4F7UP

The 6s snrnp assembly intermediate
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
124
structure length
116
Chain Sequence
MVLIMHVSPPEHGLLYTANNIKLKLGDKVVGEGTVYIAQNTLSWQPTELAEGISIEWKQVSLHGISSNPRKCIYFMLDHKVEWNGVYEVTECWLMPEDIATVDTMYSAMTTCQALH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural Basis of Assembly Chaperone- Mediated snRNP Formation.
pubmed doi rcsb
source organism Mus musculus
molecule tags Splicing
molecule keywords Small nuclear ribonucleoprotein Sm D1
total genus 25
structure length 116
sequence length 124
chains with identical sequence Q
ec nomenclature
pdb deposition date 2012-05-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 4f7uP00
3ODXA 4HAVB 1BTKA 2DLWA 1V89A 4EKUA 2DN6A 1NI2A 1RRPB 2IFSA 3SUZA 1U5GA 3AJ4A 4DXAB 3FSSA 2DYQA 3VOQA 1EGXA 2COFA 1QC6A 3ZDTA 1K5GB 2RUKB 4DX8A 1DDWA 1XX0A 1AWEA 2AL6A 1LB1A 2R0DA 2OQBA 1Y19B 5HE3A 1U2BA 1UEFA 2RVBB 3IVFA 2D9YA 3VIAA 3DXCA 1WVHA 1ISNA 1FHXA 5HE1A 1I7AA 2QKLA 4NSWA 1X05A 3SYXA 3PP2A 3KRXA 4A6HA 4GPTB 3SO6A 2ROZB 5C79A 1U5FA 3KSYA 1V5PA 3D8DA 2G35A 1U27A 1H10A 3DXEA 1NTYA 1X11A 5HE2A 2ZPYA 3QWMA 2I1KA 5C16A 4XWXA 2D9VA 1SHCA 5DHAB 4HDQA 4PQ0A 2CODA 1Z87A 4K17A 2M38A 4H8SA 3DXDA 4WSFA 1DDVA 3SV1A 3GYOA 1BAKA 2MWNB 3HW2B 1MK9B 2GCLA 5FI0A 1W1HA 4TYZA 4TKNA 1V88A 5KQ1A 4IOYX 3BJIA 1MIZB 1V5UA 2NMBA 2GJYA 2RSGA 2ROVA 3TW1A 5LONB 3V5WA 2VRWB 1U29A 3AU4A 4EMOA 4HATB 3X23A 2XQNM 4NY0A 1BWNA 2Q13A 2OTXA 3OANA 2YS3A 1IRSA 5J3YA 1XODA 4MT7A 4ZRIA 1MK7B 3RCPA 1KZGA 2DYNA 3PZDA 3TVVA 5J3TA 5JLJB 2RNRB 4ZRKA 2MFQA 2MDXA 3AU5A 2LULA 3TCAA 1M7EA 2YT0A 5DH9B 2DTCA 3U8ZA 4BBKA 2CY4A 2COAA 4HHVA 1P6SA 3ZVRA 2M14A 2V76A 3O96A 3HK0A 1TXDA 5JHGA 4K81A 3PVWA 3U7DA 1FGZA 3ODOA 4Y94A 2D9WA 2LOXA 3M1IB 3QIJA 2DHIA 1I2HA 2K2JA 3KY9A 4GMVA 2HTHB 1FHOA 2L1CA 4A6KA 4HB0B 3PSCA 1FB8A 2YT1A 2CAYA 4CHJA 2Y8FA 5C6RA 2UZRA 5J3QA 5GOWB 2Y7BA 1WGQA 1EVHA 4C0AA 2P0FA 4L6EA 1XCGA 2DHJA 4CHMA 1ZC3B 3N7CA 2LKOA 4DBBA 2X18A 3D8EA 1GC6A 2J0MA 2AEHA 1U5EA 2YS5A 4A6FA 5C5BA 5DIFB 2J0KA 2ELAA 2KCJA 2I1JA 2E2XA 4DX90 1QQGA 5D3VA 3FEHA 5DI9B 4F7HA 1NU2A 2UZSA 1MPHA 3KZ1A 3MDBC 2DA0A 4YL8A 2VSZA 1UNRA 2DKQA 3UZTA 3T06A 5D3YA 1PMSA 1UPRA 2H7EA 1XR0B 1DYNA 2K2UA 1UNQA 4GN1A 2LG1A 1V5MA 1P5TA 3WA0A 3KRWA 1KI1B 3P7ZA 2D2QA 2KUPA 1RJ2A 1ZVRA 2J0JA 2D11A 2D4QA 2DHKA 4HAZB 1W1GA 4KHOA 4HAWB 3PVUA 1KZ7A 2BCJA 4Z2NA 3BINA 2IYBA 2YS1A 1WI1A 2CY5A 2PZ1A 4HAXB 4Z2MB 2R09A 2N0YA 1OMWA 5KQ4A 2DX5A 1J0WA 2RLOA 3TFMA 2K00A 3A98B 3HQCA 1E5WA 5D3WA 5DHFB 1PFJA 1SGHA 3QBVB 3FM8C 2CRFA 3P6AA 1U5DA 2YF0A 2EC1A 2ELBA 4HB4B 1Y5OA 2I5FA 1GG3A 1M7RA 4KHAA 5D3XA 2W2XC 2DKPA 1UPQA 2EMSA 2D9XA 5HE0A 1FHWA 1ZM0A 2W2WA 1X1GA 2D9ZA 3G9WA 2N23A 1H4RA 2YSZA 1XD4A 3NSUA 1MKEA 3ML4A 4CYEA 4ZRJA 4K2PA 3A8PA 3A8QA 1DDMA 1GC7A 2P0DA 1MIXA 2J59M 1XKEA 2FJLA 1ZSQA 4GZUA 1NTVA 1DBHA 1PLSA 1FAOA 1P3RA 3ULBA 2COCA 2LOZA 3ULCA 4WJ7A 5EFXA 3LJUX 2Y8GA 1WJMA 3PEGA 4A5KA 1WG7A 3TO1A 1Q67A 4F7GA 2DX1A 4B6HA 3D8FA 1UNPA 2VKIA 2D10A 3F5RA 5KCVA 3CXBB 4KHBB 3CIKA 1B55A 2YVCA 1AQCA 1J19A 5CLQB 1EAZA 1TJ6A 4F7UP 3PG7A 1WGUA 1DROA 2LYDA 2EMTA 4KAXB 2P8VA 1BTNA 5JHHA 2NZ8B 1FOEA 2H7DA 3PVLA 4GXBA 2RGNB 2Z0OA 5L81A 4IAPA 2ADZA 4HAYB 2Z0QA 2I5CA 2Z0PA 4HB2B 4IFSA 4EJNA 4MK0A 5FI1A 5LOPB 2JP2A 1WJ1A 4HB3B 3ODWA 4D0NB 2YRYA 1W1DA 1OQNA 2P0HA 1X1FA 1EF1A 4HDOA 4PNKA 4P7IA 4YONA 5C5BB 3MPXA 4A6FB 3SNHA 3GYPA 2W2XD 4MY6A 4HAUB 1X86A 1ZC4B 5CLLB 2L2IA 2GCJA 2GS0A 1K5DB 2UVMA 1MAIA 1TQZA 4K2OA 2HE7A 4GMXB 1FGYA 4WVFB 5JP4A 2MKRA 3F0WA 2KGXB 1OY2A 2EJ8A 5D27A 1N3HA 2DFKA 4KVGB 3WYFB 1V61A 1LW3A 2QKMA
chains in the Genus database with same CATH superfamily
3ODXA 4HAVB 1BTKA 2DLWA 1V89A 4EKUA 1MI1A 2DN6A 1NI2A 1RRPB 2IFSA 3SUZA 1U5GA 3AJ4A 4DXAB 3FSSA 2DYQA 3HSAA 3VOQA 1EGXA 2COFA 5I2SA 1QC6A 3ZDTA 1K5GB 2RUKB 4DX8A 1DDWA 1XX0A 1AWEA 2AL6A 1LB1A 2R0DA 2OQBA 1Y19B 2GUMA 5HE3A 1U2BA 1UEFA 2RVBB 3IVFA 2D9YA 2Z59A 3VIAA 3DXCA 1WVHA 1ISNA 1FHXA 5HE1A 1I7AA 2QKLA 3HIEA 4NSWA 1X05A 3SYXA 3PP2A 3KRXA 4A6HA 2KIEA 4GPTB 3SO6A 2ROZB 5C79A 1U5FA 3KSYA 1V5PA 2NBVA 3D8DA 2G35A 2ZKMX 4CSQA 1U27A 1H10A 3DXEA 1NTYA 1X11A 4GOUA 5HE2A 2ZPYA 3QWMA 2I1KA 5C16A 4XWXA 2D9VA 1SHCA 5DHAB 3FVCA 4HDQA 4HSIA 4PQ0A 2CODA 1Z87A 4K17A 2M38A 4H8SA 3NWAA 3DXDA 4WSFA 1DDVA 3SV1A 3GYOA 1BAKA 2MWNB 3HW2B 4OT1A 1MK9B 2GCLA 5FI0A 1W1HA 4TYZA 4TKNA 1V88A 5KQ1A 4IOYX 3BJIA 1MIZB 4KHBA 1V5UA 2NMBA 2GJYA 2RSGA 2ROVA 3TW1A 5LONB 3V5WA 2VRWB 1U29A 3AU4A 4EMOA 3DCXA 1T77A 4HATB 3X23A 2XQNM 4NY0A 1BWNA 2Q13A 2OTXA 3OANA 4L1RA 2YT2A 2YS3A 1IRSA 5IRSA 5J3YA 1XODA 4MT7A 4DIXA 4ZRIA 1MK7B 2Z14A 3RCPA 1KZGA 2DYNA 3PZDA 3TVVA 5J3TA 5JLJB 2RNRB 4ZRKA 2MFQA 2MDXA 3AU5A 2LULA 3TCAA 1M7EA 2YT0A 5DH9B 2DTCA 3U8ZA 4BBKA 2CY4A 2COAA 4HHVA 1P6SA 3ZVRA 2M14A 2V76A 3O96A 3HK0A 1TXDA 5JHGA 4K81A 3PVWA 3U7DA 3NWFA 1FGZA 3ODOA 3U12A 4Y94A 2D9WA 2LOXA 3M1IB 3QIJA 2DHIA 1I2HA 2K2JA 3KY9A 4GMVA 2HTHB 1FHOA 2L1CA 4A6KA 4HB0B 3PSCA 1FB8A 2YT1A 2CAYA 4CHJA 2Y8FA 5C6RA 2UZRA 5J3QA 5GOWB 2Y7BA 1WGQA 1EVHA 4C0AA 4QJ5B 2P0FA 4L6EA 1XCGA 2DHJA 4CHMA 3B77A 1ZC3B 3N7CA 4OSNA 2LKOA 4DBBA 2X18A 3D8EA 1GC6A 2J0MA 2AEHA 1U5EA 2YS5A 4A6FA 5C5BA 4GNKB 5DIFB 2J0KA 2RRFA 2ELAA 2KCJA 2I1JA 2E2XA 4DX90 1QQGA 5D3VA 3FEHA 5DI9B 4F7HA 4QJ4B 1NU2A 2UZSA 1MPHA 3KZ1A 3MDBC 2DA0A 4YL8A 2VSZA 1UNRA 2DKQA 2KR0A 3UZTA 3T06A 5D3YA 1PMSA 1UPRA 2H7EA 1XR0B 1DYNA 2K2UA 1UNQA 4GN1A 2LG1A 1V5MA 4D6WA 1P5TA 3WA0A 3KRWA 1KI1B 3P7ZA 2D2QA 2KUPA 5M4YB 1RJ2A 1ZVRA 2J0JA 2D11A 2D4QA 2DHKA 4HAZB 2Z4DA 1W1GA 4KHOA 4HAWB 3PVUA 1KZ7A 2BCJA 4Z2NA 3BINA 2IYBA 2YS1A 1WI1A 2CY5A 2PZ1A 2KIGA 4HAXB 4Z2MB 2R09A 2N0YA 1OMWA 5KQ4A 2DX5A 1J0WA 2RLOA 3TFMA 2K00A 3A98B 3HQCA 1E5WA 5D3WA 5DHFB 1PFJA 1SGHA 3QBVB 3FM8C 2CRFA 3P6AA 1U5DA 2YF0A 2EC1A 2ELBA 4HB4B 1Y5OA 2I5FA 1GG3A 1M7RA 4KHAA 5D3XA 2W2XC 2DKPA 2R2YA 4QJ3B 1UPQA 2EMSA 2D9XA 5HE0A 1FHWA 1ZM0A 3NWDA 2W2WA 1X1GA 2D9ZA 3G9WA 2N23A 1H4RA 2YSZA 1XD4A 3NSUA 1MKEA 3ML4A 4CYEA 4ZRJA 4K2PA 3A8PA 3A8QA 1DDMA 1GC7A 2P0DA 1MIXA 2J59M 1XKEA 2FJLA 1ZSQA 4GZUA 1NTVA 1DBHA 1PLSA 1FAOA 1P3RA 3ULBA 2COCA 2LOZA 3ULCA 4WJ7A 5EFXA 3LJUX 2Y8GA 1WJMA 3PEGA 4A5KA 1WG7A 3TO1A 1Q67A 4F7GA 2DX1A 4B6HA 3D8FA 1UNPA 5I2MA 2VKIA 2D10A 3F5RA 5KCVA 3CXBB 4KHBB 3CIKA 1B55A 2Z13A 2YVCA 1AQCA 1J19A 3NW8A 5CLQB 1EAZA 1TJ6A 4F7UP 3PG7A 1WGUA 1DROA 2LYDA 2EMTA 2KUQA 4KAXB 5LG4B 2P8VA 1BTNA 5JHHA 2NZ8B 1FOEA 2H7DA 3PVLA 4GXBA 2RGNB 2Z0OA 5L81A 4IAPA 2ADZA 4HAYB 2Z0QA 2I5CA 2K49A 2Z0PA 4HB2B 4IFSA 4EJNA 4MK0A 5FI1A 5LOPB 2JP2A 1WJ1A 4HB3B 3ODWA 4D0NB 2YRYA 1W1DA 1OQNA 2P0HA 1X1FA 1EF1A 4HDOA 4PNKA 1ZYIA 4P7IA 4YONA 3MPXA 5C5BB 4A6FB 3SNHA 3GYPA 2W2XD 3OHMB 4HAUB 4MY6A 1X86A 1ZC4B 5CLLB 2L2IA 2GCJA 2GS0A 1K5DB 4QXAB 2UVMA 1MAIA 1TQZA 4K2OA 2K8EA 2HE7A 4GMXB 1FGYA 4WVFB 5JP4A 2MKRA 3F0WA 2KGXB 1OY2A 2FJUB 2EJ8A 5D27A 1N3HA 2DFKA 4KVGB 3A58A 3WYFB 1V61A 1LW3A 2QKMA
chains in the Genus database with same CATH topology
3ODXA 4HAVB 1BTKA 2DLWA 1V89A 4EKUA 2DN6A 1NI2A 1RRPB 2IFSA 3SUZA 1U5GA 3AJ4A 4DXAB 3FSSA 2DYQA 3VOQA 1EGXA 2COFA 1QC6A 3ZDTA 1K5GB 2RUKB 4DX8A 1DDWA 1XX0A 1AWEA 2AL6A 1LB1A 2R0DA 2OQBA 1Y19B 5HE3A 1U2BA 1UEFA 2RVBB 3IVFA 2D9YA 3VIAA 3DXCA 1WVHA 1ISNA 1FHXA 5HE1A 1I7AA 2QKLA 4NSWA 1X05A 3SYXA 3PP2A 3KRXA 4A6HA 4GPTB 3SO6A 2ROZB 5C79A 1U5FA 3KSYA 1V5PA 3D8DA 2G35A 1U27A 1H10A 3DXEA 1NTYA 1X11A 5HE2A 2ZPYA 3QWMA 2I1KA 5C16A 4XWXA 2D9VA 1SHCA 5DHAB 4HDQA 4PQ0A 2CODA 1Z87A 4K17A 2M38A 4H8SA 3DXDA 4WSFA 1DDVA 3SV1A 3GYOA 1BAKA 2MWNB 3HW2B 1MK9B 2GCLA 5FI0A 1W1HA 4TYZA 4TKNA 1V88A 5KQ1A 4IOYX 3BJIA 1MIZB 1V5UA 2NMBA 2GJYA 2RSGA 2ROVA 3TW1A 5LONB 3V5WA 2VRWB 1U29A 3AU4A 4EMOA 4HATB 3X23A 2XQNM 4NY0A 1BWNA 2Q13A 2OTXA 3OANA 2YS3A 1IRSA 5J3YA 1XODA 4MT7A 4ZRIA 1MK7B 3RCPA 1KZGA 2DYNA 3PZDA 3TVVA 5J3TA 5JLJB 2RNRB 4ZRKA 2MFQA 2MDXA 3AU5A 2LULA 3TCAA 1M7EA 2YT0A 5DH9B 2DTCA 3U8ZA 4BBKA 2CY4A 2COAA 4HHVA 1P6SA 3ZVRA 2M14A 2V76A 3O96A 3HK0A 1TXDA 5JHGA 4K81A 3PVWA 3U7DA 1FGZA 3ODOA 4Y94A 2D9WA 2LOXA 3M1IB 3QIJA 2DHIA 1I2HA 2K2JA 3KY9A 4GMVA 2HTHB 1FHOA 2L1CA 4A6KA 4HB0B 3PSCA 1FB8A 2YT1A 2CAYA 4CHJA 2Y8FA 5C6RA 2UZRA 5J3QA 5GOWB 2Y7BA 1WGQA 1EVHA 4C0AA 2P0FA 4L6EA 1XCGA 2DHJA 4CHMA 1ZC3B 3N7CA 2LKOA 4DBBA 2X18A 3D8EA 1GC6A 2J0MA 2AEHA 1U5EA 2YS5A 4A6FA 5C5BA 5DIFB 2J0KA 2ELAA 2KCJA 2I1JA 2E2XA 4DX90 1QQGA 5D3VA 3FEHA 5DI9B 4F7HA 1NU2A 2UZSA 1MPHA 3KZ1A 3MDBC 2DA0A 4YL8A 2VSZA 1UNRA 2DKQA 3UZTA 3T06A 5D3YA 1PMSA 1UPRA 2H7EA 1XR0B 1DYNA 2K2UA 1UNQA 4GN1A 2LG1A 1V5MA 1P5TA 3WA0A 3KRWA 1KI1B 3P7ZA 2D2QA 2KUPA 1RJ2A 1ZVRA 2J0JA 2D11A 2D4QA 2DHKA 4HAZB 1W1GA 4KHOA 4HAWB 3PVUA 1KZ7A 2BCJA 4Z2NA 3BINA 2IYBA 2YS1A 1WI1A 2CY5A 2PZ1A 4HAXB 4Z2MB 2R09A 2N0YA 1OMWA 5KQ4A 2DX5A 1J0WA 2RLOA 3TFMA 2K00A 3A98B 3HQCA 1E5WA 5D3WA 5DHFB 1PFJA 1SGHA 3QBVB 3FM8C 2CRFA 3P6AA 1U5DA 2YF0A 2EC1A 2ELBA 4HB4B 1Y5OA 2I5FA 1GG3A 1M7RA 4KHAA 5D3XA 2W2XC 2DKPA 1UPQA 2EMSA 2D9XA 5HE0A 1FHWA 1ZM0A 2W2WA 1X1GA 2D9ZA 3G9WA 2N23A 1H4RA 2YSZA 1XD4A 3NSUA 1MKEA 3ML4A 4CYEA 4ZRJA 4K2PA 3A8PA 3A8QA 1DDMA 1GC7A 2P0DA 1MIXA 2J59M 1XKEA 2FJLA 1ZSQA 4GZUA 1NTVA 1DBHA 1PLSA 1FAOA 1P3RA 3ULBA 2COCA 2LOZA 3ULCA 4WJ7A 5EFXA 3LJUX 2Y8GA 1WJMA 3PEGA 4A5KA 1WG7A 3TO1A 1Q67A 4F7GA 2DX1A 4B6HA 3D8FA 1UNPA 2VKIA 2D10A 3F5RA 5KCVA 3CXBB 4KHBB 3CIKA 1B55A 2YVCA 1AQCA 1J19A 5CLQB 1EAZA 1TJ6A 4F7UP 3PG7A 1WGUA 1DROA 2LYDA 2EMTA 4KAXB 2P8VA 1BTNA 5JHHA 2NZ8B 1FOEA 2H7DA 3PVLA 4GXBA 2RGNB 2Z0OA 5L81A 4IAPA 2ADZA 4HAYB 2Z0QA 2I5CA 2Z0PA 4HB2B 4IFSA 4EJNA 4MK0A 5FI1A 5LOPB 2JP2A 1WJ1A 4HB3B 3ODWA 4D0NB 2YRYA 1W1DA 1OQNA 2P0HA 1X1FA 1EF1A 4HDOA 4PNKA 4P7IA 4YONA 5C5BB 3MPXA 4A6FB 3SNHA 3GYPA 2W2XD 4MY6A 4HAUB 1X86A 1ZC4B 5CLLB 2L2IA 2GCJA 2GS0A 1K5DB 2UVMA 1MAIA 1TQZA 4K2OA 2HE7A 4GMXB 1FGYA 4WVFB 5JP4A 2MKRA 3F0WA 2KGXB 1OY2A 2EJ8A 5D27A 1N3HA 2DFKA 4KVGB 3WYFB 1V61A 1LW3A 2QKMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ODX A;  4HAV B;  1BTK A;  2DLW A;  1V89 A;  4EKU A;  2DN6 A;  1NI2 A;  1RRP B;  2IFS A;  3SUZ A;  1U5G A;  3AJ4 A;  4DXA B;  3FSS A;  2DYQ A;  3VOQ A;  1EGX A;  2COF A;  1QC6 A;  3ZDT A;  1K5G B;  2RUK B;  4DX8 A;  1DDW A;  1XX0 A;  1AWE A;  2AL6 A;  1LB1 A;  2R0D A;  2OQB A;  1Y19 B;  5HE3 A;  1U2B A;  1UEF A;  2RVB B;  3IVF A;  2D9Y A;  3VIA A;  3DXC A;  1WVH A;  1ISN A;  1FHX A;  5HE1 A;  1I7A A;  2QKL A;  4NSW A;  1X05 A;  3SYX A;  3PP2 A;  3KRX A;  4A6H A;  4GPT B;  3SO6 A;  2ROZ B;  5C79 A;  1U5F A;  3KSY A;  1V5P A;  3D8D A;  2G35 A;  1U27 A;  1H10 A;  3DXE A;  1NTY A;  1X11 A;  5HE2 A;  2ZPY A;  3QWM A;  2I1K A;  5C16 A;  4XWX A;  2D9V A;  1SHC A;  5DHA B;  4HDQ A;  4PQ0 A;  2COD A;  1Z87 A;  4K17 A;  2M38 A;  4H8S A;  3DXD A;  4WSF A;  1DDV A;  3SV1 A;  3GYO A;  1BAK A;  2MWN B;  3HW2 B;  1MK9 B;  2GCL A;  5FI0 A;  1W1H A;  4TYZ A;  4TKN A;  1V88 A;  5KQ1 A;  4IOY X;  3BJI A;  1MIZ B;  1V5U A;  2NMB A;  2GJY A;  2RSG A;  2ROV A;  3TW1 A;  5LON B;  3V5W A;  2VRW B;  1U29 A;  3AU4 A;  4EMO A;  4HAT B;  3X23 A;  2XQN M;  4NY0 A;  1BWN A;  2Q13 A;  2OTX A;  3OAN A;  2YS3 A;  1IRS A;  5J3Y A;  1XOD A;  4MT7 A;  4ZRI A;  1MK7 B;  3RCP A;  1KZG A;  2DYN A;  3PZD A;  3TVV A;  5J3T A;  5JLJ B;  2RNR B;  4ZRK A;  2MFQ A;  2MDX A;  3AU5 A;  2LUL A;  3TCA A;  1M7E A;  2YT0 A;  5DH9 B;  2DTC A;  3U8Z A;  4BBK A;  2CY4 A;  2COA A;  4HHV A;  1P6S A;  3ZVR A;  2M14 A;  2V76 A;  3O96 A;  3HK0 A;  1TXD A;  5JHG A;  4K81 A;  3PVW A;  3U7D A;  1FGZ A;  3ODO A;  4Y94 A;  2D9W A;  2LOX A;  3M1I B;  3QIJ A;  2DHI A;  1I2H A;  2K2J A;  3KY9 A;  4GMV A;  2HTH B;  1FHO A;  2L1C A;  4A6K A;  4HB0 B;  3PSC A;  1FB8 A;  2YT1 A;  2CAY A;  4CHJ A;  2Y8F A;  5C6R A;  2UZR A;  5J3Q A;  5GOW B;  2Y7B A;  1WGQ A;  1EVH A;  4C0A A;  2P0F A;  4L6E A;  1XCG A;  2DHJ A;  4CHM A;  1ZC3 B;  3N7C A;  2LKO A;  4DBB A;  2X18 A;  3D8E A;  1GC6 A;  2J0M A;  2AEH A;  1U5E A;  2YS5 A;  4A6F A;  5C5B A;  5DIF B;  2J0K A;  2ELA A;  2KCJ A;  2I1J A;  2E2X A;  4DX9 0;  1QQG A;  5D3V A;  3FEH A;  5DI9 B;  4F7H A;  1NU2 A;  2UZS A;  1MPH A;  3KZ1 A;  3MDB C;  2DA0 A;  4YL8 A;  2VSZ A;  1UNR A;  2DKQ A;  3UZT A;  3T06 A;  5D3Y A;  1PMS A;  1UPR A;  2H7E A;  1XR0 B;  1DYN A;  2K2U A;  1UNQ A;  4GN1 A;  2LG1 A;  1V5M A;  1P5T A;  3WA0 A;  3KRW A;  1KI1 B;  3P7Z A;  2D2Q A;  2KUP A;  1RJ2 A;  1ZVR A;  2J0J A;  2D11 A;  2D4Q A;  2DHK A;  4HAZ B;  1W1G A;  4KHO A;  4HAW B;  3PVU A;  1KZ7 A;  2BCJ A;  4Z2N A;  3BIN A;  2IYB A;  2YS1 A;  1WI1 A;  2CY5 A;  2PZ1 A;  4HAX B;  4Z2M B;  2R09 A;  2N0Y A;  1OMW A;  5KQ4 A;  2DX5 A;  1J0W A;  2RLO A;  3TFM A;  2K00 A;  3A98 B;  3HQC A;  1E5W A;  5D3W A;  5DHF B;  1PFJ A;  1SGH A;  3QBV B;  3FM8 C;  2CRF A;  3P6A A;  1U5D A;  2YF0 A;  2EC1 A;  2ELB A;  4HB4 B;  1Y5O A;  2I5F A;  1GG3 A;  1M7R A;  4KHA A;  5D3X A;  2W2X C;  2DKP A;  1UPQ A;  2EMS A;  2D9X A;  5HE0 A;  1FHW A;  1ZM0 A;  2W2W A;  1X1G A;  2D9Z A;  3G9W A;  2N23 A;  1H4R A;  2YSZ A;  1XD4 A;  3NSU A;  1MKE A;  3ML4 A;  4CYE A;  4ZRJ A;  4K2P A;  3A8P A;  3A8Q A;  1DDM A;  1GC7 A;  2P0D A;  1MIX A;  2J59 M;  1XKE A;  2FJL A;  1ZSQ A;  4GZU A;  1NTV A;  1DBH A;  1PLS A;  1FAO A;  1P3R A;  3ULB A;  2COC A;  2LOZ A;  3ULC A;  4WJ7 A;  5EFX A;  3LJU X;  2Y8G A;  1WJM A;  3PEG A;  4A5K A;  1WG7 A;  3TO1 A;  1Q67 A;  4F7G A;  2DX1 A;  4B6H A;  3D8F A;  1UNP A;  2VKI A;  2D10 A;  3F5R A;  5KCV A;  3CXB B;  4KHB B;  3CIK A;  1B55 A;  2YVC A;  1AQC A;  1J19 A;  5CLQ B;  1EAZ A;  1TJ6 A;  4F7U P;  3PG7 A;  1WGU A;  1DRO A;  2LYD A;  2EMT A;  4KAX B;  2P8V A;  1BTN A;  5JHH A;  2NZ8 B;  1FOE A;  2H7D A;  3PVL A;  4GXB A;  2RGN B;  2Z0O A;  5L81 A;  4IAP A;  2ADZ A;  4HAY B;  2Z0Q A;  2I5C A;  2Z0P A;  4HB2 B;  4IFS A;  4EJN A;  4MK0 A;  5FI1 A;  5LOP B;  2JP2 A;  1WJ1 A;  4HB3 B;  3ODW A;  4D0N B;  2YRY A;  1W1D A;  1OQN A;  2P0H A;  1X1F A;  1EF1 A;  4HDO A;  4PNK A;  4P7I A;  4YON A;  5C5B B;  3MPX A;  4A6F B;  3SNH A;  3GYP A;  2W2X D;  4MY6 A;  4HAU B;  1X86 A;  1ZC4 B;  5CLL B;  2L2I A;  2GCJ A;  2GS0 A;  1K5D B;  2UVM A;  1MAI A;  1TQZ A;  4K2O A;  2HE7 A;  4GMX B;  1FGY A;  4WVF B;  5JP4 A;  2MKR A;  3F0W A;  2KGX B;  1OY2 A;  2EJ8 A;  5D27 A;  1N3H A;  2DFK A;  4KVG B;  3WYF B;  1V61 A;  1LW3 A;  2QKM A; 
#chains in the Genus database with same CATH topology
 3ODX A;  4HAV B;  1BTK A;  2DLW A;  1V89 A;  4EKU A;  1MI1 A;  2DN6 A;  1NI2 A;  1RRP B;  2IFS A;  3SUZ A;  1U5G A;  3AJ4 A;  4DXA B;  3FSS A;  2DYQ A;  3HSA A;  3VOQ A;  1EGX A;  2COF A;  5I2S A;  1QC6 A;  3ZDT A;  1K5G B;  2RUK B;  4DX8 A;  1DDW A;  1XX0 A;  1AWE A;  2AL6 A;  1LB1 A;  2R0D A;  2OQB A;  1Y19 B;  2GUM A;  5HE3 A;  1U2B A;  1UEF A;  2RVB B;  3IVF A;  2D9Y A;  2Z59 A;  3VIA A;  3DXC A;  1WVH A;  1ISN A;  1FHX A;  5HE1 A;  1I7A A;  2QKL A;  3HIE A;  4NSW A;  1X05 A;  3SYX A;  3PP2 A;  3KRX A;  4A6H A;  2KIE A;  4GPT B;  3SO6 A;  2ROZ B;  5C79 A;  1U5F A;  3KSY A;  1V5P A;  2NBV A;  3D8D A;  2G35 A;  2ZKM X;  4CSQ A;  1U27 A;  1H10 A;  3DXE A;  1NTY A;  1X11 A;  4GOU A;  5HE2 A;  2ZPY A;  3QWM A;  2I1K A;  5C16 A;  4XWX A;  2D9V A;  1SHC A;  5DHA B;  3FVC A;  4HDQ A;  4HSI A;  4PQ0 A;  2COD A;  1Z87 A;  4K17 A;  2M38 A;  4H8S A;  3NWA A;  3DXD A;  4WSF A;  1DDV A;  3SV1 A;  3GYO A;  1BAK A;  2MWN B;  3HW2 B;  4OT1 A;  1MK9 B;  2GCL A;  5FI0 A;  1W1H A;  4TYZ A;  4TKN A;  1V88 A;  5KQ1 A;  4IOY X;  3BJI A;  1MIZ B;  4KHB A;  1V5U A;  2NMB A;  2GJY A;  2RSG A;  2ROV A;  3TW1 A;  5LON B;  3V5W A;  2VRW B;  1U29 A;  3AU4 A;  4EMO A;  3DCX A;  1T77 A;  4HAT B;  3X23 A;  2XQN M;  4NY0 A;  1BWN A;  2Q13 A;  2OTX A;  3OAN A;  4L1R A;  2YT2 A;  2YS3 A;  1IRS A;  5IRS A;  5J3Y A;  1XOD A;  4MT7 A;  4DIX A;  4ZRI A;  1MK7 B;  2Z14 A;  3RCP A;  1KZG A;  2DYN A;  3PZD A;  3TVV A;  5J3T A;  5JLJ B;  2RNR B;  4ZRK A;  2MFQ A;  2MDX A;  3AU5 A;  2LUL A;  3TCA A;  1M7E A;  2YT0 A;  5DH9 B;  2DTC A;  3U8Z A;  4BBK A;  2CY4 A;  2COA A;  4HHV A;  1P6S A;  3ZVR A;  2M14 A;  2V76 A;  3O96 A;  3HK0 A;  1TXD A;  5JHG A;  4K81 A;  3PVW A;  3U7D A;  3NWF A;  1FGZ A;  3ODO A;  3U12 A;  4Y94 A;  2D9W A;  2LOX A;  3M1I B;  3QIJ A;  2DHI A;  1I2H A;  2K2J A;  3KY9 A;  4GMV A;  2HTH B;  1FHO A;  2L1C A;  4A6K A;  4HB0 B;  3PSC A;  1FB8 A;  2YT1 A;  2CAY A;  4CHJ A;  2Y8F A;  5C6R A;  2UZR A;  5J3Q A;  5GOW B;  2Y7B A;  1WGQ A;  1EVH A;  4C0A A;  4QJ5 B;  2P0F A;  4L6E A;  1XCG A;  2DHJ A;  4CHM A;  3B77 A;  1ZC3 B;  3N7C A;  4OSN A;  2LKO A;  4DBB A;  2X18 A;  3D8E A;  1GC6 A;  2J0M A;  2AEH A;  1U5E A;  2YS5 A;  4A6F A;  5C5B A;  4GNK B;  5DIF B;  2J0K A;  2RRF A;  2ELA A;  2KCJ A;  2I1J A;  2E2X A;  4DX9 0;  1QQG A;  5D3V A;  3FEH A;  5DI9 B;  4F7H A;  4QJ4 B;  1NU2 A;  2UZS A;  1MPH A;  3KZ1 A;  3MDB C;  2DA0 A;  4YL8 A;  2VSZ A;  1UNR A;  2DKQ A;  2KR0 A;  3UZT A;  3T06 A;  5D3Y A;  1PMS A;  1UPR A;  2H7E A;  1XR0 B;  1DYN A;  2K2U A;  1UNQ A;  4GN1 A;  2LG1 A;  1V5M A;  4D6W A;  1P5T A;  3WA0 A;  3KRW A;  1KI1 B;  3P7Z A;  2D2Q A;  2KUP A;  5M4Y B;  1RJ2 A;  1ZVR A;  2J0J A;  2D11 A;  2D4Q A;  2DHK A;  4HAZ B;  2Z4D A;  1W1G A;  4KHO A;  4HAW B;  3PVU A;  1KZ7 A;  2BCJ A;  4Z2N A;  3BIN A;  2IYB A;  2YS1 A;  1WI1 A;  2CY5 A;  2PZ1 A;  2KIG A;  4HAX B;  4Z2M B;  2R09 A;  2N0Y A;  1OMW A;  5KQ4 A;  2DX5 A;  1J0W A;  2RLO A;  3TFM A;  2K00 A;  3A98 B;  3HQC A;  1E5W A;  5D3W A;  5DHF B;  1PFJ A;  1SGH A;  3QBV B;  3FM8 C;  2CRF A;  3P6A A;  1U5D A;  2YF0 A;  2EC1 A;  2ELB A;  4HB4 B;  1Y5O A;  2I5F A;  1GG3 A;  1M7R A;  4KHA A;  5D3X A;  2W2X C;  2DKP A;  2R2Y A;  4QJ3 B;  1UPQ A;  2EMS A;  2D9X A;  5HE0 A;  1FHW A;  1ZM0 A;  3NWD A;  2W2W A;  1X1G A;  2D9Z A;  3G9W A;  2N23 A;  1H4R A;  2YSZ A;  1XD4 A;  3NSU A;  1MKE A;  3ML4 A;  4CYE A;  4ZRJ A;  4K2P A;  3A8P A;  3A8Q A;  1DDM A;  1GC7 A;  2P0D A;  1MIX A;  2J59 M;  1XKE A;  2FJL A;  1ZSQ A;  4GZU A;  1NTV A;  1DBH A;  1PLS A;  1FAO A;  1P3R A;  3ULB A;  2COC A;  2LOZ A;  3ULC A;  4WJ7 A;  5EFX A;  3LJU X;  2Y8G A;  1WJM A;  3PEG A;  4A5K A;  1WG7 A;  3TO1 A;  1Q67 A;  4F7G A;  2DX1 A;  4B6H A;  3D8F A;  1UNP A;  5I2M A;  2VKI A;  2D10 A;  3F5R A;  5KCV A;  3CXB B;  4KHB B;  3CIK A;  1B55 A;  2Z13 A;  2YVC A;  1AQC A;  1J19 A;  3NW8 A;  5CLQ B;  1EAZ A;  1TJ6 A;  4F7U P;  3PG7 A;  1WGU A;  1DRO A;  2LYD A;  2EMT A;  2KUQ A;  4KAX B;  5LG4 B;  2P8V A;  1BTN A;  5JHH A;  2NZ8 B;  1FOE A;  2H7D A;  3PVL A;  4GXB A;  2RGN B;  2Z0O A;  5L81 A;  4IAP A;  2ADZ A;  4HAY B;  2Z0Q A;  2I5C A;  2K49 A;  2Z0P A;  4HB2 B;  4IFS A;  4EJN A;  4MK0 A;  5FI1 A;  5LOP B;  2JP2 A;  1WJ1 A;  4HB3 B;  3ODW A;  4D0N B;  2YRY A;  1W1D A;  1OQN A;  2P0H A;  1X1F A;  1EF1 A;  4HDO A;  4PNK A;  1ZYI A;  4P7I A;  4YON A;  3MPX A;  5C5B B;  4A6F B;  3SNH A;  3GYP A;  2W2X D;  3OHM B;  4HAU B;  4MY6 A;  1X86 A;  1ZC4 B;  5CLL B;  2L2I A;  2GCJ A;  2GS0 A;  1K5D B;  4QXA B;  2UVM A;  1MAI A;  1TQZ A;  4K2O A;  2K8E A;  2HE7 A;  4GMX B;  1FGY A;  4WVF B;  5JP4 A;  2MKR A;  3F0W A;  2KGX B;  1OY2 A;  2FJU B;  2EJ8 A;  5D27 A;  1N3H A;  2DFK A;  4KVG B;  3A58 A;  3WYF B;  1V61 A;  1LW3 A;  2QKM A; 
#chains in the Genus database with same CATH homology
 3ODX A;  4HAV B;  1BTK A;  2DLW A;  1V89 A;  4EKU A;  2DN6 A;  1NI2 A;  1RRP B;  2IFS A;  3SUZ A;  1U5G A;  3AJ4 A;  4DXA B;  3FSS A;  2DYQ A;  3VOQ A;  1EGX A;  2COF A;  1QC6 A;  3ZDT A;  1K5G B;  2RUK B;  4DX8 A;  1DDW A;  1XX0 A;  1AWE A;  2AL6 A;  1LB1 A;  2R0D A;  2OQB A;  1Y19 B;  5HE3 A;  1U2B A;  1UEF A;  2RVB B;  3IVF A;  2D9Y A;  3VIA A;  3DXC A;  1WVH A;  1ISN A;  1FHX A;  5HE1 A;  1I7A A;  2QKL A;  4NSW A;  1X05 A;  3SYX A;  3PP2 A;  3KRX A;  4A6H A;  4GPT B;  3SO6 A;  2ROZ B;  5C79 A;  1U5F A;  3KSY A;  1V5P A;  3D8D A;  2G35 A;  1U27 A;  1H10 A;  3DXE A;  1NTY A;  1X11 A;  5HE2 A;  2ZPY A;  3QWM A;  2I1K A;  5C16 A;  4XWX A;  2D9V A;  1SHC A;  5DHA B;  4HDQ A;  4PQ0 A;  2COD A;  1Z87 A;  4K17 A;  2M38 A;  4H8S A;  3DXD A;  4WSF A;  1DDV A;  3SV1 A;  3GYO A;  1BAK A;  2MWN B;  3HW2 B;  1MK9 B;  2GCL A;  5FI0 A;  1W1H A;  4TYZ A;  4TKN A;  1V88 A;  5KQ1 A;  4IOY X;  3BJI A;  1MIZ B;  1V5U A;  2NMB A;  2GJY A;  2RSG A;  2ROV A;  3TW1 A;  5LON B;  3V5W A;  2VRW B;  1U29 A;  3AU4 A;  4EMO A;  4HAT B;  3X23 A;  2XQN M;  4NY0 A;  1BWN A;  2Q13 A;  2OTX A;  3OAN A;  2YS3 A;  1IRS A;  5J3Y A;  1XOD A;  4MT7 A;  4ZRI A;  1MK7 B;  3RCP A;  1KZG A;  2DYN A;  3PZD A;  3TVV A;  5J3T A;  5JLJ B;  2RNR B;  4ZRK A;  2MFQ A;  2MDX A;  3AU5 A;  2LUL A;  3TCA A;  1M7E A;  2YT0 A;  5DH9 B;  2DTC A;  3U8Z A;  4BBK A;  2CY4 A;  2COA A;  4HHV A;  1P6S A;  3ZVR A;  2M14 A;  2V76 A;  3O96 A;  3HK0 A;  1TXD A;  5JHG A;  4K81 A;  3PVW A;  3U7D A;  1FGZ A;  3ODO A;  4Y94 A;  2D9W A;  2LOX A;  3M1I B;  3QIJ A;  2DHI A;  1I2H A;  2K2J A;  3KY9 A;  4GMV A;  2HTH B;  1FHO A;  2L1C A;  4A6K A;  4HB0 B;  3PSC A;  1FB8 A;  2YT1 A;  2CAY A;  4CHJ A;  2Y8F A;  5C6R A;  2UZR A;  5J3Q A;  5GOW B;  2Y7B A;  1WGQ A;  1EVH A;  4C0A A;  2P0F A;  4L6E A;  1XCG A;  2DHJ A;  4CHM A;  1ZC3 B;  3N7C A;  2LKO A;  4DBB A;  2X18 A;  3D8E A;  1GC6 A;  2J0M A;  2AEH A;  1U5E A;  2YS5 A;  4A6F A;  5C5B A;  5DIF B;  2J0K A;  2ELA A;  2KCJ A;  2I1J A;  2E2X A;  4DX9 0;  1QQG A;  5D3V A;  3FEH A;  5DI9 B;  4F7H A;  1NU2 A;  2UZS A;  1MPH A;  3KZ1 A;  3MDB C;  2DA0 A;  4YL8 A;  2VSZ A;  1UNR A;  2DKQ A;  3UZT A;  3T06 A;  5D3Y A;  1PMS A;  1UPR A;  2H7E A;  1XR0 B;  1DYN A;  2K2U A;  1UNQ A;  4GN1 A;  2LG1 A;  1V5M A;  1P5T A;  3WA0 A;  3KRW A;  1KI1 B;  3P7Z A;  2D2Q A;  2KUP A;  1RJ2 A;  1ZVR A;  2J0J A;  2D11 A;  2D4Q A;  2DHK A;  4HAZ B;  1W1G A;  4KHO A;  4HAW B;  3PVU A;  1KZ7 A;  2BCJ A;  4Z2N A;  3BIN A;  2IYB A;  2YS1 A;  1WI1 A;  2CY5 A;  2PZ1 A;  4HAX B;  4Z2M B;  2R09 A;  2N0Y A;  1OMW A;  5KQ4 A;  2DX5 A;  1J0W A;  2RLO A;  3TFM A;  2K00 A;  3A98 B;  3HQC A;  1E5W A;  5D3W A;  5DHF B;  1PFJ A;  1SGH A;  3QBV B;  3FM8 C;  2CRF A;  3P6A A;  1U5D A;  2YF0 A;  2EC1 A;  2ELB A;  4HB4 B;  1Y5O A;  2I5F A;  1GG3 A;  1M7R A;  4KHA A;  5D3X A;  2W2X C;  2DKP A;  1UPQ A;  2EMS A;  2D9X A;  5HE0 A;  1FHW A;  1ZM0 A;  2W2W A;  1X1G A;  2D9Z A;  3G9W A;  2N23 A;  1H4R A;  2YSZ A;  1XD4 A;  3NSU A;  1MKE A;  3ML4 A;  4CYE A;  4ZRJ A;  4K2P A;  3A8P A;  3A8Q A;  1DDM A;  1GC7 A;  2P0D A;  1MIX A;  2J59 M;  1XKE A;  2FJL A;  1ZSQ A;  4GZU A;  1NTV A;  1DBH A;  1PLS A;  1FAO A;  1P3R A;  3ULB A;  2COC A;  2LOZ A;  3ULC A;  4WJ7 A;  5EFX A;  3LJU X;  2Y8G A;  1WJM A;  3PEG A;  4A5K A;  1WG7 A;  3TO1 A;  1Q67 A;  4F7G A;  2DX1 A;  4B6H A;  3D8F A;  1UNP A;  2VKI A;  2D10 A;  3F5R A;  5KCV A;  3CXB B;  4KHB B;  3CIK A;  1B55 A;  2YVC A;  1AQC A;  1J19 A;  5CLQ B;  1EAZ A;  1TJ6 A;  4F7U P;  3PG7 A;  1WGU A;  1DRO A;  2LYD A;  2EMT A;  4KAX B;  2P8V A;  1BTN A;  5JHH A;  2NZ8 B;  1FOE A;  2H7D A;  3PVL A;  4GXB A;  2RGN B;  2Z0O A;  5L81 A;  4IAP A;  2ADZ A;  4HAY B;  2Z0Q A;  2I5C A;  2Z0P A;  4HB2 B;  4IFS A;  4EJN A;  4MK0 A;  5FI1 A;  5LOP B;  2JP2 A;  1WJ1 A;  4HB3 B;  3ODW A;  4D0N B;  2YRY A;  1W1D A;  1OQN A;  2P0H A;  1X1F A;  1EF1 A;  4HDO A;  4PNK A;  4P7I A;  4YON A;  5C5B B;  3MPX A;  4A6F B;  3SNH A;  3GYP A;  2W2X D;  4MY6 A;  4HAU B;  1X86 A;  1ZC4 B;  5CLL B;  2L2I A;  2GCJ A;  2GS0 A;  1K5D B;  2UVM A;  1MAI A;  1TQZ A;  4K2O A;  2HE7 A;  4GMX B;  1FGY A;  4WVF B;  5JP4 A;  2MKR A;  3F0W A;  2KGX B;  1OY2 A;  2EJ8 A;  5D27 A;  1N3H A;  2DFK A;  4KVG B;  3WYF B;  1V61 A;  1LW3 A;  2QKM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...