2YS3A

Solution structure of the ph domain of kindlin-3 from human
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
137
structure length
137
Chain Sequence
GSSGSSGIPELKDHLRIFRPRKLTLKGYRQHWVVFKETTLSYYKSQDEAPGDPIQQLNLKGCEVVPDVNVSGQKFCIKLLVPSPEGMSEIYLRCQDEQQYARWMAGCRLASKGRTMADSSYTSEVQAILAFLSLQRT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords Unc-112-related protein 2
publication title Solution structure of the PH domain of Kindlin-3 from human
rcsb
source organism Homo sapiens
total genus 21
structure length 137
sequence length 137
ec nomenclature
pdb deposition date 2007-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00169 PH PH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2ys3A00
2JP2A 5C79A 1ZVRA 4C0AA 3T06A 2K2JA 2OTXA 2YF0A 4KAXB 1ZM0A 5C6RA 4GZUA 1N3HA 2KGXB 1XR0B 1UNRA 2ELAA 3A8QA 1M7EA 1WGUA 2V76A 4K2OA 1ISNA 3AU5A 1GG3A 1X1GA 1U27A 2RSGA 3DXEA 4HAVB 1QC6A 1KI1B 2D11A 3TW1A 1WG7A 2DLWA 1BAKA 4HAYB 2J59M 1V5MA 3VIAA 1MK9B 3D8FA 4HAZB 4ZRKA 3ZVRA 4GXBA 2K00A 2Y8GA 1Y19B 1MAIA 1BWNA 5FI0A 5C5BB 2DTCA 5C5BA 3HK0A 4NY0A 2X18A 2Y7BA 1UPRA 3UZTA 1K5DB 3DXDA 1P3RA 2DKPA 1MIXA 1DDVA 1X86A 1NTVA 3SYXA 2GCLA 2DHJA 2UVMA 2OQBA 2P0DA 2R09A 4EKUA 1FHXA 1Y5OA 3SV1A 5JLJB 5J3TA 4Y94A 2XQNM 1W1GA 2UZSA 1RJ2A 3QWMA 5HE1A 2D9XA 4KVGB 3GYOA 5JHHA 1AWEA 4HHVA 3TVVA 1H10A 2AEHA 2I5CA 2DYQA 3P6AA 4L6EA 1X05A 1IRSA 1WJMA 2I1KA 3PEGA 4D0NB 1ZC3B 2RNRB 3PSCA 1V5UA 2COAA 2M38A 4Z2MB 2D9VA 2YVCA 1EF1A 2QKMA 4CHMA 1V88A 4A5KA 1NTYA 2ZPYA 1W1DA 2VRWB 2LOZA 4A6HA 1XD4A 1XODA 2D9ZA 5GOWB 2RGNB 2L1CA 4KHBB 3BINA 3WYFB 1RRPB 3D8DA 2D4QA 1I2HA 2ADZA 3KY9A 5KCVA 2CRFA 4HAWB 2H7DA 3GYPA 4HDOA 3PVLA 2YS5A 4HDQA 4YONA 1DBHA 5KQ4A 1FHOA 3TCAA 2AL6A 3VOQA 1PMSA 2LULA 4Z2NA 5D3VA 1MIZB 3LJUX 1X11A 3M1IB 4HATB 3PVWA 1MKEA 4KHAA 1U5EA 2Z0OA 2YSZA 1FHWA 2IFSA 1UNQA 1K5GB 1EGXA 2NMBA 5DHAB 2DA0A 1FAOA 4EMOA 2ROVA 2Q13A 2GCJA 5HE3A 2Z0QA 2P0HA 2H7EA 4PQ0A 2UZRA 2COCA 3A8PA 4HB0B 4H8SA 1U29A 4MK0A 3SO6A 1FGZA 4A6KA 2YS1A 2PZ1A 2IYBA 4WJ7A 3U8ZA 2LYDA 2DX5A 4F7HA 2GS0A 1EAZA 3PVUA 3KSYA 3QBVB 2KUPA 4BBKA 2R0DA 2MKRA 1WGQA 1XKEA 3MPXA 5DH9B 1TQZA 2M14A 2NZ8B 3G9WA 1I7AA 5JP4A 3F0WA 1AQCA 3ULBA 4EJNA 3IVFA 4K2PA 4B6HA 3HW2B 1DYNA 4K81A 4IFSA 3AU4A 2D10A 1ZSQA 2G35A 1V5PA 1MK7B 2VSZA 2CY4A 2QKLA 1FGYA 4GN1A 4MT7A 1P5TA 2CAYA 2EC1A 1KZ7A 3SNHA 2Y8FA 5LONB 1E5WA 1SHCA 3X23A 1OMWA 5DI9B 2L2IA 1EVHA 2VKIA 5D27A 3O96A 3BJIA 5HE2A 3FSSA 1WI1A 2EMTA 1NI2A 3A98B 4GMXB 1PFJA 2P8VA 3SUZA 3F5RA 1OY2A 2YT1A 2DKQA 1XCGA 4TKNA 4CYEA 2GJYA 4KHOA 2W2WA 3PG7A 5D3XA 1X1FA 3PZDA 3V5WA 5DIFB 2W2XC 1UNPA 3KRWA 5EFXA 1GC6A 1H4RA 2N0YA 1U5GA 1B55A 3PP2A 3MDBC 3ZDTA 1J0WA 2I1JA 2DX1A 2D2QA 3FM8C 4HB4B 4IAPA 4HAUB 4F7UP 2MFQA 1BTNA 1Z87A 3ODWA 1UPQA 4DX90 1U5FA 2I5FA 5KQ1A 3ODOA 5J3QA 1WVHA 1XX0A 3P7ZA 2DHIA 1SGHA 4F7GA 4MY6A 2KCJA 2RVBB 2W2XD 2K2UA 1OQNA 3ULCA 4ZRIA 3D8EA 1TJ6A 2DN6A 1DDWA 1LB1A 1TXDA 2E2XA 2LKOA 3KZ1A 4GMVA 2P0FA 1DROA 2CODA 4PNKA 4P7IA 5D3WA 4DX8A 1M7RA 1P6SA 3WA0A 2YT0A 2DHKA 5L81A 2ROZB 2D9WA 4NSWA 5DHFB 3TO1A 2DFKA 1W1HA 4YL8A 2J0JA 2MWNB 1V61A 5LOPB 5CLQB 2J0MA 1BTKA 5D3YA 1QQGA 2J0KA 5JHGA 1U5DA 2D9YA 4XWXA 2COFA 3FEHA 2EMSA 5FI1A 2FJLA 4HB3B 1DDMA 2ELBA 3DXCA 3KRXA 4ZRJA 4CHJA 1WJ1A 3OANA 2MDXA 3N7CA 1GC7A 2N23A 4GPTB 1V89A 3NSUA 4K17A 2LOXA 4DBBA 3AJ4A 3QIJA 2YS3A 1LW3A 2RLOA 1KZGA 1UEFA 2HE7A 3CIKA 5J3YA 2RUKB 3HQCA 5HE0A 4DXAB 4HAXB 3TFMA 2YRYA 1MPHA 4TYZA 2HTHB 1FB8A 2LG1A 1U2BA 1ZC4B 2EJ8A 3CXBB 2Z0PA 2CY5A 4A6FB 1Q67A 1PLSA 3RCPA 1FOEA 4IOYX 4A6FA 4HB2B 3ML4A 1J19A 5C16A 3U7DA 2DYNA 4WVFB 1NU2A 5CLLB 3ODXA 2BCJA 4WSFA
chains in the Genus database with same CATH superfamily
2JP2A 5C79A 1ZVRA 4C0AA 1T77A 3T06A 2K2JA 2OTXA 2YF0A 4KAXB 1ZM0A 5C6RA 4GZUA 1N3HA 2KGXB 1XR0B 1UNRA 2ELAA 3A8QA 1M7EA 1WGUA 2V76A 4K2OA 1ISNA 3AU5A 1GG3A 1X1GA 1U27A 2RSGA 3DXEA 4HAVB 1QC6A 1KI1B 2D11A 3TW1A 1WG7A 2DLWA 1BAKA 4HAYB 2J59M 1V5MA 3VIAA 1MK9B 3D8FA 4HAZB 4ZRKA 3ZVRA 4GXBA 2K00A 2Y8GA 1Y19B 1MAIA 1BWNA 5FI0A 5C5BB 2DTCA 5C5BA 3HK0A 4NY0A 2X18A 2Y7BA 1UPRA 3UZTA 1K5DB 3DXDA 1P3RA 2RRFA 2DKPA 1MIXA 1DDVA 1X86A 2GUMA 1NTVA 3SYXA 2GCLA 2DHJA 2UVMA 2OQBA 4OSNA 3U12A 2P0DA 2R09A 4EKUA 1FHXA 1Y5OA 3SV1A 5JLJB 5J3TA 4Y94A 2XQNM 1W1GA 2UZSA 1RJ2A 3QWMA 5HE1A 2D9XA 4KVGB 3GYOA 5JHHA 1AWEA 4HHVA 3TVVA 1H10A 2AEHA 2I5CA 2DYQA 3P6AA 2KR0A 4L6EA 1X05A 1IRSA 1WJMA 2I1KA 3PEGA 4D0NB 1ZC3B 2RNRB 3PSCA 1V5UA 2COAA 2M38A 4Z2MB 4HSIA 2D9VA 2YVCA 1EF1A 2QKMA 4CHMA 1V88A 4A5KA 1NTYA 2ZPYA 1W1DA 2VRWB 2LOZA 4A6HA 1XD4A 1XODA 2D9ZA 5GOWB 2RGNB 2KUQA 2L1CA 4KHBB 3BINA 4L1RA 2NBVA 4KHBA 3WYFB 1RRPB 3D8DA 2D4QA 1I2HA 2ADZA 3KY9A 5KCVA 2CRFA 4HAWB 2H7DA 3GYPA 4HDOA 3PVLA 2YS5A 4HDQA 4YONA 1DBHA 5KQ4A 4QJ5B 1FHOA 3TCAA 2AL6A 3VOQA 1PMSA 2LULA 4Z2NA 5IRSA 5D3VA 1MIZB 3LJUX 1X11A 3M1IB 4HATB 2FJUB 3PVWA 1MKEA 4KHAA 1U5EA 2Z0OA 2YSZA 1FHWA 2IFSA 1UNQA 1K5GB 1EGXA 2NMBA 5DHAB 2DA0A 1FAOA 4EMOA 2ROVA 5LG4B 2Q13A 2GCJA 5HE3A 2Z0QA 2P0HA 2H7EA 4PQ0A 2UZRA 2COCA 3A8PA 4HB0B 4H8SA 1U29A 4MK0A 3SO6A 1FGZA 4A6KA 2YS1A 2PZ1A 2IYBA 2K49A 1ZYIA 4WJ7A 2LYDA 2DX5A 3U8ZA 4F7HA 2GS0A 1EAZA 2KIEA 3KSYA 3PVUA 3QBVB 2KUPA 4BBKA 2Z59A 2R0DA 2MKRA 1WGQA 1XKEA 3MPXA 5DH9B 1TQZA 2M14A 2NZ8B 3G9WA 1I7AA 5JP4A 3F0WA 1AQCA 2Z4DA 3ULBA 5M4YB 3HSAA 4EJNA 3IVFA 4K2PA 4B6HA 3HW2B 1DYNA 4K81A 3FVCA 4IFSA 3AU4A 2D10A 1ZSQA 2G35A 1V5PA 1MK7B 2VSZA 2CY4A 2QKLA 1FGYA 4GN1A 4MT7A 1P5TA 2CAYA 2EC1A 1KZ7A 3SNHA 2Y8FA 5LONB 1E5WA 1SHCA 3X23A 1OMWA 5DI9B 2L2IA 1EVHA 2VKIA 5D27A 3O96A 3BJIA 2YT2A 5HE2A 3FSSA 1WI1A 2EMTA 1NI2A 3A98B 4GMXB 1PFJA 2P8VA 3NWDA 4D6WA 3SUZA 3F5RA 1OY2A 2YT1A 2DKQA 1XCGA 4TKNA 4CYEA 3HIEA 2GJYA 4KHOA 2W2WA 3PG7A 5D3XA 1X1FA 3PZDA 3V5WA 5DIFB 2W2XC 1UNPA 3KRWA 5EFXA 1GC6A 1H4RA 2N0YA 1U5GA 1B55A 3PP2A 3MDBC 5I2SA 3ZDTA 4GNKB 1J0WA 2I1JA 2DX1A 2D2QA 3FM8C 4HB4B 4IAPA 4HAUB 4F7UP 2MFQA 1BTNA 1Z87A 3ODWA 3DCXA 1UPQA 4DX90 1U5FA 2I5FA 5KQ1A 3ODOA 5J3QA 1WVHA 1XX0A 3P7ZA 2DHIA 1SGHA 4F7GA 4MY6A 2KCJA 2RVBB 2W2XD 2K2UA 1OQNA 3ULCA 4ZRIA 3D8EA 1TJ6A 2DN6A 1DDWA 1LB1A 1TXDA 2E2XA 2LKOA 3KZ1A 4GMVA 2P0FA 1DROA 2CODA 4PNKA 4P7IA 5D3WA 4DX8A 1M7RA 1P6SA 3WA0A 2YT0A 2DHKA 5L81A 2ROZB 2D9WA 4NSWA 5DHFB 2R2YA 3TO1A 2DFKA 1W1HA 4YL8A 2J0JA 2MWNB 1V61A 4GOUA 5LOPB 5CLQB 2J0MA 1BTKA 4DIXA 4QJ3B 5D3YA 1QQGA 2J0KA 5JHGA 1U5DA 2D9YA 2Z14A 4XWXA 2COFA 3FEHA 2EMSA 5FI1A 2FJLA 4HB3B 1DDMA 2ELBA 3DXCA 3KRXA 4ZRJA 4CHJA 1WJ1A 3NWAA 2Z13A 3OANA 2MDXA 3NW8A 3N7CA 1GC7A 2N23A 4GPTB 3OHMB 4QXAB 1MI1A 1V89A 3NSUA 2KIGA 4K17A 2LOXA 2K8EA 4DBBA 3AJ4A 3QIJA 2YS3A 1LW3A 2RLOA 1KZGA 4OT1A 1UEFA 2HE7A 3CIKA 5I2MA 5J3YA 2RUKB 3HQCA 5HE0A 4DXAB 4HAXB 3TFMA 2YRYA 1MPHA 4CSQA 4TYZA 2HTHB 1FB8A 2LG1A 1U2BA 2ZKMX 1ZC4B 2EJ8A 3CXBB 2Z0PA 2CY5A 4A6FB 1Q67A 1PLSA 3RCPA 1FOEA 4IOYX 4A6FA 4HB2B 3ML4A 1J19A 5C16A 4QJ4B 3NWFA 3U7DA 2DYNA 4WVFB 3B77A 3A58A 1NU2A 5CLLB 3ODXA 2BCJA 4WSFA
chains in the Genus database with same CATH topology
2JP2A 5C79A 1ZVRA 4C0AA 3T06A 2K2JA 2OTXA 2YF0A 4KAXB 1ZM0A 5C6RA 4GZUA 1N3HA 2KGXB 1XR0B 1UNRA 2ELAA 3A8QA 1M7EA 1WGUA 2V76A 4K2OA 1ISNA 3AU5A 1GG3A 1X1GA 1U27A 2RSGA 3DXEA 4HAVB 1QC6A 1KI1B 2D11A 3TW1A 1WG7A 2DLWA 1BAKA 4HAYB 2J59M 1V5MA 3VIAA 1MK9B 3D8FA 4HAZB 4ZRKA 3ZVRA 4GXBA 2K00A 2Y8GA 1Y19B 1MAIA 1BWNA 5FI0A 5C5BB 2DTCA 5C5BA 3HK0A 4NY0A 2X18A 2Y7BA 1UPRA 3UZTA 1K5DB 3DXDA 1P3RA 2DKPA 1MIXA 1DDVA 1X86A 1NTVA 3SYXA 2GCLA 2DHJA 2UVMA 2OQBA 2P0DA 2R09A 4EKUA 1FHXA 1Y5OA 3SV1A 5JLJB 5J3TA 4Y94A 2XQNM 1W1GA 2UZSA 1RJ2A 3QWMA 5HE1A 2D9XA 4KVGB 3GYOA 5JHHA 1AWEA 4HHVA 3TVVA 1H10A 2AEHA 2I5CA 2DYQA 3P6AA 4L6EA 1X05A 1IRSA 1WJMA 2I1KA 3PEGA 4D0NB 1ZC3B 2RNRB 3PSCA 1V5UA 2COAA 2M38A 4Z2MB 2D9VA 2YVCA 1EF1A 2QKMA 4CHMA 1V88A 4A5KA 1NTYA 2ZPYA 1W1DA 2VRWB 2LOZA 4A6HA 1XD4A 1XODA 2D9ZA 5GOWB 2RGNB 2L1CA 4KHBB 3BINA 3WYFB 1RRPB 3D8DA 2D4QA 1I2HA 2ADZA 3KY9A 5KCVA 2CRFA 4HAWB 2H7DA 3GYPA 4HDOA 3PVLA 2YS5A 4HDQA 4YONA 1DBHA 5KQ4A 1FHOA 3TCAA 2AL6A 3VOQA 1PMSA 2LULA 4Z2NA 5D3VA 1MIZB 3LJUX 1X11A 3M1IB 4HATB 3PVWA 1MKEA 4KHAA 1U5EA 2Z0OA 2YSZA 1FHWA 2IFSA 1UNQA 1K5GB 1EGXA 2NMBA 5DHAB 2DA0A 1FAOA 4EMOA 2ROVA 2Q13A 2GCJA 5HE3A 2Z0QA 2P0HA 2H7EA 4PQ0A 2UZRA 2COCA 3A8PA 4HB0B 4H8SA 1U29A 4MK0A 3SO6A 1FGZA 4A6KA 2YS1A 2PZ1A 2IYBA 4WJ7A 3U8ZA 2LYDA 2DX5A 4F7HA 2GS0A 1EAZA 3PVUA 3KSYA 3QBVB 2KUPA 4BBKA 2R0DA 2MKRA 1WGQA 1XKEA 3MPXA 5DH9B 1TQZA 2M14A 2NZ8B 3G9WA 1I7AA 5JP4A 3F0WA 1AQCA 3ULBA 4EJNA 3IVFA 4K2PA 4B6HA 3HW2B 1DYNA 4K81A 4IFSA 3AU4A 2D10A 1ZSQA 2G35A 1V5PA 1MK7B 2VSZA 2CY4A 2QKLA 1FGYA 4GN1A 4MT7A 1P5TA 2CAYA 2EC1A 1KZ7A 3SNHA 2Y8FA 5LONB 1E5WA 1SHCA 3X23A 1OMWA 5DI9B 2L2IA 1EVHA 2VKIA 5D27A 3O96A 3BJIA 5HE2A 3FSSA 1WI1A 2EMTA 1NI2A 3A98B 4GMXB 1PFJA 2P8VA 3SUZA 3F5RA 1OY2A 2YT1A 2DKQA 1XCGA 4TKNA 4CYEA 2GJYA 4KHOA 2W2WA 3PG7A 5D3XA 1X1FA 3PZDA 3V5WA 5DIFB 2W2XC 1UNPA 3KRWA 5EFXA 1GC6A 1H4RA 2N0YA 1U5GA 1B55A 3PP2A 3MDBC 3ZDTA 1J0WA 2I1JA 2DX1A 2D2QA 3FM8C 4HB4B 4IAPA 4HAUB 4F7UP 2MFQA 1BTNA 1Z87A 3ODWA 1UPQA 4DX90 1U5FA 2I5FA 5KQ1A 3ODOA 5J3QA 1WVHA 1XX0A 3P7ZA 2DHIA 1SGHA 4F7GA 4MY6A 2KCJA 2RVBB 2W2XD 2K2UA 1OQNA 3ULCA 4ZRIA 3D8EA 1TJ6A 2DN6A 1DDWA 1LB1A 1TXDA 2E2XA 2LKOA 3KZ1A 4GMVA 2P0FA 1DROA 2CODA 4PNKA 4P7IA 5D3WA 4DX8A 1M7RA 1P6SA 3WA0A 2YT0A 2DHKA 5L81A 2ROZB 2D9WA 4NSWA 5DHFB 3TO1A 2DFKA 1W1HA 4YL8A 2J0JA 2MWNB 1V61A 5LOPB 5CLQB 2J0MA 1BTKA 5D3YA 1QQGA 2J0KA 5JHGA 1U5DA 2D9YA 4XWXA 2COFA 3FEHA 2EMSA 5FI1A 2FJLA 4HB3B 1DDMA 2ELBA 3DXCA 3KRXA 4ZRJA 4CHJA 1WJ1A 3OANA 2MDXA 3N7CA 1GC7A 2N23A 4GPTB 1V89A 3NSUA 4K17A 2LOXA 4DBBA 3AJ4A 3QIJA 2YS3A 1LW3A 2RLOA 1KZGA 1UEFA 2HE7A 3CIKA 5J3YA 2RUKB 3HQCA 5HE0A 4DXAB 4HAXB 3TFMA 2YRYA 1MPHA 4TYZA 2HTHB 1FB8A 2LG1A 1U2BA 1ZC4B 2EJ8A 3CXBB 2Z0PA 2CY5A 4A6FB 1Q67A 1PLSA 3RCPA 1FOEA 4IOYX 4A6FA 4HB2B 3ML4A 1J19A 5C16A 3U7DA 2DYNA 4WVFB 1NU2A 5CLLB 3ODXA 2BCJA 4WSFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JP2 A;  5C79 A;  1ZVR A;  4C0A A;  3T06 A;  2K2J A;  2OTX A;  2YF0 A;  4KAX B;  1ZM0 A;  5C6R A;  4GZU A;  1N3H A;  2KGX B;  1XR0 B;  1UNR A;  2ELA A;  3A8Q A;  1M7E A;  1WGU A;  2V76 A;  4K2O A;  1ISN A;  3AU5 A;  1GG3 A;  1X1G A;  1U27 A;  2RSG A;  3DXE A;  4HAV B;  1QC6 A;  1KI1 B;  2D11 A;  3TW1 A;  1WG7 A;  2DLW A;  1BAK A;  4HAY B;  2J59 M;  1V5M A;  3VIA A;  1MK9 B;  3D8F A;  4HAZ B;  4ZRK A;  3ZVR A;  4GXB A;  2K00 A;  2Y8G A;  1Y19 B;  1MAI A;  1BWN A;  5FI0 A;  5C5B B;  2DTC A;  5C5B A;  3HK0 A;  4NY0 A;  2X18 A;  2Y7B A;  1UPR A;  3UZT A;  1K5D B;  3DXD A;  1P3R A;  2DKP A;  1MIX A;  1DDV A;  1X86 A;  1NTV A;  3SYX A;  2GCL A;  2DHJ A;  2UVM A;  2OQB A;  2P0D A;  2R09 A;  4EKU A;  1FHX A;  1Y5O A;  3SV1 A;  5JLJ B;  5J3T A;  4Y94 A;  2XQN M;  1W1G A;  2UZS A;  1RJ2 A;  3QWM A;  5HE1 A;  2D9X A;  4KVG B;  3GYO A;  5JHH A;  1AWE A;  4HHV A;  3TVV A;  1H10 A;  2AEH A;  2I5C A;  2DYQ A;  3P6A A;  4L6E A;  1X05 A;  1IRS A;  1WJM A;  2I1K A;  3PEG A;  4D0N B;  1ZC3 B;  2RNR B;  3PSC A;  1V5U A;  2COA A;  2M38 A;  4Z2M B;  2D9V A;  2YVC A;  1EF1 A;  2QKM A;  4CHM A;  1V88 A;  4A5K A;  1NTY A;  2ZPY A;  1W1D A;  2VRW B;  2LOZ A;  4A6H A;  1XD4 A;  1XOD A;  2D9Z A;  5GOW B;  2RGN B;  2L1C A;  4KHB B;  3BIN A;  3WYF B;  1RRP B;  3D8D A;  2D4Q A;  1I2H A;  2ADZ A;  3KY9 A;  5KCV A;  2CRF A;  4HAW B;  2H7D A;  3GYP A;  4HDO A;  3PVL A;  2YS5 A;  4HDQ A;  4YON A;  1DBH A;  5KQ4 A;  1FHO A;  3TCA A;  2AL6 A;  3VOQ A;  1PMS A;  2LUL A;  4Z2N A;  5D3V A;  1MIZ B;  3LJU X;  1X11 A;  3M1I B;  4HAT B;  3PVW A;  1MKE A;  4KHA A;  1U5E A;  2Z0O A;  2YSZ A;  1FHW A;  2IFS A;  1UNQ A;  1K5G B;  1EGX A;  2NMB A;  5DHA B;  2DA0 A;  1FAO A;  4EMO A;  2ROV A;  2Q13 A;  2GCJ A;  5HE3 A;  2Z0Q A;  2P0H A;  2H7E A;  4PQ0 A;  2UZR A;  2COC A;  3A8P A;  4HB0 B;  4H8S A;  1U29 A;  4MK0 A;  3SO6 A;  1FGZ A;  4A6K A;  2YS1 A;  2PZ1 A;  2IYB A;  4WJ7 A;  3U8Z A;  2LYD A;  2DX5 A;  4F7H A;  2GS0 A;  1EAZ A;  3PVU A;  3KSY A;  3QBV B;  2KUP A;  4BBK A;  2R0D A;  2MKR A;  1WGQ A;  1XKE A;  3MPX A;  5DH9 B;  1TQZ A;  2M14 A;  2NZ8 B;  3G9W A;  1I7A A;  5JP4 A;  3F0W A;  1AQC A;  3ULB A;  4EJN A;  3IVF A;  4K2P A;  4B6H A;  3HW2 B;  1DYN A;  4K81 A;  4IFS A;  3AU4 A;  2D10 A;  1ZSQ A;  2G35 A;  1V5P A;  1MK7 B;  2VSZ A;  2CY4 A;  2QKL A;  1FGY A;  4GN1 A;  4MT7 A;  1P5T A;  2CAY A;  2EC1 A;  1KZ7 A;  3SNH A;  2Y8F A;  5LON B;  1E5W A;  1SHC A;  3X23 A;  1OMW A;  5DI9 B;  2L2I A;  1EVH A;  2VKI A;  5D27 A;  3O96 A;  3BJI A;  5HE2 A;  3FSS A;  1WI1 A;  2EMT A;  1NI2 A;  3A98 B;  4GMX B;  1PFJ A;  2P8V A;  3SUZ A;  3F5R A;  1OY2 A;  2YT1 A;  2DKQ A;  1XCG A;  4TKN A;  4CYE A;  2GJY A;  4KHO A;  2W2W A;  3PG7 A;  5D3X A;  1X1F A;  3PZD A;  3V5W A;  5DIF B;  2W2X C;  1UNP A;  3KRW A;  5EFX A;  1GC6 A;  1H4R A;  2N0Y A;  1U5G A;  1B55 A;  3PP2 A;  3MDB C;  3ZDT A;  1J0W A;  2I1J A;  2DX1 A;  2D2Q A;  3FM8 C;  4HB4 B;  4IAP A;  4HAU B;  4F7U P;  2MFQ A;  1BTN A;  1Z87 A;  3ODW A;  1UPQ A;  4DX9 0;  1U5F A;  2I5F A;  5KQ1 A;  3ODO A;  5J3Q A;  1WVH A;  1XX0 A;  3P7Z A;  2DHI A;  1SGH A;  4F7G A;  4MY6 A;  2KCJ A;  2RVB B;  2W2X D;  2K2U A;  1OQN A;  3ULC A;  4ZRI A;  3D8E A;  1TJ6 A;  2DN6 A;  1DDW A;  1LB1 A;  1TXD A;  2E2X A;  2LKO A;  3KZ1 A;  4GMV A;  2P0F A;  1DRO A;  2COD A;  4PNK A;  4P7I A;  5D3W A;  4DX8 A;  1M7R A;  1P6S A;  3WA0 A;  2YT0 A;  2DHK A;  5L81 A;  2ROZ B;  2D9W A;  4NSW A;  5DHF B;  3TO1 A;  2DFK A;  1W1H A;  4YL8 A;  2J0J A;  2MWN B;  1V61 A;  5LOP B;  5CLQ B;  2J0M A;  1BTK A;  5D3Y A;  1QQG A;  2J0K A;  5JHG A;  1U5D A;  2D9Y A;  4XWX A;  2COF A;  3FEH A;  2EMS A;  5FI1 A;  2FJL A;  4HB3 B;  1DDM A;  2ELB A;  3DXC A;  3KRX A;  4ZRJ A;  4CHJ A;  1WJ1 A;  3OAN A;  2MDX A;  3N7C A;  1GC7 A;  2N23 A;  4GPT B;  1V89 A;  3NSU A;  4K17 A;  2LOX A;  4DBB A;  3AJ4 A;  3QIJ A;  2YS3 A;  1LW3 A;  2RLO A;  1KZG A;  1UEF A;  2HE7 A;  3CIK A;  5J3Y A;  2RUK B;  3HQC A;  5HE0 A;  4DXA B;  4HAX B;  3TFM A;  2YRY A;  1MPH A;  4TYZ A;  2HTH B;  1FB8 A;  2LG1 A;  1U2B A;  1ZC4 B;  2EJ8 A;  3CXB B;  2Z0P A;  2CY5 A;  4A6F B;  1Q67 A;  1PLS A;  3RCP A;  1FOE A;  4IOY X;  4A6F A;  4HB2 B;  3ML4 A;  1J19 A;  5C16 A;  3U7D A;  2DYN A;  4WVF B;  1NU2 A;  5CLL B;  3ODX A;  2BCJ A;  4WSF A; 
#chains in the Genus database with same CATH topology
 2JP2 A;  5C79 A;  1ZVR A;  4C0A A;  1T77 A;  3T06 A;  2K2J A;  2OTX A;  2YF0 A;  4KAX B;  1ZM0 A;  5C6R A;  4GZU A;  1N3H A;  2KGX B;  1XR0 B;  1UNR A;  2ELA A;  3A8Q A;  1M7E A;  1WGU A;  2V76 A;  4K2O A;  1ISN A;  3AU5 A;  1GG3 A;  1X1G A;  1U27 A;  2RSG A;  3DXE A;  4HAV B;  1QC6 A;  1KI1 B;  2D11 A;  3TW1 A;  1WG7 A;  2DLW A;  1BAK A;  4HAY B;  2J59 M;  1V5M A;  3VIA A;  1MK9 B;  3D8F A;  4HAZ B;  4ZRK A;  3ZVR A;  4GXB A;  2K00 A;  2Y8G A;  1Y19 B;  1MAI A;  1BWN A;  5FI0 A;  5C5B B;  2DTC A;  5C5B A;  3HK0 A;  4NY0 A;  2X18 A;  2Y7B A;  1UPR A;  3UZT A;  1K5D B;  3DXD A;  1P3R A;  2RRF A;  2DKP A;  1MIX A;  1DDV A;  1X86 A;  2GUM A;  1NTV A;  3SYX A;  2GCL A;  2DHJ A;  2UVM A;  2OQB A;  4OSN A;  3U12 A;  2P0D A;  2R09 A;  4EKU A;  1FHX A;  1Y5O A;  3SV1 A;  5JLJ B;  5J3T A;  4Y94 A;  2XQN M;  1W1G A;  2UZS A;  1RJ2 A;  3QWM A;  5HE1 A;  2D9X A;  4KVG B;  3GYO A;  5JHH A;  1AWE A;  4HHV A;  3TVV A;  1H10 A;  2AEH A;  2I5C A;  2DYQ A;  3P6A A;  2KR0 A;  4L6E A;  1X05 A;  1IRS A;  1WJM A;  2I1K A;  3PEG A;  4D0N B;  1ZC3 B;  2RNR B;  3PSC A;  1V5U A;  2COA A;  2M38 A;  4Z2M B;  4HSI A;  2D9V A;  2YVC A;  1EF1 A;  2QKM A;  4CHM A;  1V88 A;  4A5K A;  1NTY A;  2ZPY A;  1W1D A;  2VRW B;  2LOZ A;  4A6H A;  1XD4 A;  1XOD A;  2D9Z A;  5GOW B;  2RGN B;  2KUQ A;  2L1C A;  4KHB B;  3BIN A;  4L1R A;  2NBV A;  4KHB A;  3WYF B;  1RRP B;  3D8D A;  2D4Q A;  1I2H A;  2ADZ A;  3KY9 A;  5KCV A;  2CRF A;  4HAW B;  2H7D A;  3GYP A;  4HDO A;  3PVL A;  2YS5 A;  4HDQ A;  4YON A;  1DBH A;  5KQ4 A;  4QJ5 B;  1FHO A;  3TCA A;  2AL6 A;  3VOQ A;  1PMS A;  2LUL A;  4Z2N A;  5IRS A;  5D3V A;  1MIZ B;  3LJU X;  1X11 A;  3M1I B;  4HAT B;  2FJU B;  3PVW A;  1MKE A;  4KHA A;  1U5E A;  2Z0O A;  2YSZ A;  1FHW A;  2IFS A;  1UNQ A;  1K5G B;  1EGX A;  2NMB A;  5DHA B;  2DA0 A;  1FAO A;  4EMO A;  2ROV A;  5LG4 B;  2Q13 A;  2GCJ A;  5HE3 A;  2Z0Q A;  2P0H A;  2H7E A;  4PQ0 A;  2UZR A;  2COC A;  3A8P A;  4HB0 B;  4H8S A;  1U29 A;  4MK0 A;  3SO6 A;  1FGZ A;  4A6K A;  2YS1 A;  2PZ1 A;  2IYB A;  2K49 A;  1ZYI A;  4WJ7 A;  2LYD A;  2DX5 A;  3U8Z A;  4F7H A;  2GS0 A;  1EAZ A;  2KIE A;  3KSY A;  3PVU A;  3QBV B;  2KUP A;  4BBK A;  2Z59 A;  2R0D A;  2MKR A;  1WGQ A;  1XKE A;  3MPX A;  5DH9 B;  1TQZ A;  2M14 A;  2NZ8 B;  3G9W A;  1I7A A;  5JP4 A;  3F0W A;  1AQC A;  2Z4D A;  3ULB A;  5M4Y B;  3HSA A;  4EJN A;  3IVF A;  4K2P A;  4B6H A;  3HW2 B;  1DYN A;  4K81 A;  3FVC A;  4IFS A;  3AU4 A;  2D10 A;  1ZSQ A;  2G35 A;  1V5P A;  1MK7 B;  2VSZ A;  2CY4 A;  2QKL A;  1FGY A;  4GN1 A;  4MT7 A;  1P5T A;  2CAY A;  2EC1 A;  1KZ7 A;  3SNH A;  2Y8F A;  5LON B;  1E5W A;  1SHC A;  3X23 A;  1OMW A;  5DI9 B;  2L2I A;  1EVH A;  2VKI A;  5D27 A;  3O96 A;  3BJI A;  2YT2 A;  5HE2 A;  3FSS A;  1WI1 A;  2EMT A;  1NI2 A;  3A98 B;  4GMX B;  1PFJ A;  2P8V A;  3NWD A;  4D6W A;  3SUZ A;  3F5R A;  1OY2 A;  2YT1 A;  2DKQ A;  1XCG A;  4TKN A;  4CYE A;  3HIE A;  2GJY A;  4KHO A;  2W2W A;  3PG7 A;  5D3X A;  1X1F A;  3PZD A;  3V5W A;  5DIF B;  2W2X C;  1UNP A;  3KRW A;  5EFX A;  1GC6 A;  1H4R A;  2N0Y A;  1U5G A;  1B55 A;  3PP2 A;  3MDB C;  5I2S A;  3ZDT A;  4GNK B;  1J0W A;  2I1J A;  2DX1 A;  2D2Q A;  3FM8 C;  4HB4 B;  4IAP A;  4HAU B;  4F7U P;  2MFQ A;  1BTN A;  1Z87 A;  3ODW A;  3DCX A;  1UPQ A;  4DX9 0;  1U5F A;  2I5F A;  5KQ1 A;  3ODO A;  5J3Q A;  1WVH A;  1XX0 A;  3P7Z A;  2DHI A;  1SGH A;  4F7G A;  4MY6 A;  2KCJ A;  2RVB B;  2W2X D;  2K2U A;  1OQN A;  3ULC A;  4ZRI A;  3D8E A;  1TJ6 A;  2DN6 A;  1DDW A;  1LB1 A;  1TXD A;  2E2X A;  2LKO A;  3KZ1 A;  4GMV A;  2P0F A;  1DRO A;  2COD A;  4PNK A;  4P7I A;  5D3W A;  4DX8 A;  1M7R A;  1P6S A;  3WA0 A;  2YT0 A;  2DHK A;  5L81 A;  2ROZ B;  2D9W A;  4NSW A;  5DHF B;  2R2Y A;  3TO1 A;  2DFK A;  1W1H A;  4YL8 A;  2J0J A;  2MWN B;  1V61 A;  4GOU A;  5LOP B;  5CLQ B;  2J0M A;  1BTK A;  4DIX A;  4QJ3 B;  5D3Y A;  1QQG A;  2J0K A;  5JHG A;  1U5D A;  2D9Y A;  2Z14 A;  4XWX A;  2COF A;  3FEH A;  2EMS A;  5FI1 A;  2FJL A;  4HB3 B;  1DDM A;  2ELB A;  3DXC A;  3KRX A;  4ZRJ A;  4CHJ A;  1WJ1 A;  3NWA A;  2Z13 A;  3OAN A;  2MDX A;  3NW8 A;  3N7C A;  1GC7 A;  2N23 A;  4GPT B;  3OHM B;  4QXA B;  1MI1 A;  1V89 A;  3NSU A;  2KIG A;  4K17 A;  2LOX A;  2K8E A;  4DBB A;  3AJ4 A;  3QIJ A;  2YS3 A;  1LW3 A;  2RLO A;  1KZG A;  4OT1 A;  1UEF A;  2HE7 A;  3CIK A;  5I2M A;  5J3Y A;  2RUK B;  3HQC A;  5HE0 A;  4DXA B;  4HAX B;  3TFM A;  2YRY A;  1MPH A;  4CSQ A;  4TYZ A;  2HTH B;  1FB8 A;  2LG1 A;  1U2B A;  2ZKM X;  1ZC4 B;  2EJ8 A;  3CXB B;  2Z0P A;  2CY5 A;  4A6F B;  1Q67 A;  1PLS A;  3RCP A;  1FOE A;  4IOY X;  4A6F A;  4HB2 B;  3ML4 A;  1J19 A;  5C16 A;  4QJ4 B;  3NWF A;  3U7D A;  2DYN A;  4WVF B;  3B77 A;  3A58 A;  1NU2 A;  5CLL B;  3ODX A;  2BCJ A;  4WSF A; 
#chains in the Genus database with same CATH homology
 2JP2 A;  5C79 A;  1ZVR A;  4C0A A;  3T06 A;  2K2J A;  2OTX A;  2YF0 A;  4KAX B;  1ZM0 A;  5C6R A;  4GZU A;  1N3H A;  2KGX B;  1XR0 B;  1UNR A;  2ELA A;  3A8Q A;  1M7E A;  1WGU A;  2V76 A;  4K2O A;  1ISN A;  3AU5 A;  1GG3 A;  1X1G A;  1U27 A;  2RSG A;  3DXE A;  4HAV B;  1QC6 A;  1KI1 B;  2D11 A;  3TW1 A;  1WG7 A;  2DLW A;  1BAK A;  4HAY B;  2J59 M;  1V5M A;  3VIA A;  1MK9 B;  3D8F A;  4HAZ B;  4ZRK A;  3ZVR A;  4GXB A;  2K00 A;  2Y8G A;  1Y19 B;  1MAI A;  1BWN A;  5FI0 A;  5C5B B;  2DTC A;  5C5B A;  3HK0 A;  4NY0 A;  2X18 A;  2Y7B A;  1UPR A;  3UZT A;  1K5D B;  3DXD A;  1P3R A;  2DKP A;  1MIX A;  1DDV A;  1X86 A;  1NTV A;  3SYX A;  2GCL A;  2DHJ A;  2UVM A;  2OQB A;  2P0D A;  2R09 A;  4EKU A;  1FHX A;  1Y5O A;  3SV1 A;  5JLJ B;  5J3T A;  4Y94 A;  2XQN M;  1W1G A;  2UZS A;  1RJ2 A;  3QWM A;  5HE1 A;  2D9X A;  4KVG B;  3GYO A;  5JHH A;  1AWE A;  4HHV A;  3TVV A;  1H10 A;  2AEH A;  2I5C A;  2DYQ A;  3P6A A;  4L6E A;  1X05 A;  1IRS A;  1WJM A;  2I1K A;  3PEG A;  4D0N B;  1ZC3 B;  2RNR B;  3PSC A;  1V5U A;  2COA A;  2M38 A;  4Z2M B;  2D9V A;  2YVC A;  1EF1 A;  2QKM A;  4CHM A;  1V88 A;  4A5K A;  1NTY A;  2ZPY A;  1W1D A;  2VRW B;  2LOZ A;  4A6H A;  1XD4 A;  1XOD A;  2D9Z A;  5GOW B;  2RGN B;  2L1C A;  4KHB B;  3BIN A;  3WYF B;  1RRP B;  3D8D A;  2D4Q A;  1I2H A;  2ADZ A;  3KY9 A;  5KCV A;  2CRF A;  4HAW B;  2H7D A;  3GYP A;  4HDO A;  3PVL A;  2YS5 A;  4HDQ A;  4YON A;  1DBH A;  5KQ4 A;  1FHO A;  3TCA A;  2AL6 A;  3VOQ A;  1PMS A;  2LUL A;  4Z2N A;  5D3V A;  1MIZ B;  3LJU X;  1X11 A;  3M1I B;  4HAT B;  3PVW A;  1MKE A;  4KHA A;  1U5E A;  2Z0O A;  2YSZ A;  1FHW A;  2IFS A;  1UNQ A;  1K5G B;  1EGX A;  2NMB A;  5DHA B;  2DA0 A;  1FAO A;  4EMO A;  2ROV A;  2Q13 A;  2GCJ A;  5HE3 A;  2Z0Q A;  2P0H A;  2H7E A;  4PQ0 A;  2UZR A;  2COC A;  3A8P A;  4HB0 B;  4H8S A;  1U29 A;  4MK0 A;  3SO6 A;  1FGZ A;  4A6K A;  2YS1 A;  2PZ1 A;  2IYB A;  4WJ7 A;  3U8Z A;  2LYD A;  2DX5 A;  4F7H A;  2GS0 A;  1EAZ A;  3PVU A;  3KSY A;  3QBV B;  2KUP A;  4BBK A;  2R0D A;  2MKR A;  1WGQ A;  1XKE A;  3MPX A;  5DH9 B;  1TQZ A;  2M14 A;  2NZ8 B;  3G9W A;  1I7A A;  5JP4 A;  3F0W A;  1AQC A;  3ULB A;  4EJN A;  3IVF A;  4K2P A;  4B6H A;  3HW2 B;  1DYN A;  4K81 A;  4IFS A;  3AU4 A;  2D10 A;  1ZSQ A;  2G35 A;  1V5P A;  1MK7 B;  2VSZ A;  2CY4 A;  2QKL A;  1FGY A;  4GN1 A;  4MT7 A;  1P5T A;  2CAY A;  2EC1 A;  1KZ7 A;  3SNH A;  2Y8F A;  5LON B;  1E5W A;  1SHC A;  3X23 A;  1OMW A;  5DI9 B;  2L2I A;  1EVH A;  2VKI A;  5D27 A;  3O96 A;  3BJI A;  5HE2 A;  3FSS A;  1WI1 A;  2EMT A;  1NI2 A;  3A98 B;  4GMX B;  1PFJ A;  2P8V A;  3SUZ A;  3F5R A;  1OY2 A;  2YT1 A;  2DKQ A;  1XCG A;  4TKN A;  4CYE A;  2GJY A;  4KHO A;  2W2W A;  3PG7 A;  5D3X A;  1X1F A;  3PZD A;  3V5W A;  5DIF B;  2W2X C;  1UNP A;  3KRW A;  5EFX A;  1GC6 A;  1H4R A;  2N0Y A;  1U5G A;  1B55 A;  3PP2 A;  3MDB C;  3ZDT A;  1J0W A;  2I1J A;  2DX1 A;  2D2Q A;  3FM8 C;  4HB4 B;  4IAP A;  4HAU B;  4F7U P;  2MFQ A;  1BTN A;  1Z87 A;  3ODW A;  1UPQ A;  4DX9 0;  1U5F A;  2I5F A;  5KQ1 A;  3ODO A;  5J3Q A;  1WVH A;  1XX0 A;  3P7Z A;  2DHI A;  1SGH A;  4F7G A;  4MY6 A;  2KCJ A;  2RVB B;  2W2X D;  2K2U A;  1OQN A;  3ULC A;  4ZRI A;  3D8E A;  1TJ6 A;  2DN6 A;  1DDW A;  1LB1 A;  1TXD A;  2E2X A;  2LKO A;  3KZ1 A;  4GMV A;  2P0F A;  1DRO A;  2COD A;  4PNK A;  4P7I A;  5D3W A;  4DX8 A;  1M7R A;  1P6S A;  3WA0 A;  2YT0 A;  2DHK A;  5L81 A;  2ROZ B;  2D9W A;  4NSW A;  5DHF B;  3TO1 A;  2DFK A;  1W1H A;  4YL8 A;  2J0J A;  2MWN B;  1V61 A;  5LOP B;  5CLQ B;  2J0M A;  1BTK A;  5D3Y A;  1QQG A;  2J0K A;  5JHG A;  1U5D A;  2D9Y A;  4XWX A;  2COF A;  3FEH A;  2EMS A;  5FI1 A;  2FJL A;  4HB3 B;  1DDM A;  2ELB A;  3DXC A;  3KRX A;  4ZRJ A;  4CHJ A;  1WJ1 A;  3OAN A;  2MDX A;  3N7C A;  1GC7 A;  2N23 A;  4GPT B;  1V89 A;  3NSU A;  4K17 A;  2LOX A;  4DBB A;  3AJ4 A;  3QIJ A;  2YS3 A;  1LW3 A;  2RLO A;  1KZG A;  1UEF A;  2HE7 A;  3CIK A;  5J3Y A;  2RUK B;  3HQC A;  5HE0 A;  4DXA B;  4HAX B;  3TFM A;  2YRY A;  1MPH A;  4TYZ A;  2HTH B;  1FB8 A;  2LG1 A;  1U2B A;  1ZC4 B;  2EJ8 A;  3CXB B;  2Z0P A;  2CY5 A;  4A6F B;  1Q67 A;  1PLS A;  3RCP A;  1FOE A;  4IOY X;  4A6F A;  4HB2 B;  3ML4 A;  1J19 A;  5C16 A;  3U7D A;  2DYN A;  4WVF B;  1NU2 A;  5CLL B;  3ODX A;  2BCJ A;  4WSF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...