2YS3A

Solution structure of the ph domain of kindlin-3 from human
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
137
structure length
137
Chain Sequence
GSSGSSGIPELKDHLRIFRPRKLTLKGYRQHWVVFKETTLSYYKSQDEAPGDPIQQLNLKGCEVVPDVNVSGQKFCIKLLVPSPEGMSEIYLRCQDEQQYARWMAGCRLASKGRTMADSSYTSEVQAILAFLSLQRT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the PH domain of Kindlin-3 from human
rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords Unc-112-related protein 2
total genus 21
structure length 137
sequence length 137
ec nomenclature
pdb deposition date 2007-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00169 PH PH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2ys3A00
2GJYA 1E5WA 4F7UP 3TO1A 3UZTA 1PFJA 1FGZA 1SGHA 2P0DA 2ROVA 1MK7B 3F0WA 5C16A 5DH9B 2ROZB 3ODXA 1OQNA 5KQ4A 3PZDA 1XCGA 4ZRIA 1W1DA 2CY5A 2YSZA 3PVLA 1XD4A 3CXBB 4K17A 1WJ1A 1UNRA 1XR0B 2GCJA 1BTNA 2L1CA 3D8EA 1V5MA 4Z2NA 1EGXA 1TXDA 3MPXA 3P7ZA 2I5CA 3QIJA 4HAUB 3SYXA 2DHKA 5JHGA 2ADZA 3ZVRA 5HE1A 1V88A 2J0KA 2KUPA 2R09A 1BAKA 4K2PA 5HE2A 3TFMA 2RGNB 1UPRA 2RSGA 4NSWA 1WGQA 5JHHA 2KGXB 3PSCA 4ZRJA 2COFA 4PQ0A 2RUKB 2CODA 2D9VA 1UNPA 1DDMA 3CIKA 5FI0A 2ELBA 5LOPB 1P6SA 1DDWA 2YT0A 4HAVB 2N23A 2I1JA 4K2OA 1XODA 5D3YA 1WI1A 4K81A 4EKUA 1FGYA 4F7HA 5FI1A 4IOYX 2CY4A 2COAA 2RNRB 4HAZB 1Y5OA 4A6FB 5D27A 3U7DA 2P0FA 4GXBA 2MWNB 4ZRKA 1Z87A 1DYNA 2K2UA 3D8FA 2J0MA 3PVUA 5HE3A 2W2XC 1DDVA 5EFXA 2QKMA 1AWEA 2EJ8A 3BINA 1FHWA 5D3WA 1IRSA 2YF0A 2YVCA 2P0HA 2GS0A 2D9ZA 4HDOA 1H10A 1AQCA 2PZ1A 2YS1A 3NSUA 1RJ2A 2R0DA 3P6AA 2EMSA 2UVMA 3U8ZA 4GN1A 3HK0A 5C5BB 1ZC3B 4TKNA 1DBHA 4YONA 4HAWB 3AJ4A 4CHMA 4GMVA 3X23A 1W1GA 3MDBC 3GYPA 1EAZA 1OMWA 2ELAA 1H4RA 2UZSA 4PNKA 1NU2A 4KHBB 2P8VA 2I1KA 2M38A 4C0AA 4A6FA 4HB2B 1TQZA 4HAXB 2Y8GA 5J3QA 1X11A 2LOXA 2DX5A 3HQCA 1X1GA 1B55A 1OY2A 2W2XD 3AU4A 1U5FA 1ISNA 4Y94A 3T06A 1FB8A 4XWXA 3G9WA 2NZ8B 2IYBA 2LOZA 2DFKA 3FM8C 2OQBA 2LKOA 2G35A 1I7AA 3IVFA 3VIAA 4GZUA 4YL8A 4DBBA 3WYFB 3SUZA 4WSFA 3KY9A 1ZVRA 4CHJA 4DX90 2D11A 1UPQA 1M7EA 4GMXB 5C79A 2AEHA 4NY0A 1ZC4B 4H8SA 2YRYA 1FOEA 2RVBB 4IAPA 1V5UA 2W2WA 5CLQB 2EC1A 1U5DA 2L2IA 3DXCA 5KCVA 1LW3A 1GC6A 3SNHA 1KZ7A 5J3YA 1U29A 2NMBA 2QKLA 4HDQA 2DN6A 2RLOA 1ZSQA 1GG3A 3A98B 3N7CA 1XX0A 5HE0A 2D10A 2DTCA 4DX8A 3F5RA 5LONB 2Z0PA 3FEHA 1PMSA 1MKEA 2MKRA 4MT7A 1EVHA 3D8DA 3ODOA 2K00A 5L81A 1MIZB 1EF1A 1X86A 1FHXA 1MAIA 5DI9B 1M7RA 5D3XA 2DYQA 2D2QA 3GYOA 2K2JA 5KQ1A 2DX1A 1W1HA 1J0WA 5CLLB 2XQNM 1ZM0A 2J59M 4D0NB 2DYNA 2HTHB 3ODWA 5JLJB 3KRWA 3PG7A 1Y19B 4EJNA 1U2BA 3FSSA 1NTYA 4Z2MB 4BBKA 3WA0A 2Y8FA 3QBVB 4TYZA 3TVVA 3PP2A 4A6HA 4HB3B 2Q13A 5DIFB 1V61A 1FHOA 1U5EA 2BCJA 2DA0A 2DKQA 2EMTA 2D9YA 1UEFA 3O96A 4KAXB 1MIXA 1V5PA 3LJUX 2YS3A 3VOQA 2ZPYA 3PVWA 5J3TA 1X1FA 4WVFB 4HB4B 1V89A 2IFSA 3OANA 4HHVA 5C6RA 3KRXA 3A8PA 2Z0OA 2Z0QA 1I2HA 1QC6A 1KI1B 2CAYA 3A8QA 2MDXA 1X05A 3RCPA 4A6KA 1K5DB 1U27A 3SO6A 4KHOA 4EMOA 5DHAB 2D4QA 4L6EA 1WGUA 1DROA 1LB1A 3TCAA 1TJ6A 3DXEA 3HW2B 4HAYB 3PEGA 2DKPA 4GPTB 2UZRA 2D9WA 2DLWA 2JP2A 2X18A 2Y7BA 1SHCA 2AL6A 2COCA 3QWMA 4WJ7A 1K5GB 5GOWB 4B6HA 3SV1A 2E2XA 5D3VA 2D9XA 2CRFA 2OTXA 4P7IA 3BJIA 2LULA 2FJLA 4MY6A 4CYEA 4A5KA 1P5TA 1BTKA 2VRWB 1KZGA 2N0YA 1PLSA 5DHFB 5JP4A 2DHJA 2DHIA 1GC7A 4KVGB 2YT1A 3M1IB 3ML4A 2HE7A 2J0JA 3ULBA 3AU5A 2KCJA 2H7EA 1RRPB 1FAOA 1Q67A 1XKEA 1WG7A 2VKIA 2VSZA 4F7GA 1MPHA 1P3RA 4KHAA 4HATB 1NTVA 1U5GA 1WVHA 1MK9B 1NI2A 2YS5A 4DXAB 1J19A 4IFSA 2GCLA 3KZ1A 3DXDA 1UNQA 3ZDTA 2M14A 2H7DA 1WJMA 2LYDA 4HB0B 2LG1A 1N3HA 3TW1A 2MFQA 3ULCA 3KSYA 4MK0A 1QQGA 1BWNA 2V76A 2I5FA 3V5WA 5C5BA
chains in the Genus database with same CATH superfamily
2GJYA 1E5WA 4F7UP 3TO1A 3UZTA 3NWAA 1PFJA 1FGZA 3OHMB 1SGHA 2P0DA 2ROVA 1MK7B 3F0WA 5C16A 5DH9B 2ROZB 3ODXA 1OQNA 2K8EA 5KQ4A 3PZDA 1XCGA 3HSAA 4ZRIA 1W1DA 2CY5A 2YSZA 3PVLA 1XD4A 3CXBB 4K17A 1WJ1A 1UNRA 1XR0B 2GCJA 1BTNA 2L1CA 3D8EA 1V5MA 4Z2NA 1EGXA 1TXDA 3MPXA 3P7ZA 2I5CA 3U12A 3QIJA 4HAUB 3SYXA 2DHKA 5JHGA 2ADZA 3ZVRA 5HE1A 1V88A 2J0KA 2KUPA 2R09A 1BAKA 4HSIA 4K2PA 5HE2A 3TFMA 2RGNB 3NWFA 1UPRA 2RSGA 4NSWA 1WGQA 5JHHA 2KGXB 3PSCA 4ZRJA 2COFA 4PQ0A 2RUKB 2CODA 2D9VA 1UNPA 1DDMA 2NBVA 3CIKA 5FI0A 2ELBA 5LOPB 2Z13A 1P6SA 1DDWA 2YT0A 4HAVB 2N23A 2I1JA 4K2OA 1XODA 5D3YA 1WI1A 4K81A 4EKUA 1FGYA 4QJ4B 4F7HA 5FI1A 4IOYX 2CY4A 2COAA 2RNRB 4HAZB 1Y5OA 4A6FB 2R2YA 5D27A 3U7DA 1T77A 2P0FA 4GXBA 2MWNB 4ZRKA 1Z87A 3NWDA 1DYNA 2K2UA 3D8FA 2J0MA 3PVUA 5HE3A 2W2XC 1DDVA 5EFXA 2QKMA 3NW8A 1AWEA 2EJ8A 3BINA 1FHWA 5D3WA 1IRSA 2YF0A 2YVCA 2P0HA 3DCXA 2GS0A 2D9ZA 4HDOA 1H10A 1AQCA 5LG4B 2PZ1A 2YS1A 2Z4DA 3NSUA 1RJ2A 2R0DA 4QJ3B 3P6AA 2EMSA 2UVMA 3U8ZA 4GN1A 3HK0A 5C5BB 1ZC3B 2K49A 4TKNA 1DBHA 4YONA 4HAWB 3AJ4A 4CHMA 4OSNA 4GMVA 3X23A 1W1GA 3MDBC 3GYPA 1EAZA 1OMWA 2ELAA 1H4RA 2UZSA 4PNKA 1NU2A 5I2SA 4KHBB 2P8VA 2I1KA 2M38A 4KHBA 4C0AA 4A6FA 4HB2B 1TQZA 4HAXB 2Y8GA 5J3QA 1X11A 2LOXA 2DX5A 3HQCA 1X1GA 1B55A 1OY2A 2W2XD 3AU4A 1U5FA 1ISNA 4Y94A 3T06A 1FB8A 4XWXA 3G9WA 2NZ8B 2IYBA 2LOZA 2DFKA 3FM8C 2OQBA 2LKOA 2G35A 1I7AA 3IVFA 3VIAA 4GZUA 4YL8A 4DBBA 3WYFB 3SUZA 4WSFA 3KY9A 1ZVRA 4CHJA 4DX90 2D11A 1UPQA 1M7EA 4GMXB 4D6WA 5C79A 2AEHA 5M4YB 4NY0A 4L1RA 1ZC4B 4H8SA 2YRYA 1FOEA 2RVBB 4IAPA 1V5UA 2W2WA 5CLQB 2EC1A 1U5DA 2L2IA 3DXCA 5KCVA 1LW3A 1GC6A 3SNHA 1KZ7A 5J3YA 1U29A 1MI1A 2NMBA 2QKLA 4HDQA 2DN6A 2RLOA 1ZSQA 1GG3A 3A98B 3N7CA 2KIEA 1XX0A 5HE0A 4GNKB 2D10A 3A58A 2DTCA 4DX8A 3F5RA 5LONB 2Z0PA 2FJUB 4GOUA 3FEHA 1PMSA 1MKEA 2MKRA 4MT7A 1EVHA 3D8DA 3ODOA 2K00A 5L81A 1MIZB 1EF1A 3B77A 1X86A 1FHXA 1MAIA 5DI9B 1M7RA 5D3XA 2DYQA 2D2QA 3GYOA 2K2JA 5KQ1A 2DX1A 4QJ5B 1W1HA 1J0WA 5CLLB 2XQNM 3FVCA 1ZM0A 2J59M 4D0NB 2DYNA 2HTHB 3ODWA 5JLJB 3KRWA 3PG7A 1Y19B 4EJNA 1ZYIA 1U2BA 3FSSA 1NTYA 4Z2MB 4BBKA 3WA0A 2Y8FA 3QBVB 4TYZA 3TVVA 3PP2A 4A6HA 4HB3B 2Q13A 5DIFB 1V61A 1FHOA 1U5EA 2BCJA 2YT2A 2DA0A 2DKQA 2EMTA 2D9YA 1UEFA 3O96A 1MIXA 4KAXB 1V5PA 3LJUX 2YS3A 3VOQA 2ZPYA 3PVWA 5J3TA 2KUQA 1X1FA 4WVFB 4HB4B 1V89A 2IFSA 2Z59A 4DIXA 3OANA 4HHVA 5C6RA 3KRXA 3A8PA 2Z0OA 2Z0QA 1I2HA 3HIEA 1QC6A 1KI1B 2CAYA 2KR0A 3A8QA 2MDXA 1X05A 3RCPA 4A6KA 1K5DB 1U27A 3SO6A 4KHOA 4EMOA 5DHAB 2D4QA 4L6EA 1WGUA 1DROA 1LB1A 3TCAA 1TJ6A 3DXEA 3HW2B 4OT1A 4HAYB 3PEGA 2DKPA 4GPTB 2UZRA 2D9WA 2DLWA 2JP2A 2X18A 2Y7BA 5I2MA 1SHCA 2AL6A 2COCA 3QWMA 4WJ7A 1K5GB 5GOWB 4B6HA 2ZKMX 3SV1A 2E2XA 5D3VA 2D9XA 2CRFA 2OTXA 4P7IA 3BJIA 2LULA 2FJLA 4MY6A 4CYEA 4A5KA 1P5TA 1BTKA 2VRWB 1KZGA 2N0YA 2Z14A 4QXAB 1PLSA 5DHFB 4CSQA 5JP4A 2DHJA 2DHIA 2KIGA 1GC7A 4KVGB 2YT1A 3M1IB 3ML4A 2HE7A 2J0JA 3ULBA 3AU5A 2KCJA 2H7EA 1RRPB 1FAOA 1Q67A 1XKEA 1WG7A 2VKIA 2VSZA 4F7GA 1MPHA 2GUMA 1P3RA 4KHAA 4HATB 1NTVA 1U5GA 1WVHA 1MK9B 1NI2A 2YS5A 4DXAB 1J19A 4IFSA 2GCLA 3KZ1A 3DXDA 1UNQA 3ZDTA 2M14A 2H7DA 1WJMA 2LYDA 4HB0B 5IRSA 2LG1A 1N3HA 3TW1A 2MFQA 3ULCA 3KSYA 4MK0A 1QQGA 1BWNA 2V76A 2I5FA 3V5WA 2RRFA 5C5BA
chains in the Genus database with same CATH topology
2GJYA 1E5WA 4F7UP 3TO1A 3UZTA 1PFJA 1FGZA 1SGHA 2P0DA 2ROVA 1MK7B 3F0WA 5C16A 5DH9B 2ROZB 3ODXA 1OQNA 5KQ4A 3PZDA 1XCGA 4ZRIA 1W1DA 2CY5A 2YSZA 3PVLA 1XD4A 3CXBB 4K17A 1WJ1A 1UNRA 1XR0B 2GCJA 1BTNA 2L1CA 3D8EA 1V5MA 4Z2NA 1EGXA 1TXDA 3MPXA 3P7ZA 2I5CA 3QIJA 4HAUB 3SYXA 2DHKA 5JHGA 2ADZA 3ZVRA 5HE1A 1V88A 2J0KA 2KUPA 2R09A 1BAKA 4K2PA 5HE2A 3TFMA 2RGNB 1UPRA 2RSGA 4NSWA 1WGQA 5JHHA 2KGXB 3PSCA 4ZRJA 2COFA 4PQ0A 2RUKB 2CODA 2D9VA 1UNPA 1DDMA 3CIKA 5FI0A 2ELBA 5LOPB 1P6SA 1DDWA 2YT0A 4HAVB 2N23A 2I1JA 4K2OA 1XODA 5D3YA 1WI1A 4K81A 4EKUA 1FGYA 4F7HA 5FI1A 4IOYX 2CY4A 2COAA 2RNRB 4HAZB 1Y5OA 4A6FB 5D27A 3U7DA 2P0FA 4GXBA 2MWNB 4ZRKA 1Z87A 1DYNA 2K2UA 3D8FA 2J0MA 3PVUA 5HE3A 2W2XC 1DDVA 5EFXA 2QKMA 1AWEA 2EJ8A 3BINA 1FHWA 5D3WA 1IRSA 2YF0A 2YVCA 2P0HA 2GS0A 2D9ZA 4HDOA 1H10A 1AQCA 2PZ1A 2YS1A 3NSUA 1RJ2A 2R0DA 3P6AA 2EMSA 2UVMA 3U8ZA 4GN1A 3HK0A 5C5BB 1ZC3B 4TKNA 1DBHA 4YONA 4HAWB 3AJ4A 4CHMA 4GMVA 3X23A 1W1GA 3MDBC 3GYPA 1EAZA 1OMWA 2ELAA 1H4RA 2UZSA 4PNKA 1NU2A 4KHBB 2P8VA 2I1KA 2M38A 4C0AA 4A6FA 4HB2B 1TQZA 4HAXB 2Y8GA 5J3QA 1X11A 2LOXA 2DX5A 3HQCA 1X1GA 1B55A 1OY2A 2W2XD 3AU4A 1U5FA 1ISNA 4Y94A 3T06A 1FB8A 4XWXA 3G9WA 2NZ8B 2IYBA 2LOZA 2DFKA 3FM8C 2OQBA 2LKOA 2G35A 1I7AA 3IVFA 3VIAA 4GZUA 4YL8A 4DBBA 3WYFB 3SUZA 4WSFA 3KY9A 1ZVRA 4CHJA 4DX90 2D11A 1UPQA 1M7EA 4GMXB 5C79A 2AEHA 4NY0A 1ZC4B 4H8SA 2YRYA 1FOEA 2RVBB 4IAPA 1V5UA 2W2WA 5CLQB 2EC1A 1U5DA 2L2IA 3DXCA 5KCVA 1LW3A 1GC6A 3SNHA 1KZ7A 5J3YA 1U29A 2NMBA 2QKLA 4HDQA 2DN6A 2RLOA 1ZSQA 1GG3A 3A98B 3N7CA 1XX0A 5HE0A 2D10A 2DTCA 4DX8A 3F5RA 5LONB 2Z0PA 3FEHA 1PMSA 1MKEA 2MKRA 4MT7A 1EVHA 3D8DA 3ODOA 2K00A 5L81A 1MIZB 1EF1A 1X86A 1FHXA 1MAIA 5DI9B 1M7RA 5D3XA 2DYQA 2D2QA 3GYOA 2K2JA 5KQ1A 2DX1A 1W1HA 1J0WA 5CLLB 2XQNM 1ZM0A 2J59M 4D0NB 2DYNA 2HTHB 3ODWA 5JLJB 3KRWA 3PG7A 1Y19B 4EJNA 1U2BA 3FSSA 1NTYA 4Z2MB 4BBKA 3WA0A 2Y8FA 3QBVB 4TYZA 3TVVA 3PP2A 4A6HA 4HB3B 2Q13A 5DIFB 1V61A 1FHOA 1U5EA 2BCJA 2DA0A 2DKQA 2EMTA 2D9YA 1UEFA 3O96A 4KAXB 1MIXA 1V5PA 3LJUX 2YS3A 3VOQA 2ZPYA 3PVWA 5J3TA 1X1FA 4WVFB 4HB4B 1V89A 2IFSA 3OANA 4HHVA 5C6RA 3KRXA 3A8PA 2Z0OA 2Z0QA 1I2HA 1QC6A 1KI1B 2CAYA 3A8QA 2MDXA 1X05A 3RCPA 4A6KA 1K5DB 1U27A 3SO6A 4KHOA 4EMOA 5DHAB 2D4QA 4L6EA 1WGUA 1DROA 1LB1A 3TCAA 1TJ6A 3DXEA 3HW2B 4HAYB 3PEGA 2DKPA 4GPTB 2UZRA 2D9WA 2DLWA 2JP2A 2X18A 2Y7BA 1SHCA 2AL6A 2COCA 3QWMA 4WJ7A 1K5GB 5GOWB 4B6HA 3SV1A 2E2XA 5D3VA 2D9XA 2CRFA 2OTXA 4P7IA 3BJIA 2LULA 2FJLA 4MY6A 4CYEA 4A5KA 1P5TA 1BTKA 2VRWB 1KZGA 2N0YA 1PLSA 5DHFB 5JP4A 2DHJA 2DHIA 1GC7A 4KVGB 2YT1A 3M1IB 3ML4A 2HE7A 2J0JA 3ULBA 3AU5A 2KCJA 2H7EA 1RRPB 1FAOA 1Q67A 1XKEA 1WG7A 2VKIA 2VSZA 4F7GA 1MPHA 1P3RA 4KHAA 4HATB 1NTVA 1U5GA 1WVHA 1MK9B 1NI2A 2YS5A 4DXAB 1J19A 4IFSA 2GCLA 3KZ1A 3DXDA 1UNQA 3ZDTA 2M14A 2H7DA 1WJMA 2LYDA 4HB0B 2LG1A 1N3HA 3TW1A 2MFQA 3ULCA 3KSYA 4MK0A 1QQGA 1BWNA 2V76A 2I5FA 3V5WA 5C5BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GJY A;  1E5W A;  4F7U P;  3TO1 A;  3UZT A;  1PFJ A;  1FGZ A;  1SGH A;  2P0D A;  2ROV A;  1MK7 B;  3F0W A;  5C16 A;  5DH9 B;  2ROZ B;  3ODX A;  1OQN A;  5KQ4 A;  3PZD A;  1XCG A;  4ZRI A;  1W1D A;  2CY5 A;  2YSZ A;  3PVL A;  1XD4 A;  3CXB B;  4K17 A;  1WJ1 A;  1UNR A;  1XR0 B;  2GCJ A;  1BTN A;  2L1C A;  3D8E A;  1V5M A;  4Z2N A;  1EGX A;  1TXD A;  3MPX A;  3P7Z A;  2I5C A;  3QIJ A;  4HAU B;  3SYX A;  2DHK A;  5JHG A;  2ADZ A;  3ZVR A;  5HE1 A;  1V88 A;  2J0K A;  2KUP A;  2R09 A;  1BAK A;  4K2P A;  5HE2 A;  3TFM A;  2RGN B;  1UPR A;  2RSG A;  4NSW A;  1WGQ A;  5JHH A;  2KGX B;  3PSC A;  4ZRJ A;  2COF A;  4PQ0 A;  2RUK B;  2COD A;  2D9V A;  1UNP A;  1DDM A;  3CIK A;  5FI0 A;  2ELB A;  5LOP B;  1P6S A;  1DDW A;  2YT0 A;  4HAV B;  2N23 A;  2I1J A;  4K2O A;  1XOD A;  5D3Y A;  1WI1 A;  4K81 A;  4EKU A;  1FGY A;  4F7H A;  5FI1 A;  4IOY X;  2CY4 A;  2COA A;  2RNR B;  4HAZ B;  1Y5O A;  4A6F B;  5D27 A;  3U7D A;  2P0F A;  4GXB A;  2MWN B;  4ZRK A;  1Z87 A;  1DYN A;  2K2U A;  3D8F A;  2J0M A;  3PVU A;  5HE3 A;  2W2X C;  1DDV A;  5EFX A;  2QKM A;  1AWE A;  2EJ8 A;  3BIN A;  1FHW A;  5D3W A;  1IRS A;  2YF0 A;  2YVC A;  2P0H A;  2GS0 A;  2D9Z A;  4HDO A;  1H10 A;  1AQC A;  2PZ1 A;  2YS1 A;  3NSU A;  1RJ2 A;  2R0D A;  3P6A A;  2EMS A;  2UVM A;  3U8Z A;  4GN1 A;  3HK0 A;  5C5B B;  1ZC3 B;  4TKN A;  1DBH A;  4YON A;  4HAW B;  3AJ4 A;  4CHM A;  4GMV A;  3X23 A;  1W1G A;  3MDB C;  3GYP A;  1EAZ A;  1OMW A;  2ELA A;  1H4R A;  2UZS A;  4PNK A;  1NU2 A;  4KHB B;  2P8V A;  2I1K A;  2M38 A;  4C0A A;  4A6F A;  4HB2 B;  1TQZ A;  4HAX B;  2Y8G A;  5J3Q A;  1X11 A;  2LOX A;  2DX5 A;  3HQC A;  1X1G A;  1B55 A;  1OY2 A;  2W2X D;  3AU4 A;  1U5F A;  1ISN A;  4Y94 A;  3T06 A;  1FB8 A;  4XWX A;  3G9W A;  2NZ8 B;  2IYB A;  2LOZ A;  2DFK A;  3FM8 C;  2OQB A;  2LKO A;  2G35 A;  1I7A A;  3IVF A;  3VIA A;  4GZU A;  4YL8 A;  4DBB A;  3WYF B;  3SUZ A;  4WSF A;  3KY9 A;  1ZVR A;  4CHJ A;  4DX9 0;  2D11 A;  1UPQ A;  1M7E A;  4GMX B;  5C79 A;  2AEH A;  4NY0 A;  1ZC4 B;  4H8S A;  2YRY A;  1FOE A;  2RVB B;  4IAP A;  1V5U A;  2W2W A;  5CLQ B;  2EC1 A;  1U5D A;  2L2I A;  3DXC A;  5KCV A;  1LW3 A;  1GC6 A;  3SNH A;  1KZ7 A;  5J3Y A;  1U29 A;  2NMB A;  2QKL A;  4HDQ A;  2DN6 A;  2RLO A;  1ZSQ A;  1GG3 A;  3A98 B;  3N7C A;  1XX0 A;  5HE0 A;  2D10 A;  2DTC A;  4DX8 A;  3F5R A;  5LON B;  2Z0P A;  3FEH A;  1PMS A;  1MKE A;  2MKR A;  4MT7 A;  1EVH A;  3D8D A;  3ODO A;  2K00 A;  5L81 A;  1MIZ B;  1EF1 A;  1X86 A;  1FHX A;  1MAI A;  5DI9 B;  1M7R A;  5D3X A;  2DYQ A;  2D2Q A;  3GYO A;  2K2J A;  5KQ1 A;  2DX1 A;  1W1H A;  1J0W A;  5CLL B;  2XQN M;  1ZM0 A;  2J59 M;  4D0N B;  2DYN A;  2HTH B;  3ODW A;  5JLJ B;  3KRW A;  3PG7 A;  1Y19 B;  4EJN A;  1U2B A;  3FSS A;  1NTY A;  4Z2M B;  4BBK A;  3WA0 A;  2Y8F A;  3QBV B;  4TYZ A;  3TVV A;  3PP2 A;  4A6H A;  4HB3 B;  2Q13 A;  5DIF B;  1V61 A;  1FHO A;  1U5E A;  2BCJ A;  2DA0 A;  2DKQ A;  2EMT A;  2D9Y A;  1UEF A;  3O96 A;  4KAX B;  1MIX A;  1V5P A;  3LJU X;  2YS3 A;  3VOQ A;  2ZPY A;  3PVW A;  5J3T A;  1X1F A;  4WVF B;  4HB4 B;  1V89 A;  2IFS A;  3OAN A;  4HHV A;  5C6R A;  3KRX A;  3A8P A;  2Z0O A;  2Z0Q A;  1I2H A;  1QC6 A;  1KI1 B;  2CAY A;  3A8Q A;  2MDX A;  1X05 A;  3RCP A;  4A6K A;  1K5D B;  1U27 A;  3SO6 A;  4KHO A;  4EMO A;  5DHA B;  2D4Q A;  4L6E A;  1WGU A;  1DRO A;  1LB1 A;  3TCA A;  1TJ6 A;  3DXE A;  3HW2 B;  4HAY B;  3PEG A;  2DKP A;  4GPT B;  2UZR A;  2D9W A;  2DLW A;  2JP2 A;  2X18 A;  2Y7B A;  1SHC A;  2AL6 A;  2COC A;  3QWM A;  4WJ7 A;  1K5G B;  5GOW B;  4B6H A;  3SV1 A;  2E2X A;  5D3V A;  2D9X A;  2CRF A;  2OTX A;  4P7I A;  3BJI A;  2LUL A;  2FJL A;  4MY6 A;  4CYE A;  4A5K A;  1P5T A;  1BTK A;  2VRW B;  1KZG A;  2N0Y A;  1PLS A;  5DHF B;  5JP4 A;  2DHJ A;  2DHI A;  1GC7 A;  4KVG B;  2YT1 A;  3M1I B;  3ML4 A;  2HE7 A;  2J0J A;  3ULB A;  3AU5 A;  2KCJ A;  2H7E A;  1RRP B;  1FAO A;  1Q67 A;  1XKE A;  1WG7 A;  2VKI A;  2VSZ A;  4F7G A;  1MPH A;  1P3R A;  4KHA A;  4HAT B;  1NTV A;  1U5G A;  1WVH A;  1MK9 B;  1NI2 A;  2YS5 A;  4DXA B;  1J19 A;  4IFS A;  2GCL A;  3KZ1 A;  3DXD A;  1UNQ A;  3ZDT A;  2M14 A;  2H7D A;  1WJM A;  2LYD A;  4HB0 B;  2LG1 A;  1N3H A;  3TW1 A;  2MFQ A;  3ULC A;  3KSY A;  4MK0 A;  1QQG A;  1BWN A;  2V76 A;  2I5F A;  3V5W A;  5C5B A; 
#chains in the Genus database with same CATH topology
 2GJY A;  1E5W A;  4F7U P;  3TO1 A;  3UZT A;  3NWA A;  1PFJ A;  1FGZ A;  3OHM B;  1SGH A;  2P0D A;  2ROV A;  1MK7 B;  3F0W A;  5C16 A;  5DH9 B;  2ROZ B;  3ODX A;  1OQN A;  2K8E A;  5KQ4 A;  3PZD A;  1XCG A;  3HSA A;  4ZRI A;  1W1D A;  2CY5 A;  2YSZ A;  3PVL A;  1XD4 A;  3CXB B;  4K17 A;  1WJ1 A;  1UNR A;  1XR0 B;  2GCJ A;  1BTN A;  2L1C A;  3D8E A;  1V5M A;  4Z2N A;  1EGX A;  1TXD A;  3MPX A;  3P7Z A;  2I5C A;  3U12 A;  3QIJ A;  4HAU B;  3SYX A;  2DHK A;  5JHG A;  2ADZ A;  3ZVR A;  5HE1 A;  1V88 A;  2J0K A;  2KUP A;  2R09 A;  1BAK A;  4HSI A;  4K2P A;  5HE2 A;  3TFM A;  2RGN B;  3NWF A;  1UPR A;  2RSG A;  4NSW A;  1WGQ A;  5JHH A;  2KGX B;  3PSC A;  4ZRJ A;  2COF A;  4PQ0 A;  2RUK B;  2COD A;  2D9V A;  1UNP A;  1DDM A;  2NBV A;  3CIK A;  5FI0 A;  2ELB A;  5LOP B;  2Z13 A;  1P6S A;  1DDW A;  2YT0 A;  4HAV B;  2N23 A;  2I1J A;  4K2O A;  1XOD A;  5D3Y A;  1WI1 A;  4K81 A;  4EKU A;  1FGY A;  4QJ4 B;  4F7H A;  5FI1 A;  4IOY X;  2CY4 A;  2COA A;  2RNR B;  4HAZ B;  1Y5O A;  4A6F B;  2R2Y A;  5D27 A;  3U7D A;  1T77 A;  2P0F A;  4GXB A;  2MWN B;  4ZRK A;  1Z87 A;  3NWD A;  1DYN A;  2K2U A;  3D8F A;  2J0M A;  3PVU A;  5HE3 A;  2W2X C;  1DDV A;  5EFX A;  2QKM A;  3NW8 A;  1AWE A;  2EJ8 A;  3BIN A;  1FHW A;  5D3W A;  1IRS A;  2YF0 A;  2YVC A;  2P0H A;  3DCX A;  2GS0 A;  2D9Z A;  4HDO A;  1H10 A;  1AQC A;  5LG4 B;  2PZ1 A;  2YS1 A;  2Z4D A;  3NSU A;  1RJ2 A;  2R0D A;  4QJ3 B;  3P6A A;  2EMS A;  2UVM A;  3U8Z A;  4GN1 A;  3HK0 A;  5C5B B;  1ZC3 B;  2K49 A;  4TKN A;  1DBH A;  4YON A;  4HAW B;  3AJ4 A;  4CHM A;  4OSN A;  4GMV A;  3X23 A;  1W1G A;  3MDB C;  3GYP A;  1EAZ A;  1OMW A;  2ELA A;  1H4R A;  2UZS A;  4PNK A;  1NU2 A;  5I2S A;  4KHB B;  2P8V A;  2I1K A;  2M38 A;  4KHB A;  4C0A A;  4A6F A;  4HB2 B;  1TQZ A;  4HAX B;  2Y8G A;  5J3Q A;  1X11 A;  2LOX A;  2DX5 A;  3HQC A;  1X1G A;  1B55 A;  1OY2 A;  2W2X D;  3AU4 A;  1U5F A;  1ISN A;  4Y94 A;  3T06 A;  1FB8 A;  4XWX A;  3G9W A;  2NZ8 B;  2IYB A;  2LOZ A;  2DFK A;  3FM8 C;  2OQB A;  2LKO A;  2G35 A;  1I7A A;  3IVF A;  3VIA A;  4GZU A;  4YL8 A;  4DBB A;  3WYF B;  3SUZ A;  4WSF A;  3KY9 A;  1ZVR A;  4CHJ A;  4DX9 0;  2D11 A;  1UPQ A;  1M7E A;  4GMX B;  4D6W A;  5C79 A;  2AEH A;  5M4Y B;  4NY0 A;  4L1R A;  1ZC4 B;  4H8S A;  2YRY A;  1FOE A;  2RVB B;  4IAP A;  1V5U A;  2W2W A;  5CLQ B;  2EC1 A;  1U5D A;  2L2I A;  3DXC A;  5KCV A;  1LW3 A;  1GC6 A;  3SNH A;  1KZ7 A;  5J3Y A;  1U29 A;  1MI1 A;  2NMB A;  2QKL A;  4HDQ A;  2DN6 A;  2RLO A;  1ZSQ A;  1GG3 A;  3A98 B;  3N7C A;  2KIE A;  1XX0 A;  5HE0 A;  4GNK B;  2D10 A;  3A58 A;  2DTC A;  4DX8 A;  3F5R A;  5LON B;  2Z0P A;  2FJU B;  4GOU A;  3FEH A;  1PMS A;  1MKE A;  2MKR A;  4MT7 A;  1EVH A;  3D8D A;  3ODO A;  2K00 A;  5L81 A;  1MIZ B;  1EF1 A;  3B77 A;  1X86 A;  1FHX A;  1MAI A;  5DI9 B;  1M7R A;  5D3X A;  2DYQ A;  2D2Q A;  3GYO A;  2K2J A;  5KQ1 A;  2DX1 A;  4QJ5 B;  1W1H A;  1J0W A;  5CLL B;  2XQN M;  3FVC A;  1ZM0 A;  2J59 M;  4D0N B;  2DYN A;  2HTH B;  3ODW A;  5JLJ B;  3KRW A;  3PG7 A;  1Y19 B;  4EJN A;  1ZYI A;  1U2B A;  3FSS A;  1NTY A;  4Z2M B;  4BBK A;  3WA0 A;  2Y8F A;  3QBV B;  4TYZ A;  3TVV A;  3PP2 A;  4A6H A;  4HB3 B;  2Q13 A;  5DIF B;  1V61 A;  1FHO A;  1U5E A;  2BCJ A;  2YT2 A;  2DA0 A;  2DKQ A;  2EMT A;  2D9Y A;  1UEF A;  3O96 A;  1MIX A;  4KAX B;  1V5P A;  3LJU X;  2YS3 A;  3VOQ A;  2ZPY A;  3PVW A;  5J3T A;  2KUQ A;  1X1F A;  4WVF B;  4HB4 B;  1V89 A;  2IFS A;  2Z59 A;  4DIX A;  3OAN A;  4HHV A;  5C6R A;  3KRX A;  3A8P A;  2Z0O A;  2Z0Q A;  1I2H A;  3HIE A;  1QC6 A;  1KI1 B;  2CAY A;  2KR0 A;  3A8Q A;  2MDX A;  1X05 A;  3RCP A;  4A6K A;  1K5D B;  1U27 A;  3SO6 A;  4KHO A;  4EMO A;  5DHA B;  2D4Q A;  4L6E A;  1WGU A;  1DRO A;  1LB1 A;  3TCA A;  1TJ6 A;  3DXE A;  3HW2 B;  4OT1 A;  4HAY B;  3PEG A;  2DKP A;  4GPT B;  2UZR A;  2D9W A;  2DLW A;  2JP2 A;  2X18 A;  2Y7B A;  5I2M A;  1SHC A;  2AL6 A;  2COC A;  3QWM A;  4WJ7 A;  1K5G B;  5GOW B;  4B6H A;  2ZKM X;  3SV1 A;  2E2X A;  5D3V A;  2D9X A;  2CRF A;  2OTX A;  4P7I A;  3BJI A;  2LUL A;  2FJL A;  4MY6 A;  4CYE A;  4A5K A;  1P5T A;  1BTK A;  2VRW B;  1KZG A;  2N0Y A;  2Z14 A;  4QXA B;  1PLS A;  5DHF B;  4CSQ A;  5JP4 A;  2DHJ A;  2DHI A;  2KIG A;  1GC7 A;  4KVG B;  2YT1 A;  3M1I B;  3ML4 A;  2HE7 A;  2J0J A;  3ULB A;  3AU5 A;  2KCJ A;  2H7E A;  1RRP B;  1FAO A;  1Q67 A;  1XKE A;  1WG7 A;  2VKI A;  2VSZ A;  4F7G A;  1MPH A;  2GUM A;  1P3R A;  4KHA A;  4HAT B;  1NTV A;  1U5G A;  1WVH A;  1MK9 B;  1NI2 A;  2YS5 A;  4DXA B;  1J19 A;  4IFS A;  2GCL A;  3KZ1 A;  3DXD A;  1UNQ A;  3ZDT A;  2M14 A;  2H7D A;  1WJM A;  2LYD A;  4HB0 B;  5IRS A;  2LG1 A;  1N3H A;  3TW1 A;  2MFQ A;  3ULC A;  3KSY A;  4MK0 A;  1QQG A;  1BWN A;  2V76 A;  2I5F A;  3V5W A;  2RRF A;  5C5B A; 
#chains in the Genus database with same CATH homology
 2GJY A;  1E5W A;  4F7U P;  3TO1 A;  3UZT A;  1PFJ A;  1FGZ A;  1SGH A;  2P0D A;  2ROV A;  1MK7 B;  3F0W A;  5C16 A;  5DH9 B;  2ROZ B;  3ODX A;  1OQN A;  5KQ4 A;  3PZD A;  1XCG A;  4ZRI A;  1W1D A;  2CY5 A;  2YSZ A;  3PVL A;  1XD4 A;  3CXB B;  4K17 A;  1WJ1 A;  1UNR A;  1XR0 B;  2GCJ A;  1BTN A;  2L1C A;  3D8E A;  1V5M A;  4Z2N A;  1EGX A;  1TXD A;  3MPX A;  3P7Z A;  2I5C A;  3QIJ A;  4HAU B;  3SYX A;  2DHK A;  5JHG A;  2ADZ A;  3ZVR A;  5HE1 A;  1V88 A;  2J0K A;  2KUP A;  2R09 A;  1BAK A;  4K2P A;  5HE2 A;  3TFM A;  2RGN B;  1UPR A;  2RSG A;  4NSW A;  1WGQ A;  5JHH A;  2KGX B;  3PSC A;  4ZRJ A;  2COF A;  4PQ0 A;  2RUK B;  2COD A;  2D9V A;  1UNP A;  1DDM A;  3CIK A;  5FI0 A;  2ELB A;  5LOP B;  1P6S A;  1DDW A;  2YT0 A;  4HAV B;  2N23 A;  2I1J A;  4K2O A;  1XOD A;  5D3Y A;  1WI1 A;  4K81 A;  4EKU A;  1FGY A;  4F7H A;  5FI1 A;  4IOY X;  2CY4 A;  2COA A;  2RNR B;  4HAZ B;  1Y5O A;  4A6F B;  5D27 A;  3U7D A;  2P0F A;  4GXB A;  2MWN B;  4ZRK A;  1Z87 A;  1DYN A;  2K2U A;  3D8F A;  2J0M A;  3PVU A;  5HE3 A;  2W2X C;  1DDV A;  5EFX A;  2QKM A;  1AWE A;  2EJ8 A;  3BIN A;  1FHW A;  5D3W A;  1IRS A;  2YF0 A;  2YVC A;  2P0H A;  2GS0 A;  2D9Z A;  4HDO A;  1H10 A;  1AQC A;  2PZ1 A;  2YS1 A;  3NSU A;  1RJ2 A;  2R0D A;  3P6A A;  2EMS A;  2UVM A;  3U8Z A;  4GN1 A;  3HK0 A;  5C5B B;  1ZC3 B;  4TKN A;  1DBH A;  4YON A;  4HAW B;  3AJ4 A;  4CHM A;  4GMV A;  3X23 A;  1W1G A;  3MDB C;  3GYP A;  1EAZ A;  1OMW A;  2ELA A;  1H4R A;  2UZS A;  4PNK A;  1NU2 A;  4KHB B;  2P8V A;  2I1K A;  2M38 A;  4C0A A;  4A6F A;  4HB2 B;  1TQZ A;  4HAX B;  2Y8G A;  5J3Q A;  1X11 A;  2LOX A;  2DX5 A;  3HQC A;  1X1G A;  1B55 A;  1OY2 A;  2W2X D;  3AU4 A;  1U5F A;  1ISN A;  4Y94 A;  3T06 A;  1FB8 A;  4XWX A;  3G9W A;  2NZ8 B;  2IYB A;  2LOZ A;  2DFK A;  3FM8 C;  2OQB A;  2LKO A;  2G35 A;  1I7A A;  3IVF A;  3VIA A;  4GZU A;  4YL8 A;  4DBB A;  3WYF B;  3SUZ A;  4WSF A;  3KY9 A;  1ZVR A;  4CHJ A;  4DX9 0;  2D11 A;  1UPQ A;  1M7E A;  4GMX B;  5C79 A;  2AEH A;  4NY0 A;  1ZC4 B;  4H8S A;  2YRY A;  1FOE A;  2RVB B;  4IAP A;  1V5U A;  2W2W A;  5CLQ B;  2EC1 A;  1U5D A;  2L2I A;  3DXC A;  5KCV A;  1LW3 A;  1GC6 A;  3SNH A;  1KZ7 A;  5J3Y A;  1U29 A;  2NMB A;  2QKL A;  4HDQ A;  2DN6 A;  2RLO A;  1ZSQ A;  1GG3 A;  3A98 B;  3N7C A;  1XX0 A;  5HE0 A;  2D10 A;  2DTC A;  4DX8 A;  3F5R A;  5LON B;  2Z0P A;  3FEH A;  1PMS A;  1MKE A;  2MKR A;  4MT7 A;  1EVH A;  3D8D A;  3ODO A;  2K00 A;  5L81 A;  1MIZ B;  1EF1 A;  1X86 A;  1FHX A;  1MAI A;  5DI9 B;  1M7R A;  5D3X A;  2DYQ A;  2D2Q A;  3GYO A;  2K2J A;  5KQ1 A;  2DX1 A;  1W1H A;  1J0W A;  5CLL B;  2XQN M;  1ZM0 A;  2J59 M;  4D0N B;  2DYN A;  2HTH B;  3ODW A;  5JLJ B;  3KRW A;  3PG7 A;  1Y19 B;  4EJN A;  1U2B A;  3FSS A;  1NTY A;  4Z2M B;  4BBK A;  3WA0 A;  2Y8F A;  3QBV B;  4TYZ A;  3TVV A;  3PP2 A;  4A6H A;  4HB3 B;  2Q13 A;  5DIF B;  1V61 A;  1FHO A;  1U5E A;  2BCJ A;  2DA0 A;  2DKQ A;  2EMT A;  2D9Y A;  1UEF A;  3O96 A;  4KAX B;  1MIX A;  1V5P A;  3LJU X;  2YS3 A;  3VOQ A;  2ZPY A;  3PVW A;  5J3T A;  1X1F A;  4WVF B;  4HB4 B;  1V89 A;  2IFS A;  3OAN A;  4HHV A;  5C6R A;  3KRX A;  3A8P A;  2Z0O A;  2Z0Q A;  1I2H A;  1QC6 A;  1KI1 B;  2CAY A;  3A8Q A;  2MDX A;  1X05 A;  3RCP A;  4A6K A;  1K5D B;  1U27 A;  3SO6 A;  4KHO A;  4EMO A;  5DHA B;  2D4Q A;  4L6E A;  1WGU A;  1DRO A;  1LB1 A;  3TCA A;  1TJ6 A;  3DXE A;  3HW2 B;  4HAY B;  3PEG A;  2DKP A;  4GPT B;  2UZR A;  2D9W A;  2DLW A;  2JP2 A;  2X18 A;  2Y7B A;  1SHC A;  2AL6 A;  2COC A;  3QWM A;  4WJ7 A;  1K5G B;  5GOW B;  4B6H A;  3SV1 A;  2E2X A;  5D3V A;  2D9X A;  2CRF A;  2OTX A;  4P7I A;  3BJI A;  2LUL A;  2FJL A;  4MY6 A;  4CYE A;  4A5K A;  1P5T A;  1BTK A;  2VRW B;  1KZG A;  2N0Y A;  1PLS A;  5DHF B;  5JP4 A;  2DHJ A;  2DHI A;  1GC7 A;  4KVG B;  2YT1 A;  3M1I B;  3ML4 A;  2HE7 A;  2J0J A;  3ULB A;  3AU5 A;  2KCJ A;  2H7E A;  1RRP B;  1FAO A;  1Q67 A;  1XKE A;  1WG7 A;  2VKI A;  2VSZ A;  4F7G A;  1MPH A;  1P3R A;  4KHA A;  4HAT B;  1NTV A;  1U5G A;  1WVH A;  1MK9 B;  1NI2 A;  2YS5 A;  4DXA B;  1J19 A;  4IFS A;  2GCL A;  3KZ1 A;  3DXD A;  1UNQ A;  3ZDT A;  2M14 A;  2H7D A;  1WJM A;  2LYD A;  4HB0 B;  2LG1 A;  1N3H A;  3TW1 A;  2MFQ A;  3ULC A;  3KSY A;  4MK0 A;  1QQG A;  1BWN A;  2V76 A;  2I5F A;  3V5W A;  5C5B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...