1X11A

X11 ptb domain
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
170
structure length
135
Chain Sequence
MEDLIDGIIFAANYLGSTQLLSDKTPSKNVRMMQAQEAVSRIKMAQMTEVDLFILTQRIKVLNADTQETMMDHPLRTISYIADIGNIVVLMARDGKRQYKMICHVFESEDAQLIAQSIGQAFSVAYQEFLRANGI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords X11
publication title Sequence-specific recognition of the internalization motif of the Alzheimer's amyloid precursor protein by the X11 PTB domain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Complex (peptide binding module/peptide)
total genus 30
structure length 135
sequence length 170
chains with identical sequence B
ec nomenclature
pdb deposition date 1997-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00640 PID Phosphotyrosine interaction domain (PTB/PID)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 1x11A00
1P6SA 2VRWB 3ULBA 1WVHA 2COCA 1MPHA 2K00A 2ZPYA 1GC6A 4GN1A 4IFSA 4PNKA 3V5WA 5CLQB 4Z2MB 2P0HA 5LONB 4GMXB 4YONA 2CY5A 2YSZA 4F7UP 3ULCA 1WGQA 3T06A 1ZM0A 3KZ1A 2QKMA 4HB3B 1P5TA 3QWMA 1J19A 1UPRA 1MK9B 1UEFA 3KRWA 1FAOA 1V61A 3PG7A 2G35A 3PP2A 2YT0A 5DHAB 3U8ZA 4HDOA 5DH9B 5HE0A 2I1KA 5C5BB 1TXDA 3PEGA 1W1DA 4EKUA 5DIFB 5D3YA 3RCPA 5GOWB 3TO1A 2DFKA 2CRFA 2GJYA 2Z0OA 5HE2A 3OANA 5L81A 4NSWA 2Y7BA 1X05A 3TVVA 2LOZA 4EJNA 2CODA 1FB8A 5KCVA 3A8QA 2LULA 4Z2NA 1NTVA 1WJMA 3PVUA 2IYBA 1U27A 4D0NB 2COAA 1EGXA 3CXBB 2LYDA 3ZDTA 4P7IA 1EVHA 1Y5OA 5D3VA 3MDBC 3SYXA 1UNRA 2VSZA 1K5GB 3TW1A 1XKEA 1BTNA 2AEHA 2QKLA 5CLLB 1N3HA 1U5GA 1BAKA 2ELBA 4HB2B 4K2PA 2Z0QA 1RRPB 5KQ1A 2PZ1A 1FOEA 3WA0A 3HW2B 3KSYA 1DROA 2M38A 1K5DB 1V5UA 4HAWB 4DX90 2DN6A 2P0FA 1OMWA 2YS5A 1X1GA 3F5RA 1EF1A 2MDXA 4CYEA 3FEHA 2GCJA 2L2IA 4IAPA 1QC6A 1J0WA 3ZVRA 4L6EA 4TYZA 2J0MA 4HB0B 4HAZB 4HATB 5JP4A 5C5BA 4B6HA 4HAYB 2I5CA 1WI1A 4HHVA 1NU2A 3SV1A 2ROZB 5C16A 4GMVA 3SUZA 1Q67A 1W1GA 2D2QA 2I5FA 2K2UA 2NMBA 2YVCA 3P6AA 1NI2A 3PVWA 4MT7A 1W1HA 5DHFB 5JHGA 4MK0A 2P8VA 1P3RA 2UZRA 2UVMA 5DI9B 4MY6A 2Y8FA 3P7ZA 5JHHA 1WG7A 2DKPA 2DX1A 1X86A 1LB1A 1Y19B 4TKNA 3BINA 4Y94A 4DBBA 4A6FB 2YT1A 2UZSA 1B55A 4KHOA 5JLJB 5D3WA 1ISNA 1DDMA 3VIAA 2VKIA 2W2XC 1X1FA 3DXEA 3HQCA 1KZGA 1XD4A 1KI1B 4C0AA 2MKRA 2YRYA 3ODOA 4ZRIA 1V5MA 2EMSA 2LOXA 4F7HA 2J0KA 1KZ7A 5J3QA 4KVGB 1GG3A 2DTCA 4EMOA 4KHAA 2DA0A 2D4QA 5D27A 1XCGA 1U5FA 5D3XA 2XQNM 2COFA 1AQCA 1XR0B 1WJ1A 1XX0A 3VOQA 3PVLA 5FI1A 2N23A 1H10A 2I1JA 1MK7B 1U5DA 1BWNA 1GC7A 1NTYA 4HAXB 2ROVA 2DHKA 3ODWA 4YL8A 2D10A 2X18A 5J3TA 2YS3A 2OTXA 4A5KA 5C6RA 1PMSA 1E5WA 2GS0A 2D9ZA 3DXDA 1X11A 1ZVRA 4GXBA 3CIKA 1DDVA 1QQGA 1UNPA 3A98B 3ML4A 2KUPA 3KY9A 4DX8A 2JP2A 2V76A 1MAIA 5EFXA 1RJ2A 3AU4A 1H4RA 3GYOA 3M1IB 2W2WA 1FHXA 4H8SA 2ADZA 1V5PA 4BBKA 5KQ4A 4DXAB 2L1CA 2DLWA 4XWXA 1MIZB 2EMTA 2EJ8A 3KRXA 4A6FA 3O96A 3QBVB 2YF0A 4HDQA 2Z0PA 2ELAA 4F7GA 2DHIA 3SNHA 2D11A 1ZSQA 2HTHB 3QIJA 4CHJA 2K2JA 3NSUA 2CY4A 2RNRB 1DDWA 1M7RA 4K81A 3PSCA 1SGHA 2H7EA 3D8EA 2HE7A 4CHMA 2D9VA 1MIXA 3X23A 3A8PA 1UNQA 2MFQA 2EC1A 2Q13A 1BTKA 1U29A 4NY0A 1V89A 1TQZA 2RGNB 2RLOA 4WVFB 1XODA 1ZC4B 2DHJA 3FSSA 5J3YA 5FI0A 1SHCA 4HB4B 3U7DA 4IOYX 1LW3A 1WGUA 2E2XA 2D9YA 2J59M 3LJUX 3D8DA 3DXCA 2MWNB 1I7AA 1FHWA 4WJ7A 2GCLA 2P0DA 3F0WA 3GYPA 3ODXA 1PFJA 3FM8C 4GZUA 5C79A 3D8FA 3N7CA 4K17A 3TFMA 1TJ6A 2LKOA 2RUKB 2RSGA 3PZDA 2YS1A 3SO6A 4ZRKA 2BCJA 3UZTA 1M7EA 3G9WA 1EAZA 2NZ8B 1UPQA 2AL6A 1FGZA 5HE1A 4A6HA 1Z87A 4GPTB 1DBHA 2Y8GA 2DYQA 4KHBB 2IFSA 2KCJA 2R0DA 5LOPB 2LG1A 3TCAA 2RVBB 2D9XA 2J0JA 2W2XD 2N0YA 3BJIA 3AU5A 2H7DA 4KAXB 4HAVB 1OQNA 4PQ0A 2DYNA 1U2BA 2DKQA 1MKEA 2R09A 1PLSA 1IRSA 1AWEA 1ZC3B 2DX5A 2CAYA 1V88A 2M14A 2KGXB 1DYNA 2OQBA 1FGYA 5HE3A 4A6KA 4WSFA 3HK0A 2D9WA 2FJLA 4K2OA 1I2HA 3AJ4A 1U5EA 4ZRJA 3IVFA 1FHOA 4HAUB 1OY2A 3MPXA 3WYFB
chains in the Genus database with same CATH superfamily
1P6SA 2VRWB 3ULBA 1WVHA 2COCA 1MPHA 2K00A 2ZPYA 1GC6A 4GN1A 4IFSA 4PNKA 3V5WA 5CLQB 4Z2MB 2P0HA 5LONB 4GMXB 4YONA 2CY5A 2YSZA 4F7UP 5M4YB 3ULCA 1WGQA 4L1RA 3T06A 1ZM0A 3KZ1A 3HSAA 2QKMA 4HB3B 1P5TA 3QWMA 1J19A 1UPRA 1MK9B 1UEFA 3KRWA 1FAOA 1V61A 3PG7A 2G35A 3PP2A 2YT0A 5DHAB 3U8ZA 4HDOA 4GNKB 5DH9B 5HE0A 2I1KA 5C5BB 1TXDA 3PEGA 1W1DA 4QJ4B 4EKUA 5DIFB 5D3YA 3RCPA 5GOWB 3TO1A 2DFKA 2KUQA 4KHBA 2CRFA 2GJYA 2Z0OA 5HE2A 3OANA 5L81A 4NSWA 2Y7BA 1X05A 3TVVA 2LOZA 4EJNA 2CODA 1FB8A 5KCVA 3A8QA 2LULA 4Z2NA 1NTVA 1WJMA 3PVUA 2IYBA 1U27A 4D0NB 2COAA 1EGXA 3CXBB 2LYDA 3ZDTA 4P7IA 2KR0A 1EVHA 1Y5OA 5D3VA 3MDBC 3SYXA 1UNRA 2VSZA 1K5GB 3TW1A 1XKEA 1BTNA 2AEHA 2QKLA 5CLLB 1N3HA 4QJ3B 1U5GA 1BAKA 2ELBA 5LG4B 4CSQA 4HB2B 4K2PA 2Z0QA 1RRPB 5KQ1A 2Z14A 2PZ1A 1FOEA 3WA0A 3HW2B 3KSYA 1DROA 2M38A 1K5DB 1V5UA 4HAWB 4DX90 2DN6A 2P0FA 1OMWA 2YS5A 1X1GA 3F5RA 1EF1A 2MDXA 4CYEA 3FEHA 2GCJA 2L2IA 4IAPA 1QC6A 1J0WA 3ZVRA 4L6EA 4TYZA 2J0MA 2ZKMX 4HB0B 4HAZB 4HATB 5JP4A 5C5BA 4B6HA 4HAYB 3NWFA 2I5CA 1WI1A 4OSNA 4HHVA 1NU2A 3SV1A 2ROZB 5C16A 4GMVA 3SUZA 1Q67A 1W1GA 2D2QA 2I5FA 2K2UA 2NMBA 2YVCA 3P6AA 1NI2A 3PVWA 4MT7A 1W1HA 3OHMB 5DHFB 5IRSA 5JHGA 4MK0A 2KIGA 2P8VA 1P3RA 2UZRA 2UVMA 5DI9B 4MY6A 2Y8FA 3P7ZA 5JHHA 3A58A 1WG7A 2DKPA 2DX1A 1X86A 1LB1A 1Y19B 4TKNA 3BINA 4Y94A 4DBBA 2NBVA 4A6FB 2YT1A 2UZSA 1B55A 4KHOA 5JLJB 5D3WA 1ISNA 1DDMA 3VIAA 2VKIA 2W2XC 1X1FA 3DXEA 3HQCA 1KZGA 1XD4A 1KI1B 2R2YA 4C0AA 2MKRA 2YRYA 3ODOA 4ZRIA 1V5MA 2EMSA 2LOXA 4F7HA 2J0KA 3NW8A 1KZ7A 5J3QA 4KVGB 1GG3A 2DTCA 4EMOA 4KHAA 2DA0A 2D4QA 5D27A 1XCGA 1U5FA 3DCXA 5D3XA 2XQNM 2COFA 4QJ5B 2K8EA 1AQCA 1XR0B 1ZYIA 1WJ1A 1XX0A 3VOQA 3PVLA 5FI1A 2N23A 1H10A 2I1JA 2Z4DA 1MK7B 1U5DA 2YT2A 1BWNA 1GC7A 1NTYA 4HAXB 2ROVA 2DHKA 3ODWA 4YL8A 2D10A 2X18A 5J3TA 4D6WA 2YS3A 1MI1A 2OTXA 4A5KA 5C6RA 1PMSA 1E5WA 2GS0A 2D9ZA 3DXDA 1X11A 4GOUA 1ZVRA 4GXBA 3CIKA 1DDVA 1QQGA 3NWDA 1UNPA 3A98B 3ML4A 2KUPA 3KY9A 4DX8A 2JP2A 2V76A 1MAIA 5EFXA 1RJ2A 3AU4A 1H4RA 3GYOA 3M1IB 2W2WA 1FHXA 4H8SA 2ADZA 1V5PA 4BBKA 5KQ4A 4DXAB 2L1CA 2DLWA 4XWXA 1MIZB 2EMTA 2EJ8A 3KRXA 4A6FA 3O96A 3QBVB 2YF0A 4HDQA 3B77A 2Z0PA 2ELAA 4F7GA 2DHIA 2GUMA 3SNHA 2D11A 1ZSQA 2HTHB 3QIJA 4DIXA 4CHJA 2K2JA 3NSUA 2CY4A 2RNRB 1DDWA 1M7RA 4K81A 3PSCA 1SGHA 2H7EA 3D8EA 2HE7A 4CHMA 2D9VA 1MIXA 3X23A 3A8PA 1UNQA 2MFQA 2EC1A 2Q13A 1BTKA 1U29A 4NY0A 1V89A 1TQZA 2RGNB 2RLOA 4WVFB 1XODA 1ZC4B 2DHJA 3FSSA 2Z13A 5J3YA 1T77A 5FI0A 1SHCA 4HB4B 3U7DA 4IOYX 1LW3A 1WGUA 2E2XA 2D9YA 2J59M 3LJUX 3D8DA 5I2SA 3DXCA 2MWNB 1I7AA 1FHWA 4WJ7A 2GCLA 2P0DA 3F0WA 3GYPA 3ODXA 3FVCA 1PFJA 3FM8C 4GZUA 5C79A 3D8FA 3N7CA 4K17A 3TFMA 1TJ6A 2LKOA 3HIEA 2RUKB 2RSGA 3PZDA 2YS1A 3SO6A 4ZRKA 2BCJA 3UZTA 2FJUB 1M7EA 3G9WA 1EAZA 2NZ8B 1UPQA 2AL6A 2KIEA 1FGZA 5HE1A 4A6HA 1Z87A 4GPTB 1DBHA 2Y8GA 2DYQA 4QXAB 4KHBB 2IFSA 5I2MA 2KCJA 2R0DA 5LOPB 2LG1A 4HSIA 3TCAA 2RVBB 2D9XA 2J0JA 2K49A 2W2XD 2N0YA 3BJIA 3NWAA 2RRFA 3AU5A 2H7DA 4OT1A 4KAXB 4HAVB 1OQNA 4PQ0A 2DYNA 1U2BA 2DKQA 1MKEA 2R09A 1PLSA 1IRSA 3U12A 1AWEA 1ZC3B 2DX5A 2CAYA 1V88A 2Z59A 2M14A 2KGXB 1DYNA 2OQBA 1FGYA 5HE3A 4A6KA 4WSFA 3HK0A 2D9WA 2FJLA 4K2OA 1I2HA 3AJ4A 1U5EA 4ZRJA 3IVFA 1FHOA 4HAUB 1OY2A 3MPXA 3WYFB
chains in the Genus database with same CATH topology
1P6SA 2VRWB 3ULBA 1WVHA 2COCA 1MPHA 2K00A 2ZPYA 1GC6A 4GN1A 4IFSA 4PNKA 3V5WA 5CLQB 4Z2MB 2P0HA 5LONB 4GMXB 4YONA 2CY5A 2YSZA 4F7UP 3ULCA 1WGQA 3T06A 1ZM0A 3KZ1A 2QKMA 4HB3B 1P5TA 3QWMA 1J19A 1UPRA 1MK9B 1UEFA 3KRWA 1FAOA 1V61A 3PG7A 2G35A 3PP2A 2YT0A 5DHAB 3U8ZA 4HDOA 5DH9B 5HE0A 2I1KA 5C5BB 1TXDA 3PEGA 1W1DA 4EKUA 5DIFB 5D3YA 3RCPA 5GOWB 3TO1A 2DFKA 2CRFA 2GJYA 2Z0OA 5HE2A 3OANA 5L81A 4NSWA 2Y7BA 1X05A 3TVVA 2LOZA 4EJNA 2CODA 1FB8A 5KCVA 3A8QA 2LULA 4Z2NA 1NTVA 1WJMA 3PVUA 2IYBA 1U27A 4D0NB 2COAA 1EGXA 3CXBB 2LYDA 3ZDTA 4P7IA 1EVHA 1Y5OA 5D3VA 3MDBC 3SYXA 1UNRA 2VSZA 1K5GB 3TW1A 1XKEA 1BTNA 2AEHA 2QKLA 5CLLB 1N3HA 1U5GA 1BAKA 2ELBA 4HB2B 4K2PA 2Z0QA 1RRPB 5KQ1A 2PZ1A 1FOEA 3WA0A 3HW2B 3KSYA 1DROA 2M38A 1K5DB 1V5UA 4HAWB 4DX90 2DN6A 2P0FA 1OMWA 2YS5A 1X1GA 3F5RA 1EF1A 2MDXA 4CYEA 3FEHA 2GCJA 2L2IA 4IAPA 1QC6A 1J0WA 3ZVRA 4L6EA 4TYZA 2J0MA 4HB0B 4HAZB 4HATB 5JP4A 5C5BA 4B6HA 4HAYB 2I5CA 1WI1A 4HHVA 1NU2A 3SV1A 2ROZB 5C16A 4GMVA 3SUZA 1Q67A 1W1GA 2D2QA 2I5FA 2K2UA 2NMBA 2YVCA 3P6AA 1NI2A 3PVWA 4MT7A 1W1HA 5DHFB 5JHGA 4MK0A 2P8VA 1P3RA 2UZRA 2UVMA 5DI9B 4MY6A 2Y8FA 3P7ZA 5JHHA 1WG7A 2DKPA 2DX1A 1X86A 1LB1A 1Y19B 4TKNA 3BINA 4Y94A 4DBBA 4A6FB 2YT1A 2UZSA 1B55A 4KHOA 5JLJB 5D3WA 1ISNA 1DDMA 3VIAA 2VKIA 2W2XC 1X1FA 3DXEA 3HQCA 1KZGA 1XD4A 1KI1B 4C0AA 2MKRA 2YRYA 3ODOA 4ZRIA 1V5MA 2EMSA 2LOXA 4F7HA 2J0KA 1KZ7A 5J3QA 4KVGB 1GG3A 2DTCA 4EMOA 4KHAA 2DA0A 2D4QA 5D27A 1XCGA 1U5FA 5D3XA 2XQNM 2COFA 1AQCA 1XR0B 1WJ1A 1XX0A 3VOQA 3PVLA 5FI1A 2N23A 1H10A 2I1JA 1MK7B 1U5DA 1BWNA 1GC7A 1NTYA 4HAXB 2ROVA 2DHKA 3ODWA 4YL8A 2D10A 2X18A 5J3TA 2YS3A 2OTXA 4A5KA 5C6RA 1PMSA 1E5WA 2GS0A 2D9ZA 3DXDA 1X11A 1ZVRA 4GXBA 3CIKA 1DDVA 1QQGA 1UNPA 3A98B 3ML4A 2KUPA 3KY9A 4DX8A 2JP2A 2V76A 1MAIA 5EFXA 1RJ2A 3AU4A 1H4RA 3GYOA 3M1IB 2W2WA 1FHXA 4H8SA 2ADZA 1V5PA 4BBKA 5KQ4A 4DXAB 2L1CA 2DLWA 4XWXA 1MIZB 2EMTA 2EJ8A 3KRXA 4A6FA 3O96A 3QBVB 2YF0A 4HDQA 2Z0PA 2ELAA 4F7GA 2DHIA 3SNHA 2D11A 1ZSQA 2HTHB 3QIJA 4CHJA 2K2JA 3NSUA 2CY4A 2RNRB 1DDWA 1M7RA 4K81A 3PSCA 1SGHA 2H7EA 3D8EA 2HE7A 4CHMA 2D9VA 1MIXA 3X23A 3A8PA 1UNQA 2MFQA 2EC1A 2Q13A 1BTKA 1U29A 4NY0A 1V89A 1TQZA 2RGNB 2RLOA 4WVFB 1XODA 1ZC4B 2DHJA 3FSSA 5J3YA 5FI0A 1SHCA 4HB4B 3U7DA 4IOYX 1LW3A 1WGUA 2E2XA 2D9YA 2J59M 3LJUX 3D8DA 3DXCA 2MWNB 1I7AA 1FHWA 4WJ7A 2GCLA 2P0DA 3F0WA 3GYPA 3ODXA 1PFJA 3FM8C 4GZUA 5C79A 3D8FA 3N7CA 4K17A 3TFMA 1TJ6A 2LKOA 2RUKB 2RSGA 3PZDA 2YS1A 3SO6A 4ZRKA 2BCJA 3UZTA 1M7EA 3G9WA 1EAZA 2NZ8B 1UPQA 2AL6A 1FGZA 5HE1A 4A6HA 1Z87A 4GPTB 1DBHA 2Y8GA 2DYQA 4KHBB 2IFSA 2KCJA 2R0DA 5LOPB 2LG1A 3TCAA 2RVBB 2D9XA 2J0JA 2W2XD 2N0YA 3BJIA 3AU5A 2H7DA 4KAXB 4HAVB 1OQNA 4PQ0A 2DYNA 1U2BA 2DKQA 1MKEA 2R09A 1PLSA 1IRSA 1AWEA 1ZC3B 2DX5A 2CAYA 1V88A 2M14A 2KGXB 1DYNA 2OQBA 1FGYA 5HE3A 4A6KA 4WSFA 3HK0A 2D9WA 2FJLA 4K2OA 1I2HA 3AJ4A 1U5EA 4ZRJA 3IVFA 1FHOA 4HAUB 1OY2A 3MPXA 3WYFB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1P6S A;  2VRW B;  3ULB A;  1WVH A;  2COC A;  1MPH A;  2K00 A;  2ZPY A;  1GC6 A;  4GN1 A;  4IFS A;  4PNK A;  3V5W A;  5CLQ B;  4Z2M B;  2P0H A;  5LON B;  4GMX B;  4YON A;  2CY5 A;  2YSZ A;  4F7U P;  3ULC A;  1WGQ A;  3T06 A;  1ZM0 A;  3KZ1 A;  2QKM A;  4HB3 B;  1P5T A;  3QWM A;  1J19 A;  1UPR A;  1MK9 B;  1UEF A;  3KRW A;  1FAO A;  1V61 A;  3PG7 A;  2G35 A;  3PP2 A;  2YT0 A;  5DHA B;  3U8Z A;  4HDO A;  5DH9 B;  5HE0 A;  2I1K A;  5C5B B;  1TXD A;  3PEG A;  1W1D A;  4EKU A;  5DIF B;  5D3Y A;  3RCP A;  5GOW B;  3TO1 A;  2DFK A;  2CRF A;  2GJY A;  2Z0O A;  5HE2 A;  3OAN A;  5L81 A;  4NSW A;  2Y7B A;  1X05 A;  3TVV A;  2LOZ A;  4EJN A;  2COD A;  1FB8 A;  5KCV A;  3A8Q A;  2LUL A;  4Z2N A;  1NTV A;  1WJM A;  3PVU A;  2IYB A;  1U27 A;  4D0N B;  2COA A;  1EGX A;  3CXB B;  2LYD A;  3ZDT A;  4P7I A;  1EVH A;  1Y5O A;  5D3V A;  3MDB C;  3SYX A;  1UNR A;  2VSZ A;  1K5G B;  3TW1 A;  1XKE A;  1BTN A;  2AEH A;  2QKL A;  5CLL B;  1N3H A;  1U5G A;  1BAK A;  2ELB A;  4HB2 B;  4K2P A;  2Z0Q A;  1RRP B;  5KQ1 A;  2PZ1 A;  1FOE A;  3WA0 A;  3HW2 B;  3KSY A;  1DRO A;  2M38 A;  1K5D B;  1V5U A;  4HAW B;  4DX9 0;  2DN6 A;  2P0F A;  1OMW A;  2YS5 A;  1X1G A;  3F5R A;  1EF1 A;  2MDX A;  4CYE A;  3FEH A;  2GCJ A;  2L2I A;  4IAP A;  1QC6 A;  1J0W A;  3ZVR A;  4L6E A;  4TYZ A;  2J0M A;  4HB0 B;  4HAZ B;  4HAT B;  5JP4 A;  5C5B A;  4B6H A;  4HAY B;  2I5C A;  1WI1 A;  4HHV A;  1NU2 A;  3SV1 A;  2ROZ B;  5C16 A;  4GMV A;  3SUZ A;  1Q67 A;  1W1G A;  2D2Q A;  2I5F A;  2K2U A;  2NMB A;  2YVC A;  3P6A A;  1NI2 A;  3PVW A;  4MT7 A;  1W1H A;  5DHF B;  5JHG A;  4MK0 A;  2P8V A;  1P3R A;  2UZR A;  2UVM A;  5DI9 B;  4MY6 A;  2Y8F A;  3P7Z A;  5JHH A;  1WG7 A;  2DKP A;  2DX1 A;  1X86 A;  1LB1 A;  1Y19 B;  4TKN A;  3BIN A;  4Y94 A;  4DBB A;  4A6F B;  2YT1 A;  2UZS A;  1B55 A;  4KHO A;  5JLJ B;  5D3W A;  1ISN A;  1DDM A;  3VIA A;  2VKI A;  2W2X C;  1X1F A;  3DXE A;  3HQC A;  1KZG A;  1XD4 A;  1KI1 B;  4C0A A;  2MKR A;  2YRY A;  3ODO A;  4ZRI A;  1V5M A;  2EMS A;  2LOX A;  4F7H A;  2J0K A;  1KZ7 A;  5J3Q A;  4KVG B;  1GG3 A;  2DTC A;  4EMO A;  4KHA A;  2DA0 A;  2D4Q A;  5D27 A;  1XCG A;  1U5F A;  5D3X A;  2XQN M;  2COF A;  1AQC A;  1XR0 B;  1WJ1 A;  1XX0 A;  3VOQ A;  3PVL A;  5FI1 A;  2N23 A;  1H10 A;  2I1J A;  1MK7 B;  1U5D A;  1BWN A;  1GC7 A;  1NTY A;  4HAX B;  2ROV A;  2DHK A;  3ODW A;  4YL8 A;  2D10 A;  2X18 A;  5J3T A;  2YS3 A;  2OTX A;  4A5K A;  5C6R A;  1PMS A;  1E5W A;  2GS0 A;  2D9Z A;  3DXD A;  1X11 A;  1ZVR A;  4GXB A;  3CIK A;  1DDV A;  1QQG A;  1UNP A;  3A98 B;  3ML4 A;  2KUP A;  3KY9 A;  4DX8 A;  2JP2 A;  2V76 A;  1MAI A;  5EFX A;  1RJ2 A;  3AU4 A;  1H4R A;  3GYO A;  3M1I B;  2W2W A;  1FHX A;  4H8S A;  2ADZ A;  1V5P A;  4BBK A;  5KQ4 A;  4DXA B;  2L1C A;  2DLW A;  4XWX A;  1MIZ B;  2EMT A;  2EJ8 A;  3KRX A;  4A6F A;  3O96 A;  3QBV B;  2YF0 A;  4HDQ A;  2Z0P A;  2ELA A;  4F7G A;  2DHI A;  3SNH A;  2D11 A;  1ZSQ A;  2HTH B;  3QIJ A;  4CHJ A;  2K2J A;  3NSU A;  2CY4 A;  2RNR B;  1DDW A;  1M7R A;  4K81 A;  3PSC A;  1SGH A;  2H7E A;  3D8E A;  2HE7 A;  4CHM A;  2D9V A;  1MIX A;  3X23 A;  3A8P A;  1UNQ A;  2MFQ A;  2EC1 A;  2Q13 A;  1BTK A;  1U29 A;  4NY0 A;  1V89 A;  1TQZ A;  2RGN B;  2RLO A;  4WVF B;  1XOD A;  1ZC4 B;  2DHJ A;  3FSS A;  5J3Y A;  5FI0 A;  1SHC A;  4HB4 B;  3U7D A;  4IOY X;  1LW3 A;  1WGU A;  2E2X A;  2D9Y A;  2J59 M;  3LJU X;  3D8D A;  3DXC A;  2MWN B;  1I7A A;  1FHW A;  4WJ7 A;  2GCL A;  2P0D A;  3F0W A;  3GYP A;  3ODX A;  1PFJ A;  3FM8 C;  4GZU A;  5C79 A;  3D8F A;  3N7C A;  4K17 A;  3TFM A;  1TJ6 A;  2LKO A;  2RUK B;  2RSG A;  3PZD A;  2YS1 A;  3SO6 A;  4ZRK A;  2BCJ A;  3UZT A;  1M7E A;  3G9W A;  1EAZ A;  2NZ8 B;  1UPQ A;  2AL6 A;  1FGZ A;  5HE1 A;  4A6H A;  1Z87 A;  4GPT B;  1DBH A;  2Y8G A;  2DYQ A;  4KHB B;  2IFS A;  2KCJ A;  2R0D A;  5LOP B;  2LG1 A;  3TCA A;  2RVB B;  2D9X A;  2J0J A;  2W2X D;  2N0Y A;  3BJI A;  3AU5 A;  2H7D A;  4KAX B;  4HAV B;  1OQN A;  4PQ0 A;  2DYN A;  1U2B A;  2DKQ A;  1MKE A;  2R09 A;  1PLS A;  1IRS A;  1AWE A;  1ZC3 B;  2DX5 A;  2CAY A;  1V88 A;  2M14 A;  2KGX B;  1DYN A;  2OQB A;  1FGY A;  5HE3 A;  4A6K A;  4WSF A;  3HK0 A;  2D9W A;  2FJL A;  4K2O A;  1I2H A;  3AJ4 A;  1U5E A;  4ZRJ A;  3IVF A;  1FHO A;  4HAU B;  1OY2 A;  3MPX A;  3WYF B; 
#chains in the Genus database with same CATH topology
 1P6S A;  2VRW B;  3ULB A;  1WVH A;  2COC A;  1MPH A;  2K00 A;  2ZPY A;  1GC6 A;  4GN1 A;  4IFS A;  4PNK A;  3V5W A;  5CLQ B;  4Z2M B;  2P0H A;  5LON B;  4GMX B;  4YON A;  2CY5 A;  2YSZ A;  4F7U P;  5M4Y B;  3ULC A;  1WGQ A;  4L1R A;  3T06 A;  1ZM0 A;  3KZ1 A;  3HSA A;  2QKM A;  4HB3 B;  1P5T A;  3QWM A;  1J19 A;  1UPR A;  1MK9 B;  1UEF A;  3KRW A;  1FAO A;  1V61 A;  3PG7 A;  2G35 A;  3PP2 A;  2YT0 A;  5DHA B;  3U8Z A;  4HDO A;  4GNK B;  5DH9 B;  5HE0 A;  2I1K A;  5C5B B;  1TXD A;  3PEG A;  1W1D A;  4QJ4 B;  4EKU A;  5DIF B;  5D3Y A;  3RCP A;  5GOW B;  3TO1 A;  2DFK A;  2KUQ A;  4KHB A;  2CRF A;  2GJY A;  2Z0O A;  5HE2 A;  3OAN A;  5L81 A;  4NSW A;  2Y7B A;  1X05 A;  3TVV A;  2LOZ A;  4EJN A;  2COD A;  1FB8 A;  5KCV A;  3A8Q A;  2LUL A;  4Z2N A;  1NTV A;  1WJM A;  3PVU A;  2IYB A;  1U27 A;  4D0N B;  2COA A;  1EGX A;  3CXB B;  2LYD A;  3ZDT A;  4P7I A;  2KR0 A;  1EVH A;  1Y5O A;  5D3V A;  3MDB C;  3SYX A;  1UNR A;  2VSZ A;  1K5G B;  3TW1 A;  1XKE A;  1BTN A;  2AEH A;  2QKL A;  5CLL B;  1N3H A;  4QJ3 B;  1U5G A;  1BAK A;  2ELB A;  5LG4 B;  4CSQ A;  4HB2 B;  4K2P A;  2Z0Q A;  1RRP B;  5KQ1 A;  2Z14 A;  2PZ1 A;  1FOE A;  3WA0 A;  3HW2 B;  3KSY A;  1DRO A;  2M38 A;  1K5D B;  1V5U A;  4HAW B;  4DX9 0;  2DN6 A;  2P0F A;  1OMW A;  2YS5 A;  1X1G A;  3F5R A;  1EF1 A;  2MDX A;  4CYE A;  3FEH A;  2GCJ A;  2L2I A;  4IAP A;  1QC6 A;  1J0W A;  3ZVR A;  4L6E A;  4TYZ A;  2J0M A;  2ZKM X;  4HB0 B;  4HAZ B;  4HAT B;  5JP4 A;  5C5B A;  4B6H A;  4HAY B;  3NWF A;  2I5C A;  1WI1 A;  4OSN A;  4HHV A;  1NU2 A;  3SV1 A;  2ROZ B;  5C16 A;  4GMV A;  3SUZ A;  1Q67 A;  1W1G A;  2D2Q A;  2I5F A;  2K2U A;  2NMB A;  2YVC A;  3P6A A;  1NI2 A;  3PVW A;  4MT7 A;  1W1H A;  3OHM B;  5DHF B;  5IRS A;  5JHG A;  4MK0 A;  2KIG A;  2P8V A;  1P3R A;  2UZR A;  2UVM A;  5DI9 B;  4MY6 A;  2Y8F A;  3P7Z A;  5JHH A;  3A58 A;  1WG7 A;  2DKP A;  2DX1 A;  1X86 A;  1LB1 A;  1Y19 B;  4TKN A;  3BIN A;  4Y94 A;  4DBB A;  2NBV A;  4A6F B;  2YT1 A;  2UZS A;  1B55 A;  4KHO A;  5JLJ B;  5D3W A;  1ISN A;  1DDM A;  3VIA A;  2VKI A;  2W2X C;  1X1F A;  3DXE A;  3HQC A;  1KZG A;  1XD4 A;  1KI1 B;  2R2Y A;  4C0A A;  2MKR A;  2YRY A;  3ODO A;  4ZRI A;  1V5M A;  2EMS A;  2LOX A;  4F7H A;  2J0K A;  3NW8 A;  1KZ7 A;  5J3Q A;  4KVG B;  1GG3 A;  2DTC A;  4EMO A;  4KHA A;  2DA0 A;  2D4Q A;  5D27 A;  1XCG A;  1U5F A;  3DCX A;  5D3X A;  2XQN M;  2COF A;  4QJ5 B;  2K8E A;  1AQC A;  1XR0 B;  1ZYI A;  1WJ1 A;  1XX0 A;  3VOQ A;  3PVL A;  5FI1 A;  2N23 A;  1H10 A;  2I1J A;  2Z4D A;  1MK7 B;  1U5D A;  2YT2 A;  1BWN A;  1GC7 A;  1NTY A;  4HAX B;  2ROV A;  2DHK A;  3ODW A;  4YL8 A;  2D10 A;  2X18 A;  5J3T A;  4D6W A;  2YS3 A;  1MI1 A;  2OTX A;  4A5K A;  5C6R A;  1PMS A;  1E5W A;  2GS0 A;  2D9Z A;  3DXD A;  1X11 A;  4GOU A;  1ZVR A;  4GXB A;  3CIK A;  1DDV A;  1QQG A;  3NWD A;  1UNP A;  3A98 B;  3ML4 A;  2KUP A;  3KY9 A;  4DX8 A;  2JP2 A;  2V76 A;  1MAI A;  5EFX A;  1RJ2 A;  3AU4 A;  1H4R A;  3GYO A;  3M1I B;  2W2W A;  1FHX A;  4H8S A;  2ADZ A;  1V5P A;  4BBK A;  5KQ4 A;  4DXA B;  2L1C A;  2DLW A;  4XWX A;  1MIZ B;  2EMT A;  2EJ8 A;  3KRX A;  4A6F A;  3O96 A;  3QBV B;  2YF0 A;  4HDQ A;  3B77 A;  2Z0P A;  2ELA A;  4F7G A;  2DHI A;  2GUM A;  3SNH A;  2D11 A;  1ZSQ A;  2HTH B;  3QIJ A;  4DIX A;  4CHJ A;  2K2J A;  3NSU A;  2CY4 A;  2RNR B;  1DDW A;  1M7R A;  4K81 A;  3PSC A;  1SGH A;  2H7E A;  3D8E A;  2HE7 A;  4CHM A;  2D9V A;  1MIX A;  3X23 A;  3A8P A;  1UNQ A;  2MFQ A;  2EC1 A;  2Q13 A;  1BTK A;  1U29 A;  4NY0 A;  1V89 A;  1TQZ A;  2RGN B;  2RLO A;  4WVF B;  1XOD A;  1ZC4 B;  2DHJ A;  3FSS A;  2Z13 A;  5J3Y A;  1T77 A;  5FI0 A;  1SHC A;  4HB4 B;  3U7D A;  4IOY X;  1LW3 A;  1WGU A;  2E2X A;  2D9Y A;  2J59 M;  3LJU X;  3D8D A;  5I2S A;  3DXC A;  2MWN B;  1I7A A;  1FHW A;  4WJ7 A;  2GCL A;  2P0D A;  3F0W A;  3GYP A;  3ODX A;  3FVC A;  1PFJ A;  3FM8 C;  4GZU A;  5C79 A;  3D8F A;  3N7C A;  4K17 A;  3TFM A;  1TJ6 A;  2LKO A;  3HIE A;  2RUK B;  2RSG A;  3PZD A;  2YS1 A;  3SO6 A;  4ZRK A;  2BCJ A;  3UZT A;  2FJU B;  1M7E A;  3G9W A;  1EAZ A;  2NZ8 B;  1UPQ A;  2AL6 A;  2KIE A;  1FGZ A;  5HE1 A;  4A6H A;  1Z87 A;  4GPT B;  1DBH A;  2Y8G A;  2DYQ A;  4QXA B;  4KHB B;  2IFS A;  5I2M A;  2KCJ A;  2R0D A;  5LOP B;  2LG1 A;  4HSI A;  3TCA A;  2RVB B;  2D9X A;  2J0J A;  2K49 A;  2W2X D;  2N0Y A;  3BJI A;  3NWA A;  2RRF A;  3AU5 A;  2H7D A;  4OT1 A;  4KAX B;  4HAV B;  1OQN A;  4PQ0 A;  2DYN A;  1U2B A;  2DKQ A;  1MKE A;  2R09 A;  1PLS A;  1IRS A;  3U12 A;  1AWE A;  1ZC3 B;  2DX5 A;  2CAY A;  1V88 A;  2Z59 A;  2M14 A;  2KGX B;  1DYN A;  2OQB A;  1FGY A;  5HE3 A;  4A6K A;  4WSF A;  3HK0 A;  2D9W A;  2FJL A;  4K2O A;  1I2H A;  3AJ4 A;  1U5E A;  4ZRJ A;  3IVF A;  1FHO A;  4HAU B;  1OY2 A;  3MPX A;  3WYF B; 
#chains in the Genus database with same CATH homology
 1P6S A;  2VRW B;  3ULB A;  1WVH A;  2COC A;  1MPH A;  2K00 A;  2ZPY A;  1GC6 A;  4GN1 A;  4IFS A;  4PNK A;  3V5W A;  5CLQ B;  4Z2M B;  2P0H A;  5LON B;  4GMX B;  4YON A;  2CY5 A;  2YSZ A;  4F7U P;  3ULC A;  1WGQ A;  3T06 A;  1ZM0 A;  3KZ1 A;  2QKM A;  4HB3 B;  1P5T A;  3QWM A;  1J19 A;  1UPR A;  1MK9 B;  1UEF A;  3KRW A;  1FAO A;  1V61 A;  3PG7 A;  2G35 A;  3PP2 A;  2YT0 A;  5DHA B;  3U8Z A;  4HDO A;  5DH9 B;  5HE0 A;  2I1K A;  5C5B B;  1TXD A;  3PEG A;  1W1D A;  4EKU A;  5DIF B;  5D3Y A;  3RCP A;  5GOW B;  3TO1 A;  2DFK A;  2CRF A;  2GJY A;  2Z0O A;  5HE2 A;  3OAN A;  5L81 A;  4NSW A;  2Y7B A;  1X05 A;  3TVV A;  2LOZ A;  4EJN A;  2COD A;  1FB8 A;  5KCV A;  3A8Q A;  2LUL A;  4Z2N A;  1NTV A;  1WJM A;  3PVU A;  2IYB A;  1U27 A;  4D0N B;  2COA A;  1EGX A;  3CXB B;  2LYD A;  3ZDT A;  4P7I A;  1EVH A;  1Y5O A;  5D3V A;  3MDB C;  3SYX A;  1UNR A;  2VSZ A;  1K5G B;  3TW1 A;  1XKE A;  1BTN A;  2AEH A;  2QKL A;  5CLL B;  1N3H A;  1U5G A;  1BAK A;  2ELB A;  4HB2 B;  4K2P A;  2Z0Q A;  1RRP B;  5KQ1 A;  2PZ1 A;  1FOE A;  3WA0 A;  3HW2 B;  3KSY A;  1DRO A;  2M38 A;  1K5D B;  1V5U A;  4HAW B;  4DX9 0;  2DN6 A;  2P0F A;  1OMW A;  2YS5 A;  1X1G A;  3F5R A;  1EF1 A;  2MDX A;  4CYE A;  3FEH A;  2GCJ A;  2L2I A;  4IAP A;  1QC6 A;  1J0W A;  3ZVR A;  4L6E A;  4TYZ A;  2J0M A;  4HB0 B;  4HAZ B;  4HAT B;  5JP4 A;  5C5B A;  4B6H A;  4HAY B;  2I5C A;  1WI1 A;  4HHV A;  1NU2 A;  3SV1 A;  2ROZ B;  5C16 A;  4GMV A;  3SUZ A;  1Q67 A;  1W1G A;  2D2Q A;  2I5F A;  2K2U A;  2NMB A;  2YVC A;  3P6A A;  1NI2 A;  3PVW A;  4MT7 A;  1W1H A;  5DHF B;  5JHG A;  4MK0 A;  2P8V A;  1P3R A;  2UZR A;  2UVM A;  5DI9 B;  4MY6 A;  2Y8F A;  3P7Z A;  5JHH A;  1WG7 A;  2DKP A;  2DX1 A;  1X86 A;  1LB1 A;  1Y19 B;  4TKN A;  3BIN A;  4Y94 A;  4DBB A;  4A6F B;  2YT1 A;  2UZS A;  1B55 A;  4KHO A;  5JLJ B;  5D3W A;  1ISN A;  1DDM A;  3VIA A;  2VKI A;  2W2X C;  1X1F A;  3DXE A;  3HQC A;  1KZG A;  1XD4 A;  1KI1 B;  4C0A A;  2MKR A;  2YRY A;  3ODO A;  4ZRI A;  1V5M A;  2EMS A;  2LOX A;  4F7H A;  2J0K A;  1KZ7 A;  5J3Q A;  4KVG B;  1GG3 A;  2DTC A;  4EMO A;  4KHA A;  2DA0 A;  2D4Q A;  5D27 A;  1XCG A;  1U5F A;  5D3X A;  2XQN M;  2COF A;  1AQC A;  1XR0 B;  1WJ1 A;  1XX0 A;  3VOQ A;  3PVL A;  5FI1 A;  2N23 A;  1H10 A;  2I1J A;  1MK7 B;  1U5D A;  1BWN A;  1GC7 A;  1NTY A;  4HAX B;  2ROV A;  2DHK A;  3ODW A;  4YL8 A;  2D10 A;  2X18 A;  5J3T A;  2YS3 A;  2OTX A;  4A5K A;  5C6R A;  1PMS A;  1E5W A;  2GS0 A;  2D9Z A;  3DXD A;  1X11 A;  1ZVR A;  4GXB A;  3CIK A;  1DDV A;  1QQG A;  1UNP A;  3A98 B;  3ML4 A;  2KUP A;  3KY9 A;  4DX8 A;  2JP2 A;  2V76 A;  1MAI A;  5EFX A;  1RJ2 A;  3AU4 A;  1H4R A;  3GYO A;  3M1I B;  2W2W A;  1FHX A;  4H8S A;  2ADZ A;  1V5P A;  4BBK A;  5KQ4 A;  4DXA B;  2L1C A;  2DLW A;  4XWX A;  1MIZ B;  2EMT A;  2EJ8 A;  3KRX A;  4A6F A;  3O96 A;  3QBV B;  2YF0 A;  4HDQ A;  2Z0P A;  2ELA A;  4F7G A;  2DHI A;  3SNH A;  2D11 A;  1ZSQ A;  2HTH B;  3QIJ A;  4CHJ A;  2K2J A;  3NSU A;  2CY4 A;  2RNR B;  1DDW A;  1M7R A;  4K81 A;  3PSC A;  1SGH A;  2H7E A;  3D8E A;  2HE7 A;  4CHM A;  2D9V A;  1MIX A;  3X23 A;  3A8P A;  1UNQ A;  2MFQ A;  2EC1 A;  2Q13 A;  1BTK A;  1U29 A;  4NY0 A;  1V89 A;  1TQZ A;  2RGN B;  2RLO A;  4WVF B;  1XOD A;  1ZC4 B;  2DHJ A;  3FSS A;  5J3Y A;  5FI0 A;  1SHC A;  4HB4 B;  3U7D A;  4IOY X;  1LW3 A;  1WGU A;  2E2X A;  2D9Y A;  2J59 M;  3LJU X;  3D8D A;  3DXC A;  2MWN B;  1I7A A;  1FHW A;  4WJ7 A;  2GCL A;  2P0D A;  3F0W A;  3GYP A;  3ODX A;  1PFJ A;  3FM8 C;  4GZU A;  5C79 A;  3D8F A;  3N7C A;  4K17 A;  3TFM A;  1TJ6 A;  2LKO A;  2RUK B;  2RSG A;  3PZD A;  2YS1 A;  3SO6 A;  4ZRK A;  2BCJ A;  3UZT A;  1M7E A;  3G9W A;  1EAZ A;  2NZ8 B;  1UPQ A;  2AL6 A;  1FGZ A;  5HE1 A;  4A6H A;  1Z87 A;  4GPT B;  1DBH A;  2Y8G A;  2DYQ A;  4KHB B;  2IFS A;  2KCJ A;  2R0D A;  5LOP B;  2LG1 A;  3TCA A;  2RVB B;  2D9X A;  2J0J A;  2W2X D;  2N0Y A;  3BJI A;  3AU5 A;  2H7D A;  4KAX B;  4HAV B;  1OQN A;  4PQ0 A;  2DYN A;  1U2B A;  2DKQ A;  1MKE A;  2R09 A;  1PLS A;  1IRS A;  1AWE A;  1ZC3 B;  2DX5 A;  2CAY A;  1V88 A;  2M14 A;  2KGX B;  1DYN A;  2OQB A;  1FGY A;  5HE3 A;  4A6K A;  4WSF A;  3HK0 A;  2D9W A;  2FJL A;  4K2O A;  1I2H A;  3AJ4 A;  1U5E A;  4ZRJ A;  3IVF A;  1FHO A;  4HAU B;  1OY2 A;  3MPX A;  3WYF B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...