4F7UP

The 6s snrnp assembly intermediate
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
124
structure length
116
Chain Sequence
b'MVLIMHVSPPEHGLLYTANNIKLKLGDKVVGEGTVYIAQNTLSWQPTELAEGISIEWKQVSLHGISSNPRKCIYFMLDHKVEWNGVYEVTECWLMPEDIATVDTMYSAMTTCQALH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Small nuclear ribonucleoprotein Sm D1
publication title Structural Basis of Assembly Chaperone- Mediated snRNP Formation.
pubmed doi rcsb
source organism Mus musculus
molecule tags Splicing
total genus 25
structure length 116
sequence length 124
chains with identical sequence Q
ec nomenclature
pdb deposition date 2012-05-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 4f7uP00
1WG7A 1FGZA 4CYEA 5EFXA 1DROA 1ZVRA 2H7DA 4A6FA 1NU2A 2AL6A 1U5DA 2BCJA 4L6EA 5J3QA 1GC7A 1TXDA 2J59M 2RLOA 5CLQB 2CRFA 4HB3B 2D9WA 1FAOA 4GMVA 2VKIA 2Y8GA 3HK0A 4YL8A 5C5BA 2YRYA 2Z0PA 2IYBA 3VOQA 4YONA 2DX1A 5C16A 2W2XD 4CHJA 2P8VA 5HE0A 3LJUX 1EAZA 3PVLA 3WYFB 2CY4A 1K5GB 2J0MA 3ZDTA 2LOXA 2D9YA 2D9ZA 5FI0A 4DX90 1U5EA 4F7GA 2EJ8A 2MKRA 1MIZB 4XWXA 1PLSA 2DA0A 2YT1A 2G35A 2MWNB 5JHHA 1V89A 4GXBA 5FI1A 1WGUA 2UZRA 4D0NB 5JLJB 3P6AA 1X11A 4HAZB 1K5DB 1V5MA 2VRWB 3CIKA 1TQZA 2DKQA 2I5FA 1Y5OA 3U7DA 1QQGA 1ZM0A 2DFKA 2Q13A 4IAPA 4B6HA 2K2UA 3AU4A 4ZRJA 1WJMA 2COAA 2D9VA 2J0JA 1DBHA 2Y8FA 5J3YA 4DX8A 1MPHA 1EF1A 3V5WA 2RVBB 3D8FA 2DKPA 4NY0A 1KI1B 1NTYA 3HW2B 5DHFB 1V88A 4HB2B 2OQBA 1W1GA 5C79A 5D3XA 1W1HA 2D10A 4KHAA 1DDVA 2E2XA 2AEHA 2EMTA 2YS3A 1ZC3B 4MT7A 2P0DA 1BAKA 4PQ0A 2QKMA 1J19A 1P5TA 3TCAA 3F0WA 2GJYA 2DLWA 3KRWA 1V5PA 3PVWA 4HAVB 1IRSA 3SYXA 3FM8C 3CXBB 5J3TA 2HTHB 3HQCA 4KAXB 1P6SA 1MK7B 1PMSA 2ZPYA 1U5FA 2ELBA 2PZ1A 3QWMA 1SHCA 2L1CA 2ELAA 2P0HA 1TJ6A 4F7UP 1X1GA 2W2XC 1XX0A 5JP4A 2KGXB 1W1DA 2YT0A 1EGXA 2UVMA 4HAWB 3ULBA 4ZRKA 2Y7BA 4HHVA 4C0AA 3TVVA 4A6HA 1U2BA 4WJ7A 4K2OA 2X18A 2EC1A 1AWEA 4HB0B 1QC6A 1FHOA 2VSZA 1OY2A 2CAYA 4HAUB 1UNPA 2CY5A 3AU5A 3ODWA 2K2JA 2D2QA 1X86A 1Q67A 3ODXA 3N7CA 4DBBA 3T06A 3TFMA 2COFA 2RSGA 2COCA 4H8SA 2NZ8B 4BBKA 4TKNA 2LYDA 2D11A 3ML4A 4HB4B 2J0KA 4HAYB 4K17A 3VIAA 1KZ7A 2RUKB 2DYNA 5D27A 2GCJA 3X23A 4P7IA 1BTKA 3TW1A 2QKLA 3SO6A 3IVFA 5LOPB 1MKEA 3M1IB 4DXAB 1ISNA 5JHGA 2UZSA 2RNRB 4TYZA 2DHJA 1DDWA 4Z2MB 2EMSA 5HE1A 2DYQA 4MY6A 4Y94A 1V5UA 2JP2A 5D3VA 2GS0A 2N0YA 1XODA 3AJ4A 5DIFB 3FEHA 1WGQA 2YVCA 5LONB 4MK0A 1XKEA 2YS5A 2DHKA 4NSWA 2R0DA 4KHOA 2RGNB 2Z0OA 4GPTB 2DTCA 1MIXA 1EVHA 3PP2A 1RJ2A 3GYOA 2MDXA 3MDBC 3ODOA 4HDQA 4IFSA 4EJNA 4GN1A 1E5WA 3A8PA 5C5BB 5DI9B 3D8DA 3G9WA 2Z0QA 1N3HA 1U29A 4Z2NA 2DN6A 1XR0B 4EMOA 2P0FA 4WVFB 4HATB 2YF0A 2LKOA 2YSZA 5D3WA 1UPQA 1J0WA 3DXDA 2K00A 3U8ZA 1UNRA 1NTVA 5KQ4A 1DDMA 3MPXA 3KRXA 5GOWB 4F7HA 4A6KA 2MFQA 1UPRA 3KZ1A 3PVUA 5CLLB 3P7ZA 3O96A 3ULCA 2DHIA 1LB1A 1DYNA 2N23A 3KSYA 5HE3A 5L81A 1FHWA 2LOZA 4IOYX 5KQ1A 2GCLA 1U27A 2HE7A 3RCPA 1FGYA 1AQCA 4CHMA 1X05A 3F5RA 1B55A 1H4RA 2D9XA 4EKUA 2R09A 1SGHA 2NMBA 3DXEA 1WI1A 2YS1A 2DX5A 1WVHA 4PNKA 2M38A 4WSFA 2ADZA 1ZSQA 1BWNA 1XCGA 3QBVB 1XD4A 4ZRIA 2H7EA 3A8QA 3PSCA 2I1KA 2LG1A 3TO1A 1MAIA 2KCJA 3PG7A 2IFSA 4KHBB 1Z87A 1ZC4B 1RRPB 3NSUA 3PEGA 3ZVRA 2KUPA 3BINA 4GZUA 3WA0A 2V76A 1GC6A 1M7RA 3SV1A 1MK9B 1PFJA 5DH9B 1NI2A 3UZTA 3BJIA 3KY9A 1I7AA 2L2IA 3GYPA 1LW3A 5C6RA 1H10A 4A5KA 5D3YA 1OMWA 1X1FA 1OQNA 4K2PA 1KZGA 1WJ1A 1I2HA 5HE2A 1FOEA 2I5CA 2M14A 2I1JA 4A6FB 5KCVA 2D4QA 2W2WA 3DXCA 3OANA 3D8EA 1M7EA 1FB8A 2OTXA 2CODA 3PZDA 1FHXA 3SNHA 4HAXB 1U5GA 2ROZB 3QIJA 1BTNA 4HDOA 2ROVA 4GMXB 3FSSA 4KVGB 3A98B 1UNQA 5DHAB 1GG3A 4K81A 3SUZA 2FJLA 2LULA 2XQNM 1P3RA 1UEFA 1V61A 1Y19B
chains in the Genus database with same CATH superfamily
1WG7A 1FGZA 4CYEA 5EFXA 1DROA 1ZVRA 2H7DA 4GNKB 4A6FA 1NU2A 2AL6A 1U5DA 2BCJA 4L6EA 5J3QA 1GC7A 1TXDA 2J59M 2RLOA 5CLQB 2CRFA 4HB3B 2D9WA 1FAOA 4GMVA 2RRFA 2VKIA 2Y8GA 3HK0A 4YL8A 5C5BA 2YRYA 2Z0PA 2IYBA 3VOQA 4YONA 2DX1A 5C16A 2W2XD 4CHJA 2P8VA 5HE0A 3LJUX 1EAZA 3PVLA 3WYFB 2CY4A 1K5GB 2J0MA 3ZDTA 3U12A 2LOXA 2D9YA 2D9ZA 5LG4B 5FI0A 4DX90 1U5EA 2KIEA 4F7GA 2EJ8A 2MKRA 1MIZB 4XWXA 1PLSA 2DA0A 2YT1A 2G35A 2Z59A 2MWNB 5JHHA 1V89A 4GXBA 5FI1A 2KR0A 1WGUA 2KUQA 4L1RA 2UZRA 4D0NB 5JLJB 4CSQA 3P6AA 1X11A 4HAZB 3NWAA 1K5DB 1V5MA 2VRWB 3CIKA 1TQZA 2DKQA 2I5FA 1Y5OA 3U7DA 1QQGA 1ZM0A 2DFKA 1MI1A 2Q13A 4IAPA 4B6HA 2K2UA 3AU4A 4ZRJA 1WJMA 2COAA 2D9VA 2J0JA 1DBHA 2Y8FA 5J3YA 4DX8A 1MPHA 1EF1A 3V5WA 2RVBB 4QJ3B 3D8FA 2DKPA 4NY0A 1KI1B 4D6WA 1NTYA 3HW2B 5DHFB 1V88A 4GOUA 4HB2B 2OQBA 4KHBA 1W1GA 5C79A 5D3XA 1W1HA 5I2MA 3OHMB 2D10A 4KHAA 1DDVA 2E2XA 2AEHA 2EMTA 2YS3A 1ZC3B 2NBVA 4MT7A 2P0DA 1BAKA 4PQ0A 2QKMA 1J19A 2GUMA 1P5TA 3TCAA 3F0WA 2GJYA 2FJUB 2DLWA 3KRWA 3B77A 1V5PA 3PVWA 4HAVB 1IRSA 3SYXA 3FM8C 3CXBB 5J3TA 2HTHB 3HQCA 2Z13A 4KAXB 1P6SA 1MK7B 1PMSA 2ZPYA 2ZKMX 1U5FA 2ELBA 2PZ1A 3QWMA 1SHCA 2L1CA 2ELAA 2P0HA 1TJ6A 4F7UP 1X1GA 2W2XC 1XX0A 5JP4A 2KGXB 1W1DA 2YT0A 1EGXA 2UVMA 4HAWB 3ULBA 4ZRKA 2Y7BA 4HHVA 2K49A 4C0AA 3TVVA 4A6HA 1U2BA 4WJ7A 4K2OA 4DIXA 2X18A 2KIGA 2EC1A 1AWEA 4HB0B 1QC6A 1FHOA 2VSZA 1OY2A 2CAYA 4HAUB 1UNPA 2CY5A 3AU5A 3ODWA 2K2JA 2D2QA 1X86A 1Q67A 3ODXA 3N7CA 4DBBA 3T06A 3TFMA 3NW8A 2COFA 2RSGA 2COCA 4H8SA 2NZ8B 4BBKA 4TKNA 2LYDA 2R2YA 2D11A 3ML4A 4HB4B 2Z14A 2J0KA 3A58A 4HAYB 4K17A 3VIAA 1KZ7A 2RUKB 2DYNA 5D27A 2GCJA 3X23A 4P7IA 1BTKA 3TW1A 2QKLA 3SO6A 3IVFA 5LOPB 1MKEA 3M1IB 4DXAB 1ISNA 5JHGA 2UZSA 2RNRB 4TYZA 2DHJA 1DDWA 4Z2MB 2EMSA 5HE1A 2DYQA 4MY6A 4Y94A 1V5UA 2JP2A 1ZYIA 2GS0A 5D3VA 2N0YA 1XODA 3AJ4A 5DIFB 3FEHA 1WGQA 2YVCA 5LONB 3HSAA 4MK0A 1XKEA 2YS5A 2DHKA 3NWDA 4NSWA 2R0DA 4KHOA 2RGNB 4OT1A 4QJ4B 2Z0OA 3FVCA 4GPTB 2DTCA 1MIXA 1EVHA 3PP2A 1RJ2A 3GYOA 2MDXA 3MDBC 3ODOA 4HDQA 4IFSA 4EJNA 4GN1A 1E5WA 3A8PA 5C5BB 3DCXA 5DI9B 3D8DA 3G9WA 2Z0QA 1N3HA 1U29A 4Z2NA 2DN6A 1XR0B 4EMOA 2P0FA 4WVFB 4HATB 2YF0A 2LKOA 2YSZA 5D3WA 1UPQA 1J0WA 3DXDA 2K00A 3U8ZA 1UNRA 1NTVA 5KQ4A 1DDMA 3MPXA 3KRXA 5M4YB 5GOWB 4F7HA 4A6KA 2MFQA 1UPRA 3KZ1A 3PVUA 5CLLB 3P7ZA 3O96A 3ULCA 2DHIA 1LB1A 1DYNA 2N23A 3KSYA 4HSIA 5HE3A 5L81A 1FHWA 2LOZA 4IOYX 5KQ1A 2GCLA 1U27A 2HE7A 4QJ5B 3RCPA 1FGYA 1AQCA 4CHMA 1X05A 3F5RA 1B55A 1H4RA 2D9XA 4EKUA 2R09A 1SGHA 2K8EA 2NMBA 3DXEA 1WI1A 2YS1A 2DX5A 1WVHA 3NWFA 4PNKA 2M38A 4WSFA 2ADZA 1ZSQA 1BWNA 1XCGA 3QBVB 4OSNA 1XD4A 4ZRIA 2H7EA 2Z4DA 3A8QA 3PSCA 2I1KA 2LG1A 1T77A 3TO1A 1MAIA 2KCJA 3PG7A 2IFSA 4KHBB 1Z87A 1ZC4B 1RRPB 3NSUA 3PEGA 3ZVRA 2KUPA 3BINA 4GZUA 5I2SA 3WA0A 2V76A 1GC6A 5IRSA 1M7RA 3SV1A 1MK9B 1PFJA 5DH9B 1NI2A 3UZTA 3BJIA 3KY9A 1I7AA 2L2IA 3GYPA 1LW3A 5C6RA 1H10A 4A5KA 5D3YA 1OMWA 1X1FA 1OQNA 2YT2A 1KZGA 4K2PA 1WJ1A 1I2HA 4QXAB 5HE2A 1FOEA 2I5CA 2M14A 2I1JA 4A6FB 5KCVA 2D4QA 2W2WA 3DXCA 3OANA 3D8EA 1M7EA 1FB8A 3HIEA 2OTXA 2CODA 3PZDA 1FHXA 3SNHA 4HAXB 1U5GA 2ROZB 3QIJA 1BTNA 4HDOA 2ROVA 4GMXB 3FSSA 4KVGB 3A98B 1UNQA 5DHAB 1GG3A 4K81A 3SUZA 2FJLA 2LULA 2XQNM 1P3RA 1UEFA 1V61A 1Y19B
chains in the Genus database with same CATH topology
1WG7A 1FGZA 4CYEA 5EFXA 1DROA 1ZVRA 2H7DA 4A6FA 1NU2A 2AL6A 1U5DA 2BCJA 4L6EA 5J3QA 1GC7A 1TXDA 2J59M 2RLOA 5CLQB 2CRFA 4HB3B 2D9WA 1FAOA 4GMVA 2VKIA 2Y8GA 3HK0A 4YL8A 5C5BA 2YRYA 2Z0PA 2IYBA 3VOQA 4YONA 2DX1A 5C16A 2W2XD 4CHJA 2P8VA 5HE0A 3LJUX 1EAZA 3PVLA 3WYFB 2CY4A 1K5GB 2J0MA 3ZDTA 2LOXA 2D9YA 2D9ZA 5FI0A 4DX90 1U5EA 4F7GA 2EJ8A 2MKRA 1MIZB 4XWXA 1PLSA 2DA0A 2YT1A 2G35A 2MWNB 5JHHA 1V89A 4GXBA 5FI1A 1WGUA 2UZRA 4D0NB 5JLJB 3P6AA 1X11A 4HAZB 1K5DB 1V5MA 2VRWB 3CIKA 1TQZA 2DKQA 2I5FA 1Y5OA 3U7DA 1QQGA 1ZM0A 2DFKA 2Q13A 4IAPA 4B6HA 2K2UA 3AU4A 4ZRJA 1WJMA 2COAA 2D9VA 2J0JA 1DBHA 2Y8FA 5J3YA 4DX8A 1MPHA 1EF1A 3V5WA 2RVBB 3D8FA 2DKPA 4NY0A 1KI1B 1NTYA 3HW2B 5DHFB 1V88A 4HB2B 2OQBA 1W1GA 5C79A 5D3XA 1W1HA 2D10A 4KHAA 1DDVA 2E2XA 2AEHA 2EMTA 2YS3A 1ZC3B 4MT7A 2P0DA 1BAKA 4PQ0A 2QKMA 1J19A 1P5TA 3TCAA 3F0WA 2GJYA 2DLWA 3KRWA 1V5PA 3PVWA 4HAVB 1IRSA 3SYXA 3FM8C 3CXBB 5J3TA 2HTHB 3HQCA 4KAXB 1P6SA 1MK7B 1PMSA 2ZPYA 1U5FA 2ELBA 2PZ1A 3QWMA 1SHCA 2L1CA 2ELAA 2P0HA 1TJ6A 4F7UP 1X1GA 2W2XC 1XX0A 5JP4A 2KGXB 1W1DA 2YT0A 1EGXA 2UVMA 4HAWB 3ULBA 4ZRKA 2Y7BA 4HHVA 4C0AA 3TVVA 4A6HA 1U2BA 4WJ7A 4K2OA 2X18A 2EC1A 1AWEA 4HB0B 1QC6A 1FHOA 2VSZA 1OY2A 2CAYA 4HAUB 1UNPA 2CY5A 3AU5A 3ODWA 2K2JA 2D2QA 1X86A 1Q67A 3ODXA 3N7CA 4DBBA 3T06A 3TFMA 2COFA 2RSGA 2COCA 4H8SA 2NZ8B 4BBKA 4TKNA 2LYDA 2D11A 3ML4A 4HB4B 2J0KA 4HAYB 4K17A 3VIAA 1KZ7A 2RUKB 2DYNA 5D27A 2GCJA 3X23A 4P7IA 1BTKA 3TW1A 2QKLA 3SO6A 3IVFA 5LOPB 1MKEA 3M1IB 4DXAB 1ISNA 5JHGA 2UZSA 2RNRB 4TYZA 2DHJA 1DDWA 4Z2MB 2EMSA 5HE1A 2DYQA 4MY6A 4Y94A 1V5UA 2JP2A 5D3VA 2GS0A 2N0YA 1XODA 3AJ4A 5DIFB 3FEHA 1WGQA 2YVCA 5LONB 4MK0A 1XKEA 2YS5A 2DHKA 4NSWA 2R0DA 4KHOA 2RGNB 2Z0OA 4GPTB 2DTCA 1MIXA 1EVHA 3PP2A 1RJ2A 3GYOA 2MDXA 3MDBC 3ODOA 4HDQA 4IFSA 4EJNA 4GN1A 1E5WA 3A8PA 5C5BB 5DI9B 3D8DA 3G9WA 2Z0QA 1N3HA 1U29A 4Z2NA 2DN6A 1XR0B 4EMOA 2P0FA 4WVFB 4HATB 2YF0A 2LKOA 2YSZA 5D3WA 1UPQA 1J0WA 3DXDA 2K00A 3U8ZA 1UNRA 1NTVA 5KQ4A 1DDMA 3MPXA 3KRXA 5GOWB 4F7HA 4A6KA 2MFQA 1UPRA 3KZ1A 3PVUA 5CLLB 3P7ZA 3O96A 3ULCA 2DHIA 1LB1A 1DYNA 2N23A 3KSYA 5HE3A 5L81A 1FHWA 2LOZA 4IOYX 5KQ1A 2GCLA 1U27A 2HE7A 3RCPA 1FGYA 1AQCA 4CHMA 1X05A 3F5RA 1B55A 1H4RA 2D9XA 4EKUA 2R09A 1SGHA 2NMBA 3DXEA 1WI1A 2YS1A 2DX5A 1WVHA 4PNKA 2M38A 4WSFA 2ADZA 1ZSQA 1BWNA 1XCGA 3QBVB 1XD4A 4ZRIA 2H7EA 3A8QA 3PSCA 2I1KA 2LG1A 3TO1A 1MAIA 2KCJA 3PG7A 2IFSA 4KHBB 1Z87A 1ZC4B 1RRPB 3NSUA 3PEGA 3ZVRA 2KUPA 3BINA 4GZUA 3WA0A 2V76A 1GC6A 1M7RA 3SV1A 1MK9B 1PFJA 5DH9B 1NI2A 3UZTA 3BJIA 3KY9A 1I7AA 2L2IA 3GYPA 1LW3A 5C6RA 1H10A 4A5KA 5D3YA 1OMWA 1X1FA 1OQNA 4K2PA 1KZGA 1WJ1A 1I2HA 5HE2A 1FOEA 2I5CA 2M14A 2I1JA 4A6FB 5KCVA 2D4QA 2W2WA 3DXCA 3OANA 3D8EA 1M7EA 1FB8A 2OTXA 2CODA 3PZDA 1FHXA 3SNHA 4HAXB 1U5GA 2ROZB 3QIJA 1BTNA 4HDOA 2ROVA 4GMXB 3FSSA 4KVGB 3A98B 1UNQA 5DHAB 1GG3A 4K81A 3SUZA 2FJLA 2LULA 2XQNM 1P3RA 1UEFA 1V61A 1Y19B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WG7 A;  1FGZ A;  4CYE A;  5EFX A;  1DRO A;  1ZVR A;  2H7D A;  4A6F A;  1NU2 A;  2AL6 A;  1U5D A;  2BCJ A;  4L6E A;  5J3Q A;  1GC7 A;  1TXD A;  2J59 M;  2RLO A;  5CLQ B;  2CRF A;  4HB3 B;  2D9W A;  1FAO A;  4GMV A;  2VKI A;  2Y8G A;  3HK0 A;  4YL8 A;  5C5B A;  2YRY A;  2Z0P A;  2IYB A;  3VOQ A;  4YON A;  2DX1 A;  5C16 A;  2W2X D;  4CHJ A;  2P8V A;  5HE0 A;  3LJU X;  1EAZ A;  3PVL A;  3WYF B;  2CY4 A;  1K5G B;  2J0M A;  3ZDT A;  2LOX A;  2D9Y A;  2D9Z A;  5FI0 A;  4DX9 0;  1U5E A;  4F7G A;  2EJ8 A;  2MKR A;  1MIZ B;  4XWX A;  1PLS A;  2DA0 A;  2YT1 A;  2G35 A;  2MWN B;  5JHH A;  1V89 A;  4GXB A;  5FI1 A;  1WGU A;  2UZR A;  4D0N B;  5JLJ B;  3P6A A;  1X11 A;  4HAZ B;  1K5D B;  1V5M A;  2VRW B;  3CIK A;  1TQZ A;  2DKQ A;  2I5F A;  1Y5O A;  3U7D A;  1QQG A;  1ZM0 A;  2DFK A;  2Q13 A;  4IAP A;  4B6H A;  2K2U A;  3AU4 A;  4ZRJ A;  1WJM A;  2COA A;  2D9V A;  2J0J A;  1DBH A;  2Y8F A;  5J3Y A;  4DX8 A;  1MPH A;  1EF1 A;  3V5W A;  2RVB B;  3D8F A;  2DKP A;  4NY0 A;  1KI1 B;  1NTY A;  3HW2 B;  5DHF B;  1V88 A;  4HB2 B;  2OQB A;  1W1G A;  5C79 A;  5D3X A;  1W1H A;  2D10 A;  4KHA A;  1DDV A;  2E2X A;  2AEH A;  2EMT A;  2YS3 A;  1ZC3 B;  4MT7 A;  2P0D A;  1BAK A;  4PQ0 A;  2QKM A;  1J19 A;  1P5T A;  3TCA A;  3F0W A;  2GJY A;  2DLW A;  3KRW A;  1V5P A;  3PVW A;  4HAV B;  1IRS A;  3SYX A;  3FM8 C;  3CXB B;  5J3T A;  2HTH B;  3HQC A;  4KAX B;  1P6S A;  1MK7 B;  1PMS A;  2ZPY A;  1U5F A;  2ELB A;  2PZ1 A;  3QWM A;  1SHC A;  2L1C A;  2ELA A;  2P0H A;  1TJ6 A;  4F7U P;  1X1G A;  2W2X C;  1XX0 A;  5JP4 A;  2KGX B;  1W1D A;  2YT0 A;  1EGX A;  2UVM A;  4HAW B;  3ULB A;  4ZRK A;  2Y7B A;  4HHV A;  4C0A A;  3TVV A;  4A6H A;  1U2B A;  4WJ7 A;  4K2O A;  2X18 A;  2EC1 A;  1AWE A;  4HB0 B;  1QC6 A;  1FHO A;  2VSZ A;  1OY2 A;  2CAY A;  4HAU B;  1UNP A;  2CY5 A;  3AU5 A;  3ODW A;  2K2J A;  2D2Q A;  1X86 A;  1Q67 A;  3ODX A;  3N7C A;  4DBB A;  3T06 A;  3TFM A;  2COF A;  2RSG A;  2COC A;  4H8S A;  2NZ8 B;  4BBK A;  4TKN A;  2LYD A;  2D11 A;  3ML4 A;  4HB4 B;  2J0K A;  4HAY B;  4K17 A;  3VIA A;  1KZ7 A;  2RUK B;  2DYN A;  5D27 A;  2GCJ A;  3X23 A;  4P7I A;  1BTK A;  3TW1 A;  2QKL A;  3SO6 A;  3IVF A;  5LOP B;  1MKE A;  3M1I B;  4DXA B;  1ISN A;  5JHG A;  2UZS A;  2RNR B;  4TYZ A;  2DHJ A;  1DDW A;  4Z2M B;  2EMS A;  5HE1 A;  2DYQ A;  4MY6 A;  4Y94 A;  1V5U A;  2JP2 A;  5D3V A;  2GS0 A;  2N0Y A;  1XOD A;  3AJ4 A;  5DIF B;  3FEH A;  1WGQ A;  2YVC A;  5LON B;  4MK0 A;  1XKE A;  2YS5 A;  2DHK A;  4NSW A;  2R0D A;  4KHO A;  2RGN B;  2Z0O A;  4GPT B;  2DTC A;  1MIX A;  1EVH A;  3PP2 A;  1RJ2 A;  3GYO A;  2MDX A;  3MDB C;  3ODO A;  4HDQ A;  4IFS A;  4EJN A;  4GN1 A;  1E5W A;  3A8P A;  5C5B B;  5DI9 B;  3D8D A;  3G9W A;  2Z0Q A;  1N3H A;  1U29 A;  4Z2N A;  2DN6 A;  1XR0 B;  4EMO A;  2P0F A;  4WVF B;  4HAT B;  2YF0 A;  2LKO A;  2YSZ A;  5D3W A;  1UPQ A;  1J0W A;  3DXD A;  2K00 A;  3U8Z A;  1UNR A;  1NTV A;  5KQ4 A;  1DDM A;  3MPX A;  3KRX A;  5GOW B;  4F7H A;  4A6K A;  2MFQ A;  1UPR A;  3KZ1 A;  3PVU A;  5CLL B;  3P7Z A;  3O96 A;  3ULC A;  2DHI A;  1LB1 A;  1DYN A;  2N23 A;  3KSY A;  5HE3 A;  5L81 A;  1FHW A;  2LOZ A;  4IOY X;  5KQ1 A;  2GCL A;  1U27 A;  2HE7 A;  3RCP A;  1FGY A;  1AQC A;  4CHM A;  1X05 A;  3F5R A;  1B55 A;  1H4R A;  2D9X A;  4EKU A;  2R09 A;  1SGH A;  2NMB A;  3DXE A;  1WI1 A;  2YS1 A;  2DX5 A;  1WVH A;  4PNK A;  2M38 A;  4WSF A;  2ADZ A;  1ZSQ A;  1BWN A;  1XCG A;  3QBV B;  1XD4 A;  4ZRI A;  2H7E A;  3A8Q A;  3PSC A;  2I1K A;  2LG1 A;  3TO1 A;  1MAI A;  2KCJ A;  3PG7 A;  2IFS A;  4KHB B;  1Z87 A;  1ZC4 B;  1RRP B;  3NSU A;  3PEG A;  3ZVR A;  2KUP A;  3BIN A;  4GZU A;  3WA0 A;  2V76 A;  1GC6 A;  1M7R A;  3SV1 A;  1MK9 B;  1PFJ A;  5DH9 B;  1NI2 A;  3UZT A;  3BJI A;  3KY9 A;  1I7A A;  2L2I A;  3GYP A;  1LW3 A;  5C6R A;  1H10 A;  4A5K A;  5D3Y A;  1OMW A;  1X1F A;  1OQN A;  4K2P A;  1KZG A;  1WJ1 A;  1I2H A;  5HE2 A;  1FOE A;  2I5C A;  2M14 A;  2I1J A;  4A6F B;  5KCV A;  2D4Q A;  2W2W A;  3DXC A;  3OAN A;  3D8E A;  1M7E A;  1FB8 A;  2OTX A;  2COD A;  3PZD A;  1FHX A;  3SNH A;  4HAX B;  1U5G A;  2ROZ B;  3QIJ A;  1BTN A;  4HDO A;  2ROV A;  4GMX B;  3FSS A;  4KVG B;  3A98 B;  1UNQ A;  5DHA B;  1GG3 A;  4K81 A;  3SUZ A;  2FJL A;  2LUL A;  2XQN M;  1P3R A;  1UEF A;  1V61 A;  1Y19 B; 
#chains in the Genus database with same CATH topology
 1WG7 A;  1FGZ A;  4CYE A;  5EFX A;  1DRO A;  1ZVR A;  2H7D A;  4GNK B;  4A6F A;  1NU2 A;  2AL6 A;  1U5D A;  2BCJ A;  4L6E A;  5J3Q A;  1GC7 A;  1TXD A;  2J59 M;  2RLO A;  5CLQ B;  2CRF A;  4HB3 B;  2D9W A;  1FAO A;  4GMV A;  2RRF A;  2VKI A;  2Y8G A;  3HK0 A;  4YL8 A;  5C5B A;  2YRY A;  2Z0P A;  2IYB A;  3VOQ A;  4YON A;  2DX1 A;  5C16 A;  2W2X D;  4CHJ A;  2P8V A;  5HE0 A;  3LJU X;  1EAZ A;  3PVL A;  3WYF B;  2CY4 A;  1K5G B;  2J0M A;  3ZDT A;  3U12 A;  2LOX A;  2D9Y A;  2D9Z A;  5LG4 B;  5FI0 A;  4DX9 0;  1U5E A;  2KIE A;  4F7G A;  2EJ8 A;  2MKR A;  1MIZ B;  4XWX A;  1PLS A;  2DA0 A;  2YT1 A;  2G35 A;  2Z59 A;  2MWN B;  5JHH A;  1V89 A;  4GXB A;  5FI1 A;  2KR0 A;  1WGU A;  2KUQ A;  4L1R A;  2UZR A;  4D0N B;  5JLJ B;  4CSQ A;  3P6A A;  1X11 A;  4HAZ B;  3NWA A;  1K5D B;  1V5M A;  2VRW B;  3CIK A;  1TQZ A;  2DKQ A;  2I5F A;  1Y5O A;  3U7D A;  1QQG A;  1ZM0 A;  2DFK A;  1MI1 A;  2Q13 A;  4IAP A;  4B6H A;  2K2U A;  3AU4 A;  4ZRJ A;  1WJM A;  2COA A;  2D9V A;  2J0J A;  1DBH A;  2Y8F A;  5J3Y A;  4DX8 A;  1MPH A;  1EF1 A;  3V5W A;  2RVB B;  4QJ3 B;  3D8F A;  2DKP A;  4NY0 A;  1KI1 B;  4D6W A;  1NTY A;  3HW2 B;  5DHF B;  1V88 A;  4GOU A;  4HB2 B;  2OQB A;  4KHB A;  1W1G A;  5C79 A;  5D3X A;  1W1H A;  5I2M A;  3OHM B;  2D10 A;  4KHA A;  1DDV A;  2E2X A;  2AEH A;  2EMT A;  2YS3 A;  1ZC3 B;  2NBV A;  4MT7 A;  2P0D A;  1BAK A;  4PQ0 A;  2QKM A;  1J19 A;  2GUM A;  1P5T A;  3TCA A;  3F0W A;  2GJY A;  2FJU B;  2DLW A;  3KRW A;  3B77 A;  1V5P A;  3PVW A;  4HAV B;  1IRS A;  3SYX A;  3FM8 C;  3CXB B;  5J3T A;  2HTH B;  3HQC A;  2Z13 A;  4KAX B;  1P6S A;  1MK7 B;  1PMS A;  2ZPY A;  2ZKM X;  1U5F A;  2ELB A;  2PZ1 A;  3QWM A;  1SHC A;  2L1C A;  2ELA A;  2P0H A;  1TJ6 A;  4F7U P;  1X1G A;  2W2X C;  1XX0 A;  5JP4 A;  2KGX B;  1W1D A;  2YT0 A;  1EGX A;  2UVM A;  4HAW B;  3ULB A;  4ZRK A;  2Y7B A;  4HHV A;  2K49 A;  4C0A A;  3TVV A;  4A6H A;  1U2B A;  4WJ7 A;  4K2O A;  4DIX A;  2X18 A;  2KIG A;  2EC1 A;  1AWE A;  4HB0 B;  1QC6 A;  1FHO A;  2VSZ A;  1OY2 A;  2CAY A;  4HAU B;  1UNP A;  2CY5 A;  3AU5 A;  3ODW A;  2K2J A;  2D2Q A;  1X86 A;  1Q67 A;  3ODX A;  3N7C A;  4DBB A;  3T06 A;  3TFM A;  3NW8 A;  2COF A;  2RSG A;  2COC A;  4H8S A;  2NZ8 B;  4BBK A;  4TKN A;  2LYD A;  2R2Y A;  2D11 A;  3ML4 A;  4HB4 B;  2Z14 A;  2J0K A;  3A58 A;  4HAY B;  4K17 A;  3VIA A;  1KZ7 A;  2RUK B;  2DYN A;  5D27 A;  2GCJ A;  3X23 A;  4P7I A;  1BTK A;  3TW1 A;  2QKL A;  3SO6 A;  3IVF A;  5LOP B;  1MKE A;  3M1I B;  4DXA B;  1ISN A;  5JHG A;  2UZS A;  2RNR B;  4TYZ A;  2DHJ A;  1DDW A;  4Z2M B;  2EMS A;  5HE1 A;  2DYQ A;  4MY6 A;  4Y94 A;  1V5U A;  2JP2 A;  1ZYI A;  2GS0 A;  5D3V A;  2N0Y A;  1XOD A;  3AJ4 A;  5DIF B;  3FEH A;  1WGQ A;  2YVC A;  5LON B;  3HSA A;  4MK0 A;  1XKE A;  2YS5 A;  2DHK A;  3NWD A;  4NSW A;  2R0D A;  4KHO A;  2RGN B;  4OT1 A;  4QJ4 B;  2Z0O A;  3FVC A;  4GPT B;  2DTC A;  1MIX A;  1EVH A;  3PP2 A;  1RJ2 A;  3GYO A;  2MDX A;  3MDB C;  3ODO A;  4HDQ A;  4IFS A;  4EJN A;  4GN1 A;  1E5W A;  3A8P A;  5C5B B;  3DCX A;  5DI9 B;  3D8D A;  3G9W A;  2Z0Q A;  1N3H A;  1U29 A;  4Z2N A;  2DN6 A;  1XR0 B;  4EMO A;  2P0F A;  4WVF B;  4HAT B;  2YF0 A;  2LKO A;  2YSZ A;  5D3W A;  1UPQ A;  1J0W A;  3DXD A;  2K00 A;  3U8Z A;  1UNR A;  1NTV A;  5KQ4 A;  1DDM A;  3MPX A;  3KRX A;  5M4Y B;  5GOW B;  4F7H A;  4A6K A;  2MFQ A;  1UPR A;  3KZ1 A;  3PVU A;  5CLL B;  3P7Z A;  3O96 A;  3ULC A;  2DHI A;  1LB1 A;  1DYN A;  2N23 A;  3KSY A;  4HSI A;  5HE3 A;  5L81 A;  1FHW A;  2LOZ A;  4IOY X;  5KQ1 A;  2GCL A;  1U27 A;  2HE7 A;  4QJ5 B;  3RCP A;  1FGY A;  1AQC A;  4CHM A;  1X05 A;  3F5R A;  1B55 A;  1H4R A;  2D9X A;  4EKU A;  2R09 A;  1SGH A;  2K8E A;  2NMB A;  3DXE A;  1WI1 A;  2YS1 A;  2DX5 A;  1WVH A;  3NWF A;  4PNK A;  2M38 A;  4WSF A;  2ADZ A;  1ZSQ A;  1BWN A;  1XCG A;  3QBV B;  4OSN A;  1XD4 A;  4ZRI A;  2H7E A;  2Z4D A;  3A8Q A;  3PSC A;  2I1K A;  2LG1 A;  1T77 A;  3TO1 A;  1MAI A;  2KCJ A;  3PG7 A;  2IFS A;  4KHB B;  1Z87 A;  1ZC4 B;  1RRP B;  3NSU A;  3PEG A;  3ZVR A;  2KUP A;  3BIN A;  4GZU A;  5I2S A;  3WA0 A;  2V76 A;  1GC6 A;  5IRS A;  1M7R A;  3SV1 A;  1MK9 B;  1PFJ A;  5DH9 B;  1NI2 A;  3UZT A;  3BJI A;  3KY9 A;  1I7A A;  2L2I A;  3GYP A;  1LW3 A;  5C6R A;  1H10 A;  4A5K A;  5D3Y A;  1OMW A;  1X1F A;  1OQN A;  2YT2 A;  1KZG A;  4K2P A;  1WJ1 A;  1I2H A;  4QXA B;  5HE2 A;  1FOE A;  2I5C A;  2M14 A;  2I1J A;  4A6F B;  5KCV A;  2D4Q A;  2W2W A;  3DXC A;  3OAN A;  3D8E A;  1M7E A;  1FB8 A;  3HIE A;  2OTX A;  2COD A;  3PZD A;  1FHX A;  3SNH A;  4HAX B;  1U5G A;  2ROZ B;  3QIJ A;  1BTN A;  4HDO A;  2ROV A;  4GMX B;  3FSS A;  4KVG B;  3A98 B;  1UNQ A;  5DHA B;  1GG3 A;  4K81 A;  3SUZ A;  2FJL A;  2LUL A;  2XQN M;  1P3R A;  1UEF A;  1V61 A;  1Y19 B; 
#chains in the Genus database with same CATH homology
 1WG7 A;  1FGZ A;  4CYE A;  5EFX A;  1DRO A;  1ZVR A;  2H7D A;  4A6F A;  1NU2 A;  2AL6 A;  1U5D A;  2BCJ A;  4L6E A;  5J3Q A;  1GC7 A;  1TXD A;  2J59 M;  2RLO A;  5CLQ B;  2CRF A;  4HB3 B;  2D9W A;  1FAO A;  4GMV A;  2VKI A;  2Y8G A;  3HK0 A;  4YL8 A;  5C5B A;  2YRY A;  2Z0P A;  2IYB A;  3VOQ A;  4YON A;  2DX1 A;  5C16 A;  2W2X D;  4CHJ A;  2P8V A;  5HE0 A;  3LJU X;  1EAZ A;  3PVL A;  3WYF B;  2CY4 A;  1K5G B;  2J0M A;  3ZDT A;  2LOX A;  2D9Y A;  2D9Z A;  5FI0 A;  4DX9 0;  1U5E A;  4F7G A;  2EJ8 A;  2MKR A;  1MIZ B;  4XWX A;  1PLS A;  2DA0 A;  2YT1 A;  2G35 A;  2MWN B;  5JHH A;  1V89 A;  4GXB A;  5FI1 A;  1WGU A;  2UZR A;  4D0N B;  5JLJ B;  3P6A A;  1X11 A;  4HAZ B;  1K5D B;  1V5M A;  2VRW B;  3CIK A;  1TQZ A;  2DKQ A;  2I5F A;  1Y5O A;  3U7D A;  1QQG A;  1ZM0 A;  2DFK A;  2Q13 A;  4IAP A;  4B6H A;  2K2U A;  3AU4 A;  4ZRJ A;  1WJM A;  2COA A;  2D9V A;  2J0J A;  1DBH A;  2Y8F A;  5J3Y A;  4DX8 A;  1MPH A;  1EF1 A;  3V5W A;  2RVB B;  3D8F A;  2DKP A;  4NY0 A;  1KI1 B;  1NTY A;  3HW2 B;  5DHF B;  1V88 A;  4HB2 B;  2OQB A;  1W1G A;  5C79 A;  5D3X A;  1W1H A;  2D10 A;  4KHA A;  1DDV A;  2E2X A;  2AEH A;  2EMT A;  2YS3 A;  1ZC3 B;  4MT7 A;  2P0D A;  1BAK A;  4PQ0 A;  2QKM A;  1J19 A;  1P5T A;  3TCA A;  3F0W A;  2GJY A;  2DLW A;  3KRW A;  1V5P A;  3PVW A;  4HAV B;  1IRS A;  3SYX A;  3FM8 C;  3CXB B;  5J3T A;  2HTH B;  3HQC A;  4KAX B;  1P6S A;  1MK7 B;  1PMS A;  2ZPY A;  1U5F A;  2ELB A;  2PZ1 A;  3QWM A;  1SHC A;  2L1C A;  2ELA A;  2P0H A;  1TJ6 A;  4F7U P;  1X1G A;  2W2X C;  1XX0 A;  5JP4 A;  2KGX B;  1W1D A;  2YT0 A;  1EGX A;  2UVM A;  4HAW B;  3ULB A;  4ZRK A;  2Y7B A;  4HHV A;  4C0A A;  3TVV A;  4A6H A;  1U2B A;  4WJ7 A;  4K2O A;  2X18 A;  2EC1 A;  1AWE A;  4HB0 B;  1QC6 A;  1FHO A;  2VSZ A;  1OY2 A;  2CAY A;  4HAU B;  1UNP A;  2CY5 A;  3AU5 A;  3ODW A;  2K2J A;  2D2Q A;  1X86 A;  1Q67 A;  3ODX A;  3N7C A;  4DBB A;  3T06 A;  3TFM A;  2COF A;  2RSG A;  2COC A;  4H8S A;  2NZ8 B;  4BBK A;  4TKN A;  2LYD A;  2D11 A;  3ML4 A;  4HB4 B;  2J0K A;  4HAY B;  4K17 A;  3VIA A;  1KZ7 A;  2RUK B;  2DYN A;  5D27 A;  2GCJ A;  3X23 A;  4P7I A;  1BTK A;  3TW1 A;  2QKL A;  3SO6 A;  3IVF A;  5LOP B;  1MKE A;  3M1I B;  4DXA B;  1ISN A;  5JHG A;  2UZS A;  2RNR B;  4TYZ A;  2DHJ A;  1DDW A;  4Z2M B;  2EMS A;  5HE1 A;  2DYQ A;  4MY6 A;  4Y94 A;  1V5U A;  2JP2 A;  5D3V A;  2GS0 A;  2N0Y A;  1XOD A;  3AJ4 A;  5DIF B;  3FEH A;  1WGQ A;  2YVC A;  5LON B;  4MK0 A;  1XKE A;  2YS5 A;  2DHK A;  4NSW A;  2R0D A;  4KHO A;  2RGN B;  2Z0O A;  4GPT B;  2DTC A;  1MIX A;  1EVH A;  3PP2 A;  1RJ2 A;  3GYO A;  2MDX A;  3MDB C;  3ODO A;  4HDQ A;  4IFS A;  4EJN A;  4GN1 A;  1E5W A;  3A8P A;  5C5B B;  5DI9 B;  3D8D A;  3G9W A;  2Z0Q A;  1N3H A;  1U29 A;  4Z2N A;  2DN6 A;  1XR0 B;  4EMO A;  2P0F A;  4WVF B;  4HAT B;  2YF0 A;  2LKO A;  2YSZ A;  5D3W A;  1UPQ A;  1J0W A;  3DXD A;  2K00 A;  3U8Z A;  1UNR A;  1NTV A;  5KQ4 A;  1DDM A;  3MPX A;  3KRX A;  5GOW B;  4F7H A;  4A6K A;  2MFQ A;  1UPR A;  3KZ1 A;  3PVU A;  5CLL B;  3P7Z A;  3O96 A;  3ULC A;  2DHI A;  1LB1 A;  1DYN A;  2N23 A;  3KSY A;  5HE3 A;  5L81 A;  1FHW A;  2LOZ A;  4IOY X;  5KQ1 A;  2GCL A;  1U27 A;  2HE7 A;  3RCP A;  1FGY A;  1AQC A;  4CHM A;  1X05 A;  3F5R A;  1B55 A;  1H4R A;  2D9X A;  4EKU A;  2R09 A;  1SGH A;  2NMB A;  3DXE A;  1WI1 A;  2YS1 A;  2DX5 A;  1WVH A;  4PNK A;  2M38 A;  4WSF A;  2ADZ A;  1ZSQ A;  1BWN A;  1XCG A;  3QBV B;  1XD4 A;  4ZRI A;  2H7E A;  3A8Q A;  3PSC A;  2I1K A;  2LG1 A;  3TO1 A;  1MAI A;  2KCJ A;  3PG7 A;  2IFS A;  4KHB B;  1Z87 A;  1ZC4 B;  1RRP B;  3NSU A;  3PEG A;  3ZVR A;  2KUP A;  3BIN A;  4GZU A;  3WA0 A;  2V76 A;  1GC6 A;  1M7R A;  3SV1 A;  1MK9 B;  1PFJ A;  5DH9 B;  1NI2 A;  3UZT A;  3BJI A;  3KY9 A;  1I7A A;  2L2I A;  3GYP A;  1LW3 A;  5C6R A;  1H10 A;  4A5K A;  5D3Y A;  1OMW A;  1X1F A;  1OQN A;  4K2P A;  1KZG A;  1WJ1 A;  1I2H A;  5HE2 A;  1FOE A;  2I5C A;  2M14 A;  2I1J A;  4A6F B;  5KCV A;  2D4Q A;  2W2W A;  3DXC A;  3OAN A;  3D8E A;  1M7E A;  1FB8 A;  2OTX A;  2COD A;  3PZD A;  1FHX A;  3SNH A;  4HAX B;  1U5G A;  2ROZ B;  3QIJ A;  1BTN A;  4HDO A;  2ROV A;  4GMX B;  3FSS A;  4KVG B;  3A98 B;  1UNQ A;  5DHA B;  1GG3 A;  4K81 A;  3SUZ A;  2FJL A;  2LUL A;  2XQN M;  1P3R A;  1UEF A;  1V61 A;  1Y19 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...