2YS3A

Solution structure of the ph domain of kindlin-3 from human
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
137
structure length
137
Chain Sequence
GSSGSSGIPELKDHLRIFRPRKLTLKGYRQHWVVFKETTLSYYKSQDEAPGDPIQQLNLKGCEVVPDVNVSGQKFCIKLLVPSPEGMSEIYLRCQDEQQYARWMAGCRLASKGRTMADSSYTSEVQAILAFLSLQRT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Unc-112-related protein 2
publication title Solution structure of the PH domain of Kindlin-3 from human
rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 21
structure length 137
sequence length 137
ec nomenclature
pdb deposition date 2007-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00169 PH PH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2ys3A00
2RGNB 2RVBB 1ZVRA 2CAYA 1EAZA 3P6AA 4IFSA 1N3HA 2R0DA 4B6HA 3KSYA 1WG7A 2I5FA 4D0NB 5C79A 4HAUB 1BTKA 1MIXA 3G9WA 2HE7A 3PG7A 3PSCA 5DHAB 1AQCA 2D9VA 2AEHA 2PZ1A 3VOQA 2I1JA 1V88A 1X1GA 3CXBB 2ROVA 4HAXB 4K2OA 2Q13A 4KAXB 5JLJB 2P8VA 1WGUA 2XQNM 4YONA 3HW2B 4GN1A 1PMSA 4EJNA 1FHOA 3T06A 2N0YA 4A6HA 1K5GB 1BTNA 1MPHA 2I1KA 3KZ1A 1W1GA 2L1CA 2LYDA 4CHMA 1MIZB 5DI9B 1H10A 1GC7A 1V5PA 2W2WA 2YT0A 5D3WA 1QQGA 3ZDTA 1FHXA 2D10A 1KI1B 4H8SA 1PLSA 2QKLA 3F0WA 4HDOA 1W1DA 1M7EA 4TYZA 1WGQA 2D11A 3N7CA 4F7UP 1Y5OA 5FI0A 4HHVA 3M1IB 2COFA 2X18A 3BJIA 2CRFA 1P5TA 2YT1A 2DX1A 2MWNB 2J0MA 2IFSA 3ODOA 4HDQA 2DTCA 2RUKB 1UEFA 5HE3A 5D3VA 2CODA 3TFMA 1WJ1A 3CIKA 3ULCA 2YRYA 5C5BB 4HAYB 3A8PA 5LONB 3SUZA 3OANA 1LW3A 1DYNA 3KRWA 3GYPA 5EFXA 2D4QA 4GMVA 1PFJA 3GYOA 3D8DA 1FHWA 2P0DA 1X1FA 1XR0B 2D9YA 3LJUX 4PQ0A 5CLLB 1WJMA 4KHBB 2NZ8B 3V5WA 3SNHA 1XCGA 3QWMA 1GG3A 3D8EA 3TCAA 2L2IA 4C0AA 3AU4A 4KHAA 2LOXA 3A8QA 4L6EA 1ZM0A 3SYXA 1UPRA 3A98B 1EF1A 2Y7BA 1U29A 4MK0A 5KQ4A 2LOZA 1OY2A 5KCVA 1V61A 1FOEA 2D2QA 3PVWA 2DHIA 2RSGA 4GXBA 4CHJA 4Z2NA 4K81A 1WVHA 2OQBA 2VSZA 3RCPA 2VRWB 2K2JA 1H4RA 1P3RA 1KZ7A 2DHKA 2P0FA 2YF0A 4MY6A 4A6KA 1U5GA 3P7ZA 2BCJA 2LKOA 1DROA 2GCJA 3SV1A 2KGXB 2E2XA 2LULA 2D9WA 4DXAB 4HAZB 4WJ7A 4HB0B 2UZSA 1X11A 3AJ4A 1TXDA 2YSZA 2DHJA 3AU5A 4A5KA 1U2BA 1BWNA 4CYEA 2K00A 3PP2A 1FGYA 2Z0PA 2RNRB 1SHCA 4IOYX 2AL6A 2IYBA 2MKRA 2W2XD 4A6FB 5FI1A 2UZRA 3U8ZA 1J0WA 2H7EA 3NSUA 1V5UA 1KZGA 2VKIA 4EKUA 2EC1A 2Z0QA 1J19A 2ROZB 3IVFA 1X86A 4HB4B 1FGZA 1LB1A 5DIFB 3KY9A 5C5BA 1MKEA 3BINA 1UPQA 1U5FA 2MDXA 2MFQA 1IRSA 2KUPA 1ZSQA 2EMSA 3F5RA 4EMOA 5C6RA 2M38A 2ELBA 2YS5A 3ML4A 1MK7B 1GC6A 5CLQB 5D3XA 5KQ1A 1B55A 4MT7A 5D3YA 4HATB 4YL8A 1Q67A 1U5EA 1EGXA 2ADZA 1DDVA 2COAA 2V76A 3DXCA 3D8FA 1NU2A 2W2XC 2GJYA 3FM8C 1XD4A 3U7DA 1MK9B 4PNKA 3QIJA 3QBVB 2J0KA 2M14A 4HAWB 2DFKA 2QKMA 4NSWA 1I2HA 5HE0A 2CY5A 3PVLA 4GPTB 4NY0A 1XX0A 2ZPYA 4BBKA 1FAOA 5J3TA 2OTXA 2DYQA 2Z0OA 1U5DA 5HE1A 2YS1A 4ZRIA 4HB3B 2D9ZA 1NTYA 1ZC3B 2HTHB 2J59M 1DBHA 1BAKA 5L81A 1EVHA 2DKQA 5JP4A 1ISNA 1NTVA 5GOWB 5D27A 1OQNA 5HE2A 4KHOA 1K5DB 2DKPA 2EJ8A 2N23A 5LOPB 1UNRA 1AWEA 2JP2A 3FEHA 2DA0A 2UVMA 3UZTA 3ULBA 2H7DA 3WA0A 3ZVRA 1SGHA 1UNQA 3HQCA 2LG1A 1TQZA 3ODXA 3HK0A 1U27A 1V5MA 2COCA 4DX90 4A6FA 3PZDA 1DDWA 2Y8FA 4XWXA 2ELAA 4ZRKA 1M7RA 2KCJA 4TKNA 2D9XA 1MAIA 1P6SA 2EMTA 3MDBC 2K2UA 4GMXB 4HAVB 1RJ2A 5JHGA 2GCLA 2RLOA 2J0JA 1NI2A 3VIAA 3X23A 2FJLA 1W1HA 4Y94A 3ODWA 5J3YA 2GS0A 5C16A 1OMWA 2CY4A 2I5CA 2YS3A 4DBBA 2G35A 1TJ6A 2DYNA 2DX5A 2Y8GA 4GZUA 1E5WA 4P7IA 1ZC4B 4DX8A 4HB2B 4IAPA 5DH9B 3FSSA 1V89A 4F7GA 4WSFA 1XODA 3O96A 5JHHA 2NMBA 3MPXA 2R09A 3TO1A 4K2PA 1XKEA 3SO6A 4K17A 1WI1A 4KVGB 5J3QA 3TW1A 2YVCA 1Y19B 1UNPA 1X05A 5DHFB 2DN6A 1DDMA 2P0HA 3PVUA 1QC6A 1FB8A 3WYFB 3TVVA 1I7AA 3DXEA 4F7HA 3PEGA 4WVFB 2DLWA 1Z87A 3KRXA 1RRPB 3DXDA 4Z2MB 4ZRJA
chains in the Genus database with same CATH superfamily
2RGNB 2RVBB 1ZVRA 2CAYA 1EAZA 3P6AA 4IFSA 2KIGA 1N3HA 2R0DA 4B6HA 3KSYA 1WG7A 2I5FA 4D0NB 5C79A 4HAUB 1BTKA 1MIXA 3G9WA 2HE7A 3PG7A 3PSCA 5DHAB 3A58A 1AQCA 2D9VA 2AEHA 2PZ1A 3VOQA 2I1JA 1V88A 1X1GA 2K8EA 3CXBB 2ROVA 4HAXB 4K2OA 2Q13A 4KAXB 4QJ4B 5JLJB 2P8VA 1WGUA 2XQNM 4YONA 3HW2B 4GN1A 1PMSA 4EJNA 4HSIA 1FHOA 3T06A 2N0YA 4A6HA 1K5GB 1BTNA 1MPHA 2I1KA 3KZ1A 3NWFA 2LYDA 1W1GA 2L1CA 4CHMA 1MIZB 5DI9B 1H10A 4QJ5B 1GC7A 1V5PA 2W2WA 2YT0A 2R2YA 1QQGA 5D3WA 3ZDTA 1FHXA 2D10A 1KI1B 4H8SA 1PLSA 2QKLA 3F0WA 4HDOA 1W1DA 3NWDA 1M7EA 4TYZA 1WGQA 2D11A 3N7CA 2NBVA 4F7UP 1Y5OA 5FI0A 4HHVA 3M1IB 2COFA 2X18A 5M4YB 3BJIA 2CRFA 1P5TA 2YT1A 2DX1A 2MWNB 2J0MA 2IFSA 5LG4B 3ODOA 4HDQA 2DTCA 2RUKB 1UEFA 5HE3A 5D3VA 2CODA 3TFMA 1WJ1A 3CIKA 3ULCA 2YRYA 5C5BB 4HAYB 3A8PA 5LONB 3SUZA 3OANA 1LW3A 1DYNA 3KRWA 3GYPA 5EFXA 2D4QA 4GMVA 1PFJA 3GYOA 3D8DA 1FHWA 2P0DA 1X1FA 1XR0B 2D9YA 3LJUX 1MI1A 3OHMB 4PQ0A 5CLLB 1WJMA 4KHBB 2KR0A 2NZ8B 3V5WA 3SNHA 1XCGA 3QWMA 1GG3A 3D8EA 3TCAA 2L2IA 4C0AA 3AU4A 4KHAA 2LOXA 3A8QA 4L6EA 1ZM0A 3SYXA 1UPRA 3A98B 1EF1A 2Y7BA 4QXAB 1U29A 4MK0A 4GOUA 5KQ4A 2Z13A 2LOZA 1OY2A 5KCVA 1V61A 1FOEA 2D2QA 3PVWA 2DHIA 2RSGA 4GXBA 4L1RA 4CHJA 4Z2NA 4K81A 4QJ3B 1WVHA 2OQBA 2VSZA 3RCPA 2VRWB 2K2JA 3B77A 1H4RA 1P3RA 1KZ7A 2DHKA 2P0FA 2YF0A 4MY6A 4A6KA 1U5GA 2YT2A 3P7ZA 3HSAA 2BCJA 2LKOA 5IRSA 1DROA 2GCJA 3SV1A 2KGXB 2E2XA 2LULA 2Z59A 2D9WA 4DXAB 4HAZB 4WJ7A 4HB0B 2UZSA 4GNKB 1X11A 3AJ4A 1TXDA 2YSZA 2DHJA 3AU5A 4A5KA 1U2BA 1BWNA 4CYEA 2K00A 3PP2A 1FGYA 2Z0PA 2RNRB 1SHCA 4IOYX 2AL6A 2IYBA 2MKRA 2W2XD 2FJUB 4A6FB 5FI1A 2UZRA 3U8ZA 1J0WA 2Z14A 2H7EA 3NSUA 4DIXA 1V5UA 1KZGA 2VKIA 4EKUA 2EC1A 2Z0QA 1J19A 2ROZB 3IVFA 1X86A 4HB4B 1FGZA 1LB1A 5DIFB 3KY9A 5C5BA 1MKEA 4D6WA 3BINA 1UPQA 1U5FA 3DCXA 2MDXA 2MFQA 1IRSA 2KUPA 1ZSQA 2EMSA 3F5RA 2KIEA 4EMOA 5C6RA 2M38A 2ELBA 2YS5A 3ML4A 1MK7B 1GC6A 4KHBA 5CLQB 5D3XA 5KQ1A 1B55A 4MT7A 5D3YA 4HATB 4YL8A 1Q67A 1U5EA 1EGXA 2ADZA 2K49A 1DDVA 1ZYIA 2COAA 2KUQA 2V76A 3DXCA 3D8FA 1NU2A 2W2XC 2GJYA 3FM8C 1XD4A 3U7DA 1MK9B 4PNKA 5I2SA 3QIJA 3QBVB 2J0KA 2M14A 4HAWB 2DFKA 2QKMA 4NSWA 1I2HA 5HE0A 2CY5A 3HIEA 3PVLA 4GPTB 4NY0A 1XX0A 2ZPYA 4BBKA 1FAOA 5J3TA 2OTXA 2DYQA 2Z0OA 1U5DA 5HE1A 2YS1A 4ZRIA 4HB3B 2D9ZA 3NW8A 1NTYA 1ZC3B 2HTHB 2J59M 1DBHA 1BAKA 5L81A 1EVHA 2DKQA 5JP4A 1T77A 1ISNA 1NTVA 5GOWB 5D27A 1OQNA 5HE2A 4KHOA 1K5DB 2DKPA 2EJ8A 4OSNA 2N23A 5LOPB 3U12A 1UNRA 1AWEA 2JP2A 3FEHA 2DA0A 2UVMA 3UZTA 3ULBA 2H7DA 3WA0A 3ZVRA 1SGHA 1UNQA 3HQCA 2LG1A 1TQZA 2RRFA 3ODXA 3HK0A 1U27A 1V5MA 2COCA 4DX90 4A6FA 3PZDA 1DDWA 2Y8FA 3NWAA 4XWXA 2GUMA 2ELAA 4ZRKA 1M7RA 2KCJA 4TKNA 2D9XA 1MAIA 1P6SA 2EMTA 3MDBC 2K2UA 4OT1A 4GMXB 4HAVB 1RJ2A 5JHGA 2GCLA 2RLOA 2J0JA 1NI2A 3VIAA 3X23A 2FJLA 1W1HA 4Y94A 3ODWA 5J3YA 2GS0A 5C16A 1OMWA 2CY4A 2I5CA 2YS3A 4DBBA 2G35A 1TJ6A 5I2MA 2DYNA 2ZKMX 2DX5A 2Y8GA 4GZUA 1E5WA 4P7IA 1ZC4B 4DX8A 4HB2B 4IAPA 5DH9B 3FSSA 1V89A 4F7GA 4WSFA 1XODA 3O96A 5JHHA 2NMBA 3MPXA 2R09A 3TO1A 4K2PA 1XKEA 3SO6A 4K17A 1WI1A 4KVGB 5J3QA 3TW1A 2YVCA 1Y19B 1UNPA 1X05A 3FVCA 5DHFB 2DN6A 1DDMA 2P0HA 3PVUA 1QC6A 4CSQA 1FB8A 3WYFB 3TVVA 1I7AA 3DXEA 4F7HA 3PEGA 4WVFB 2DLWA 1Z87A 3KRXA 1RRPB 3DXDA 2Z4DA 4Z2MB 4ZRJA
chains in the Genus database with same CATH topology
2RGNB 2RVBB 1ZVRA 2CAYA 1EAZA 3P6AA 4IFSA 1N3HA 2R0DA 4B6HA 3KSYA 1WG7A 2I5FA 4D0NB 5C79A 4HAUB 1BTKA 1MIXA 3G9WA 2HE7A 3PG7A 3PSCA 5DHAB 1AQCA 2D9VA 2AEHA 2PZ1A 3VOQA 2I1JA 1V88A 1X1GA 3CXBB 2ROVA 4HAXB 4K2OA 2Q13A 4KAXB 5JLJB 2P8VA 1WGUA 2XQNM 4YONA 3HW2B 4GN1A 1PMSA 4EJNA 1FHOA 3T06A 2N0YA 4A6HA 1K5GB 1BTNA 1MPHA 2I1KA 3KZ1A 1W1GA 2L1CA 2LYDA 4CHMA 1MIZB 5DI9B 1H10A 1GC7A 1V5PA 2W2WA 2YT0A 5D3WA 1QQGA 3ZDTA 1FHXA 2D10A 1KI1B 4H8SA 1PLSA 2QKLA 3F0WA 4HDOA 1W1DA 1M7EA 4TYZA 1WGQA 2D11A 3N7CA 4F7UP 1Y5OA 5FI0A 4HHVA 3M1IB 2COFA 2X18A 3BJIA 2CRFA 1P5TA 2YT1A 2DX1A 2MWNB 2J0MA 2IFSA 3ODOA 4HDQA 2DTCA 2RUKB 1UEFA 5HE3A 5D3VA 2CODA 3TFMA 1WJ1A 3CIKA 3ULCA 2YRYA 5C5BB 4HAYB 3A8PA 5LONB 3SUZA 3OANA 1LW3A 1DYNA 3KRWA 3GYPA 5EFXA 2D4QA 4GMVA 1PFJA 3GYOA 3D8DA 1FHWA 2P0DA 1X1FA 1XR0B 2D9YA 3LJUX 4PQ0A 5CLLB 1WJMA 4KHBB 2NZ8B 3V5WA 3SNHA 1XCGA 3QWMA 1GG3A 3D8EA 3TCAA 2L2IA 4C0AA 3AU4A 4KHAA 2LOXA 3A8QA 4L6EA 1ZM0A 3SYXA 1UPRA 3A98B 1EF1A 2Y7BA 1U29A 4MK0A 5KQ4A 2LOZA 1OY2A 5KCVA 1V61A 1FOEA 2D2QA 3PVWA 2DHIA 2RSGA 4GXBA 4CHJA 4Z2NA 4K81A 1WVHA 2OQBA 2VSZA 3RCPA 2VRWB 2K2JA 1H4RA 1P3RA 1KZ7A 2DHKA 2P0FA 2YF0A 4MY6A 4A6KA 1U5GA 3P7ZA 2BCJA 2LKOA 1DROA 2GCJA 3SV1A 2KGXB 2E2XA 2LULA 2D9WA 4DXAB 4HAZB 4WJ7A 4HB0B 2UZSA 1X11A 3AJ4A 1TXDA 2YSZA 2DHJA 3AU5A 4A5KA 1U2BA 1BWNA 4CYEA 2K00A 3PP2A 1FGYA 2Z0PA 2RNRB 1SHCA 4IOYX 2AL6A 2IYBA 2MKRA 2W2XD 4A6FB 5FI1A 2UZRA 3U8ZA 1J0WA 2H7EA 3NSUA 1V5UA 1KZGA 2VKIA 4EKUA 2EC1A 2Z0QA 1J19A 2ROZB 3IVFA 1X86A 4HB4B 1FGZA 1LB1A 5DIFB 3KY9A 5C5BA 1MKEA 3BINA 1UPQA 1U5FA 2MDXA 2MFQA 1IRSA 2KUPA 1ZSQA 2EMSA 3F5RA 4EMOA 5C6RA 2M38A 2ELBA 2YS5A 3ML4A 1MK7B 1GC6A 5CLQB 5D3XA 5KQ1A 1B55A 4MT7A 5D3YA 4HATB 4YL8A 1Q67A 1U5EA 1EGXA 2ADZA 1DDVA 2COAA 2V76A 3DXCA 3D8FA 1NU2A 2W2XC 2GJYA 3FM8C 1XD4A 3U7DA 1MK9B 4PNKA 3QIJA 3QBVB 2J0KA 2M14A 4HAWB 2DFKA 2QKMA 4NSWA 1I2HA 5HE0A 2CY5A 3PVLA 4GPTB 4NY0A 1XX0A 2ZPYA 4BBKA 1FAOA 5J3TA 2OTXA 2DYQA 2Z0OA 1U5DA 5HE1A 2YS1A 4ZRIA 4HB3B 2D9ZA 1NTYA 1ZC3B 2HTHB 2J59M 1DBHA 1BAKA 5L81A 1EVHA 2DKQA 5JP4A 1ISNA 1NTVA 5GOWB 5D27A 1OQNA 5HE2A 4KHOA 1K5DB 2DKPA 2EJ8A 2N23A 5LOPB 1UNRA 1AWEA 2JP2A 3FEHA 2DA0A 2UVMA 3UZTA 3ULBA 2H7DA 3WA0A 3ZVRA 1SGHA 1UNQA 3HQCA 2LG1A 1TQZA 3ODXA 3HK0A 1U27A 1V5MA 2COCA 4DX90 4A6FA 3PZDA 1DDWA 2Y8FA 4XWXA 2ELAA 4ZRKA 1M7RA 2KCJA 4TKNA 2D9XA 1MAIA 1P6SA 2EMTA 3MDBC 2K2UA 4GMXB 4HAVB 1RJ2A 5JHGA 2GCLA 2RLOA 2J0JA 1NI2A 3VIAA 3X23A 2FJLA 1W1HA 4Y94A 3ODWA 5J3YA 2GS0A 5C16A 1OMWA 2CY4A 2I5CA 2YS3A 4DBBA 2G35A 1TJ6A 2DYNA 2DX5A 2Y8GA 4GZUA 1E5WA 4P7IA 1ZC4B 4DX8A 4HB2B 4IAPA 5DH9B 3FSSA 1V89A 4F7GA 4WSFA 1XODA 3O96A 5JHHA 2NMBA 3MPXA 2R09A 3TO1A 4K2PA 1XKEA 3SO6A 4K17A 1WI1A 4KVGB 5J3QA 3TW1A 2YVCA 1Y19B 1UNPA 1X05A 5DHFB 2DN6A 1DDMA 2P0HA 3PVUA 1QC6A 1FB8A 3WYFB 3TVVA 1I7AA 3DXEA 4F7HA 3PEGA 4WVFB 2DLWA 1Z87A 3KRXA 1RRPB 3DXDA 4Z2MB 4ZRJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RGN B;  2RVB B;  1ZVR A;  2CAY A;  1EAZ A;  3P6A A;  4IFS A;  1N3H A;  2R0D A;  4B6H A;  3KSY A;  1WG7 A;  2I5F A;  4D0N B;  5C79 A;  4HAU B;  1BTK A;  1MIX A;  3G9W A;  2HE7 A;  3PG7 A;  3PSC A;  5DHA B;  1AQC A;  2D9V A;  2AEH A;  2PZ1 A;  3VOQ A;  2I1J A;  1V88 A;  1X1G A;  3CXB B;  2ROV A;  4HAX B;  4K2O A;  2Q13 A;  4KAX B;  5JLJ B;  2P8V A;  1WGU A;  2XQN M;  4YON A;  3HW2 B;  4GN1 A;  1PMS A;  4EJN A;  1FHO A;  3T06 A;  2N0Y A;  4A6H A;  1K5G B;  1BTN A;  1MPH A;  2I1K A;  3KZ1 A;  1W1G A;  2L1C A;  2LYD A;  4CHM A;  1MIZ B;  5DI9 B;  1H10 A;  1GC7 A;  1V5P A;  2W2W A;  2YT0 A;  5D3W A;  1QQG A;  3ZDT A;  1FHX A;  2D10 A;  1KI1 B;  4H8S A;  1PLS A;  2QKL A;  3F0W A;  4HDO A;  1W1D A;  1M7E A;  4TYZ A;  1WGQ A;  2D11 A;  3N7C A;  4F7U P;  1Y5O A;  5FI0 A;  4HHV A;  3M1I B;  2COF A;  2X18 A;  3BJI A;  2CRF A;  1P5T A;  2YT1 A;  2DX1 A;  2MWN B;  2J0M A;  2IFS A;  3ODO A;  4HDQ A;  2DTC A;  2RUK B;  1UEF A;  5HE3 A;  5D3V A;  2COD A;  3TFM A;  1WJ1 A;  3CIK A;  3ULC A;  2YRY A;  5C5B B;  4HAY B;  3A8P A;  5LON B;  3SUZ A;  3OAN A;  1LW3 A;  1DYN A;  3KRW A;  3GYP A;  5EFX A;  2D4Q A;  4GMV A;  1PFJ A;  3GYO A;  3D8D A;  1FHW A;  2P0D A;  1X1F A;  1XR0 B;  2D9Y A;  3LJU X;  4PQ0 A;  5CLL B;  1WJM A;  4KHB B;  2NZ8 B;  3V5W A;  3SNH A;  1XCG A;  3QWM A;  1GG3 A;  3D8E A;  3TCA A;  2L2I A;  4C0A A;  3AU4 A;  4KHA A;  2LOX A;  3A8Q A;  4L6E A;  1ZM0 A;  3SYX A;  1UPR A;  3A98 B;  1EF1 A;  2Y7B A;  1U29 A;  4MK0 A;  5KQ4 A;  2LOZ A;  1OY2 A;  5KCV A;  1V61 A;  1FOE A;  2D2Q A;  3PVW A;  2DHI A;  2RSG A;  4GXB A;  4CHJ A;  4Z2N A;  4K81 A;  1WVH A;  2OQB A;  2VSZ A;  3RCP A;  2VRW B;  2K2J A;  1H4R A;  1P3R A;  1KZ7 A;  2DHK A;  2P0F A;  2YF0 A;  4MY6 A;  4A6K A;  1U5G A;  3P7Z A;  2BCJ A;  2LKO A;  1DRO A;  2GCJ A;  3SV1 A;  2KGX B;  2E2X A;  2LUL A;  2D9W A;  4DXA B;  4HAZ B;  4WJ7 A;  4HB0 B;  2UZS A;  1X11 A;  3AJ4 A;  1TXD A;  2YSZ A;  2DHJ A;  3AU5 A;  4A5K A;  1U2B A;  1BWN A;  4CYE A;  2K00 A;  3PP2 A;  1FGY A;  2Z0P A;  2RNR B;  1SHC A;  4IOY X;  2AL6 A;  2IYB A;  2MKR A;  2W2X D;  4A6F B;  5FI1 A;  2UZR A;  3U8Z A;  1J0W A;  2H7E A;  3NSU A;  1V5U A;  1KZG A;  2VKI A;  4EKU A;  2EC1 A;  2Z0Q A;  1J19 A;  2ROZ B;  3IVF A;  1X86 A;  4HB4 B;  1FGZ A;  1LB1 A;  5DIF B;  3KY9 A;  5C5B A;  1MKE A;  3BIN A;  1UPQ A;  1U5F A;  2MDX A;  2MFQ A;  1IRS A;  2KUP A;  1ZSQ A;  2EMS A;  3F5R A;  4EMO A;  5C6R A;  2M38 A;  2ELB A;  2YS5 A;  3ML4 A;  1MK7 B;  1GC6 A;  5CLQ B;  5D3X A;  5KQ1 A;  1B55 A;  4MT7 A;  5D3Y A;  4HAT B;  4YL8 A;  1Q67 A;  1U5E A;  1EGX A;  2ADZ A;  1DDV A;  2COA A;  2V76 A;  3DXC A;  3D8F A;  1NU2 A;  2W2X C;  2GJY A;  3FM8 C;  1XD4 A;  3U7D A;  1MK9 B;  4PNK A;  3QIJ A;  3QBV B;  2J0K A;  2M14 A;  4HAW B;  2DFK A;  2QKM A;  4NSW A;  1I2H A;  5HE0 A;  2CY5 A;  3PVL A;  4GPT B;  4NY0 A;  1XX0 A;  2ZPY A;  4BBK A;  1FAO A;  5J3T A;  2OTX A;  2DYQ A;  2Z0O A;  1U5D A;  5HE1 A;  2YS1 A;  4ZRI A;  4HB3 B;  2D9Z A;  1NTY A;  1ZC3 B;  2HTH B;  2J59 M;  1DBH A;  1BAK A;  5L81 A;  1EVH A;  2DKQ A;  5JP4 A;  1ISN A;  1NTV A;  5GOW B;  5D27 A;  1OQN A;  5HE2 A;  4KHO A;  1K5D B;  2DKP A;  2EJ8 A;  2N23 A;  5LOP B;  1UNR A;  1AWE A;  2JP2 A;  3FEH A;  2DA0 A;  2UVM A;  3UZT A;  3ULB A;  2H7D A;  3WA0 A;  3ZVR A;  1SGH A;  1UNQ A;  3HQC A;  2LG1 A;  1TQZ A;  3ODX A;  3HK0 A;  1U27 A;  1V5M A;  2COC A;  4DX9 0;  4A6F A;  3PZD A;  1DDW A;  2Y8F A;  4XWX A;  2ELA A;  4ZRK A;  1M7R A;  2KCJ A;  4TKN A;  2D9X A;  1MAI A;  1P6S A;  2EMT A;  3MDB C;  2K2U A;  4GMX B;  4HAV B;  1RJ2 A;  5JHG A;  2GCL A;  2RLO A;  2J0J A;  1NI2 A;  3VIA A;  3X23 A;  2FJL A;  1W1H A;  4Y94 A;  3ODW A;  5J3Y A;  2GS0 A;  5C16 A;  1OMW A;  2CY4 A;  2I5C A;  2YS3 A;  4DBB A;  2G35 A;  1TJ6 A;  2DYN A;  2DX5 A;  2Y8G A;  4GZU A;  1E5W A;  4P7I A;  1ZC4 B;  4DX8 A;  4HB2 B;  4IAP A;  5DH9 B;  3FSS A;  1V89 A;  4F7G A;  4WSF A;  1XOD A;  3O96 A;  5JHH A;  2NMB A;  3MPX A;  2R09 A;  3TO1 A;  4K2P A;  1XKE A;  3SO6 A;  4K17 A;  1WI1 A;  4KVG B;  5J3Q A;  3TW1 A;  2YVC A;  1Y19 B;  1UNP A;  1X05 A;  5DHF B;  2DN6 A;  1DDM A;  2P0H A;  3PVU A;  1QC6 A;  1FB8 A;  3WYF B;  3TVV A;  1I7A A;  3DXE A;  4F7H A;  3PEG A;  4WVF B;  2DLW A;  1Z87 A;  3KRX A;  1RRP B;  3DXD A;  4Z2M B;  4ZRJ A; 
#chains in the Genus database with same CATH topology
 2RGN B;  2RVB B;  1ZVR A;  2CAY A;  1EAZ A;  3P6A A;  4IFS A;  2KIG A;  1N3H A;  2R0D A;  4B6H A;  3KSY A;  1WG7 A;  2I5F A;  4D0N B;  5C79 A;  4HAU B;  1BTK A;  1MIX A;  3G9W A;  2HE7 A;  3PG7 A;  3PSC A;  5DHA B;  3A58 A;  1AQC A;  2D9V A;  2AEH A;  2PZ1 A;  3VOQ A;  2I1J A;  1V88 A;  1X1G A;  2K8E A;  3CXB B;  2ROV A;  4HAX B;  4K2O A;  2Q13 A;  4KAX B;  4QJ4 B;  5JLJ B;  2P8V A;  1WGU A;  2XQN M;  4YON A;  3HW2 B;  4GN1 A;  1PMS A;  4EJN A;  4HSI A;  1FHO A;  3T06 A;  2N0Y A;  4A6H A;  1K5G B;  1BTN A;  1MPH A;  2I1K A;  3KZ1 A;  3NWF A;  2LYD A;  1W1G A;  2L1C A;  4CHM A;  1MIZ B;  5DI9 B;  1H10 A;  4QJ5 B;  1GC7 A;  1V5P A;  2W2W A;  2YT0 A;  2R2Y A;  1QQG A;  5D3W A;  3ZDT A;  1FHX A;  2D10 A;  1KI1 B;  4H8S A;  1PLS A;  2QKL A;  3F0W A;  4HDO A;  1W1D A;  3NWD A;  1M7E A;  4TYZ A;  1WGQ A;  2D11 A;  3N7C A;  2NBV A;  4F7U P;  1Y5O A;  5FI0 A;  4HHV A;  3M1I B;  2COF A;  2X18 A;  5M4Y B;  3BJI A;  2CRF A;  1P5T A;  2YT1 A;  2DX1 A;  2MWN B;  2J0M A;  2IFS A;  5LG4 B;  3ODO A;  4HDQ A;  2DTC A;  2RUK B;  1UEF A;  5HE3 A;  5D3V A;  2COD A;  3TFM A;  1WJ1 A;  3CIK A;  3ULC A;  2YRY A;  5C5B B;  4HAY B;  3A8P A;  5LON B;  3SUZ A;  3OAN A;  1LW3 A;  1DYN A;  3KRW A;  3GYP A;  5EFX A;  2D4Q A;  4GMV A;  1PFJ A;  3GYO A;  3D8D A;  1FHW A;  2P0D A;  1X1F A;  1XR0 B;  2D9Y A;  3LJU X;  1MI1 A;  3OHM B;  4PQ0 A;  5CLL B;  1WJM A;  4KHB B;  2KR0 A;  2NZ8 B;  3V5W A;  3SNH A;  1XCG A;  3QWM A;  1GG3 A;  3D8E A;  3TCA A;  2L2I A;  4C0A A;  3AU4 A;  4KHA A;  2LOX A;  3A8Q A;  4L6E A;  1ZM0 A;  3SYX A;  1UPR A;  3A98 B;  1EF1 A;  2Y7B A;  4QXA B;  1U29 A;  4MK0 A;  4GOU A;  5KQ4 A;  2Z13 A;  2LOZ A;  1OY2 A;  5KCV A;  1V61 A;  1FOE A;  2D2Q A;  3PVW A;  2DHI A;  2RSG A;  4GXB A;  4L1R A;  4CHJ A;  4Z2N A;  4K81 A;  4QJ3 B;  1WVH A;  2OQB A;  2VSZ A;  3RCP A;  2VRW B;  2K2J A;  3B77 A;  1H4R A;  1P3R A;  1KZ7 A;  2DHK A;  2P0F A;  2YF0 A;  4MY6 A;  4A6K A;  1U5G A;  2YT2 A;  3P7Z A;  3HSA A;  2BCJ A;  2LKO A;  5IRS A;  1DRO A;  2GCJ A;  3SV1 A;  2KGX B;  2E2X A;  2LUL A;  2Z59 A;  2D9W A;  4DXA B;  4HAZ B;  4WJ7 A;  4HB0 B;  2UZS A;  4GNK B;  1X11 A;  3AJ4 A;  1TXD A;  2YSZ A;  2DHJ A;  3AU5 A;  4A5K A;  1U2B A;  1BWN A;  4CYE A;  2K00 A;  3PP2 A;  1FGY A;  2Z0P A;  2RNR B;  1SHC A;  4IOY X;  2AL6 A;  2IYB A;  2MKR A;  2W2X D;  2FJU B;  4A6F B;  5FI1 A;  2UZR A;  3U8Z A;  1J0W A;  2Z14 A;  2H7E A;  3NSU A;  4DIX A;  1V5U A;  1KZG A;  2VKI A;  4EKU A;  2EC1 A;  2Z0Q A;  1J19 A;  2ROZ B;  3IVF A;  1X86 A;  4HB4 B;  1FGZ A;  1LB1 A;  5DIF B;  3KY9 A;  5C5B A;  1MKE A;  4D6W A;  3BIN A;  1UPQ A;  1U5F A;  3DCX A;  2MDX A;  2MFQ A;  1IRS A;  2KUP A;  1ZSQ A;  2EMS A;  3F5R A;  2KIE A;  4EMO A;  5C6R A;  2M38 A;  2ELB A;  2YS5 A;  3ML4 A;  1MK7 B;  1GC6 A;  4KHB A;  5CLQ B;  5D3X A;  5KQ1 A;  1B55 A;  4MT7 A;  5D3Y A;  4HAT B;  4YL8 A;  1Q67 A;  1U5E A;  1EGX A;  2ADZ A;  2K49 A;  1DDV A;  1ZYI A;  2COA A;  2KUQ A;  2V76 A;  3DXC A;  3D8F A;  1NU2 A;  2W2X C;  2GJY A;  3FM8 C;  1XD4 A;  3U7D A;  1MK9 B;  4PNK A;  5I2S A;  3QIJ A;  3QBV B;  2J0K A;  2M14 A;  4HAW B;  2DFK A;  2QKM A;  4NSW A;  1I2H A;  5HE0 A;  2CY5 A;  3HIE A;  3PVL A;  4GPT B;  4NY0 A;  1XX0 A;  2ZPY A;  4BBK A;  1FAO A;  5J3T A;  2OTX A;  2DYQ A;  2Z0O A;  1U5D A;  5HE1 A;  2YS1 A;  4ZRI A;  4HB3 B;  2D9Z A;  3NW8 A;  1NTY A;  1ZC3 B;  2HTH B;  2J59 M;  1DBH A;  1BAK A;  5L81 A;  1EVH A;  2DKQ A;  5JP4 A;  1T77 A;  1ISN A;  1NTV A;  5GOW B;  5D27 A;  1OQN A;  5HE2 A;  4KHO A;  1K5D B;  2DKP A;  2EJ8 A;  4OSN A;  2N23 A;  5LOP B;  3U12 A;  1UNR A;  1AWE A;  2JP2 A;  3FEH A;  2DA0 A;  2UVM A;  3UZT A;  3ULB A;  2H7D A;  3WA0 A;  3ZVR A;  1SGH A;  1UNQ A;  3HQC A;  2LG1 A;  1TQZ A;  2RRF A;  3ODX A;  3HK0 A;  1U27 A;  1V5M A;  2COC A;  4DX9 0;  4A6F A;  3PZD A;  1DDW A;  2Y8F A;  3NWA A;  4XWX A;  2GUM A;  2ELA A;  4ZRK A;  1M7R A;  2KCJ A;  4TKN A;  2D9X A;  1MAI A;  1P6S A;  2EMT A;  3MDB C;  2K2U A;  4OT1 A;  4GMX B;  4HAV B;  1RJ2 A;  5JHG A;  2GCL A;  2RLO A;  2J0J A;  1NI2 A;  3VIA A;  3X23 A;  2FJL A;  1W1H A;  4Y94 A;  3ODW A;  5J3Y A;  2GS0 A;  5C16 A;  1OMW A;  2CY4 A;  2I5C A;  2YS3 A;  4DBB A;  2G35 A;  1TJ6 A;  5I2M A;  2DYN A;  2ZKM X;  2DX5 A;  2Y8G A;  4GZU A;  1E5W A;  4P7I A;  1ZC4 B;  4DX8 A;  4HB2 B;  4IAP A;  5DH9 B;  3FSS A;  1V89 A;  4F7G A;  4WSF A;  1XOD A;  3O96 A;  5JHH A;  2NMB A;  3MPX A;  2R09 A;  3TO1 A;  4K2P A;  1XKE A;  3SO6 A;  4K17 A;  1WI1 A;  4KVG B;  5J3Q A;  3TW1 A;  2YVC A;  1Y19 B;  1UNP A;  1X05 A;  3FVC A;  5DHF B;  2DN6 A;  1DDM A;  2P0H A;  3PVU A;  1QC6 A;  4CSQ A;  1FB8 A;  3WYF B;  3TVV A;  1I7A A;  3DXE A;  4F7H A;  3PEG A;  4WVF B;  2DLW A;  1Z87 A;  3KRX A;  1RRP B;  3DXD A;  2Z4D A;  4Z2M B;  4ZRJ A; 
#chains in the Genus database with same CATH homology
 2RGN B;  2RVB B;  1ZVR A;  2CAY A;  1EAZ A;  3P6A A;  4IFS A;  1N3H A;  2R0D A;  4B6H A;  3KSY A;  1WG7 A;  2I5F A;  4D0N B;  5C79 A;  4HAU B;  1BTK A;  1MIX A;  3G9W A;  2HE7 A;  3PG7 A;  3PSC A;  5DHA B;  1AQC A;  2D9V A;  2AEH A;  2PZ1 A;  3VOQ A;  2I1J A;  1V88 A;  1X1G A;  3CXB B;  2ROV A;  4HAX B;  4K2O A;  2Q13 A;  4KAX B;  5JLJ B;  2P8V A;  1WGU A;  2XQN M;  4YON A;  3HW2 B;  4GN1 A;  1PMS A;  4EJN A;  1FHO A;  3T06 A;  2N0Y A;  4A6H A;  1K5G B;  1BTN A;  1MPH A;  2I1K A;  3KZ1 A;  1W1G A;  2L1C A;  2LYD A;  4CHM A;  1MIZ B;  5DI9 B;  1H10 A;  1GC7 A;  1V5P A;  2W2W A;  2YT0 A;  5D3W A;  1QQG A;  3ZDT A;  1FHX A;  2D10 A;  1KI1 B;  4H8S A;  1PLS A;  2QKL A;  3F0W A;  4HDO A;  1W1D A;  1M7E A;  4TYZ A;  1WGQ A;  2D11 A;  3N7C A;  4F7U P;  1Y5O A;  5FI0 A;  4HHV A;  3M1I B;  2COF A;  2X18 A;  3BJI A;  2CRF A;  1P5T A;  2YT1 A;  2DX1 A;  2MWN B;  2J0M A;  2IFS A;  3ODO A;  4HDQ A;  2DTC A;  2RUK B;  1UEF A;  5HE3 A;  5D3V A;  2COD A;  3TFM A;  1WJ1 A;  3CIK A;  3ULC A;  2YRY A;  5C5B B;  4HAY B;  3A8P A;  5LON B;  3SUZ A;  3OAN A;  1LW3 A;  1DYN A;  3KRW A;  3GYP A;  5EFX A;  2D4Q A;  4GMV A;  1PFJ A;  3GYO A;  3D8D A;  1FHW A;  2P0D A;  1X1F A;  1XR0 B;  2D9Y A;  3LJU X;  4PQ0 A;  5CLL B;  1WJM A;  4KHB B;  2NZ8 B;  3V5W A;  3SNH A;  1XCG A;  3QWM A;  1GG3 A;  3D8E A;  3TCA A;  2L2I A;  4C0A A;  3AU4 A;  4KHA A;  2LOX A;  3A8Q A;  4L6E A;  1ZM0 A;  3SYX A;  1UPR A;  3A98 B;  1EF1 A;  2Y7B A;  1U29 A;  4MK0 A;  5KQ4 A;  2LOZ A;  1OY2 A;  5KCV A;  1V61 A;  1FOE A;  2D2Q A;  3PVW A;  2DHI A;  2RSG A;  4GXB A;  4CHJ A;  4Z2N A;  4K81 A;  1WVH A;  2OQB A;  2VSZ A;  3RCP A;  2VRW B;  2K2J A;  1H4R A;  1P3R A;  1KZ7 A;  2DHK A;  2P0F A;  2YF0 A;  4MY6 A;  4A6K A;  1U5G A;  3P7Z A;  2BCJ A;  2LKO A;  1DRO A;  2GCJ A;  3SV1 A;  2KGX B;  2E2X A;  2LUL A;  2D9W A;  4DXA B;  4HAZ B;  4WJ7 A;  4HB0 B;  2UZS A;  1X11 A;  3AJ4 A;  1TXD A;  2YSZ A;  2DHJ A;  3AU5 A;  4A5K A;  1U2B A;  1BWN A;  4CYE A;  2K00 A;  3PP2 A;  1FGY A;  2Z0P A;  2RNR B;  1SHC A;  4IOY X;  2AL6 A;  2IYB A;  2MKR A;  2W2X D;  4A6F B;  5FI1 A;  2UZR A;  3U8Z A;  1J0W A;  2H7E A;  3NSU A;  1V5U A;  1KZG A;  2VKI A;  4EKU A;  2EC1 A;  2Z0Q A;  1J19 A;  2ROZ B;  3IVF A;  1X86 A;  4HB4 B;  1FGZ A;  1LB1 A;  5DIF B;  3KY9 A;  5C5B A;  1MKE A;  3BIN A;  1UPQ A;  1U5F A;  2MDX A;  2MFQ A;  1IRS A;  2KUP A;  1ZSQ A;  2EMS A;  3F5R A;  4EMO A;  5C6R A;  2M38 A;  2ELB A;  2YS5 A;  3ML4 A;  1MK7 B;  1GC6 A;  5CLQ B;  5D3X A;  5KQ1 A;  1B55 A;  4MT7 A;  5D3Y A;  4HAT B;  4YL8 A;  1Q67 A;  1U5E A;  1EGX A;  2ADZ A;  1DDV A;  2COA A;  2V76 A;  3DXC A;  3D8F A;  1NU2 A;  2W2X C;  2GJY A;  3FM8 C;  1XD4 A;  3U7D A;  1MK9 B;  4PNK A;  3QIJ A;  3QBV B;  2J0K A;  2M14 A;  4HAW B;  2DFK A;  2QKM A;  4NSW A;  1I2H A;  5HE0 A;  2CY5 A;  3PVL A;  4GPT B;  4NY0 A;  1XX0 A;  2ZPY A;  4BBK A;  1FAO A;  5J3T A;  2OTX A;  2DYQ A;  2Z0O A;  1U5D A;  5HE1 A;  2YS1 A;  4ZRI A;  4HB3 B;  2D9Z A;  1NTY A;  1ZC3 B;  2HTH B;  2J59 M;  1DBH A;  1BAK A;  5L81 A;  1EVH A;  2DKQ A;  5JP4 A;  1ISN A;  1NTV A;  5GOW B;  5D27 A;  1OQN A;  5HE2 A;  4KHO A;  1K5D B;  2DKP A;  2EJ8 A;  2N23 A;  5LOP B;  1UNR A;  1AWE A;  2JP2 A;  3FEH A;  2DA0 A;  2UVM A;  3UZT A;  3ULB A;  2H7D A;  3WA0 A;  3ZVR A;  1SGH A;  1UNQ A;  3HQC A;  2LG1 A;  1TQZ A;  3ODX A;  3HK0 A;  1U27 A;  1V5M A;  2COC A;  4DX9 0;  4A6F A;  3PZD A;  1DDW A;  2Y8F A;  4XWX A;  2ELA A;  4ZRK A;  1M7R A;  2KCJ A;  4TKN A;  2D9X A;  1MAI A;  1P6S A;  2EMT A;  3MDB C;  2K2U A;  4GMX B;  4HAV B;  1RJ2 A;  5JHG A;  2GCL A;  2RLO A;  2J0J A;  1NI2 A;  3VIA A;  3X23 A;  2FJL A;  1W1H A;  4Y94 A;  3ODW A;  5J3Y A;  2GS0 A;  5C16 A;  1OMW A;  2CY4 A;  2I5C A;  2YS3 A;  4DBB A;  2G35 A;  1TJ6 A;  2DYN A;  2DX5 A;  2Y8G A;  4GZU A;  1E5W A;  4P7I A;  1ZC4 B;  4DX8 A;  4HB2 B;  4IAP A;  5DH9 B;  3FSS A;  1V89 A;  4F7G A;  4WSF A;  1XOD A;  3O96 A;  5JHH A;  2NMB A;  3MPX A;  2R09 A;  3TO1 A;  4K2P A;  1XKE A;  3SO6 A;  4K17 A;  1WI1 A;  4KVG B;  5J3Q A;  3TW1 A;  2YVC A;  1Y19 B;  1UNP A;  1X05 A;  5DHF B;  2DN6 A;  1DDM A;  2P0H A;  3PVU A;  1QC6 A;  1FB8 A;  3WYF B;  3TVV A;  1I7A A;  3DXE A;  4F7H A;  3PEG A;  4WVF B;  2DLW A;  1Z87 A;  3KRX A;  1RRP B;  3DXD A;  4Z2M B;  4ZRJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...