1X11A

X11 ptb domain
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
170
structure length
135
Chain Sequence
MEDLIDGIIFAANYLGSTQLLSDKTPSKNVRMMQAQEAVSRIKMAQMTEVDLFILTQRIKVLNADTQETMMDHPLRTISYIADIGNIVVLMARDGKRQYKMICHVFESEDAQLIAQSIGQAFSVAYQEFLRANGI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Complex (peptide binding module/peptide)
molecule keywords X11
publication title Sequence-specific recognition of the internalization motif of the Alzheimer's amyloid precursor protein by the X11 PTB domain.
pubmed doi rcsb
source organism Homo sapiens
total genus 30
structure length 135
sequence length 170
chains with identical sequence B
ec nomenclature
pdb deposition date 1997-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00640 PID Phosphotyrosine interaction domain (PTB/PID)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 1x11A00
5C5BB 4GN1A 4ZRJA 1TQZA 2UZSA 3A8QA 3ODOA 1GC7A 5KQ1A 3MPXA 1PFJA 1M7RA 1Z87A 4CHJA 2YS3A 5DH9B 5DI9B 2EJ8A 1WGQA 4Y94A 2YSZA 1FHXA 4WVFB 2DKPA 3WYFB 1QQGA 4HAZB 3PVWA 1NI2A 1RRPB 3PZDA 1BTKA 4A5KA 1EVHA 2QKMA 4DX90 3ML4A 2Y8FA 4MK0A 3SV1A 1WI1A 3T06A 5D3WA 2I1JA 2YF0A 3CXBB 1Y5OA 2Z0OA 4F7HA 2D4QA 2D9ZA 2M14A 4EJNA 2DA0A 3ODWA 4GMXB 2K2UA 1FOEA 3V5WA 1MK9B 2RLOA 1SHCA 2P8VA 2D9XA 3N7CA 3D8EA 1AQCA 1EGXA 4DX8A 4HB4B 4IOYX 4D0NB 4CHMA 2EMSA 3F0WA 5C16A 1FGZA 4HB3B 1WJ1A 5GOWB 1V5MA 2OTXA 3HK0A 1UEFA 2IYBA 2ELAA 2H7EA 1X86A 1U29A 2MKRA 4IAPA 1N3HA 1ZVRA 2D9WA 3OANA 4BBKA 5HE0A 2J59M 4IFSA 2DYNA 4EMOA 5J3TA 2I5FA 2ADZA 2DHKA 1U5EA 4HB2B 2CAYA 2DYQA 3ZDTA 2D9VA 5CLLB 2ROVA 1H4RA 4GXBA 3TCAA 2N0YA 2NMBA 3A98B 1BTNA 4MT7A 3RCPA 4A6KA 3PP2A 3QIJA 1X1FA 2P0FA 2GCLA 1MKEA 2YS1A 4K17A 2J0KA 4DXAB 4A6HA 2Y7BA 3SYXA 5JP4A 1AWEA 2KCJA 2P0HA 2RVBB 1FAOA 1XCGA 4HDQA 3CIKA 2LOXA 2YRYA 2RGNB 2COCA 3UZTA 1MIZB 2LOZA 5FI1A 2HE7A 1FGYA 3PVUA 2Q13A 5D27A 5EFXA 3M1IB 2EMTA 1NTYA 3PG7A 1FHWA 2G35A 2K00A 3TFMA 4B6HA 4WSFA 5C5BA 3FM8C 1H10A 2OQBA 2PZ1A 2ROZB 2V76A 3DXCA 1MK7B 5C79A 1LB1A 2YS5A 5J3QA 1P5TA 1ZC4B 1GC6A 3AJ4A 3D8DA 5HE3A 1BAKA 1V5PA 2YVCA 3ZVRA 1ZM0A 2H7DA 2DTCA 5KQ4A 2J0JA 2AL6A 1OMWA 1WVHA 3LJUX 4K2PA 1ISNA 3ODXA 2LG1A 1I7AA 3TVVA 3TO1A 3QBVB 3HW2B 2I5CA 2CY5A 4ZRIA 1UNRA 1EF1A 2DN6A 4TKNA 5J3YA 5HE1A 4DBBA 1U27A 3PEGA 3AU5A 5D3VA 2EC1A 4Z2NA 1M7EA 2VKIA 1LW3A 2XQNM 3SO6A 3U7DA 3VIAA 2J0MA 1P3RA 1IRSA 2LULA 2AEHA 1U5FA 2KUPA 4ZRKA 1NU2A 1ZC3B 3ULBA 1TJ6A 3PVLA 4NSWA 3KY9A 2MWNB 3FSSA 1PMSA 1QC6A 1XX0A 4Z2MB 3WA0A 1BWNA 4KHAA 4EKUA 2Z0PA 1UNPA 2R09A 5KCVA 1ZSQA 3DXDA 1V88A 5FI0A 4NY0A 1W1DA 1OY2A 2DLWA 3SNHA 2VSZA 1NTVA 4WJ7A 2UZRA 4K2OA 2Z0QA 1XD4A 3D8FA 4YL8A 1U2BA 2COAA 5DHFB 2W2XC 1MAIA 1KI1B 1P6SA 5JHHA 2LKOA 4MY6A 2HTHB 2N23A 3QWMA 4K81A 3P7ZA 3TW1A 2ELBA 1K5GB 2CRFA 5DIFB 1V61A 5HE2A 2BCJA 1WGUA 2W2WA 1W1GA 3KSYA 4TYZA 2W2XD 1DDWA 2R0DA 2DX5A 3G9WA 4PQ0A 3A8PA 3HQCA 2IFSA 3KRWA 2CODA 4KHOA 1DYNA 1XKEA 3KRXA 1J0WA 2ZPYA 5JHGA 1E5WA 3FEHA 2K2JA 1KZGA 3SUZA 1Q67A 1UNQA 1W1HA 4HDOA 1DDVA 3F5RA 1B55A 4HATB 2FJLA 4F7GA 1X1GA 2E2XA 1V5UA 1OQNA 1EAZA 2D2QA 1MPHA 2I1KA 4GMVA 4HB0B 1SGHA 3BINA 2CY4A 4HAYB 5D3XA 4PNKA 5JLJB 2D10A 3X23A 2MFQA 2JP2A 2UVMA 1U5DA 2GCJA 1K5DB 5CLQB 2D11A 2X18A 2RSGA 4C0AA 4GZUA 2DX1A 1GG3A 2GS0A 4KVGB 3O96A 2LYDA 1UPQA 2DHIA 3U8ZA 4KAXB 1XODA 3MDBC 2RUKB 2COFA 4HAXB 1TXDA 2KGXB 1X11A 2NZ8B 3AU4A 1DROA 2P0DA 1DBHA 1Y19B 4HAVB 1UPRA 3ULCA 2MDXA 3PSCA 2DHJA 1WG7A 3VOQA 1J19A 1X05A 2VRWB 3KZ1A 3GYPA 1FHOA 4HAWB 4A6FB 1I2HA 5L81A 3P6AA 4P7IA 5C6RA 2RNRB 4KHBB 5LONB 4L6EA 2DKQA 2Y8GA 2M38A 3DXEA 2QKLA 1KZ7A 2L1CA 1WJMA 4CYEA 3GYOA 1RJ2A 4H8SA 4HHVA 2GJYA 5DHAB 5D3YA 1DDMA 3BJIA 1MIXA 1V89A 1U5GA 1XR0B 2L2IA 4F7UP 4A6FA 2DFKA 3IVFA 4HAUB 4GPTB 2YT1A 4YONA 1FB8A 3NSUA 5LOPB 2YT0A 1PLSA 2D9YA 4XWXA
chains in the Genus database with same CATH superfamily
5C5BB 4GN1A 4ZRJA 1TQZA 2UZSA 3A8QA 3ODOA 1GC7A 5KQ1A 2KUQA 3MPXA 1PFJA 1M7RA 1Z87A 4CHJA 2YS3A 5DH9B 3B77A 5DI9B 2EJ8A 1WGQA 2Z13A 4Y94A 2YSZA 4OSNA 1FHXA 4WVFB 2DKPA 3WYFB 1QQGA 4HAZB 3PVWA 1NI2A 1RRPB 3PZDA 1BTKA 4A5KA 1EVHA 2QKMA 4DX90 3ML4A 2Y8FA 2Z4DA 4MK0A 3SV1A 1WI1A 3T06A 5D3WA 2I1JA 2KIGA 2YF0A 1Y5OA 3CXBB 4QXAB 2Z0OA 4F7HA 2D4QA 2D9ZA 4HSIA 2M14A 4EJNA 2DA0A 3ODWA 4GMXB 2K2UA 1FOEA 3V5WA 1MK9B 3NWAA 3OHMB 2RLOA 1SHCA 2P8VA 2D9XA 3N7CA 3D8EA 1AQCA 1EGXA 4DX8A 4HB4B 4IOYX 4D0NB 4CHMA 2EMSA 2GUMA 3F0WA 5C16A 1FGZA 4HB3B 1WJ1A 5GOWB 3A58A 1V5MA 2OTXA 2K49A 3HK0A 1UEFA 2Z59A 2IYBA 2ELAA 2H7EA 1X86A 3DCXA 1U29A 2MKRA 4IAPA 1N3HA 1ZVRA 2D9WA 3OANA 4BBKA 5HE0A 2J59M 4IFSA 2DYNA 4EMOA 5J3TA 2I5FA 2ADZA 2DHKA 1U5EA 4HB2B 2CAYA 2DYQA 3ZDTA 2D9VA 5CLLB 2ROVA 1H4RA 4GXBA 3TCAA 2N0YA 2NMBA 3A98B 1BTNA 4MT7A 3RCPA 4A6KA 3PP2A 3QIJA 3HSAA 1X1FA 2P0FA 2GCLA 4GNKB 1MKEA 2YS1A 4K17A 2J0KA 4DXAB 4A6HA 2Y7BA 3SYXA 5JP4A 1AWEA 2KCJA 2P0HA 2RVBB 1FAOA 1XCGA 4HDQA 3CIKA 2LOXA 2YRYA 2RGNB 2COCA 3UZTA 1MIZB 2LOZA 5FI1A 2HE7A 1FGYA 3PVUA 2Q13A 5D27A 5EFXA 3M1IB 2EMTA 1NTYA 3PG7A 1FHWA 2NBVA 2G35A 2K00A 3TFMA 4B6HA 5I2SA 4WSFA 5C5BA 3FM8C 1H10A 2OQBA 2PZ1A 2ROZB 2V76A 3DXCA 1MK7B 5C79A 1LB1A 2YS5A 5J3QA 1P5TA 1ZC4B 1GC6A 3AJ4A 3D8DA 5HE3A 1BAKA 1V5PA 2R2YA 2YVCA 3ZVRA 1ZM0A 2H7DA 2DTCA 5KQ4A 2J0JA 2AL6A 1OMWA 1WVHA 3LJUX 3HIEA 4K2PA 1ISNA 3ODXA 2LG1A 1I7AA 3TVVA 3TO1A 3QBVB 3HW2B 3NWDA 2I5CA 2CY5A 4ZRIA 1UNRA 1EF1A 2DN6A 4TKNA 5J3YA 5HE1A 4DBBA 1U27A 3PEGA 3AU5A 5D3VA 2RRFA 2EC1A 4Z2NA 1M7EA 2VKIA 1LW3A 2XQNM 3SO6A 3U7DA 4DIXA 3VIAA 2J0MA 3U12A 1P3RA 1IRSA 2LULA 2AEHA 1U5FA 2KUPA 4ZRKA 1NU2A 1ZC3B 3ULBA 1T77A 1TJ6A 1ZYIA 3PVLA 4NSWA 3KY9A 2MWNB 3FSSA 1PMSA 1QC6A 1XX0A 4Z2MB 3WA0A 1BWNA 4KHAA 4EKUA 2Z0PA 1UNPA 2R09A 5KCVA 1ZSQA 3DXDA 1V88A 5FI0A 4NY0A 1W1DA 1OY2A 2DLWA 3SNHA 2VSZA 1NTVA 4WJ7A 2UZRA 4K2OA 4GOUA 2Z0QA 1XD4A 2FJUB 3D8FA 1U2BA 4YL8A 2COAA 5DHFB 2W2XC 4CSQA 1MI1A 1MAIA 1KI1B 1P6SA 5JHHA 2LKOA 2KR0A 4MY6A 2HTHB 2N23A 3QWMA 4K81A 3P7ZA 3TW1A 2ELBA 1K5GB 2CRFA 5DIFB 1V61A 5HE2A 2Z14A 2BCJA 1WGUA 2W2WA 1W1GA 3KSYA 4TYZA 2ZKMX 2W2XD 1DDWA 2R0DA 2DX5A 4D6WA 3G9WA 4PQ0A 3A8PA 3HQCA 2IFSA 3KRWA 2CODA 4KHOA 1DYNA 1XKEA 3KRXA 1J0WA 2ZPYA 5JHGA 1E5WA 3FEHA 2K8EA 2K2JA 1KZGA 3SUZA 1Q67A 1UNQA 1W1HA 4HDOA 1DDVA 3F5RA 1B55A 5M4YB 4HATB 4OT1A 2FJLA 4F7GA 5LG4B 1X1GA 2E2XA 1V5UA 1OQNA 1EAZA 2D2QA 1MPHA 2I1KA 4GMVA 4HB0B 1SGHA 3BINA 2CY4A 4HAYB 5D3XA 4L1RA 4PNKA 5JLJB 2D10A 2YT2A 3X23A 2MFQA 2JP2A 2UVMA 1U5DA 2GCJA 1K5DB 3NW8A 5CLQB 2D11A 2X18A 2RSGA 5IRSA 4C0AA 4GZUA 2DX1A 3NWFA 1GG3A 2GS0A 4KVGB 3O96A 2LYDA 1UPQA 2DHIA 3U8ZA 4KAXB 1XODA 3MDBC 2RUKB 3FVCA 2COFA 4HAXB 1TXDA 2KGXB 1X11A 2NZ8B 3AU4A 1DROA 2P0DA 1DBHA 1Y19B 2KIEA 4HAVB 1UPRA 3ULCA 2MDXA 3PSCA 2DHJA 1WG7A 3VOQA 1J19A 1X05A 2VRWB 3KZ1A 4QJ4B 3GYPA 1FHOA 4HAWB 4A6FB 1I2HA 4QJ3B 5L81A 3P6AA 4P7IA 5C6RA 2RNRB 4KHBB 5LONB 4L6EA 2DKQA 2Y8GA 2M38A 3DXEA 2QKLA 1KZ7A 4QJ5B 2L1CA 1WJMA 4CYEA 3GYOA 1RJ2A 4H8SA 4HHVA 2GJYA 5I2MA 5DHAB 5D3YA 1DDMA 3BJIA 1MIXA 1V89A 1U5GA 1XR0B 2L2IA 4F7UP 4A6FA 2DFKA 3IVFA 4HAUB 4GPTB 4KHBA 2YT1A 4YONA 1FB8A 3NSUA 5LOPB 2YT0A 1PLSA 2D9YA 4XWXA
chains in the Genus database with same CATH topology
5C5BB 4GN1A 4ZRJA 1TQZA 2UZSA 3A8QA 3ODOA 1GC7A 5KQ1A 3MPXA 1PFJA 1M7RA 1Z87A 4CHJA 2YS3A 5DH9B 5DI9B 2EJ8A 1WGQA 4Y94A 2YSZA 1FHXA 4WVFB 2DKPA 3WYFB 1QQGA 4HAZB 3PVWA 1NI2A 1RRPB 3PZDA 1BTKA 4A5KA 1EVHA 2QKMA 4DX90 3ML4A 2Y8FA 4MK0A 3SV1A 1WI1A 3T06A 5D3WA 2I1JA 2YF0A 3CXBB 1Y5OA 2Z0OA 4F7HA 2D4QA 2D9ZA 2M14A 4EJNA 2DA0A 3ODWA 4GMXB 2K2UA 1FOEA 3V5WA 1MK9B 2RLOA 1SHCA 2P8VA 2D9XA 3N7CA 3D8EA 1AQCA 1EGXA 4DX8A 4HB4B 4IOYX 4D0NB 4CHMA 2EMSA 3F0WA 5C16A 1FGZA 4HB3B 1WJ1A 5GOWB 1V5MA 2OTXA 3HK0A 1UEFA 2IYBA 2ELAA 2H7EA 1X86A 1U29A 2MKRA 4IAPA 1N3HA 1ZVRA 2D9WA 3OANA 4BBKA 5HE0A 2J59M 4IFSA 2DYNA 4EMOA 5J3TA 2I5FA 2ADZA 2DHKA 1U5EA 4HB2B 2CAYA 2DYQA 3ZDTA 2D9VA 5CLLB 2ROVA 1H4RA 4GXBA 3TCAA 2N0YA 2NMBA 3A98B 1BTNA 4MT7A 3RCPA 4A6KA 3PP2A 3QIJA 1X1FA 2P0FA 2GCLA 1MKEA 2YS1A 4K17A 2J0KA 4DXAB 4A6HA 2Y7BA 3SYXA 5JP4A 1AWEA 2KCJA 2P0HA 2RVBB 1FAOA 1XCGA 4HDQA 3CIKA 2LOXA 2YRYA 2RGNB 2COCA 3UZTA 1MIZB 2LOZA 5FI1A 2HE7A 1FGYA 3PVUA 2Q13A 5D27A 5EFXA 3M1IB 2EMTA 1NTYA 3PG7A 1FHWA 2G35A 2K00A 3TFMA 4B6HA 4WSFA 5C5BA 3FM8C 1H10A 2OQBA 2PZ1A 2ROZB 2V76A 3DXCA 1MK7B 5C79A 1LB1A 2YS5A 5J3QA 1P5TA 1ZC4B 1GC6A 3AJ4A 3D8DA 5HE3A 1BAKA 1V5PA 2YVCA 3ZVRA 1ZM0A 2H7DA 2DTCA 5KQ4A 2J0JA 2AL6A 1OMWA 1WVHA 3LJUX 4K2PA 1ISNA 3ODXA 2LG1A 1I7AA 3TVVA 3TO1A 3QBVB 3HW2B 2I5CA 2CY5A 4ZRIA 1UNRA 1EF1A 2DN6A 4TKNA 5J3YA 5HE1A 4DBBA 1U27A 3PEGA 3AU5A 5D3VA 2EC1A 4Z2NA 1M7EA 2VKIA 1LW3A 2XQNM 3SO6A 3U7DA 3VIAA 2J0MA 1P3RA 1IRSA 2LULA 2AEHA 1U5FA 2KUPA 4ZRKA 1NU2A 1ZC3B 3ULBA 1TJ6A 3PVLA 4NSWA 3KY9A 2MWNB 3FSSA 1PMSA 1QC6A 1XX0A 4Z2MB 3WA0A 1BWNA 4KHAA 4EKUA 2Z0PA 1UNPA 2R09A 5KCVA 1ZSQA 3DXDA 1V88A 5FI0A 4NY0A 1W1DA 1OY2A 2DLWA 3SNHA 2VSZA 1NTVA 4WJ7A 2UZRA 4K2OA 2Z0QA 1XD4A 3D8FA 4YL8A 1U2BA 2COAA 5DHFB 2W2XC 1MAIA 1KI1B 1P6SA 5JHHA 2LKOA 4MY6A 2HTHB 2N23A 3QWMA 4K81A 3P7ZA 3TW1A 2ELBA 1K5GB 2CRFA 5DIFB 1V61A 5HE2A 2BCJA 1WGUA 2W2WA 1W1GA 3KSYA 4TYZA 2W2XD 1DDWA 2R0DA 2DX5A 3G9WA 4PQ0A 3A8PA 3HQCA 2IFSA 3KRWA 2CODA 4KHOA 1DYNA 1XKEA 3KRXA 1J0WA 2ZPYA 5JHGA 1E5WA 3FEHA 2K2JA 1KZGA 3SUZA 1Q67A 1UNQA 1W1HA 4HDOA 1DDVA 3F5RA 1B55A 4HATB 2FJLA 4F7GA 1X1GA 2E2XA 1V5UA 1OQNA 1EAZA 2D2QA 1MPHA 2I1KA 4GMVA 4HB0B 1SGHA 3BINA 2CY4A 4HAYB 5D3XA 4PNKA 5JLJB 2D10A 3X23A 2MFQA 2JP2A 2UVMA 1U5DA 2GCJA 1K5DB 5CLQB 2D11A 2X18A 2RSGA 4C0AA 4GZUA 2DX1A 1GG3A 2GS0A 4KVGB 3O96A 2LYDA 1UPQA 2DHIA 3U8ZA 4KAXB 1XODA 3MDBC 2RUKB 2COFA 4HAXB 1TXDA 2KGXB 1X11A 2NZ8B 3AU4A 1DROA 2P0DA 1DBHA 1Y19B 4HAVB 1UPRA 3ULCA 2MDXA 3PSCA 2DHJA 1WG7A 3VOQA 1J19A 1X05A 2VRWB 3KZ1A 3GYPA 1FHOA 4HAWB 4A6FB 1I2HA 5L81A 3P6AA 4P7IA 5C6RA 2RNRB 4KHBB 5LONB 4L6EA 2DKQA 2Y8GA 2M38A 3DXEA 2QKLA 1KZ7A 2L1CA 1WJMA 4CYEA 3GYOA 1RJ2A 4H8SA 4HHVA 2GJYA 5DHAB 5D3YA 1DDMA 3BJIA 1MIXA 1V89A 1U5GA 1XR0B 2L2IA 4F7UP 4A6FA 2DFKA 3IVFA 4HAUB 4GPTB 2YT1A 4YONA 1FB8A 3NSUA 5LOPB 2YT0A 1PLSA 2D9YA 4XWXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5C5B B;  4GN1 A;  4ZRJ A;  1TQZ A;  2UZS A;  3A8Q A;  3ODO A;  1GC7 A;  5KQ1 A;  3MPX A;  1PFJ A;  1M7R A;  1Z87 A;  4CHJ A;  2YS3 A;  5DH9 B;  5DI9 B;  2EJ8 A;  1WGQ A;  4Y94 A;  2YSZ A;  1FHX A;  4WVF B;  2DKP A;  3WYF B;  1QQG A;  4HAZ B;  3PVW A;  1NI2 A;  1RRP B;  3PZD A;  1BTK A;  4A5K A;  1EVH A;  2QKM A;  4DX9 0;  3ML4 A;  2Y8F A;  4MK0 A;  3SV1 A;  1WI1 A;  3T06 A;  5D3W A;  2I1J A;  2YF0 A;  3CXB B;  1Y5O A;  2Z0O A;  4F7H A;  2D4Q A;  2D9Z A;  2M14 A;  4EJN A;  2DA0 A;  3ODW A;  4GMX B;  2K2U A;  1FOE A;  3V5W A;  1MK9 B;  2RLO A;  1SHC A;  2P8V A;  2D9X A;  3N7C A;  3D8E A;  1AQC A;  1EGX A;  4DX8 A;  4HB4 B;  4IOY X;  4D0N B;  4CHM A;  2EMS A;  3F0W A;  5C16 A;  1FGZ A;  4HB3 B;  1WJ1 A;  5GOW B;  1V5M A;  2OTX A;  3HK0 A;  1UEF A;  2IYB A;  2ELA A;  2H7E A;  1X86 A;  1U29 A;  2MKR A;  4IAP A;  1N3H A;  1ZVR A;  2D9W A;  3OAN A;  4BBK A;  5HE0 A;  2J59 M;  4IFS A;  2DYN A;  4EMO A;  5J3T A;  2I5F A;  2ADZ A;  2DHK A;  1U5E A;  4HB2 B;  2CAY A;  2DYQ A;  3ZDT A;  2D9V A;  5CLL B;  2ROV A;  1H4R A;  4GXB A;  3TCA A;  2N0Y A;  2NMB A;  3A98 B;  1BTN A;  4MT7 A;  3RCP A;  4A6K A;  3PP2 A;  3QIJ A;  1X1F A;  2P0F A;  2GCL A;  1MKE A;  2YS1 A;  4K17 A;  2J0K A;  4DXA B;  4A6H A;  2Y7B A;  3SYX A;  5JP4 A;  1AWE A;  2KCJ A;  2P0H A;  2RVB B;  1FAO A;  1XCG A;  4HDQ A;  3CIK A;  2LOX A;  2YRY A;  2RGN B;  2COC A;  3UZT A;  1MIZ B;  2LOZ A;  5FI1 A;  2HE7 A;  1FGY A;  3PVU A;  2Q13 A;  5D27 A;  5EFX A;  3M1I B;  2EMT A;  1NTY A;  3PG7 A;  1FHW A;  2G35 A;  2K00 A;  3TFM A;  4B6H A;  4WSF A;  5C5B A;  3FM8 C;  1H10 A;  2OQB A;  2PZ1 A;  2ROZ B;  2V76 A;  3DXC A;  1MK7 B;  5C79 A;  1LB1 A;  2YS5 A;  5J3Q A;  1P5T A;  1ZC4 B;  1GC6 A;  3AJ4 A;  3D8D A;  5HE3 A;  1BAK A;  1V5P A;  2YVC A;  3ZVR A;  1ZM0 A;  2H7D A;  2DTC A;  5KQ4 A;  2J0J A;  2AL6 A;  1OMW A;  1WVH A;  3LJU X;  4K2P A;  1ISN A;  3ODX A;  2LG1 A;  1I7A A;  3TVV A;  3TO1 A;  3QBV B;  3HW2 B;  2I5C A;  2CY5 A;  4ZRI A;  1UNR A;  1EF1 A;  2DN6 A;  4TKN A;  5J3Y A;  5HE1 A;  4DBB A;  1U27 A;  3PEG A;  3AU5 A;  5D3V A;  2EC1 A;  4Z2N A;  1M7E A;  2VKI A;  1LW3 A;  2XQN M;  3SO6 A;  3U7D A;  3VIA A;  2J0M A;  1P3R A;  1IRS A;  2LUL A;  2AEH A;  1U5F A;  2KUP A;  4ZRK A;  1NU2 A;  1ZC3 B;  3ULB A;  1TJ6 A;  3PVL A;  4NSW A;  3KY9 A;  2MWN B;  3FSS A;  1PMS A;  1QC6 A;  1XX0 A;  4Z2M B;  3WA0 A;  1BWN A;  4KHA A;  4EKU A;  2Z0P A;  1UNP A;  2R09 A;  5KCV A;  1ZSQ A;  3DXD A;  1V88 A;  5FI0 A;  4NY0 A;  1W1D A;  1OY2 A;  2DLW A;  3SNH A;  2VSZ A;  1NTV A;  4WJ7 A;  2UZR A;  4K2O A;  2Z0Q A;  1XD4 A;  3D8F A;  4YL8 A;  1U2B A;  2COA A;  5DHF B;  2W2X C;  1MAI A;  1KI1 B;  1P6S A;  5JHH A;  2LKO A;  4MY6 A;  2HTH B;  2N23 A;  3QWM A;  4K81 A;  3P7Z A;  3TW1 A;  2ELB A;  1K5G B;  2CRF A;  5DIF B;  1V61 A;  5HE2 A;  2BCJ A;  1WGU A;  2W2W A;  1W1G A;  3KSY A;  4TYZ A;  2W2X D;  1DDW A;  2R0D A;  2DX5 A;  3G9W A;  4PQ0 A;  3A8P A;  3HQC A;  2IFS A;  3KRW A;  2COD A;  4KHO A;  1DYN A;  1XKE A;  3KRX A;  1J0W A;  2ZPY A;  5JHG A;  1E5W A;  3FEH A;  2K2J A;  1KZG A;  3SUZ A;  1Q67 A;  1UNQ A;  1W1H A;  4HDO A;  1DDV A;  3F5R A;  1B55 A;  4HAT B;  2FJL A;  4F7G A;  1X1G A;  2E2X A;  1V5U A;  1OQN A;  1EAZ A;  2D2Q A;  1MPH A;  2I1K A;  4GMV A;  4HB0 B;  1SGH A;  3BIN A;  2CY4 A;  4HAY B;  5D3X A;  4PNK A;  5JLJ B;  2D10 A;  3X23 A;  2MFQ A;  2JP2 A;  2UVM A;  1U5D A;  2GCJ A;  1K5D B;  5CLQ B;  2D11 A;  2X18 A;  2RSG A;  4C0A A;  4GZU A;  2DX1 A;  1GG3 A;  2GS0 A;  4KVG B;  3O96 A;  2LYD A;  1UPQ A;  2DHI A;  3U8Z A;  4KAX B;  1XOD A;  3MDB C;  2RUK B;  2COF A;  4HAX B;  1TXD A;  2KGX B;  1X11 A;  2NZ8 B;  3AU4 A;  1DRO A;  2P0D A;  1DBH A;  1Y19 B;  4HAV B;  1UPR A;  3ULC A;  2MDX A;  3PSC A;  2DHJ A;  1WG7 A;  3VOQ A;  1J19 A;  1X05 A;  2VRW B;  3KZ1 A;  3GYP A;  1FHO A;  4HAW B;  4A6F B;  1I2H A;  5L81 A;  3P6A A;  4P7I A;  5C6R A;  2RNR B;  4KHB B;  5LON B;  4L6E A;  2DKQ A;  2Y8G A;  2M38 A;  3DXE A;  2QKL A;  1KZ7 A;  2L1C A;  1WJM A;  4CYE A;  3GYO A;  1RJ2 A;  4H8S A;  4HHV A;  2GJY A;  5DHA B;  5D3Y A;  1DDM A;  3BJI A;  1MIX A;  1V89 A;  1U5G A;  1XR0 B;  2L2I A;  4F7U P;  4A6F A;  2DFK A;  3IVF A;  4HAU B;  4GPT B;  2YT1 A;  4YON A;  1FB8 A;  3NSU A;  5LOP B;  2YT0 A;  1PLS A;  2D9Y A;  4XWX A; 
#chains in the Genus database with same CATH topology
 5C5B B;  4GN1 A;  4ZRJ A;  1TQZ A;  2UZS A;  3A8Q A;  3ODO A;  1GC7 A;  5KQ1 A;  2KUQ A;  3MPX A;  1PFJ A;  1M7R A;  1Z87 A;  4CHJ A;  2YS3 A;  5DH9 B;  3B77 A;  5DI9 B;  2EJ8 A;  1WGQ A;  2Z13 A;  4Y94 A;  2YSZ A;  4OSN A;  1FHX A;  4WVF B;  2DKP A;  3WYF B;  1QQG A;  4HAZ B;  3PVW A;  1NI2 A;  1RRP B;  3PZD A;  1BTK A;  4A5K A;  1EVH A;  2QKM A;  4DX9 0;  3ML4 A;  2Y8F A;  2Z4D A;  4MK0 A;  3SV1 A;  1WI1 A;  3T06 A;  5D3W A;  2I1J A;  2KIG A;  2YF0 A;  1Y5O A;  3CXB B;  4QXA B;  2Z0O A;  4F7H A;  2D4Q A;  2D9Z A;  4HSI A;  2M14 A;  4EJN A;  2DA0 A;  3ODW A;  4GMX B;  2K2U A;  1FOE A;  3V5W A;  1MK9 B;  3NWA A;  3OHM B;  2RLO A;  1SHC A;  2P8V A;  2D9X A;  3N7C A;  3D8E A;  1AQC A;  1EGX A;  4DX8 A;  4HB4 B;  4IOY X;  4D0N B;  4CHM A;  2EMS A;  2GUM A;  3F0W A;  5C16 A;  1FGZ A;  4HB3 B;  1WJ1 A;  5GOW B;  3A58 A;  1V5M A;  2OTX A;  2K49 A;  3HK0 A;  1UEF A;  2Z59 A;  2IYB A;  2ELA A;  2H7E A;  1X86 A;  3DCX A;  1U29 A;  2MKR A;  4IAP A;  1N3H A;  1ZVR A;  2D9W A;  3OAN A;  4BBK A;  5HE0 A;  2J59 M;  4IFS A;  2DYN A;  4EMO A;  5J3T A;  2I5F A;  2ADZ A;  2DHK A;  1U5E A;  4HB2 B;  2CAY A;  2DYQ A;  3ZDT A;  2D9V A;  5CLL B;  2ROV A;  1H4R A;  4GXB A;  3TCA A;  2N0Y A;  2NMB A;  3A98 B;  1BTN A;  4MT7 A;  3RCP A;  4A6K A;  3PP2 A;  3QIJ A;  3HSA A;  1X1F A;  2P0F A;  2GCL A;  4GNK B;  1MKE A;  2YS1 A;  4K17 A;  2J0K A;  4DXA B;  4A6H A;  2Y7B A;  3SYX A;  5JP4 A;  1AWE A;  2KCJ A;  2P0H A;  2RVB B;  1FAO A;  1XCG A;  4HDQ A;  3CIK A;  2LOX A;  2YRY A;  2RGN B;  2COC A;  3UZT A;  1MIZ B;  2LOZ A;  5FI1 A;  2HE7 A;  1FGY A;  3PVU A;  2Q13 A;  5D27 A;  5EFX A;  3M1I B;  2EMT A;  1NTY A;  3PG7 A;  1FHW A;  2NBV A;  2G35 A;  2K00 A;  3TFM A;  4B6H A;  5I2S A;  4WSF A;  5C5B A;  3FM8 C;  1H10 A;  2OQB A;  2PZ1 A;  2ROZ B;  2V76 A;  3DXC A;  1MK7 B;  5C79 A;  1LB1 A;  2YS5 A;  5J3Q A;  1P5T A;  1ZC4 B;  1GC6 A;  3AJ4 A;  3D8D A;  5HE3 A;  1BAK A;  1V5P A;  2R2Y A;  2YVC A;  3ZVR A;  1ZM0 A;  2H7D A;  2DTC A;  5KQ4 A;  2J0J A;  2AL6 A;  1OMW A;  1WVH A;  3LJU X;  3HIE A;  4K2P A;  1ISN A;  3ODX A;  2LG1 A;  1I7A A;  3TVV A;  3TO1 A;  3QBV B;  3HW2 B;  3NWD A;  2I5C A;  2CY5 A;  4ZRI A;  1UNR A;  1EF1 A;  2DN6 A;  4TKN A;  5J3Y A;  5HE1 A;  4DBB A;  1U27 A;  3PEG A;  3AU5 A;  5D3V A;  2RRF A;  2EC1 A;  4Z2N A;  1M7E A;  2VKI A;  1LW3 A;  2XQN M;  3SO6 A;  3U7D A;  4DIX A;  3VIA A;  2J0M A;  3U12 A;  1P3R A;  1IRS A;  2LUL A;  2AEH A;  1U5F A;  2KUP A;  4ZRK A;  1NU2 A;  1ZC3 B;  3ULB A;  1T77 A;  1TJ6 A;  1ZYI A;  3PVL A;  4NSW A;  3KY9 A;  2MWN B;  3FSS A;  1PMS A;  1QC6 A;  1XX0 A;  4Z2M B;  3WA0 A;  1BWN A;  4KHA A;  4EKU A;  2Z0P A;  1UNP A;  2R09 A;  5KCV A;  1ZSQ A;  3DXD A;  1V88 A;  5FI0 A;  4NY0 A;  1W1D A;  1OY2 A;  2DLW A;  3SNH A;  2VSZ A;  1NTV A;  4WJ7 A;  2UZR A;  4K2O A;  4GOU A;  2Z0Q A;  1XD4 A;  2FJU B;  3D8F A;  1U2B A;  4YL8 A;  2COA A;  5DHF B;  2W2X C;  4CSQ A;  1MI1 A;  1MAI A;  1KI1 B;  1P6S A;  5JHH A;  2LKO A;  2KR0 A;  4MY6 A;  2HTH B;  2N23 A;  3QWM A;  4K81 A;  3P7Z A;  3TW1 A;  2ELB A;  1K5G B;  2CRF A;  5DIF B;  1V61 A;  5HE2 A;  2Z14 A;  2BCJ A;  1WGU A;  2W2W A;  1W1G A;  3KSY A;  4TYZ A;  2ZKM X;  2W2X D;  1DDW A;  2R0D A;  2DX5 A;  4D6W A;  3G9W A;  4PQ0 A;  3A8P A;  3HQC A;  2IFS A;  3KRW A;  2COD A;  4KHO A;  1DYN A;  1XKE A;  3KRX A;  1J0W A;  2ZPY A;  5JHG A;  1E5W A;  3FEH A;  2K8E A;  2K2J A;  1KZG A;  3SUZ A;  1Q67 A;  1UNQ A;  1W1H A;  4HDO A;  1DDV A;  3F5R A;  1B55 A;  5M4Y B;  4HAT B;  4OT1 A;  2FJL A;  4F7G A;  5LG4 B;  1X1G A;  2E2X A;  1V5U A;  1OQN A;  1EAZ A;  2D2Q A;  1MPH A;  2I1K A;  4GMV A;  4HB0 B;  1SGH A;  3BIN A;  2CY4 A;  4HAY B;  5D3X A;  4L1R A;  4PNK A;  5JLJ B;  2D10 A;  2YT2 A;  3X23 A;  2MFQ A;  2JP2 A;  2UVM A;  1U5D A;  2GCJ A;  1K5D B;  3NW8 A;  5CLQ B;  2D11 A;  2X18 A;  2RSG A;  5IRS A;  4C0A A;  4GZU A;  2DX1 A;  3NWF A;  1GG3 A;  2GS0 A;  4KVG B;  3O96 A;  2LYD A;  1UPQ A;  2DHI A;  3U8Z A;  4KAX B;  1XOD A;  3MDB C;  2RUK B;  3FVC A;  2COF A;  4HAX B;  1TXD A;  2KGX B;  1X11 A;  2NZ8 B;  3AU4 A;  1DRO A;  2P0D A;  1DBH A;  1Y19 B;  2KIE A;  4HAV B;  1UPR A;  3ULC A;  2MDX A;  3PSC A;  2DHJ A;  1WG7 A;  3VOQ A;  1J19 A;  1X05 A;  2VRW B;  3KZ1 A;  4QJ4 B;  3GYP A;  1FHO A;  4HAW B;  4A6F B;  1I2H A;  4QJ3 B;  5L81 A;  3P6A A;  4P7I A;  5C6R A;  2RNR B;  4KHB B;  5LON B;  4L6E A;  2DKQ A;  2Y8G A;  2M38 A;  3DXE A;  2QKL A;  1KZ7 A;  4QJ5 B;  2L1C A;  1WJM A;  4CYE A;  3GYO A;  1RJ2 A;  4H8S A;  4HHV A;  2GJY A;  5I2M A;  5DHA B;  5D3Y A;  1DDM A;  3BJI A;  1MIX A;  1V89 A;  1U5G A;  1XR0 B;  2L2I A;  4F7U P;  4A6F A;  2DFK A;  3IVF A;  4HAU B;  4GPT B;  4KHB A;  2YT1 A;  4YON A;  1FB8 A;  3NSU A;  5LOP B;  2YT0 A;  1PLS A;  2D9Y A;  4XWX A; 
#chains in the Genus database with same CATH homology
 5C5B B;  4GN1 A;  4ZRJ A;  1TQZ A;  2UZS A;  3A8Q A;  3ODO A;  1GC7 A;  5KQ1 A;  3MPX A;  1PFJ A;  1M7R A;  1Z87 A;  4CHJ A;  2YS3 A;  5DH9 B;  5DI9 B;  2EJ8 A;  1WGQ A;  4Y94 A;  2YSZ A;  1FHX A;  4WVF B;  2DKP A;  3WYF B;  1QQG A;  4HAZ B;  3PVW A;  1NI2 A;  1RRP B;  3PZD A;  1BTK A;  4A5K A;  1EVH A;  2QKM A;  4DX9 0;  3ML4 A;  2Y8F A;  4MK0 A;  3SV1 A;  1WI1 A;  3T06 A;  5D3W A;  2I1J A;  2YF0 A;  3CXB B;  1Y5O A;  2Z0O A;  4F7H A;  2D4Q A;  2D9Z A;  2M14 A;  4EJN A;  2DA0 A;  3ODW A;  4GMX B;  2K2U A;  1FOE A;  3V5W A;  1MK9 B;  2RLO A;  1SHC A;  2P8V A;  2D9X A;  3N7C A;  3D8E A;  1AQC A;  1EGX A;  4DX8 A;  4HB4 B;  4IOY X;  4D0N B;  4CHM A;  2EMS A;  3F0W A;  5C16 A;  1FGZ A;  4HB3 B;  1WJ1 A;  5GOW B;  1V5M A;  2OTX A;  3HK0 A;  1UEF A;  2IYB A;  2ELA A;  2H7E A;  1X86 A;  1U29 A;  2MKR A;  4IAP A;  1N3H A;  1ZVR A;  2D9W A;  3OAN A;  4BBK A;  5HE0 A;  2J59 M;  4IFS A;  2DYN A;  4EMO A;  5J3T A;  2I5F A;  2ADZ A;  2DHK A;  1U5E A;  4HB2 B;  2CAY A;  2DYQ A;  3ZDT A;  2D9V A;  5CLL B;  2ROV A;  1H4R A;  4GXB A;  3TCA A;  2N0Y A;  2NMB A;  3A98 B;  1BTN A;  4MT7 A;  3RCP A;  4A6K A;  3PP2 A;  3QIJ A;  1X1F A;  2P0F A;  2GCL A;  1MKE A;  2YS1 A;  4K17 A;  2J0K A;  4DXA B;  4A6H A;  2Y7B A;  3SYX A;  5JP4 A;  1AWE A;  2KCJ A;  2P0H A;  2RVB B;  1FAO A;  1XCG A;  4HDQ A;  3CIK A;  2LOX A;  2YRY A;  2RGN B;  2COC A;  3UZT A;  1MIZ B;  2LOZ A;  5FI1 A;  2HE7 A;  1FGY A;  3PVU A;  2Q13 A;  5D27 A;  5EFX A;  3M1I B;  2EMT A;  1NTY A;  3PG7 A;  1FHW A;  2G35 A;  2K00 A;  3TFM A;  4B6H A;  4WSF A;  5C5B A;  3FM8 C;  1H10 A;  2OQB A;  2PZ1 A;  2ROZ B;  2V76 A;  3DXC A;  1MK7 B;  5C79 A;  1LB1 A;  2YS5 A;  5J3Q A;  1P5T A;  1ZC4 B;  1GC6 A;  3AJ4 A;  3D8D A;  5HE3 A;  1BAK A;  1V5P A;  2YVC A;  3ZVR A;  1ZM0 A;  2H7D A;  2DTC A;  5KQ4 A;  2J0J A;  2AL6 A;  1OMW A;  1WVH A;  3LJU X;  4K2P A;  1ISN A;  3ODX A;  2LG1 A;  1I7A A;  3TVV A;  3TO1 A;  3QBV B;  3HW2 B;  2I5C A;  2CY5 A;  4ZRI A;  1UNR A;  1EF1 A;  2DN6 A;  4TKN A;  5J3Y A;  5HE1 A;  4DBB A;  1U27 A;  3PEG A;  3AU5 A;  5D3V A;  2EC1 A;  4Z2N A;  1M7E A;  2VKI A;  1LW3 A;  2XQN M;  3SO6 A;  3U7D A;  3VIA A;  2J0M A;  1P3R A;  1IRS A;  2LUL A;  2AEH A;  1U5F A;  2KUP A;  4ZRK A;  1NU2 A;  1ZC3 B;  3ULB A;  1TJ6 A;  3PVL A;  4NSW A;  3KY9 A;  2MWN B;  3FSS A;  1PMS A;  1QC6 A;  1XX0 A;  4Z2M B;  3WA0 A;  1BWN A;  4KHA A;  4EKU A;  2Z0P A;  1UNP A;  2R09 A;  5KCV A;  1ZSQ A;  3DXD A;  1V88 A;  5FI0 A;  4NY0 A;  1W1D A;  1OY2 A;  2DLW A;  3SNH A;  2VSZ A;  1NTV A;  4WJ7 A;  2UZR A;  4K2O A;  2Z0Q A;  1XD4 A;  3D8F A;  4YL8 A;  1U2B A;  2COA A;  5DHF B;  2W2X C;  1MAI A;  1KI1 B;  1P6S A;  5JHH A;  2LKO A;  4MY6 A;  2HTH B;  2N23 A;  3QWM A;  4K81 A;  3P7Z A;  3TW1 A;  2ELB A;  1K5G B;  2CRF A;  5DIF B;  1V61 A;  5HE2 A;  2BCJ A;  1WGU A;  2W2W A;  1W1G A;  3KSY A;  4TYZ A;  2W2X D;  1DDW A;  2R0D A;  2DX5 A;  3G9W A;  4PQ0 A;  3A8P A;  3HQC A;  2IFS A;  3KRW A;  2COD A;  4KHO A;  1DYN A;  1XKE A;  3KRX A;  1J0W A;  2ZPY A;  5JHG A;  1E5W A;  3FEH A;  2K2J A;  1KZG A;  3SUZ A;  1Q67 A;  1UNQ A;  1W1H A;  4HDO A;  1DDV A;  3F5R A;  1B55 A;  4HAT B;  2FJL A;  4F7G A;  1X1G A;  2E2X A;  1V5U A;  1OQN A;  1EAZ A;  2D2Q A;  1MPH A;  2I1K A;  4GMV A;  4HB0 B;  1SGH A;  3BIN A;  2CY4 A;  4HAY B;  5D3X A;  4PNK A;  5JLJ B;  2D10 A;  3X23 A;  2MFQ A;  2JP2 A;  2UVM A;  1U5D A;  2GCJ A;  1K5D B;  5CLQ B;  2D11 A;  2X18 A;  2RSG A;  4C0A A;  4GZU A;  2DX1 A;  1GG3 A;  2GS0 A;  4KVG B;  3O96 A;  2LYD A;  1UPQ A;  2DHI A;  3U8Z A;  4KAX B;  1XOD A;  3MDB C;  2RUK B;  2COF A;  4HAX B;  1TXD A;  2KGX B;  1X11 A;  2NZ8 B;  3AU4 A;  1DRO A;  2P0D A;  1DBH A;  1Y19 B;  4HAV B;  1UPR A;  3ULC A;  2MDX A;  3PSC A;  2DHJ A;  1WG7 A;  3VOQ A;  1J19 A;  1X05 A;  2VRW B;  3KZ1 A;  3GYP A;  1FHO A;  4HAW B;  4A6F B;  1I2H A;  5L81 A;  3P6A A;  4P7I A;  5C6R A;  2RNR B;  4KHB B;  5LON B;  4L6E A;  2DKQ A;  2Y8G A;  2M38 A;  3DXE A;  2QKL A;  1KZ7 A;  2L1C A;  1WJM A;  4CYE A;  3GYO A;  1RJ2 A;  4H8S A;  4HHV A;  2GJY A;  5DHA B;  5D3Y A;  1DDM A;  3BJI A;  1MIX A;  1V89 A;  1U5G A;  1XR0 B;  2L2I A;  4F7U P;  4A6F A;  2DFK A;  3IVF A;  4HAU B;  4GPT B;  2YT1 A;  4YON A;  1FB8 A;  3NSU A;  5LOP B;  2YT0 A;  1PLS A;  2D9Y A;  4XWX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...