4F7UP

The 6s snrnp assembly intermediate
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
124
structure length
116
Chain Sequence
MVLIMHVSPPEHGLLYTANNIKLKLGDKVVGEGTVYIAQNTLSWQPTELAEGISIEWKQVSLHGISSNPRKCIYFMLDHKVEWNGVYEVTECWLMPEDIATVDTMYSAMTTCQALH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Splicing
molecule keywords Small nuclear ribonucleoprotein Sm D1
publication title Structural Basis of Assembly Chaperone- Mediated snRNP Formation.
pubmed doi rcsb
source organism Mus musculus
total genus 25
structure length 116
sequence length 124
chains with identical sequence Q
ec nomenclature
pdb deposition date 2012-05-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 4f7uP00
3ZDTA 2Y8FA 2K2JA 3HK0A 4EJNA 2MFQA 4HHVA 5LOPB 1KI1B 1UEFA 2DLWA 2KGXB 3KSYA 3SUZA 2J0KA 4XWXA 2MDXA 1H4RA 4PNKA 1E5WA 2CY5A 4KAXB 2M14A 4YONA 3D8FA 1U5FA 3P6AA 1QQGA 2LOZA 1DBHA 1DDVA 2VRWB 2W2XD 3V5WA 1V5UA 1EAZA 2RGNB 1J19A 1WJMA 2H7EA 2DX1A 1KZGA 1GC6A 2CODA 2IFSA 5HE3A 2Y7BA 4KHOA 3KRXA 4HAXB 3GYPA 2J59M 5JHHA 1UPQA 2K00A 1Q67A 5JLJB 1N3HA 5JHGA 5D27A 4TYZA 1ZM0A 2EMSA 3PSCA 4Y94A 5DHFB 4GMVA 2RVBB 2VKIA 3AU4A 4HB2B 2ADZA 1M7EA 1IRSA 1U27A 4ZRKA 1P3RA 3CXBB 3D8EA 1J0WA 1QC6A 1U29A 4D0NB 1MK7B 1FHWA 2D9WA 5D3XA 3GYOA 1XCGA 4NY0A 2GJYA 5DIFB 3U7DA 3HQCA 2XQNM 4YL8A 2AL6A 2LULA 5FI0A 2YS5A 4HB4B 4MT7A 3DXDA 5DI9B 1TXDA 2V76A 4EKUA 5EFXA 4HAUB 5LONB 3WA0A 5J3QA 1RJ2A 3PVWA 2GS0A 4HB0B 4MK0A 2LYDA 2L1CA 1UNRA 1K5GB 3PZDA 1U2BA 1WGQA 1U5DA 3IVFA 1WVHA 4K17A 4KHBB 4IFSA 3T06A 1FGZA 2DA0A 4HAZB 1B55A 3KRWA 5KQ4A 2Z0OA 1PFJA 1PLSA 2UVMA 1EF1A 5D3YA 4DXAB 1BAKA 2D9XA 3TO1A 1V5PA 4ZRJA 4CYEA 3FM8C 4GZUA 4ZRIA 2YS1A 2IYBA 5HE2A 1ZSQA 3QBVB 3F5RA 5J3TA 2UZRA 2CRFA 3ULCA 2R0DA 3PVLA 5C5BB 2I5FA 1SHCA 5L81A 1P5TA 4HAVB 2COFA 2ROZB 2AEHA 2P0HA 4K2PA 2X18A 1XODA 5KQ1A 3MPXA 4HAYB 3N7CA 5FI1A 1TQZA 4WSFA 3NSUA 2PZ1A 4HAWB 2D9YA 1WG7A 4A6FB 1GC7A 2R09A 2I5CA 5JP4A 4HATB 4L6EA 1V5MA 3LJUX 2N0YA 1Y19B 2G35A 2DYNA 1WI1A 2DKPA 5D3VA 2N23A 2W2XC 3ODXA 3AJ4A 1XKEA 3A8PA 1LB1A 2EMTA 1FOEA 2BCJA 3ULBA 2H7DA 2D11A 1I7AA 1MPHA 5DHAB 3BINA 1BTKA 2GCJA 2LKOA 3QIJA 1DDMA 1ZC3B 1NU2A 4CHMA 3X23A 2UZSA 2RUKB 2YS3A 1UPRA 2NZ8B 3DXEA 1ISNA 3U8ZA 4A5KA 1OQNA 3PG7A 4B6HA 4BBKA 2DTCA 2COCA 5C6RA 2D2QA 2P0FA 3KZ1A 3HW2B 2CAYA 5C79A 1X11A 2I1JA 1OY2A 2YT1A 1EVHA 1XR0B 3OANA 2QKMA 2K2UA 4HDQA 4H8SA 5KCVA 2OTXA 1V61A 4DX90 4C0AA 2Q13A 3BJIA 3SNHA 1FHOA 2Z0PA 1XD4A 2ROVA 2RSGA 3PEGA 4CHJA 3TVVA 1MAIA 1XX0A 2FJLA 3F0WA 2P8VA 1X1FA 1KZ7A 4K81A 2W2WA 3KY9A 1EGXA 4WJ7A 1WJ1A 2ZPYA 1U5GA 3A8QA 1ZC4B 1X1GA 2P0DA 1BWNA 3ML4A 2DHKA 2KUPA 2ELBA 4A6HA 2DHIA 2ELAA 4HDOA 5GOWB 3SV1A 2CY4A 1FAOA 4GN1A 2DN6A 5HE1A 3TFMA 4A6KA 2DKQA 1SGHA 1W1DA 4F7HA 1W1HA 3ODOA 3P7ZA 1DROA 1RRPB 1BTNA 1Y5OA 4TKNA 4WVFB 2GCLA 2DHJA 2HTHB 4F7UP 4IAPA 3ZVRA 3VIAA 2QKLA 3QWMA 3TCAA 2EC1A 1X05A 2MKRA 3DXCA 5C16A 3PP2A 2JP2A 3PVUA 3SYXA 2MWNB 2YF0A 2I1KA 3SO6A 2L2IA 4Z2NA 4EMOA 3AU5A 3ODWA 1H10A 3VOQA 3G9WA 3M1IB 2YRYA 1Z87A 1NTVA 4NSWA 3A98B 2COAA 2RNRB 1DYNA 1UNQA 3FSSA 2OQBA 1P6SA 1NTYA 1M7RA 2YVCA 2LOXA 4K2OA 2YSZA 1MK9B 1NI2A 3FEHA 2D10A 1K5DB 4GMXB 1X86A 4KHAA 2YT0A 4P7IA 3CIKA 4HB3B 1OMWA 1WGUA 4GXBA 2D4QA 4F7GA 2Z0QA 1DDWA 4IOYX 2Y8GA 2VSZA 1FHXA 3D8DA 5C5BA 2LG1A 1AQCA 3WYFB 2HE7A 3O96A 1U5EA 5DH9B 5J3YA 3MDBC 2DYQA 2D9ZA 5CLQB 3TW1A 2DFKA 2DX5A 1UNPA 3RCPA 1I2HA 4DX8A 1PMSA 2RLOA 2EJ8A 4KVGB 2KCJA 2NMBA 1W1GA 1V88A 5CLLB 4DBBA 3UZTA 4PQ0A 1FB8A 5HE0A 2J0JA 4A6FA 1MIZB 1MIXA 1TJ6A 1ZVRA 1MKEA 2E2XA 1GG3A 4Z2MB 4MY6A 1AWEA 1V89A 2M38A 2D9VA 1FGYA 2J0MA 4GPTB 1LW3A 5D3WA
chains in the Genus database with same CATH superfamily
3ZDTA 2Y8FA 2K2JA 3HK0A 4DIXA 4EJNA 2MFQA 4HHVA 5LOPB 1KI1B 1UEFA 2DLWA 2KGXB 3KSYA 3SUZA 2J0KA 4XWXA 2MDXA 1H4RA 4PNKA 1E5WA 4QXAB 2CY5A 4KAXB 2M14A 4YONA 3D8FA 1U5FA 3FVCA 3P6AA 1QQGA 2LOZA 1DBHA 1DDVA 2VRWB 2W2XD 3V5WA 1V5UA 2RRFA 1EAZA 2RGNB 1J19A 1WJMA 2H7EA 2DX1A 1KZGA 1GC6A 2CODA 2IFSA 5HE3A 2Y7BA 4KHOA 3KRXA 4HAXB 3GYPA 2J59M 5JHHA 1UPQA 4GOUA 2K00A 2FJUB 1Q67A 5JLJB 1N3HA 5JHGA 5D27A 4TYZA 1ZM0A 2EMSA 3PSCA 4Y94A 5DHFB 4GMVA 2RVBB 2VKIA 3AU4A 4HB2B 2ADZA 3HSAA 1M7EA 1IRSA 1U27A 4ZRKA 3NWFA 1P3RA 3CXBB 3D8EA 1J0WA 1QC6A 1U29A 4D0NB 1MK7B 1FHWA 2D9WA 5D3XA 3GYOA 1XCGA 4NY0A 2GJYA 5DIFB 3U7DA 3HQCA 2XQNM 4YL8A 2AL6A 2LULA 5FI0A 2YS5A 4HB4B 4MT7A 3DXDA 5DI9B 1TXDA 2V76A 4EKUA 3OHMB 3B77A 5EFXA 4HAUB 2R2YA 5LONB 3WA0A 5J3QA 1RJ2A 3PVWA 2GS0A 4HB0B 4MK0A 2LYDA 2L1CA 1UNRA 1K5GB 3PZDA 1U2BA 1WGQA 1U5DA 3IVFA 1WVHA 2K49A 4K17A 4KHBB 4IFSA 3T06A 1FGZA 2DA0A 4HAZB 1B55A 3KRWA 5KQ4A 2Z0OA 1PFJA 1PLSA 2KIGA 2UVMA 1EF1A 5D3YA 4D6WA 4DXAB 1BAKA 2D9XA 3TO1A 1V5PA 4ZRJA 4CYEA 3FM8C 4GZUA 4ZRIA 2YS1A 2IYBA 2Z59A 5HE2A 1ZSQA 1MI1A 3QBVB 3F5RA 5LG4B 5J3TA 2UZRA 2CRFA 3ULCA 2R0DA 3PVLA 5C5BB 2I5FA 1SHCA 5L81A 1P5TA 4HAVB 2COFA 2ROZB 2AEHA 2P0HA 4K2PA 2X18A 1XODA 5KQ1A 3MPXA 5IRSA 4HAYB 3N7CA 5FI1A 1TQZA 4WSFA 2ZKMX 2Z4DA 3NSUA 2PZ1A 4HAWB 2D9YA 1WG7A 3NWDA 4L1RA 2KIEA 4A6FB 1GC7A 2R09A 2I5CA 5JP4A 4HATB 4L6EA 1V5MA 3LJUX 2N0YA 2K8EA 1Y19B 2G35A 3NW8A 2DYNA 1WI1A 2DKPA 5D3VA 2N23A 2W2XC 3ODXA 3AJ4A 1XKEA 3A8PA 3HIEA 1LB1A 2EMTA 1FOEA 2BCJA 3ULBA 2H7DA 2D11A 1I7AA 1MPHA 1ZYIA 3BINA 1BTKA 5DHAB 2GCJA 2LKOA 3QIJA 1T77A 1DDMA 1ZC3B 1NU2A 4CHMA 3X23A 2UZSA 2RUKB 2YS3A 1UPRA 2NZ8B 3DXEA 1ISNA 3U8ZA 4A5KA 1OQNA 3PG7A 4B6HA 2Z13A 4BBKA 2DTCA 2COCA 5C6RA 2D2QA 2P0FA 3KZ1A 3HW2B 2CAYA 5C79A 1X11A 2I1JA 1OY2A 2YT1A 1EVHA 1XR0B 3OANA 2QKMA 2K2UA 4HDQA 4H8SA 5KCVA 2OTXA 1V61A 4DX90 4C0AA 2Q13A 3BJIA 3SNHA 1FHOA 2Z0PA 1XD4A 2ROVA 2RSGA 3PEGA 4CHJA 3TVVA 1MAIA 1XX0A 2FJLA 4CSQA 3F0WA 2P8VA 1X1FA 1KZ7A 4K81A 2W2WA 3KY9A 1EGXA 4WJ7A 1WJ1A 2ZPYA 1U5GA 3A8QA 1ZC4B 1X1GA 2P0DA 1BWNA 3ML4A 2DHKA 2KUPA 2ELBA 4A6HA 2DHIA 2ELAA 4HDOA 5GOWB 3SV1A 2CY4A 1FAOA 4GN1A 2DN6A 5HE1A 3TFMA 4A6KA 2DKQA 1SGHA 1W1DA 4F7HA 1W1HA 3ODOA 5M4YB 3P7ZA 1DROA 1RRPB 1BTNA 1Y5OA 4TKNA 4WVFB 2GCLA 2DHJA 2HTHB 4F7UP 4IAPA 3ZVRA 3VIAA 2QKLA 3QWMA 3TCAA 2EC1A 1X05A 2MKRA 3DXCA 5C16A 3PP2A 2JP2A 3PVUA 3SYXA 4QJ4B 2MWNB 2YF0A 2I1KA 3SO6A 2L2IA 4Z2NA 4EMOA 3AU5A 3ODWA 1H10A 3VOQA 4OT1A 3G9WA 3M1IB 2GUMA 4HSIA 2YRYA 1Z87A 1NTVA 4NSWA 3A98B 2COAA 2RNRB 5I2SA 1DYNA 4QJ3B 1UNQA 3FSSA 4KHBA 2OQBA 1P6SA 1NTYA 1M7RA 2YVCA 2LOXA 4K2OA 2YSZA 1MK9B 5I2MA 1NI2A 3FEHA 2D10A 1K5DB 4GMXB 1X86A 4KHAA 2YT0A 4P7IA 3CIKA 4HB3B 1OMWA 1WGUA 4GXBA 2D4QA 3DCXA 4F7GA 2Z0QA 3U12A 1DDWA 4IOYX 2Y8GA 4QJ5B 2VSZA 2KR0A 1FHXA 3D8DA 5C5BA 2LG1A 1AQCA 3WYFB 2HE7A 3O96A 1U5EA 5DH9B 5J3YA 3MDBC 2DYQA 2D9ZA 5CLQB 3TW1A 2DFKA 2DX5A 1UNPA 3RCPA 1I2HA 4DX8A 1PMSA 2RLOA 2YT2A 2EJ8A 4OSNA 2NBVA 4KVGB 2KCJA 2NMBA 1W1GA 1V88A 5CLLB 4DBBA 3UZTA 4PQ0A 4GNKB 1FB8A 5HE0A 2Z14A 2J0JA 4A6FA 3A58A 1MIZB 1MIXA 1TJ6A 1ZVRA 2KUQA 1MKEA 3NWAA 2E2XA 1GG3A 4Z2MB 4MY6A 1AWEA 1V89A 2M38A 2D9VA 1FGYA 2J0MA 4GPTB 1LW3A 5D3WA
chains in the Genus database with same CATH topology
3ZDTA 2Y8FA 2K2JA 3HK0A 4EJNA 2MFQA 4HHVA 5LOPB 1KI1B 1UEFA 2DLWA 2KGXB 3KSYA 3SUZA 2J0KA 4XWXA 2MDXA 1H4RA 4PNKA 1E5WA 2CY5A 4KAXB 2M14A 4YONA 3D8FA 1U5FA 3P6AA 1QQGA 2LOZA 1DBHA 1DDVA 2VRWB 2W2XD 3V5WA 1V5UA 1EAZA 2RGNB 1J19A 1WJMA 2H7EA 2DX1A 1KZGA 1GC6A 2CODA 2IFSA 5HE3A 2Y7BA 4KHOA 3KRXA 4HAXB 3GYPA 2J59M 5JHHA 1UPQA 2K00A 1Q67A 5JLJB 1N3HA 5JHGA 5D27A 4TYZA 1ZM0A 2EMSA 3PSCA 4Y94A 5DHFB 4GMVA 2RVBB 2VKIA 3AU4A 4HB2B 2ADZA 1M7EA 1IRSA 1U27A 4ZRKA 1P3RA 3CXBB 3D8EA 1J0WA 1QC6A 1U29A 4D0NB 1MK7B 1FHWA 2D9WA 5D3XA 3GYOA 1XCGA 4NY0A 2GJYA 5DIFB 3U7DA 3HQCA 2XQNM 4YL8A 2AL6A 2LULA 5FI0A 2YS5A 4HB4B 4MT7A 3DXDA 5DI9B 1TXDA 2V76A 4EKUA 5EFXA 4HAUB 5LONB 3WA0A 5J3QA 1RJ2A 3PVWA 2GS0A 4HB0B 4MK0A 2LYDA 2L1CA 1UNRA 1K5GB 3PZDA 1U2BA 1WGQA 1U5DA 3IVFA 1WVHA 4K17A 4KHBB 4IFSA 3T06A 1FGZA 2DA0A 4HAZB 1B55A 3KRWA 5KQ4A 2Z0OA 1PFJA 1PLSA 2UVMA 1EF1A 5D3YA 4DXAB 1BAKA 2D9XA 3TO1A 1V5PA 4ZRJA 4CYEA 3FM8C 4GZUA 4ZRIA 2YS1A 2IYBA 5HE2A 1ZSQA 3QBVB 3F5RA 5J3TA 2UZRA 2CRFA 3ULCA 2R0DA 3PVLA 5C5BB 2I5FA 1SHCA 5L81A 1P5TA 4HAVB 2COFA 2ROZB 2AEHA 2P0HA 4K2PA 2X18A 1XODA 5KQ1A 3MPXA 4HAYB 3N7CA 5FI1A 1TQZA 4WSFA 3NSUA 2PZ1A 4HAWB 2D9YA 1WG7A 4A6FB 1GC7A 2R09A 2I5CA 5JP4A 4HATB 4L6EA 1V5MA 3LJUX 2N0YA 1Y19B 2G35A 2DYNA 1WI1A 2DKPA 5D3VA 2N23A 2W2XC 3ODXA 3AJ4A 1XKEA 3A8PA 1LB1A 2EMTA 1FOEA 2BCJA 3ULBA 2H7DA 2D11A 1I7AA 1MPHA 5DHAB 3BINA 1BTKA 2GCJA 2LKOA 3QIJA 1DDMA 1ZC3B 1NU2A 4CHMA 3X23A 2UZSA 2RUKB 2YS3A 1UPRA 2NZ8B 3DXEA 1ISNA 3U8ZA 4A5KA 1OQNA 3PG7A 4B6HA 4BBKA 2DTCA 2COCA 5C6RA 2D2QA 2P0FA 3KZ1A 3HW2B 2CAYA 5C79A 1X11A 2I1JA 1OY2A 2YT1A 1EVHA 1XR0B 3OANA 2QKMA 2K2UA 4HDQA 4H8SA 5KCVA 2OTXA 1V61A 4DX90 4C0AA 2Q13A 3BJIA 3SNHA 1FHOA 2Z0PA 1XD4A 2ROVA 2RSGA 3PEGA 4CHJA 3TVVA 1MAIA 1XX0A 2FJLA 3F0WA 2P8VA 1X1FA 1KZ7A 4K81A 2W2WA 3KY9A 1EGXA 4WJ7A 1WJ1A 2ZPYA 1U5GA 3A8QA 1ZC4B 1X1GA 2P0DA 1BWNA 3ML4A 2DHKA 2KUPA 2ELBA 4A6HA 2DHIA 2ELAA 4HDOA 5GOWB 3SV1A 2CY4A 1FAOA 4GN1A 2DN6A 5HE1A 3TFMA 4A6KA 2DKQA 1SGHA 1W1DA 4F7HA 1W1HA 3ODOA 3P7ZA 1DROA 1RRPB 1BTNA 1Y5OA 4TKNA 4WVFB 2GCLA 2DHJA 2HTHB 4F7UP 4IAPA 3ZVRA 3VIAA 2QKLA 3QWMA 3TCAA 2EC1A 1X05A 2MKRA 3DXCA 5C16A 3PP2A 2JP2A 3PVUA 3SYXA 2MWNB 2YF0A 2I1KA 3SO6A 2L2IA 4Z2NA 4EMOA 3AU5A 3ODWA 1H10A 3VOQA 3G9WA 3M1IB 2YRYA 1Z87A 1NTVA 4NSWA 3A98B 2COAA 2RNRB 1DYNA 1UNQA 3FSSA 2OQBA 1P6SA 1NTYA 1M7RA 2YVCA 2LOXA 4K2OA 2YSZA 1MK9B 1NI2A 3FEHA 2D10A 1K5DB 4GMXB 1X86A 4KHAA 2YT0A 4P7IA 3CIKA 4HB3B 1OMWA 1WGUA 4GXBA 2D4QA 4F7GA 2Z0QA 1DDWA 4IOYX 2Y8GA 2VSZA 1FHXA 3D8DA 5C5BA 2LG1A 1AQCA 3WYFB 2HE7A 3O96A 1U5EA 5DH9B 5J3YA 3MDBC 2DYQA 2D9ZA 5CLQB 3TW1A 2DFKA 2DX5A 1UNPA 3RCPA 1I2HA 4DX8A 1PMSA 2RLOA 2EJ8A 4KVGB 2KCJA 2NMBA 1W1GA 1V88A 5CLLB 4DBBA 3UZTA 4PQ0A 1FB8A 5HE0A 2J0JA 4A6FA 1MIZB 1MIXA 1TJ6A 1ZVRA 1MKEA 2E2XA 1GG3A 4Z2MB 4MY6A 1AWEA 1V89A 2M38A 2D9VA 1FGYA 2J0MA 4GPTB 1LW3A 5D3WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZDT A;  2Y8F A;  2K2J A;  3HK0 A;  4EJN A;  2MFQ A;  4HHV A;  5LOP B;  1KI1 B;  1UEF A;  2DLW A;  2KGX B;  3KSY A;  3SUZ A;  2J0K A;  4XWX A;  2MDX A;  1H4R A;  4PNK A;  1E5W A;  2CY5 A;  4KAX B;  2M14 A;  4YON A;  3D8F A;  1U5F A;  3P6A A;  1QQG A;  2LOZ A;  1DBH A;  1DDV A;  2VRW B;  2W2X D;  3V5W A;  1V5U A;  1EAZ A;  2RGN B;  1J19 A;  1WJM A;  2H7E A;  2DX1 A;  1KZG A;  1GC6 A;  2COD A;  2IFS A;  5HE3 A;  2Y7B A;  4KHO A;  3KRX A;  4HAX B;  3GYP A;  2J59 M;  5JHH A;  1UPQ A;  2K00 A;  1Q67 A;  5JLJ B;  1N3H A;  5JHG A;  5D27 A;  4TYZ A;  1ZM0 A;  2EMS A;  3PSC A;  4Y94 A;  5DHF B;  4GMV A;  2RVB B;  2VKI A;  3AU4 A;  4HB2 B;  2ADZ A;  1M7E A;  1IRS A;  1U27 A;  4ZRK A;  1P3R A;  3CXB B;  3D8E A;  1J0W A;  1QC6 A;  1U29 A;  4D0N B;  1MK7 B;  1FHW A;  2D9W A;  5D3X A;  3GYO A;  1XCG A;  4NY0 A;  2GJY A;  5DIF B;  3U7D A;  3HQC A;  2XQN M;  4YL8 A;  2AL6 A;  2LUL A;  5FI0 A;  2YS5 A;  4HB4 B;  4MT7 A;  3DXD A;  5DI9 B;  1TXD A;  2V76 A;  4EKU A;  5EFX A;  4HAU B;  5LON B;  3WA0 A;  5J3Q A;  1RJ2 A;  3PVW A;  2GS0 A;  4HB0 B;  4MK0 A;  2LYD A;  2L1C A;  1UNR A;  1K5G B;  3PZD A;  1U2B A;  1WGQ A;  1U5D A;  3IVF A;  1WVH A;  4K17 A;  4KHB B;  4IFS A;  3T06 A;  1FGZ A;  2DA0 A;  4HAZ B;  1B55 A;  3KRW A;  5KQ4 A;  2Z0O A;  1PFJ A;  1PLS A;  2UVM A;  1EF1 A;  5D3Y A;  4DXA B;  1BAK A;  2D9X A;  3TO1 A;  1V5P A;  4ZRJ A;  4CYE A;  3FM8 C;  4GZU A;  4ZRI A;  2YS1 A;  2IYB A;  5HE2 A;  1ZSQ A;  3QBV B;  3F5R A;  5J3T A;  2UZR A;  2CRF A;  3ULC A;  2R0D A;  3PVL A;  5C5B B;  2I5F A;  1SHC A;  5L81 A;  1P5T A;  4HAV B;  2COF A;  2ROZ B;  2AEH A;  2P0H A;  4K2P A;  2X18 A;  1XOD A;  5KQ1 A;  3MPX A;  4HAY B;  3N7C A;  5FI1 A;  1TQZ A;  4WSF A;  3NSU A;  2PZ1 A;  4HAW B;  2D9Y A;  1WG7 A;  4A6F B;  1GC7 A;  2R09 A;  2I5C A;  5JP4 A;  4HAT B;  4L6E A;  1V5M A;  3LJU X;  2N0Y A;  1Y19 B;  2G35 A;  2DYN A;  1WI1 A;  2DKP A;  5D3V A;  2N23 A;  2W2X C;  3ODX A;  3AJ4 A;  1XKE A;  3A8P A;  1LB1 A;  2EMT A;  1FOE A;  2BCJ A;  3ULB A;  2H7D A;  2D11 A;  1I7A A;  1MPH A;  5DHA B;  3BIN A;  1BTK A;  2GCJ A;  2LKO A;  3QIJ A;  1DDM A;  1ZC3 B;  1NU2 A;  4CHM A;  3X23 A;  2UZS A;  2RUK B;  2YS3 A;  1UPR A;  2NZ8 B;  3DXE A;  1ISN A;  3U8Z A;  4A5K A;  1OQN A;  3PG7 A;  4B6H A;  4BBK A;  2DTC A;  2COC A;  5C6R A;  2D2Q A;  2P0F A;  3KZ1 A;  3HW2 B;  2CAY A;  5C79 A;  1X11 A;  2I1J A;  1OY2 A;  2YT1 A;  1EVH A;  1XR0 B;  3OAN A;  2QKM A;  2K2U A;  4HDQ A;  4H8S A;  5KCV A;  2OTX A;  1V61 A;  4DX9 0;  4C0A A;  2Q13 A;  3BJI A;  3SNH A;  1FHO A;  2Z0P A;  1XD4 A;  2ROV A;  2RSG A;  3PEG A;  4CHJ A;  3TVV A;  1MAI A;  1XX0 A;  2FJL A;  3F0W A;  2P8V A;  1X1F A;  1KZ7 A;  4K81 A;  2W2W A;  3KY9 A;  1EGX A;  4WJ7 A;  1WJ1 A;  2ZPY A;  1U5G A;  3A8Q A;  1ZC4 B;  1X1G A;  2P0D A;  1BWN A;  3ML4 A;  2DHK A;  2KUP A;  2ELB A;  4A6H A;  2DHI A;  2ELA A;  4HDO A;  5GOW B;  3SV1 A;  2CY4 A;  1FAO A;  4GN1 A;  2DN6 A;  5HE1 A;  3TFM A;  4A6K A;  2DKQ A;  1SGH A;  1W1D A;  4F7H A;  1W1H A;  3ODO A;  3P7Z A;  1DRO A;  1RRP B;  1BTN A;  1Y5O A;  4TKN A;  4WVF B;  2GCL A;  2DHJ A;  2HTH B;  4F7U P;  4IAP A;  3ZVR A;  3VIA A;  2QKL A;  3QWM A;  3TCA A;  2EC1 A;  1X05 A;  2MKR A;  3DXC A;  5C16 A;  3PP2 A;  2JP2 A;  3PVU A;  3SYX A;  2MWN B;  2YF0 A;  2I1K A;  3SO6 A;  2L2I A;  4Z2N A;  4EMO A;  3AU5 A;  3ODW A;  1H10 A;  3VOQ A;  3G9W A;  3M1I B;  2YRY A;  1Z87 A;  1NTV A;  4NSW A;  3A98 B;  2COA A;  2RNR B;  1DYN A;  1UNQ A;  3FSS A;  2OQB A;  1P6S A;  1NTY A;  1M7R A;  2YVC A;  2LOX A;  4K2O A;  2YSZ A;  1MK9 B;  1NI2 A;  3FEH A;  2D10 A;  1K5D B;  4GMX B;  1X86 A;  4KHA A;  2YT0 A;  4P7I A;  3CIK A;  4HB3 B;  1OMW A;  1WGU A;  4GXB A;  2D4Q A;  4F7G A;  2Z0Q A;  1DDW A;  4IOY X;  2Y8G A;  2VSZ A;  1FHX A;  3D8D A;  5C5B A;  2LG1 A;  1AQC A;  3WYF B;  2HE7 A;  3O96 A;  1U5E A;  5DH9 B;  5J3Y A;  3MDB C;  2DYQ A;  2D9Z A;  5CLQ B;  3TW1 A;  2DFK A;  2DX5 A;  1UNP A;  3RCP A;  1I2H A;  4DX8 A;  1PMS A;  2RLO A;  2EJ8 A;  4KVG B;  2KCJ A;  2NMB A;  1W1G A;  1V88 A;  5CLL B;  4DBB A;  3UZT A;  4PQ0 A;  1FB8 A;  5HE0 A;  2J0J A;  4A6F A;  1MIZ B;  1MIX A;  1TJ6 A;  1ZVR A;  1MKE A;  2E2X A;  1GG3 A;  4Z2M B;  4MY6 A;  1AWE A;  1V89 A;  2M38 A;  2D9V A;  1FGY A;  2J0M A;  4GPT B;  1LW3 A;  5D3W A; 
#chains in the Genus database with same CATH topology
 3ZDT A;  2Y8F A;  2K2J A;  3HK0 A;  4DIX A;  4EJN A;  2MFQ A;  4HHV A;  5LOP B;  1KI1 B;  1UEF A;  2DLW A;  2KGX B;  3KSY A;  3SUZ A;  2J0K A;  4XWX A;  2MDX A;  1H4R A;  4PNK A;  1E5W A;  4QXA B;  2CY5 A;  4KAX B;  2M14 A;  4YON A;  3D8F A;  1U5F A;  3FVC A;  3P6A A;  1QQG A;  2LOZ A;  1DBH A;  1DDV A;  2VRW B;  2W2X D;  3V5W A;  1V5U A;  2RRF A;  1EAZ A;  2RGN B;  1J19 A;  1WJM A;  2H7E A;  2DX1 A;  1KZG A;  1GC6 A;  2COD A;  2IFS A;  5HE3 A;  2Y7B A;  4KHO A;  3KRX A;  4HAX B;  3GYP A;  2J59 M;  5JHH A;  1UPQ A;  4GOU A;  2K00 A;  2FJU B;  1Q67 A;  5JLJ B;  1N3H A;  5JHG A;  5D27 A;  4TYZ A;  1ZM0 A;  2EMS A;  3PSC A;  4Y94 A;  5DHF B;  4GMV A;  2RVB B;  2VKI A;  3AU4 A;  4HB2 B;  2ADZ A;  3HSA A;  1M7E A;  1IRS A;  1U27 A;  4ZRK A;  3NWF A;  1P3R A;  3CXB B;  3D8E A;  1J0W A;  1QC6 A;  1U29 A;  4D0N B;  1MK7 B;  1FHW A;  2D9W A;  5D3X A;  3GYO A;  1XCG A;  4NY0 A;  2GJY A;  5DIF B;  3U7D A;  3HQC A;  2XQN M;  4YL8 A;  2AL6 A;  2LUL A;  5FI0 A;  2YS5 A;  4HB4 B;  4MT7 A;  3DXD A;  5DI9 B;  1TXD A;  2V76 A;  4EKU A;  3OHM B;  3B77 A;  5EFX A;  4HAU B;  2R2Y A;  5LON B;  3WA0 A;  5J3Q A;  1RJ2 A;  3PVW A;  2GS0 A;  4HB0 B;  4MK0 A;  2LYD A;  2L1C A;  1UNR A;  1K5G B;  3PZD A;  1U2B A;  1WGQ A;  1U5D A;  3IVF A;  1WVH A;  2K49 A;  4K17 A;  4KHB B;  4IFS A;  3T06 A;  1FGZ A;  2DA0 A;  4HAZ B;  1B55 A;  3KRW A;  5KQ4 A;  2Z0O A;  1PFJ A;  1PLS A;  2KIG A;  2UVM A;  1EF1 A;  5D3Y A;  4D6W A;  4DXA B;  1BAK A;  2D9X A;  3TO1 A;  1V5P A;  4ZRJ A;  4CYE A;  3FM8 C;  4GZU A;  4ZRI A;  2YS1 A;  2IYB A;  2Z59 A;  5HE2 A;  1ZSQ A;  1MI1 A;  3QBV B;  3F5R A;  5LG4 B;  5J3T A;  2UZR A;  2CRF A;  3ULC A;  2R0D A;  3PVL A;  5C5B B;  2I5F A;  1SHC A;  5L81 A;  1P5T A;  4HAV B;  2COF A;  2ROZ B;  2AEH A;  2P0H A;  4K2P A;  2X18 A;  1XOD A;  5KQ1 A;  3MPX A;  5IRS A;  4HAY B;  3N7C A;  5FI1 A;  1TQZ A;  4WSF A;  2ZKM X;  2Z4D A;  3NSU A;  2PZ1 A;  4HAW B;  2D9Y A;  1WG7 A;  3NWD A;  4L1R A;  2KIE A;  4A6F B;  1GC7 A;  2R09 A;  2I5C A;  5JP4 A;  4HAT B;  4L6E A;  1V5M A;  3LJU X;  2N0Y A;  2K8E A;  1Y19 B;  2G35 A;  3NW8 A;  2DYN A;  1WI1 A;  2DKP A;  5D3V A;  2N23 A;  2W2X C;  3ODX A;  3AJ4 A;  1XKE A;  3A8P A;  3HIE A;  1LB1 A;  2EMT A;  1FOE A;  2BCJ A;  3ULB A;  2H7D A;  2D11 A;  1I7A A;  1MPH A;  1ZYI A;  3BIN A;  1BTK A;  5DHA B;  2GCJ A;  2LKO A;  3QIJ A;  1T77 A;  1DDM A;  1ZC3 B;  1NU2 A;  4CHM A;  3X23 A;  2UZS A;  2RUK B;  2YS3 A;  1UPR A;  2NZ8 B;  3DXE A;  1ISN A;  3U8Z A;  4A5K A;  1OQN A;  3PG7 A;  4B6H A;  2Z13 A;  4BBK A;  2DTC A;  2COC A;  5C6R A;  2D2Q A;  2P0F A;  3KZ1 A;  3HW2 B;  2CAY A;  5C79 A;  1X11 A;  2I1J A;  1OY2 A;  2YT1 A;  1EVH A;  1XR0 B;  3OAN A;  2QKM A;  2K2U A;  4HDQ A;  4H8S A;  5KCV A;  2OTX A;  1V61 A;  4DX9 0;  4C0A A;  2Q13 A;  3BJI A;  3SNH A;  1FHO A;  2Z0P A;  1XD4 A;  2ROV A;  2RSG A;  3PEG A;  4CHJ A;  3TVV A;  1MAI A;  1XX0 A;  2FJL A;  4CSQ A;  3F0W A;  2P8V A;  1X1F A;  1KZ7 A;  4K81 A;  2W2W A;  3KY9 A;  1EGX A;  4WJ7 A;  1WJ1 A;  2ZPY A;  1U5G A;  3A8Q A;  1ZC4 B;  1X1G A;  2P0D A;  1BWN A;  3ML4 A;  2DHK A;  2KUP A;  2ELB A;  4A6H A;  2DHI A;  2ELA A;  4HDO A;  5GOW B;  3SV1 A;  2CY4 A;  1FAO A;  4GN1 A;  2DN6 A;  5HE1 A;  3TFM A;  4A6K A;  2DKQ A;  1SGH A;  1W1D A;  4F7H A;  1W1H A;  3ODO A;  5M4Y B;  3P7Z A;  1DRO A;  1RRP B;  1BTN A;  1Y5O A;  4TKN A;  4WVF B;  2GCL A;  2DHJ A;  2HTH B;  4F7U P;  4IAP A;  3ZVR A;  3VIA A;  2QKL A;  3QWM A;  3TCA A;  2EC1 A;  1X05 A;  2MKR A;  3DXC A;  5C16 A;  3PP2 A;  2JP2 A;  3PVU A;  3SYX A;  4QJ4 B;  2MWN B;  2YF0 A;  2I1K A;  3SO6 A;  2L2I A;  4Z2N A;  4EMO A;  3AU5 A;  3ODW A;  1H10 A;  3VOQ A;  4OT1 A;  3G9W A;  3M1I B;  2GUM A;  4HSI A;  2YRY A;  1Z87 A;  1NTV A;  4NSW A;  3A98 B;  2COA A;  2RNR B;  5I2S A;  1DYN A;  4QJ3 B;  1UNQ A;  3FSS A;  4KHB A;  2OQB A;  1P6S A;  1NTY A;  1M7R A;  2YVC A;  2LOX A;  4K2O A;  2YSZ A;  1MK9 B;  5I2M A;  1NI2 A;  3FEH A;  2D10 A;  1K5D B;  4GMX B;  1X86 A;  4KHA A;  2YT0 A;  4P7I A;  3CIK A;  4HB3 B;  1OMW A;  1WGU A;  4GXB A;  2D4Q A;  3DCX A;  4F7G A;  2Z0Q A;  3U12 A;  1DDW A;  4IOY X;  2Y8G A;  4QJ5 B;  2VSZ A;  2KR0 A;  1FHX A;  3D8D A;  5C5B A;  2LG1 A;  1AQC A;  3WYF B;  2HE7 A;  3O96 A;  1U5E A;  5DH9 B;  5J3Y A;  3MDB C;  2DYQ A;  2D9Z A;  5CLQ B;  3TW1 A;  2DFK A;  2DX5 A;  1UNP A;  3RCP A;  1I2H A;  4DX8 A;  1PMS A;  2RLO A;  2YT2 A;  2EJ8 A;  4OSN A;  2NBV A;  4KVG B;  2KCJ A;  2NMB A;  1W1G A;  1V88 A;  5CLL B;  4DBB A;  3UZT A;  4PQ0 A;  4GNK B;  1FB8 A;  5HE0 A;  2Z14 A;  2J0J A;  4A6F A;  3A58 A;  1MIZ B;  1MIX A;  1TJ6 A;  1ZVR A;  2KUQ A;  1MKE A;  3NWA A;  2E2X A;  1GG3 A;  4Z2M B;  4MY6 A;  1AWE A;  1V89 A;  2M38 A;  2D9V A;  1FGY A;  2J0M A;  4GPT B;  1LW3 A;  5D3W A; 
#chains in the Genus database with same CATH homology
 3ZDT A;  2Y8F A;  2K2J A;  3HK0 A;  4EJN A;  2MFQ A;  4HHV A;  5LOP B;  1KI1 B;  1UEF A;  2DLW A;  2KGX B;  3KSY A;  3SUZ A;  2J0K A;  4XWX A;  2MDX A;  1H4R A;  4PNK A;  1E5W A;  2CY5 A;  4KAX B;  2M14 A;  4YON A;  3D8F A;  1U5F A;  3P6A A;  1QQG A;  2LOZ A;  1DBH A;  1DDV A;  2VRW B;  2W2X D;  3V5W A;  1V5U A;  1EAZ A;  2RGN B;  1J19 A;  1WJM A;  2H7E A;  2DX1 A;  1KZG A;  1GC6 A;  2COD A;  2IFS A;  5HE3 A;  2Y7B A;  4KHO A;  3KRX A;  4HAX B;  3GYP A;  2J59 M;  5JHH A;  1UPQ A;  2K00 A;  1Q67 A;  5JLJ B;  1N3H A;  5JHG A;  5D27 A;  4TYZ A;  1ZM0 A;  2EMS A;  3PSC A;  4Y94 A;  5DHF B;  4GMV A;  2RVB B;  2VKI A;  3AU4 A;  4HB2 B;  2ADZ A;  1M7E A;  1IRS A;  1U27 A;  4ZRK A;  1P3R A;  3CXB B;  3D8E A;  1J0W A;  1QC6 A;  1U29 A;  4D0N B;  1MK7 B;  1FHW A;  2D9W A;  5D3X A;  3GYO A;  1XCG A;  4NY0 A;  2GJY A;  5DIF B;  3U7D A;  3HQC A;  2XQN M;  4YL8 A;  2AL6 A;  2LUL A;  5FI0 A;  2YS5 A;  4HB4 B;  4MT7 A;  3DXD A;  5DI9 B;  1TXD A;  2V76 A;  4EKU A;  5EFX A;  4HAU B;  5LON B;  3WA0 A;  5J3Q A;  1RJ2 A;  3PVW A;  2GS0 A;  4HB0 B;  4MK0 A;  2LYD A;  2L1C A;  1UNR A;  1K5G B;  3PZD A;  1U2B A;  1WGQ A;  1U5D A;  3IVF A;  1WVH A;  4K17 A;  4KHB B;  4IFS A;  3T06 A;  1FGZ A;  2DA0 A;  4HAZ B;  1B55 A;  3KRW A;  5KQ4 A;  2Z0O A;  1PFJ A;  1PLS A;  2UVM A;  1EF1 A;  5D3Y A;  4DXA B;  1BAK A;  2D9X A;  3TO1 A;  1V5P A;  4ZRJ A;  4CYE A;  3FM8 C;  4GZU A;  4ZRI A;  2YS1 A;  2IYB A;  5HE2 A;  1ZSQ A;  3QBV B;  3F5R A;  5J3T A;  2UZR A;  2CRF A;  3ULC A;  2R0D A;  3PVL A;  5C5B B;  2I5F A;  1SHC A;  5L81 A;  1P5T A;  4HAV B;  2COF A;  2ROZ B;  2AEH A;  2P0H A;  4K2P A;  2X18 A;  1XOD A;  5KQ1 A;  3MPX A;  4HAY B;  3N7C A;  5FI1 A;  1TQZ A;  4WSF A;  3NSU A;  2PZ1 A;  4HAW B;  2D9Y A;  1WG7 A;  4A6F B;  1GC7 A;  2R09 A;  2I5C A;  5JP4 A;  4HAT B;  4L6E A;  1V5M A;  3LJU X;  2N0Y A;  1Y19 B;  2G35 A;  2DYN A;  1WI1 A;  2DKP A;  5D3V A;  2N23 A;  2W2X C;  3ODX A;  3AJ4 A;  1XKE A;  3A8P A;  1LB1 A;  2EMT A;  1FOE A;  2BCJ A;  3ULB A;  2H7D A;  2D11 A;  1I7A A;  1MPH A;  5DHA B;  3BIN A;  1BTK A;  2GCJ A;  2LKO A;  3QIJ A;  1DDM A;  1ZC3 B;  1NU2 A;  4CHM A;  3X23 A;  2UZS A;  2RUK B;  2YS3 A;  1UPR A;  2NZ8 B;  3DXE A;  1ISN A;  3U8Z A;  4A5K A;  1OQN A;  3PG7 A;  4B6H A;  4BBK A;  2DTC A;  2COC A;  5C6R A;  2D2Q A;  2P0F A;  3KZ1 A;  3HW2 B;  2CAY A;  5C79 A;  1X11 A;  2I1J A;  1OY2 A;  2YT1 A;  1EVH A;  1XR0 B;  3OAN A;  2QKM A;  2K2U A;  4HDQ A;  4H8S A;  5KCV A;  2OTX A;  1V61 A;  4DX9 0;  4C0A A;  2Q13 A;  3BJI A;  3SNH A;  1FHO A;  2Z0P A;  1XD4 A;  2ROV A;  2RSG A;  3PEG A;  4CHJ A;  3TVV A;  1MAI A;  1XX0 A;  2FJL A;  3F0W A;  2P8V A;  1X1F A;  1KZ7 A;  4K81 A;  2W2W A;  3KY9 A;  1EGX A;  4WJ7 A;  1WJ1 A;  2ZPY A;  1U5G A;  3A8Q A;  1ZC4 B;  1X1G A;  2P0D A;  1BWN A;  3ML4 A;  2DHK A;  2KUP A;  2ELB A;  4A6H A;  2DHI A;  2ELA A;  4HDO A;  5GOW B;  3SV1 A;  2CY4 A;  1FAO A;  4GN1 A;  2DN6 A;  5HE1 A;  3TFM A;  4A6K A;  2DKQ A;  1SGH A;  1W1D A;  4F7H A;  1W1H A;  3ODO A;  3P7Z A;  1DRO A;  1RRP B;  1BTN A;  1Y5O A;  4TKN A;  4WVF B;  2GCL A;  2DHJ A;  2HTH B;  4F7U P;  4IAP A;  3ZVR A;  3VIA A;  2QKL A;  3QWM A;  3TCA A;  2EC1 A;  1X05 A;  2MKR A;  3DXC A;  5C16 A;  3PP2 A;  2JP2 A;  3PVU A;  3SYX A;  2MWN B;  2YF0 A;  2I1K A;  3SO6 A;  2L2I A;  4Z2N A;  4EMO A;  3AU5 A;  3ODW A;  1H10 A;  3VOQ A;  3G9W A;  3M1I B;  2YRY A;  1Z87 A;  1NTV A;  4NSW A;  3A98 B;  2COA A;  2RNR B;  1DYN A;  1UNQ A;  3FSS A;  2OQB A;  1P6S A;  1NTY A;  1M7R A;  2YVC A;  2LOX A;  4K2O A;  2YSZ A;  1MK9 B;  1NI2 A;  3FEH A;  2D10 A;  1K5D B;  4GMX B;  1X86 A;  4KHA A;  2YT0 A;  4P7I A;  3CIK A;  4HB3 B;  1OMW A;  1WGU A;  4GXB A;  2D4Q A;  4F7G A;  2Z0Q A;  1DDW A;  4IOY X;  2Y8G A;  2VSZ A;  1FHX A;  3D8D A;  5C5B A;  2LG1 A;  1AQC A;  3WYF B;  2HE7 A;  3O96 A;  1U5E A;  5DH9 B;  5J3Y A;  3MDB C;  2DYQ A;  2D9Z A;  5CLQ B;  3TW1 A;  2DFK A;  2DX5 A;  1UNP A;  3RCP A;  1I2H A;  4DX8 A;  1PMS A;  2RLO A;  2EJ8 A;  4KVG B;  2KCJ A;  2NMB A;  1W1G A;  1V88 A;  5CLL B;  4DBB A;  3UZT A;  4PQ0 A;  1FB8 A;  5HE0 A;  2J0J A;  4A6F A;  1MIZ B;  1MIX A;  1TJ6 A;  1ZVR A;  1MKE A;  2E2X A;  1GG3 A;  4Z2M B;  4MY6 A;  1AWE A;  1V89 A;  2M38 A;  2D9V A;  1FGY A;  2J0M A;  4GPT B;  1LW3 A;  5D3W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...