;  2COF A;  2DHJ A;  4ZRK A;  1TJ6 A;  4YON A;  1SHC A;  3X23 A;  1MIX A;  2ROV A;  5D3V A;  3M1I B;  5FI0 A;  1GC7 A;  3P6A A;  5KQ4 A;  3SO6 A;  1DBH A;  2D2Q A;  1KZ7 A;  2D9X A;  4HHV A;  1MIZ B;  1NI2 A;  1Y19 B;  1XCG A;  1ZC3 B;  1V61 A;  4K2O A;  2LUL A;  2VRW B;  4HAZ B;  1EGX A;  3GYP A;  1W1G A;  2ROZ B;  2LOX A;  4GMV A;  1EAZ A;  3DXE A;  2DYQ A;  2I1J A;  4WJ7 A;  1V5M A;  1ISN A;  2MDX A;  4KAX B;  3MDB C;  1M7R A;  1XOD A;  1P6S A;  3ODO A;  3SV1 A;  2QKL A;  5D27 A;  3QWM A;  3D8D A;  3T06 A;  3TCA A;  5LOP B;  2ELB A;  3PVL A;  4CYE A;  2MKR A;  1U5E A;  2DX1 A;  4PNK A;  1B55 A;  2K00 A;  1N3H A;  4H8S A;  4HB3 B;  4B6H A;  1AQC A;  4HDQ A;  3A8Q A;  5J3Y A;  1DRO A;  1X1F A;  2COA A;  2UVM A;  1WG7 A;  1LW3 A;  3OAN A;  1MPH A;  2DFK A;  1EVH A;  1PMS A;  4HAV B;  2NZ8 B;  4DX8 A;  2YS5 A;  2QKM A;  4XWX A;  4BBK A;  4KHO A;  4Y94 A;  3HQC A;  1FHX A;  4HB2 B;  3WA0 A;  4HB0 B;  4TYZ A;  2R0D A;  4HAX B;  4TKN A;  4KVG B;  1U27 A;  2DKP A;  4NSW A;  5DHF B;  1V88 A;  2L1C A;  1ZC4 B;  4IFS A;  1UNQ A;  2W2X C;  2VKI A;  3F0W A;  3HW2 B;  3D8E A;  2ELA A;  3RCP A;  2DYN A;  2DA0 A;  3WYF B;  4F7U P;  5J3Q A;  3SUZ A;  1BAK A;  1WJM A;  2N0Y A;  1W1D A;  3A98 B;  3U8Z A;  2YF0 A;  3FM8 C;  1WGQ A;  2W2X D;  1W1H A;  2E2X A;  2Q13 A; 
#chains in the Genus database with same CATH topology
 4A6H A;  2K8E A;  5C5B A;  1IRS A;  1U29 A;  1OQN A;  1RJ2 A;  1I7A A;  3TO1 A;  4EMO A;  3ODX A;  2RVB B;  5GOW B;  1X1G A;  2XQN M;  2OQB A;  4F7G A;  2Y8F A;  2RNR B;  3O96 A;  4GZU A;  1WJ1 A;  4IOY X;  3TW1 A;  2ADZ A;  1TXD A;  5JHG A;  3D8F A;  1XR0 B;  3ODW A;  5DH9 B;  2YRY A;  1DDV A;  1SGH A;  1PLS A;  4A6K A;  1P5T A;  1GC6 A;  4D6W A;  1EF1 A;  3NSU A;  3PZD A;  2Z0Q A;  1J19 A;  1UPQ A;  2V76 A;  2VSZ A;  1U2B A;  1QQG A;  2KGX B;  4A5K A;  2J0K A;  1UNR A;  3QIJ A;  5DI9 B;  2KIG A;  1I2H A;  3TVV A;  4EJN A;  3B77 A;  2YS3 A;  3VIA A;  1MKE A;  2CRF A;  4P7I A;  1BTN A;  1WGU A;  1E5W A;  1DDW A;  2W2W A;  2YT2 A;  5C16 A;  1NTY A;  2HTH B;  1OMW A;  3NWD A;  3G9W A;  3LJU X;  3V5W A;  3BJI A;  4A6F A;  2P0D A;  1BWN A;  1UEF A;  2RLO A;  3IVF A;  4C0A A;  1NU2 A;  5C5B B;  1FHW A;  5M4Y B;  1X86 A;  3PSC A;  2RUK B;  5C79 A;  1BTK A;  2D9Y A;  4GOU A;  4K2P A;  1NTV A;  2X18 A;  3DXC A;  3NWA A;  1J0W A;  4GPT B;  3FEH A;  3UZT A;  2JP2 A;  2RGN B;  2H7D A;  5C6R A;  3ULC A;  2DN6 A;  2OTX A;  3KZ1 A;  2GS0 A;  4WSF A;  2M38 A;  4GN1 A;  2EJ8 A;  2AEH A;  5J3T A;  1DDM A;  2L2I A;  4EKU A;  4YL8 A;  2IFS A;  2NBV A;  5D3X A;  1ZSQ A;  2R09 A;  5JP4 A;  5CLQ B;  1Y5O A;  2LYD A;  4L1R A;  3ULB A;  1FAO A;  4MK0 A;  1UNP A;  4F7H A;  1K5D B;  4Z2M B;  3PG7 A;  3F5R A;  2KUQ A;  2MWN B;  4DIX A;  2COD A;  3CIK A;  5IRS A;  1MAI A;  1K5G B;  2YVC A;  2P8V A;  5L81 A;  2CY5 A;  1OY2 A;  2MFQ A;  4A6F B;  3PP2 A;  5HE0 A;  1U5D A;  3KSY A;  2Y8G A;  1P3R A;  1MK7 B;  1X11 A;  2P0F A;  2CY4 A;  2N23 A;  4HAW B;  2J59 M;  1FGY A;  5CLL B;  5JHH A;  3SYX A;  3ML4 A;  3ZDT A;  3ZVR A;  3CXB B;  3AJ4 A;  5FI1 A;  5HE3 A;  2Z13 A;  4Z2N A;  2RSG A;  4HAY B;  3U7D A;  1KI1 B;  2Y7B A;  3AU5 A;  4QXA B;  2YS1 A;  1T77 A;  5KQ1 A;  1FB8 A;  3FVC A;  2Z0P A;  4MY6 A;  2YT1 A;  2D10 A;  1DYN A;  4QJ5 B;  4GXB A;  1Z87 A;  2KUP A;  2DX5 A;  1WI1 A;  4DX9 0;  1QC6 A;  4HAT B;  3NWF A;  3U12 A;  2COC A;  4CHM A;  1UPR A;  4HDO A;  4K81 A;  2M14 A;  1FGZ A;  3DXD A;  4L6E A;  2K2U A;  2YSZ A;  2D9Z A;  3HK0 A;  4HAU B;  1PFJ A;  1KZG A;  1XX0 A;  2LG1 A;  2KR0 A;  2G35 A;  4GMX B;  2DTC A;  2I1K A;  2GCJ A;  4KHB A;  2EMS A;  3P7Z A;  5LG4 B;  5EFX A;  2D9W A;  2P0H A;  3VOQ A;  4HB4 B;  2Z0O A;  5D3Y A;  1ZM0 A;  2NMB A;  4D0N B;  1FHO A;  2BCJ A;  2D4Q A;  2FJL A;  1TQZ A;  4GNK B;  5JLJ B;  2HE7 A;  1RRP B;  1FOE A;  2YT0 A;  2DHK A;  3PVW A;  2AL6 A;  2D11 A;  2GJY A;  1WVH A;  4DBB A;  3KY9 A;  2DHI A;  4PQ0 A;  2J0J A;  3MPX A;  5HE2 A;  4DXA B;  1X05 A;  3N7C A;  1H10 A;  1H4R A;  2DKQ A;  3BIN A;  3TFM A;  2Z59 A;  3KRX A;  3HIE A;  1V89 A;  3KRW A;  2ZPY A;  3FSS A;  4IAP A;  2EMT A;  2GCL A;  1Q67 A;  2GUM A;  2K2J A;  4CHJ A;  1ZVR A;  2PZ1 A;  2I5C A;  5KCV A;  2J0M A;  5HE1 A;  1XKE A;  1ZYI A;  2Z4D A;  3SNH A;  1V5U A;  1V5P A;  3PEG A;  4MT7 A;  3PVU A;  3A8P A;  4ZRJ A;  4QJ4 B;  3QBV B;  2I5F A;  2IYB A;  2UZS A;  1U5G A;  1MK9 B;  1GG3 A;  2ZKM X;  5D3W A;  2DLW A;  4KHB B;  1LB1 A;  5DHA B;  4KHA A;  4OT1 A;  4ZRI A;  1XD4 A;  1M7E A;  3GYO A;  1AWE A;  2LOZ A;  4K17 A;  4WVF B;  2CAY A;  1U5F A;  2EC1 A;  2UZR A;  2KCJ A;  2D9V A;  2H7E A;  5DIF B;  2LKO A;  5LON B;  4NY0 A;  4OSN A;  3AU4 A;  2COF A;  2DHJ A;  4ZRK A;  1TJ6 A;  4YON A;  1SHC A;  3X23 A;  1MIX A;  3A58 A;  2ROV A;  4QJ3 B;  5D3V A;  3M1I B;  5FI0 A;  1GC7 A;  3P6A A;  5KQ4 A;  3SO6 A;  1DBH A;  2D2Q A;  1KZ7 A;  2D9X A;  4HHV A;  1MIZ B;  1NI2 A;  1Y19 B;  1XCG A;  1ZC3 B;  2R2Y A;  1V61 A;  4K2O A;  2LUL A;  2VRW B;  4HAZ B;  1EGX A;  3GYP A;  1W1G A;  2ROZ B;  2LOX A;  4GMV A;  2KIE A;  1EAZ A;  3DXE A;  2DYQ A;  2I1J A;  4WJ7 A;  1V5M A;  1ISN A;  3NW8 A;  2MDX A;  4KAX B;  3MDB C;  1M7R A;  1XOD A;  1P6S A;  3ODO A;  3SV1 A;  2QKL A;  5D27 A;  3QWM A;  3D8D A;  3T06 A;  3TCA A;  5LOP B;  2ELB A;  3PVL A;  4CYE A;  2MKR A;  1U5E A;  2DX1 A;  4PNK A;  1B55 A;  2K00 A;  1N3H A;  4H8S A;  1MI1 A;  4HB3 B;  4HSI A;  4B6H A;  1AQC A;  4HDQ A;  3A8Q A;  5J3Y A;  2Z14 A;  1DRO A;  3OHM B;  1X1F A;  2COA A;  2UVM A;  1WG7 A;  1LW3 A;  3OAN A;  1MPH A;  2DFK A;  1EVH A;  1PMS A;  4HAV B;  2NZ8 B;  4DX8 A;  2YS5 A;  2QKM A;  4XWX A;  4BBK A;  4KHO A;  4Y94 A;  3HQC A;  1FHX A;  4HB2 B;  4CSQ A;  3WA0 A;  4HB0 B;  4TYZ A;  2R0D A;  4HAX B;  5I2S A;  4TKN A;  4KVG B;  1U27 A;  2DKP A;  5I2M A;  4NSW A;  5DHF B;  1V88 A;  2L1C A;  1ZC4 B;  4IFS A;  1UNQ A;  2W2X C;  2VKI A;  3F0W A;  3HW2 B;  3HSA A;  3D8E A;  2RRF A;  2ELA A;  3DCX A;  3RCP A;  2DYN A;  2DA0 A;  3WYF B;  4F7U P;  5J3Q A;  2FJU B;  3SUZ A;  1BAK A;  1WJM A;  2N0Y A;  1W1D A;  3A98 B;  2K49 A;  3U8Z A;  2YF0 A;  3FM8 C;  1WGQ A;  2W2X D;  1W1H A;  2E2X A;  2Q13 A; 
#chains in the Genus database with same CATH homology
 4A6H A;  5C5B A;  1IRS A;  1U29 A;  1OQN A;  1RJ2 A;  1I7A A;  3TO1 A;  4EMO A;  3ODX A;  2RVB B;  5GOW B;  1X1G A;  2XQN M;  2OQB A;  4F7G A;  2Y8F A;  2RNR B;  3O96 A;  4GZU A;  1WJ1 A;  4IOY X;  3TW1 A;  2ADZ A;  1TXD A;  5JHG A;  3D8F A;  1XR0 B;  3ODW A;  5DH9 B;  2YRY A;  1DDV A;  1SGH A;  1PLS A;  4A6K A;  1P5T A;  1GC6 A;  1EF1 A;  3NSU A;  3PZD A;  2Z0Q A;  1J19 A;  1UPQ A;  2V76 A;  2VSZ A;  1U2B A;  1QQG A;  2KGX B;  4A5K A;  2J0K A;  1UNR A;  3QIJ A;  5DI9 B;  1I2H A;  3TVV A;  4EJN A;  2YS3 A;  3VIA A;  1MKE A;  2CRF A;  4P7I A;  1BTN A;  1WGU A;  1E5W A;  1DDW A;  2W2W A;  5C16 A;  1NTY A;  2HTH B;  1OMW A;  3G9W A;  3LJU X;  3V5W A;  3BJI A;  4A6F A;  2P0D A;  1BWN A;  1UEF A;  2RLO A;  3IVF A;  4C0A A;  1NU2 A;  5C5B B;  1FHW A;  1X86 A;  3PSC A;  2RUK B;  5C79 A;  1BTK A;  2D9Y A;  4K2P A;  1NTV A;  2X18 A;  3DXC A;  1J0W A;  4GPT B;  3FEH A;  3UZT A;  2JP2 A;  2RGN B;  2H7D A;  5C6R A;  3ULC A;  2DN6 A;  2OTX A;  3KZ1 A;  2GS0 A;  4WSF A;  2M38 A;  4GN1 A;  2EJ8 A;  2AEH A;  5J3T A;  1DDM A;  2L2I A;  4EKU A;  4YL8 A;  2IFS A;  5D3X A;  1ZSQ A;  2R09 A;  5JP4 A;  5CLQ B;  1Y5O A;  2LYD A;  3ULB A;  1FAO A;  4MK0 A;  1UNP A;  4F7H A;  1K5D B;  4Z2M B;  3PG7 A;  3F5R A;  2MWN B;  2COD A;  3CIK A;  1MAI A;  1K5G B;  2YVC A;  2P8V A;  5L81 A;  2CY5 A;  1OY2 A;  2MFQ A;  4A6F B;  3PP2 A;  5HE0 A;  1U5D A;  3KSY A;  2Y8G A;  1P3R A;  1MK7 B;  1X11 A;  2P0F A;  2CY4 A;  2N23 A;  4HAW B;  2J59 M;  1FGY A;  5CLL B;  5JHH A;  3SYX A;  3ML4 A;  3ZDT A;  3ZVR A;  3CXB B;  3AJ4 A;  5FI1 A;  5HE3 A;  4Z2N A;  2RSG A;  4HAY B;  3U7D A;  1KI1 B;  2Y7B A;  3AU5 A;  2YS1 A;  5KQ1 A;  1FB8 A;  2Z0P A;  4MY6 A;  2YT1 A;  2D10 A;  1DYN A;  4GXB A;  1Z87 A;  2KUP A;  2DX5 A;  1WI1 A;  4DX9 0;  1QC6 A;  4HAT B;  2COC A;  4CHM A;  1UPR A;  4HDO A;  4K81 A;  2M14 A;  1FGZ A;  3DXD A;  4L6E A;  2K2U A;  2YSZ A;  2D9Z A;  3HK0 A;  4HAU B;  1PFJ A;  1KZG A;  1XX0 A;  2LG1 A;  2G35 A;  4GMX B;  2DTC A;  2I1K A;  2GCJ A;  2EMS A;  3P7Z A;  5EFX A;  2D9W A;  2P0H A;  3VOQ A;  4HB4 B;  2Z0O A;  5D3Y A;  1ZM0 A;  2NMB A;  4D0N B;  1FHO A;  2BCJ A;  2D4Q A;  2FJL A;  1TQZ A;  5JLJ B;  2HE7 A;  1RRP B;  1FOE A;  2YT0 A;  2DHK A;  3PVW A;  2AL6 A;  2D11 A;  2GJY A;  1WVH A;  4DBB A;  3KY9 A;  2DHI A;  4PQ0 A;  2J0J A;  3MPX A;  5HE2 A;  4DXA B;  1X05 A;  3N7C A;  1H10 A;  1H4R A;  2DKQ A;  3BIN A;  3TFM A;  3KRX A;  1V89 A;  3KRW A;  2ZPY A;  3FSS A;  4IAP A;  2EMT A;  2GCL A;  1Q67 A;  2K2J A;  4CHJ A;  1ZVR A;  2PZ1 A;  2I5C A;  5KCV A;  2J0M A;  5HE1 A;  1XKE A;  3SNH A;  1V5U A;  1V5P A;  3PEG A;  4MT7 A;  3PVU A;  3A8P A;  4ZRJ A;  3QBV B;  2I5F A;  2IYB A;  2UZS A;  1U5G A;  1MK9 B;  1GG3 A;  5D3W A;  2DLW A;  4KHB B;  1LB1 A;  5DHA B;  4KHA A;  4ZRI A;  1XD4 A;  1M7E A;  3GYO A;  1AWE A;  2LOZ A;  4K17 A;  4WVF B;  2CAY A;  1U5F A;  2EC1 A;  2UZR A;  2KCJ A;  2D9V A;  2H7E A;  5DIF B;  2LKO A;  5LON B;  4NY0 A;  3AU4 A;  2COF A;  2DHJ A;  4ZRK A;  1TJ6 A;  4YON A;  1SHC A;  3X23 A;  1MIX A;  2ROV A;  5D3V A;  3M1I B;  5FI0 A;  1GC7 A;  3P6A A;  5KQ4 A;  3SO6 A;  1DBH A;  2D2Q A;  1KZ7 A;  2D9X A;  4HHV A;  1MIZ B;  1NI2 A;  1Y19 B;  1XCG A;  1ZC3 B;  1V61 A;  4K2O A;  2LUL A;  2VRW B;  4HAZ B;  1EGX A;  3GYP A;  1W1G A;  2ROZ B;  2LOX A;  4GMV A;  1EAZ A;  3DXE A;  2DYQ A;  2I1J A;  4WJ7 A;  1V5M A;  1ISN A;  2MDX A;  4KAX B;  3MDB C;  1M7R A;  1XOD A;  1P6S A;  3ODO A;  3SV1 A;  2QKL A;  5D27 A;  3QWM A;  3D8D A;  3T06 A;  3TCA A;  5LOP B;  2ELB A;  3PVL A;  4CYE A;  2MKR A;  1U5E A;  2DX1 A;  4PNK A;  1B55 A;  2K00 A;  1N3H A;  4H8S A;  4HB3 B;  4B6H A;  1AQC A;  4HDQ A;  3A8Q A;  5J3Y A;  1DRO A;  1X1F A;  2COA A;  2UVM A;  1WG7 A;  1LW3 A;  3OAN A;  1MPH A;  2DFK A;  1EVH A;  1PMS A;  4HAV B;  2NZ8 B;  4DX8 A;  2YS5 A;  2QKM A;  4XWX A;  4BBK A;  4KHO A;  4Y94 A;  3HQC A;  1FHX A;  4HB2 B;  3WA0 A;  4HB0 B;  4TYZ A;  2R0D A;  4HAX B;  4TKN A;  4KVG B;  1U27 A;  2DKP A;  4NSW A;  5DHF B;  1V88 A;  2L1C A;  1ZC4 B;  4IFS A;  1UNQ A;  2W2X C;  2VKI A;  3F0W A;  3HW2 B;  3D8E A;  2ELA A;  3RCP A;  2DYN A;  2DA0 A;  3WYF B;  4F7U P;  5J3Q A;  3SUZ A;  1BAK A;  1WJM A;  2N0Y A;  1W1D A;  3A98 B;  3U8Z A;  2YF0 A;  3FM8 C;  1WGQ A;  2W2X D;  1W1H A;  2E2X A;  2Q13 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...