4F7UP

The 6s snrnp assembly intermediate
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
124
structure length
116
Chain Sequence
MVLIMHVSPPEHGLLYTANNIKLKLGDKVVGEGTVYIAQNTLSWQPTELAEGISIEWKQVSLHGISSNPRKCIYFMLDHKVEWNGVYEVTECWLMPEDIATVDTMYSAMTTCQALH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Small nuclear ribonucleoprotein Sm D1
publication title Structural Basis of Assembly Chaperone- Mediated snRNP Formation.
pubmed doi rcsb
source organism Mus musculus
molecule tags Splicing
total genus 25
structure length 116
sequence length 124
chains with identical sequence Q
ec nomenclature
pdb deposition date 2012-05-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 4f7uP00
2I1KA 4CHMA 2D9XA 1BTNA 2HE7A 2LG1A 3BJIA 5L81A 2COAA 1X1FA 3QWMA 5CLQB 4HB3B 3TO1A 2YS1A 4GMXB 1Y19B 2UZSA 3AJ4A 5CLLB 3A8PA 3TVVA 2CY4A 1MPHA 4PNKA 3V5WA 2Y8FA 3M1IB 5DI9B 3RCPA 2J0JA 4DBBA 5DHFB 3D8DA 2DX1A 2QKMA 2I5CA 5JLJB 3WYFB 3KRXA 4K17A 2LKOA 1DROA 2ADZA 2EMTA 4HAWB 1E5WA 3U7DA 5C16A 4Y94A 3SO6A 4HAYB 1EGXA 2V76A 2NMBA 3QBVB 4PQ0A 2LYDA 4L6EA 4D0NB 1FGYA 2ZPYA 1V5MA 1Y5OA 1K5GB 2I5FA 4WVFB 3SNHA 1FHWA 2UVMA 3AU4A 3ML4A 1MIXA 2R0DA 5KQ4A 3ZVRA 1ZC4B 3PVWA 5D3XA 2YSZA 2DKPA 4TKNA 4GXBA 3TCAA 4A6HA 2Y8GA 1V5UA 1TJ6A 1MKEA 2FJLA 2Q13A 2NZ8B 4CYEA 1V5PA 1MIZB 1Z87A 3BINA 4HB4B 5C5BB 2W2WA 2M38A 1V89A 1M7EA 2DHIA 2RGNB 5D3VA 2W2XC 2DYQA 1TXDA 2ELAA 4NSWA 1X11A 5D3YA 2DN6A 1M7RA 2LULA 4HB2B 3SV1A 1GC7A 1MAIA 2L1CA 5LOPB 2VSZA 4ZRKA 4YONA 1X86A 1OQNA 3HK0A 1N3HA 4K81A 3AU5A 1Q67A 3PP2A 1MK9B 3ZDTA 1FGZA 3LJUX 2Z0QA 2KCJA 2DLWA 3KRWA 3QIJA 3T06A 1BTKA 5D3WA 5JHHA 1DDWA 3D8FA 2LOXA 2CRFA 2COFA 5EFXA 4CHJA 2DHKA 3DXEA 4A6FB 4DX90 4F7HA 2M14A 1BWNA 2DX5A 2K2JA 4HAUB 1IRSA 2X18A 2QKLA 3TW1A 2D9WA 4GPTB 3PZDA 4HATB 3PG7A 4GZUA 4KVGB 2YVCA 4F7UP 4MY6A 2DHJA 1FHXA 4B6HA 3CIKA 2LOZA 4HDOA 1U5EA 4WSFA 3P7ZA 2RLOA 5DH9B 4HAZB 2EJ8A 1FHOA 2UZRA 1WG7A 1PMSA 1WVHA 2D4QA 2P0FA 4GN1A 3F0WA 1RJ2A 2CY5A 1U5DA 1XKEA 2XQNM 1U2BA 4MK0A 3CXBB 1H4RA 1AWEA 4DX8A 4KHOA 1XX0A 1W1HA 4KAXB 1V61A 4KHAA 4MT7A 2EMSA 3DXCA 3UZTA 2OTXA 4EMOA 2COCA 3ODOA 4F7GA 1OMWA 1WGQA 1J0WA 1KZGA 5C6RA 5J3TA 1DYNA 1KI1B 1NTYA 2CODA 3PEGA 4K2PA 3WA0A 1J19A 4ZRIA 2MWNB 4KHBB 1SHCA 3U8ZA 5J3QA 2MFQA 2KUPA 3OANA 1X1GA 3FM8C 2AL6A 3KZ1A 1AQCA 1WI1A 4A5KA 2I1JA 2VRWB 3KSYA 1W1GA 2H7EA 2ROZB 3IVFA 4HHVA 1UEFA 2D10A 3N7CA 1V88A 1P3RA 3MPXA 1FAOA 2N23A 1X05A 1XD4A 2K00A 4NY0A 2YT0A 1OY2A 3ULBA 2D9ZA 4A6KA 4HAVB 4IAPA 1FB8A 4K2OA 1GC6A 2MDXA 1TQZA 3G9WA 1LB1A 2DKQA 2J0KA 3P6AA 4DXAB 1H10A 1UNRA 3ODXA 2Z0OA 5FI1A 1NI2A 1B55A 1UNPA 2YF0A 4GMVA 2L2IA 2DA0A 2JP2A 2P0DA 4TYZA 2YRYA 2IYBA 5DIFB 3SUZA 2P0HA 1GG3A 2ELBA 4YL8A 3GYPA 3VIAA 1XODA 5C5BA 2G35A 1ZM0A 1KZ7A 3HQCA 1SGHA 1UPRA 1DDVA 5HE2A 2Z0PA 2P8VA 1ZC3B 2KGXB 2Y7BA 4C0AA 3ODWA 4HDQA 2GCLA 4HB0B 2RUKB 2J59M 5JP4A 1EAZA 2E2XA 3HW2B 2H7DA 2VKIA 1U27A 2DFKA 3D8EA 3F5RA 4Z2NA 1RRPB 5KCVA 2K2UA 2GS0A 4EKUA 4P7IA 3MDBC 2GJYA 5JHGA 3KY9A 2DTCA 2IFSA 5DHAB 2YS5A 3SYXA 2HTHB 5LONB 5C79A 4WJ7A 3FEHA 5GOWB 1PFJA 4Z2MB 4A6FA 3A98B 2DYNA 1EVHA 3VOQA 2YT1A 1XR0B 2ROVA 2D9YA 2W2XD 1ZVRA 2OQBA 3PSCA 3GYOA 5FI0A 1DBHA 2RNRB 1W1DA 5HE0A 1XCGA 5J3YA 2D11A 2D2QA 3O96A 3TFMA 3DXDA 5D27A 1UNQA 2RVBB 1EF1A 1U5FA 1FOEA 2BCJA 4HAXB 4XWXA 1ZSQA 5HE3A 1NTVA 2YS3A 1K5DB 2PZ1A 4H8SA 1U29A 3A8QA 2MKRA 2EC1A 1I2HA 4BBKA 2AEHA 3PVUA 1U5GA 3NSUA 2RSGA 4IFSA 1QC6A 3PVLA 1P5TA 1LW3A 3FSSA 4IOYX 3ULCA 1WJ1A 5HE1A 5KQ1A 1WGUA 1BAKA 1DDMA 2J0MA 1I7AA 1MK7B 2N0YA 4ZRJA 1NU2A 2CAYA 3X23A 2GCJA 1PLSA 1P6SA 1UPQA 1QQGA 2D9VA 4EJNA 2R09A 1WJMA 1ISNA
chains in the Genus database with same CATH superfamily
2I1KA 4CHMA 2D9XA 1BTNA 2HE7A 2LG1A 3BJIA 5L81A 2COAA 3B77A 1X1FA 1ZYIA 3QWMA 5CLQB 4HB3B 3TO1A 2YS1A 4GMXB 1Y19B 2UZSA 3AJ4A 5CLLB 3A8PA 3TVVA 2CY4A 1MPHA 4PNKA 3V5WA 2Y8FA 3M1IB 5DI9B 3RCPA 2J0JA 4KHBA 2ZKMX 4OT1A 2KUQA 4DBBA 5DHFB 3D8DA 2DX1A 3A58A 2QKMA 2I5CA 5JLJB 3WYFB 3KRXA 4K17A 2LKOA 2K8EA 1DROA 2ADZA 2EMTA 4HAWB 1E5WA 3U7DA 5C16A 4Y94A 3SO6A 4HAYB 1EGXA 2V76A 2NMBA 3QBVB 4PQ0A 2KR0A 2LYDA 4L6EA 4D0NB 1FGYA 2ZPYA 1V5MA 1Y5OA 1K5GB 2I5FA 4WVFB 3SNHA 1FHWA 2UVMA 3AU4A 3ML4A 1MIXA 2R0DA 5KQ4A 4GOUA 3ZVRA 1ZC4B 3PVWA 5D3XA 2YSZA 2DKPA 4TKNA 4GXBA 3TCAA 3HSAA 4A6HA 2Y8GA 4QJ4B 1V5UA 1TJ6A 1MKEA 2FJLA 2Q13A 2NZ8B 4CYEA 2K49A 1V5PA 1MIZB 1Z87A 3BINA 3NWFA 4HB4B 5C5BB 2W2WA 2M38A 5I2SA 1V89A 1M7EA 2DHIA 2RGNB 2NBVA 5D3VA 2W2XC 2DYQA 1TXDA 2ELAA 4NSWA 1X11A 5D3YA 2DN6A 1M7RA 2LULA 4HB2B 3SV1A 1GC7A 1MAIA 2L1CA 5LOPB 2VSZA 4ZRKA 4YONA 1X86A 1OQNA 3HK0A 1N3HA 4K81A 3AU5A 1Q67A 3PP2A 1MK9B 3ZDTA 2YT2A 1FGZA 3LJUX 2Z0QA 2KCJA 2DLWA 3KRWA 3QIJA 3T06A 1BTKA 5D3WA 5JHHA 4DIXA 1DDWA 3D8FA 2LOXA 2CRFA 2COFA 4CSQA 5EFXA 4CHJA 2DHKA 2KIGA 3DXEA 4A6FB 4DX90 4F7HA 2FJUB 2M14A 1BWNA 2DX5A 2K2JA 4HAUB 1IRSA 2X18A 2QKLA 3TW1A 2D9WA 4GPTB 3PZDA 4HATB 3PG7A 4GZUA 4KVGB 2YVCA 4F7UP 4MY6A 2DHJA 1FHXA 4B6HA 3CIKA 2LOZA 4HDOA 1T77A 4D6WA 1U5EA 4WSFA 3P7ZA 2RLOA 5IRSA 4QJ5B 5DH9B 4HAZB 2EJ8A 1FHOA 2UZRA 3HIEA 1WG7A 1PMSA 1WVHA 2D4QA 5M4YB 2P0FA 4GN1A 3F0WA 1RJ2A 2CY5A 1U5DA 1XKEA 2XQNM 3NW8A 1U2BA 4MK0A 3CXBB 1H4RA 1AWEA 4DX8A 4KHOA 1XX0A 2R2YA 1W1HA 4KAXB 1V61A 4KHAA 4MT7A 2EMSA 3DXCA 3UZTA 2OTXA 4OSNA 4EMOA 2COCA 3ODOA 4F7GA 1OMWA 1WGQA 1J0WA 1KZGA 5C6RA 5J3TA 1DYNA 1KI1B 1NTYA 3NWDA 2CODA 3PEGA 4K2PA 3WA0A 1J19A 4ZRIA 2MWNB 4KHBB 1SHCA 3U8ZA 5J3QA 2MFQA 2KUPA 3OANA 1X1GA 3FM8C 2AL6A 3KZ1A 1AQCA 1WI1A 4A5KA 2I1JA 2VRWB 3KSYA 1W1GA 2H7EA 2ROZB 3IVFA 4HHVA 1UEFA 2D10A 3N7CA 1V88A 1P3RA 3MPXA 1FAOA 2N23A 1X05A 1XD4A 2K00A 4NY0A 2YT0A 1OY2A 3ULBA 2D9ZA 4A6KA 4HAVB 4IAPA 1FB8A 4K2OA 1GC6A 2MDXA 1TQZA 2Z13A 3G9WA 1LB1A 2DKQA 2J0KA 3P6AA 4DXAB 1H10A 1UNRA 3ODXA 2Z0OA 5FI1A 1NI2A 1B55A 1UNPA 2YF0A 4GMVA 3DCXA 2L2IA 2DA0A 2JP2A 2P0DA 4TYZA 2YRYA 2IYBA 5DIFB 2RRFA 3SUZA 2P0HA 1GG3A 2ELBA 4YL8A 3GYPA 3VIAA 1XODA 5C5BA 2G35A 1ZM0A 1KZ7A 3HQCA 1SGHA 1UPRA 1DDVA 2Z14A 5HE2A 3FVCA 2Z4DA 2Z0PA 2P8VA 4HSIA 4QJ3B 1ZC3B 2KGXB 2Y7BA 4C0AA 3ODWA 4HDQA 2GCLA 4HB0B 2RUKB 2J59M 5JP4A 1EAZA 2E2XA 3HW2B 2H7DA 2VKIA 1U27A 2DFKA 3D8EA 3F5RA 3U12A 4Z2NA 1RRPB 5KCVA 2K2UA 2GS0A 4EKUA 4P7IA 3MDBC 2GJYA 5JHGA 3KY9A 2DTCA 2IFSA 2KIEA 5DHAB 2YS5A 3SYXA 2HTHB 5I2MA 5LONB 5C79A 4WJ7A 3FEHA 5GOWB 1PFJA 4Z2MB 4A6FA 3A98B 2DYNA 1EVHA 3VOQA 2YT1A 1XR0B 2Z59A 2ROVA 2D9YA 5LG4B 2W2XD 1ZVRA 2OQBA 3PSCA 4GNKB 3GYOA 5FI0A 1DBHA 2RNRB 1W1DA 5HE0A 1XCGA 5J3YA 2D11A 2D2QA 3O96A 3TFMA 3DXDA 5D27A 1UNQA 2RVBB 1EF1A 1U5FA 1FOEA 2BCJA 4HAXB 4XWXA 1ZSQA 5HE3A 1NTVA 2YS3A 1K5DB 2PZ1A 4H8SA 1U29A 3A8QA 2MKRA 2EC1A 2GUMA 1I2HA 4BBKA 4L1RA 2AEHA 3PVUA 1U5GA 4QXAB 3NSUA 2RSGA 4IFSA 1QC6A 1MI1A 3OHMB 3PVLA 1P5TA 1LW3A 3FSSA 4IOYX 3ULCA 1WJ1A 5HE1A 5KQ1A 1WGUA 1BAKA 1DDMA 2J0MA 1I7AA 1MK7B 2N0YA 4ZRJA 1NU2A 2CAYA 3X23A 2GCJA 1PLSA 1P6SA 1UPQA 1QQGA 3NWAA 2D9VA 4EJNA 2R09A 1WJMA 1ISNA
chains in the Genus database with same CATH topology
2I1KA 4CHMA 2D9XA 1BTNA 2HE7A 2LG1A 3BJIA 5L81A 2COAA 1X1FA 3QWMA 5CLQB 4HB3B 3TO1A 2YS1A 4GMXB 1Y19B 2UZSA 3AJ4A 5CLLB 3A8PA 3TVVA 2CY4A 1MPHA 4PNKA 3V5WA 2Y8FA 3M1IB 5DI9B 3RCPA 2J0JA 4DBBA 5DHFB 3D8DA 2DX1A 2QKMA 2I5CA 5JLJB 3WYFB 3KRXA 4K17A 2LKOA 1DROA 2ADZA 2EMTA 4HAWB 1E5WA 3U7DA 5C16A 4Y94A 3SO6A 4HAYB 1EGXA 2V76A 2NMBA 3QBVB 4PQ0A 2LYDA 4L6EA 4D0NB 1FGYA 2ZPYA 1V5MA 1Y5OA 1K5GB 2I5FA 4WVFB 3SNHA 1FHWA 2UVMA 3AU4A 3ML4A 1MIXA 2R0DA 5KQ4A 3ZVRA 1ZC4B 3PVWA 5D3XA 2YSZA 2DKPA 4TKNA 4GXBA 3TCAA 4A6HA 2Y8GA 1V5UA 1TJ6A 1MKEA 2FJLA 2Q13A 2NZ8B 4CYEA 1V5PA 1MIZB 1Z87A 3BINA 4HB4B 5C5BB 2W2WA 2M38A 1V89A 1M7EA 2DHIA 2RGNB 5D3VA 2W2XC 2DYQA 1TXDA 2ELAA 4NSWA 1X11A 5D3YA 2DN6A 1M7RA 2LULA 4HB2B 3SV1A 1GC7A 1MAIA 2L1CA 5LOPB 2VSZA 4ZRKA 4YONA 1X86A 1OQNA 3HK0A 1N3HA 4K81A 3AU5A 1Q67A 3PP2A 1MK9B 3ZDTA 1FGZA 3LJUX 2Z0QA 2KCJA 2DLWA 3KRWA 3QIJA 3T06A 1BTKA 5D3WA 5JHHA 1DDWA 3D8FA 2LOXA 2CRFA 2COFA 5EFXA 4CHJA 2DHKA 3DXEA 4A6FB 4DX90 4F7HA 2M14A 1BWNA 2DX5A 2K2JA 4HAUB 1IRSA 2X18A 2QKLA 3TW1A 2D9WA 4GPTB 3PZDA 4HATB 3PG7A 4GZUA 4KVGB 2YVCA 4F7UP 4MY6A 2DHJA 1FHXA 4B6HA 3CIKA 2LOZA 4HDOA 1U5EA 4WSFA 3P7ZA 2RLOA 5DH9B 4HAZB 2EJ8A 1FHOA 2UZRA 1WG7A 1PMSA 1WVHA 2D4QA 2P0FA 4GN1A 3F0WA 1RJ2A 2CY5A 1U5DA 1XKEA 2XQNM 1U2BA 4MK0A 3CXBB 1H4RA 1AWEA 4DX8A 4KHOA 1XX0A 1W1HA 4KAXB 1V61A 4KHAA 4MT7A 2EMSA 3DXCA 3UZTA 2OTXA 4EMOA 2COCA 3ODOA 4F7GA 1OMWA 1WGQA 1J0WA 1KZGA 5C6RA 5J3TA 1DYNA 1KI1B 1NTYA 2CODA 3PEGA 4K2PA 3WA0A 1J19A 4ZRIA 2MWNB 4KHBB 1SHCA 3U8ZA 5J3QA 2MFQA 2KUPA 3OANA 1X1GA 3FM8C 2AL6A 3KZ1A 1AQCA 1WI1A 4A5KA 2I1JA 2VRWB 3KSYA 1W1GA 2H7EA 2ROZB 3IVFA 4HHVA 1UEFA 2D10A 3N7CA 1V88A 1P3RA 3MPXA 1FAOA 2N23A 1X05A 1XD4A 2K00A 4NY0A 2YT0A 1OY2A 3ULBA 2D9ZA 4A6KA 4HAVB 4IAPA 1FB8A 4K2OA 1GC6A 2MDXA 1TQZA 3G9WA 1LB1A 2DKQA 2J0KA 3P6AA 4DXAB 1H10A 1UNRA 3ODXA 2Z0OA 5FI1A 1NI2A 1B55A 1UNPA 2YF0A 4GMVA 2L2IA 2DA0A 2JP2A 2P0DA 4TYZA 2YRYA 2IYBA 5DIFB 3SUZA 2P0HA 1GG3A 2ELBA 4YL8A 3GYPA 3VIAA 1XODA 5C5BA 2G35A 1ZM0A 1KZ7A 3HQCA 1SGHA 1UPRA 1DDVA 5HE2A 2Z0PA 2P8VA 1ZC3B 2KGXB 2Y7BA 4C0AA 3ODWA 4HDQA 2GCLA 4HB0B 2RUKB 2J59M 5JP4A 1EAZA 2E2XA 3HW2B 2H7DA 2VKIA 1U27A 2DFKA 3D8EA 3F5RA 4Z2NA 1RRPB 5KCVA 2K2UA 2GS0A 4EKUA 4P7IA 3MDBC 2GJYA 5JHGA 3KY9A 2DTCA 2IFSA 5DHAB 2YS5A 3SYXA 2HTHB 5LONB 5C79A 4WJ7A 3FEHA 5GOWB 1PFJA 4Z2MB 4A6FA 3A98B 2DYNA 1EVHA 3VOQA 2YT1A 1XR0B 2ROVA 2D9YA 2W2XD 1ZVRA 2OQBA 3PSCA 3GYOA 5FI0A 1DBHA 2RNRB 1W1DA 5HE0A 1XCGA 5J3YA 2D11A 2D2QA 3O96A 3TFMA 3DXDA 5D27A 1UNQA 2RVBB 1EF1A 1U5FA 1FOEA 2BCJA 4HAXB 4XWXA 1ZSQA 5HE3A 1NTVA 2YS3A 1K5DB 2PZ1A 4H8SA 1U29A 3A8QA 2MKRA 2EC1A 1I2HA 4BBKA 2AEHA 3PVUA 1U5GA 3NSUA 2RSGA 4IFSA 1QC6A 3PVLA 1P5TA 1LW3A 3FSSA 4IOYX 3ULCA 1WJ1A 5HE1A 5KQ1A 1WGUA 1BAKA 1DDMA 2J0MA 1I7AA 1MK7B 2N0YA 4ZRJA 1NU2A 2CAYA 3X23A 2GCJA 1PLSA 1P6SA 1UPQA 1QQGA 2D9VA 4EJNA 2R09A 1WJMA 1ISNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2I1K A;  4CHM A;  2D9X A;  1BTN A;  2HE7 A;  2LG1 A;  3BJI A;  5L81 A;  2COA A;  1X1F A;  3QWM A;  5CLQ B;  4HB3 B;  3TO1 A;  2YS1 A;  4GMX B;  1Y19 B;  2UZS A;  3AJ4 A;  5CLL B;  3A8P A;  3TVV A;  2CY4 A;  1MPH A;  4PNK A;  3V5W A;  2Y8F A;  3M1I B;  5DI9 B;  3RCP A;  2J0J A;  4DBB A;  5DHF B;  3D8D A;  2DX1 A;  2QKM A;  2I5C A;  5JLJ B;  3WYF B;  3KRX A;  4K17 A;  2LKO A;  1DRO A;  2ADZ A;  2EMT A;  4HAW B;  1E5W A;  3U7D A;  5C16 A;  4Y94 A;  3SO6 A;  4HAY B;  1EGX A;  2V76 A;  2NMB A;  3QBV B;  4PQ0 A;  2LYD A;  4L6E A;  4D0N B;  1FGY A;  2ZPY A;  1V5M A;  1Y5O A;  1K5G B;  2I5F A;  4WVF B;  3SNH A;  1FHW A;  2UVM A;  3AU4 A;  3ML4 A;  1MIX A;  2R0D A;  5KQ4 A;  3ZVR A;  1ZC4 B;  3PVW A;  5D3X A;  2YSZ A;  2DKP A;  4TKN A;  4GXB A;  3TCA A;  4A6H A;  2Y8G A;  1V5U A;  1TJ6 A;  1MKE A;  2FJL A;  2Q13 A;  2NZ8 B;  4CYE A;  1V5P A;  1MIZ B;  1Z87 A;  3BIN A;  4HB4 B;  5C5B B;  2W2W A;  2M38 A;  1V89 A;  1M7E A;  2DHI A;  2RGN B;  5D3V A;  2W2X C;  2DYQ A;  1TXD A;  2ELA A;  4NSW A;  1X11 A;  5D3Y A;  2DN6 A;  1M7R A;  2LUL A;  4HB2 B;  3SV1 A;  1GC7 A;  1MAI A;  2L1C A;  5LOP B;  2VSZ A;  4ZRK A;  4YON A;  1X86 A;  1OQN A;  3HK0 A;  1N3H A;  4K81 A;  3AU5 A;  1Q67 A;  3PP2 A;  1MK9 B;  3ZDT A;  1FGZ A;  3LJU X;  2Z0Q A;  2KCJ A;  2DLW A;  3KRW A;  3QIJ A;  3T06 A;  1BTK A;  5D3W A;  5JHH A;  1DDW A;  3D8F A;  2LOX A;  2CRF A;  2COF A;  5EFX A;  4CHJ A;  2DHK A;  3DXE A;  4A6F B;  4DX9 0;  4F7H A;  2M14 A;  1BWN A;  2DX5 A;  2K2J A;  4HAU B;  1IRS A;  2X18 A;  2QKL A;  3TW1 A;  2D9W A;  4GPT B;  3PZD A;  4HAT B;  3PG7 A;  4GZU A;  4KVG B;  2YVC A;  4F7U P;  4MY6 A;  2DHJ A;  1FHX A;  4B6H A;  3CIK A;  2LOZ A;  4HDO A;  1U5E A;  4WSF A;  3P7Z A;  2RLO A;  5DH9 B;  4HAZ B;  2EJ8 A;  1FHO A;  2UZR A;  1WG7 A;  1PMS A;  1WVH A;  2D4Q A;  2P0F A;  4GN1 A;  3F0W A;  1RJ2 A;  2CY5 A;  1U5D A;  1XKE A;  2XQN M;  1U2B A;  4MK0 A;  3CXB B;  1H4R A;  1AWE A;  4DX8 A;  4KHO A;  1XX0 A;  1W1H A;  4KAX B;  1V61 A;  4KHA A;  4MT7 A;  2EMS A;  3DXC A;  3UZT A;  2OTX A;  4EMO A;  2COC A;  3ODO A;  4F7G A;  1OMW A;  1WGQ A;  1J0W A;  1KZG A;  5C6R A;  5J3T A;  1DYN A;  1KI1 B;  1NTY A;  2COD A;  3PEG A;  4K2P A;  3WA0 A;  1J19 A;  4ZRI A;  2MWN B;  4KHB B;  1SHC A;  3U8Z A;  5J3Q A;  2MFQ A;  2KUP A;  3OAN A;  1X1G A;  3FM8 C;  2AL6 A;  3KZ1 A;  1AQC A;  1WI1 A;  4A5K A;  2I1J A;  2VRW B;  3KSY A;  1W1G A;  2H7E A;  2ROZ B;  3IVF A;  4HHV A;  1UEF A;  2D10 A;  3N7C A;  1V88 A;  1P3R A;  3MPX A;  1FAO A;  2N23 A;  1X05 A;  1XD4 A;  2K00 A;  4NY0 A;  2YT0 A;  1OY2 A;  3ULB A;  2D9Z A;  4A6K A;  4HAV B;  4IAP A;  1FB8 A;  4K2O A;  1GC6 A;  2MDX A;  1TQZ A;  3G9W A;  1LB1 A;  2DKQ A;  2J0K A;  3P6A A;  4DXA B;  1H10 A;  1UNR A;  3ODX A;  2Z0O A;  5FI1 A;  1NI2 A;  1B55 A;  1UNP A;  2YF0 A;  4GMV A;  2L2I A;  2DA0 A;  2JP2 A;  2P0D A;  4TYZ A;  2YRY A;  2IYB A;  5DIF B;  3SUZ A;  2P0H A;  1GG3 A;  2ELB A;  4YL8 A;  3GYP A;  3VIA A;  1XOD A;  5C5B A;  2G35 A;  1ZM0 A;  1KZ7 A;  3HQC A;  1SGH A;  1UPR A;  1DDV A;  5HE2 A;  2Z0P A;  2P8V A;  1ZC3 B;  2KGX B;  2Y7B A;  4C0A A;  3ODW A;  4HDQ A;  2GCL A;  4HB0 B;  2RUK B;  2J59 M;  5JP4 A;  1EAZ A;  2E2X A;  3HW2 B;  2H7D A;  2VKI A;  1U27 A;  2DFK A;  3D8E A;  3F5R A;  4Z2N A;  1RRP B;  5KCV A;  2K2U A;  2GS0 A;  4EKU A;  4P7I A;  3MDB C;  2GJY A;  5JHG A;  3KY9 A;  2DTC A;  2IFS A;  5DHA B;  2YS5 A;  3SYX A;  2HTH B;  5LON B;  5C79 A;  4WJ7 A;  3FEH A;  5GOW B;  1PFJ A;  4Z2M B;  4A6F A;  3A98 B;  2DYN A;  1EVH A;  3VOQ A;  2YT1 A;  1XR0 B;  2ROV A;  2D9Y A;  2W2X D;  1ZVR A;  2OQB A;  3PSC A;  3GYO A;  5FI0 A;  1DBH A;  2RNR B;  1W1D A;  5HE0 A;  1XCG A;  5J3Y A;  2D11 A;  2D2Q A;  3O96 A;  3TFM A;  3DXD A;  5D27 A;  1UNQ A;  2RVB B;  1EF1 A;  1U5F A;  1FOE A;  2BCJ A;  4HAX B;  4XWX A;  1ZSQ A;  5HE3 A;  1NTV A;  2YS3 A;  1K5D B;  2PZ1 A;  4H8S A;  1U29 A;  3A8Q A;  2MKR A;  2EC1 A;  1I2H A;  4BBK A;  2AEH A;  3PVU A;  1U5G A;  3NSU A;  2RSG A;  4IFS A;  1QC6 A;  3PVL A;  1P5T A;  1LW3 A;  3FSS A;  4IOY X;  3ULC A;  1WJ1 A;  5HE1 A;  5KQ1 A;  1WGU A;  1BAK A;  1DDM A;  2J0M A;  1I7A A;  1MK7 B;  2N0Y A;  4ZRJ A;  1NU2 A;  2CAY A;  3X23 A;  2GCJ A;  1PLS A;  1P6S A;  1UPQ A;  1QQG A;  2D9V A;  4EJN A;  2R09 A;  1WJM A;  1ISN A; 
#chains in the Genus database with same CATH topology
 2I1K A;  4CHM A;  2D9X A;  1BTN A;  2HE7 A;  2LG1 A;  3BJI A;  5L81 A;  2COA A;  3B77 A;  1X1F A;  1ZYI A;  3QWM A;  5CLQ B;  4HB3 B;  3TO1 A;  2YS1 A;  4GMX B;  1Y19 B;  2UZS A;  3AJ4 A;  5CLL B;  3A8P A;  3TVV A;  2CY4 A;  1MPH A;  4PNK A;  3V5W A;  2Y8F A;  3M1I B;  5DI9 B;  3RCP A;  2J0J A;  4KHB A;  2ZKM X;  4OT1 A;  2KUQ A;  4DBB A;  5DHF B;  3D8D A;  2DX1 A;  3A58 A;  2QKM A;  2I5C A;  5JLJ B;  3WYF B;  3KRX A;  4K17 A;  2LKO A;  2K8E A;  1DRO A;  2ADZ A;  2EMT A;  4HAW B;  1E5W A;  3U7D A;  5C16 A;  4Y94 A;  3SO6 A;  4HAY B;  1EGX A;  2V76 A;  2NMB A;  3QBV B;  4PQ0 A;  2KR0 A;  2LYD A;  4L6E A;  4D0N B;  1FGY A;  2ZPY A;  1V5M A;  1Y5O A;  1K5G B;  2I5F A;  4WVF B;  3SNH A;  1FHW A;  2UVM A;  3AU4 A;  3ML4 A;  1MIX A;  2R0D A;  5KQ4 A;  4GOU A;  3ZVR A;  1ZC4 B;  3PVW A;  5D3X A;  2YSZ A;  2DKP A;  4TKN A;  4GXB A;  3TCA A;  3HSA A;  4A6H A;  2Y8G A;  4QJ4 B;  1V5U A;  1TJ6 A;  1MKE A;  2FJL A;  2Q13 A;  2NZ8 B;  4CYE A;  2K49 A;  1V5P A;  1MIZ B;  1Z87 A;  3BIN A;  3NWF A;  4HB4 B;  5C5B B;  2W2W A;  2M38 A;  5I2S A;  1V89 A;  1M7E A;  2DHI A;  2RGN B;  2NBV A;  5D3V A;  2W2X C;  2DYQ A;  1TXD A;  2ELA A;  4NSW A;  1X11 A;  5D3Y A;  2DN6 A;  1M7R A;  2LUL A;  4HB2 B;  3SV1 A;  1GC7 A;  1MAI A;  2L1C A;  5LOP B;  2VSZ A;  4ZRK A;  4YON A;  1X86 A;  1OQN A;  3HK0 A;  1N3H A;  4K81 A;  3AU5 A;  1Q67 A;  3PP2 A;  1MK9 B;  3ZDT A;  2YT2 A;  1FGZ A;  3LJU X;  2Z0Q A;  2KCJ A;  2DLW A;  3KRW A;  3QIJ A;  3T06 A;  1BTK A;  5D3W A;  5JHH A;  4DIX A;  1DDW A;  3D8F A;  2LOX A;  2CRF A;  2COF A;  4CSQ A;  5EFX A;  4CHJ A;  2DHK A;  2KIG A;  3DXE A;  4A6F B;  4DX9 0;  4F7H A;  2FJU B;  2M14 A;  1BWN A;  2DX5 A;  2K2J A;  4HAU B;  1IRS A;  2X18 A;  2QKL A;  3TW1 A;  2D9W A;  4GPT B;  3PZD A;  4HAT B;  3PG7 A;  4GZU A;  4KVG B;  2YVC A;  4F7U P;  4MY6 A;  2DHJ A;  1FHX A;  4B6H A;  3CIK A;  2LOZ A;  4HDO A;  1T77 A;  4D6W A;  1U5E A;  4WSF A;  3P7Z A;  2RLO A;  5IRS A;  4QJ5 B;  5DH9 B;  4HAZ B;  2EJ8 A;  1FHO A;  2UZR A;  3HIE A;  1WG7 A;  1PMS A;  1WVH A;  2D4Q A;  5M4Y B;  2P0F A;  4GN1 A;  3F0W A;  1RJ2 A;  2CY5 A;  1U5D A;  1XKE A;  2XQN M;  3NW8 A;  1U2B A;  4MK0 A;  3CXB B;  1H4R A;  1AWE A;  4DX8 A;  4KHO A;  1XX0 A;  2R2Y A;  1W1H A;  4KAX B;  1V61 A;  4KHA A;  4MT7 A;  2EMS A;  3DXC A;  3UZT A;  2OTX A;  4OSN A;  4EMO A;  2COC A;  3ODO A;  4F7G A;  1OMW A;  1WGQ A;  1J0W A;  1KZG A;  5C6R A;  5J3T A;  1DYN A;  1KI1 B;  1NTY A;  3NWD A;  2COD A;  3PEG A;  4K2P A;  3WA0 A;  1J19 A;  4ZRI A;  2MWN B;  4KHB B;  1SHC A;  3U8Z A;  5J3Q A;  2MFQ A;  2KUP A;  3OAN A;  1X1G A;  3FM8 C;  2AL6 A;  3KZ1 A;  1AQC A;  1WI1 A;  4A5K A;  2I1J A;  2VRW B;  3KSY A;  1W1G A;  2H7E A;  2ROZ B;  3IVF A;  4HHV A;  1UEF A;  2D10 A;  3N7C A;  1V88 A;  1P3R A;  3MPX A;  1FAO A;  2N23 A;  1X05 A;  1XD4 A;  2K00 A;  4NY0 A;  2YT0 A;  1OY2 A;  3ULB A;  2D9Z A;  4A6K A;  4HAV B;  4IAP A;  1FB8 A;  4K2O A;  1GC6 A;  2MDX A;  1TQZ A;  2Z13 A;  3G9W A;  1LB1 A;  2DKQ A;  2J0K A;  3P6A A;  4DXA B;  1H10 A;  1UNR A;  3ODX A;  2Z0O A;  5FI1 A;  1NI2 A;  1B55 A;  1UNP A;  2YF0 A;  4GMV A;  3DCX A;  2L2I A;  2DA0 A;  2JP2 A;  2P0D A;  4TYZ A;  2YRY A;  2IYB A;  5DIF B;  2RRF A;  3SUZ A;  2P0H A;  1GG3 A;  2ELB A;  4YL8 A;  3GYP A;  3VIA A;  1XOD A;  5C5B A;  2G35 A;  1ZM0 A;  1KZ7 A;  3HQC A;  1SGH A;  1UPR A;  1DDV A;  2Z14 A;  5HE2 A;  3FVC A;  2Z4D A;  2Z0P A;  2P8V A;  4HSI A;  4QJ3 B;  1ZC3 B;  2KGX B;  2Y7B A;  4C0A A;  3ODW A;  4HDQ A;  2GCL A;  4HB0 B;  2RUK B;  2J59 M;  5JP4 A;  1EAZ A;  2E2X A;  3HW2 B;  2H7D A;  2VKI A;  1U27 A;  2DFK A;  3D8E A;  3F5R A;  3U12 A;  4Z2N A;  1RRP B;  5KCV A;  2K2U A;  2GS0 A;  4EKU A;  4P7I A;  3MDB C;  2GJY A;  5JHG A;  3KY9 A;  2DTC A;  2IFS A;  2KIE A;  5DHA B;  2YS5 A;  3SYX A;  2HTH B;  5I2M A;  5LON B;  5C79 A;  4WJ7 A;  3FEH A;  5GOW B;  1PFJ A;  4Z2M B;  4A6F A;  3A98 B;  2DYN A;  1EVH A;  3VOQ A;  2YT1 A;  1XR0 B;  2Z59 A;  2ROV A;  2D9Y A;  5LG4 B;  2W2X D;  1ZVR A;  2OQB A;  3PSC A;  4GNK B;  3GYO A;  5FI0 A;  1DBH A;  2RNR B;  1W1D A;  5HE0 A;  1XCG A;  5J3Y A;  2D11 A;  2D2Q A;  3O96 A;  3TFM A;  3DXD A;  5D27 A;  1UNQ A;  2RVB B;  1EF1 A;  1U5F A;  1FOE A;  2BCJ A;  4HAX B;  4XWX A;  1ZSQ A;  5HE3 A;  1NTV A;  2YS3 A;  1K5D B;  2PZ1 A;  4H8S A;  1U29 A;  3A8Q A;  2MKR A;  2EC1 A;  2GUM A;  1I2H A;  4BBK A;  4L1R A;  2AEH A;  3PVU A;  1U5G A;  4QXA B;  3NSU A;  2RSG A;  4IFS A;  1QC6 A;  1MI1 A;  3OHM B;  3PVL A;  1P5T A;  1LW3 A;  3FSS A;  4IOY X;  3ULC A;  1WJ1 A;  5HE1 A;  5KQ1 A;  1WGU A;  1BAK A;  1DDM A;  2J0M A;  1I7A A;  1MK7 B;  2N0Y A;  4ZRJ A;  1NU2 A;  2CAY A;  3X23 A;  2GCJ A;  1PLS A;  1P6S A;  1UPQ A;  1QQG A;  3NWA A;  2D9V A;  4EJN A;  2R09 A;  1WJM A;  1ISN A; 
#chains in the Genus database with same CATH homology
 2I1K A;  4CHM A;  2D9X A;  1BTN A;  2HE7 A;  2LG1 A;  3BJI A;  5L81 A;  2COA A;  1X1F A;  3QWM A;  5CLQ B;  4HB3 B;  3TO1 A;  2YS1 A;  4GMX B;  1Y19 B;  2UZS A;  3AJ4 A;  5CLL B;  3A8P A;  3TVV A;  2CY4 A;  1MPH A;  4PNK A;  3V5W A;  2Y8F A;  3M1I B;  5DI9 B;  3RCP A;  2J0J A;  4DBB A;  5DHF B;  3D8D A;  2DX1 A;  2QKM A;  2I5C A;  5JLJ B;  3WYF B;  3KRX A;  4K17 A;  2LKO A;  1DRO A;  2ADZ A;  2EMT A;  4HAW B;  1E5W A;  3U7D A;  5C16 A;  4Y94 A;  3SO6 A;  4HAY B;  1EGX A;  2V76 A;  2NMB A;  3QBV B;  4PQ0 A;  2LYD A;  4L6E A;  4D0N B;  1FGY A;  2ZPY A;  1V5M A;  1Y5O A;  1K5G B;  2I5F A;  4WVF B;  3SNH A;  1FHW A;  2UVM A;  3AU4 A;  3ML4 A;  1MIX A;  2R0D A;  5KQ4 A;  3ZVR A;  1ZC4 B;  3PVW A;  5D3X A;  2YSZ A;  2DKP A;  4TKN A;  4GXB A;  3TCA A;  4A6H A;  2Y8G A;  1V5U A;  1TJ6 A;  1MKE A;  2FJL A;  2Q13 A;  2NZ8 B;  4CYE A;  1V5P A;  1MIZ B;  1Z87 A;  3BIN A;  4HB4 B;  5C5B B;  2W2W A;  2M38 A;  1V89 A;  1M7E A;  2DHI A;  2RGN B;  5D3V A;  2W2X C;  2DYQ A;  1TXD A;  2ELA A;  4NSW A;  1X11 A;  5D3Y A;  2DN6 A;  1M7R A;  2LUL A;  4HB2 B;  3SV1 A;  1GC7 A;  1MAI A;  2L1C A;  5LOP B;  2VSZ A;  4ZRK A;  4YON A;  1X86 A;  1OQN A;  3HK0 A;  1N3H A;  4K81 A;  3AU5 A;  1Q67 A;  3PP2 A;  1MK9 B;  3ZDT A;  1FGZ A;  3LJU X;  2Z0Q A;  2KCJ A;  2DLW A;  3KRW A;  3QIJ A;  3T06 A;  1BTK A;  5D3W A;  5JHH A;  1DDW A;  3D8F A;  2LOX A;  2CRF A;  2COF A;  5EFX A;  4CHJ A;  2DHK A;  3DXE A;  4A6F B;  4DX9 0;  4F7H A;  2M14 A;  1BWN A;  2DX5 A;  2K2J A;  4HAU B;  1IRS A;  2X18 A;  2QKL A;  3TW1 A;  2D9W A;  4GPT B;  3PZD A;  4HAT B;  3PG7 A;  4GZU A;  4KVG B;  2YVC A;  4F7U P;  4MY6 A;  2DHJ A;  1FHX A;  4B6H A;  3CIK A;  2LOZ A;  4HDO A;  1U5E A;  4WSF A;  3P7Z A;  2RLO A;  5DH9 B;  4HAZ B;  2EJ8 A;  1FHO A;  2UZR A;  1WG7 A;  1PMS A;  1WVH A;  2D4Q A;  2P0F A;  4GN1 A;  3F0W A;  1RJ2 A;  2CY5 A;  1U5D A;  1XKE A;  2XQN M;  1U2B A;  4MK0 A;  3CXB B;  1H4R A;  1AWE A;  4DX8 A;  4KHO A;  1XX0 A;  1W1H A;  4KAX B;  1V61 A;  4KHA A;  4MT7 A;  2EMS A;  3DXC A;  3UZT A;  2OTX A;  4EMO A;  2COC A;  3ODO A;  4F7G A;  1OMW A;  1WGQ A;  1J0W A;  1KZG A;  5C6R A;  5J3T A;  1DYN A;  1KI1 B;  1NTY A;  2COD A;  3PEG A;  4K2P A;  3WA0 A;  1J19 A;  4ZRI A;  2MWN B;  4KHB B;  1SHC A;  3U8Z A;  5J3Q A;  2MFQ A;  2KUP A;  3OAN A;  1X1G A;  3FM8 C;  2AL6 A;  3KZ1 A;  1AQC A;  1WI1 A;  4A5K A;  2I1J A;  2VRW B;  3KSY A;  1W1G A;  2H7E A;  2ROZ B;  3IVF A;  4HHV A;  1UEF A;  2D10 A;  3N7C A;  1V88 A;  1P3R A;  3MPX A;  1FAO A;  2N23 A;  1X05 A;  1XD4 A;  2K00 A;  4NY0 A;  2YT0 A;  1OY2 A;  3ULB A;  2D9Z A;  4A6K A;  4HAV B;  4IAP A;  1FB8 A;  4K2O A;  1GC6 A;  2MDX A;  1TQZ A;  3G9W A;  1LB1 A;  2DKQ A;  2J0K A;  3P6A A;  4DXA B;  1H10 A;  1UNR A;  3ODX A;  2Z0O A;  5FI1 A;  1NI2 A;  1B55 A;  1UNP A;  2YF0 A;  4GMV A;  2L2I A;  2DA0 A;  2JP2 A;  2P0D A;  4TYZ A;  2YRY A;  2IYB A;  5DIF B;  3SUZ A;  2P0H A;  1GG3 A;  2ELB A;  4YL8 A;  3GYP A;  3VIA A;  1XOD A;  5C5B A;  2G35 A;  1ZM0 A;  1KZ7 A;  3HQC A;  1SGH A;  1UPR A;  1DDV A;  5HE2 A;  2Z0P A;  2P8V A;  1ZC3 B;  2KGX B;  2Y7B A;  4C0A A;  3ODW A;  4HDQ A;  2GCL A;  4HB0 B;  2RUK B;  2J59 M;  5JP4 A;  1EAZ A;  2E2X A;  3HW2 B;  2H7D A;  2VKI A;  1U27 A;  2DFK A;  3D8E A;  3F5R A;  4Z2N A;  1RRP B;  5KCV A;  2K2U A;  2GS0 A;  4EKU A;  4P7I A;  3MDB C;  2GJY A;  5JHG A;  3KY9 A;  2DTC A;  2IFS A;  5DHA B;  2YS5 A;  3SYX A;  2HTH B;  5LON B;  5C79 A;  4WJ7 A;  3FEH A;  5GOW B;  1PFJ A;  4Z2M B;  4A6F A;  3A98 B;  2DYN A;  1EVH A;  3VOQ A;  2YT1 A;  1XR0 B;  2ROV A;  2D9Y A;  2W2X D;  1ZVR A;  2OQB A;  3PSC A;  3GYO A;  5FI0 A;  1DBH A;  2RNR B;  1W1D A;  5HE0 A;  1XCG A;  5J3Y A;  2D11 A;  2D2Q A;  3O96 A;  3TFM A;  3DXD A;  5D27 A;  1UNQ A;  2RVB B;  1EF1 A;  1U5F A;  1FOE A;  2BCJ A;  4HAX B;  4XWX A;  1ZSQ A;  5HE3 A;  1NTV A;  2YS3 A;  1K5D B;  2PZ1 A;  4H8S A;  1U29 A;  3A8Q A;  2MKR A;  2EC1 A;  1I2H A;  4BBK A;  2AEH A;  3PVU A;  1U5G A;  3NSU A;  2RSG A;  4IFS A;  1QC6 A;  3PVL A;  1P5T A;  1LW3 A;  3FSS A;  4IOY X;  3ULC A;  1WJ1 A;  5HE1 A;  5KQ1 A;  1WGU A;  1BAK A;  1DDM A;  2J0M A;  1I7A A;  1MK7 B;  2N0Y A;  4ZRJ A;  1NU2 A;  2CAY A;  3X23 A;  2GCJ A;  1PLS A;  1P6S A;  1UPQ A;  1QQG A;  2D9V A;  4EJN A;  2R09 A;  1WJM A;  1ISN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...