1X11A

X11 ptb domain
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
170
structure length
135
Chain Sequence
b'MEDLIDGIIFAANYLGSTQLLSDKTPSKNVRMMQAQEAVSRIKMAQMTEVDLFILTQRIKVLNADTQETMMDHPLRTISYIADIGNIVVLMARDGKRQYKMICHVFESEDAQLIAQSIGQAFSVAYQEFLRANGI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords X11
publication title Sequence-specific recognition of the internalization motif of the Alzheimer's amyloid precursor protein by the X11 PTB domain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Complex (peptide binding module/peptide)
total genus 30
structure length 135
sequence length 170
chains with identical sequence B
ec nomenclature
pdb deposition date 1997-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00640 PID Phosphotyrosine interaction domain (PTB/PID)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 1x11A00
2I5CA 2ELAA 1DROA 1GC6A 1KZ7A 1NI2A 3KRXA 2HTHB 2DTCA 2E2XA 1U2BA 3M1IB 5D3WA 1DDWA 1I2HA 2I1KA 2OQBA 2I1JA 2RLOA 3UZTA 1M7RA 3A8PA 4NSWA 4KAXB 4A6FB 1XR0B 3PEGA 2DFKA 3PP2A 5JLJB 2DHKA 4MT7A 1EAZA 2D4QA 1FHOA 3PVUA 3V5WA 2H7DA 1LW3A 4HAYB 1V5MA 3PVLA 1AWEA 4YONA 1PMSA 2DN6A 2VRWB 3P7ZA 3D8FA 2GJYA 3AU4A 1OY2A 4YL8A 5HE1A 2DHJA 2UZRA 4ZRKA 4F7UP 3ULBA 3PG7A 4KHBB 1DDMA 4C0AA 3CIKA 2D9VA 1K5GB 2D9ZA 1NU2A 1X11A 2NZ8B 3TVVA 4HDQA 2D11A 4HB3B 5FI0A 1XD4A 1WI1A 2P0FA 2D9XA 2XQNM 1X86A 4HDOA 5C5BB 2D9YA 4KHOA 2AEHA 2YT1A 1V61A 2CY4A 1U5FA 2NMBA 3SNHA 1I7AA 3BJIA 4K2PA 2CAYA 2UZSA 3NSUA 1J0WA 1ZC3B 2J0JA 3VOQA 3KY9A 2P0DA 4PNKA 3FEHA 4DX90 2JP2A 4GMVA 4ZRJA 1OMWA 5KQ4A 5HE0A 1V88A 3X23A 3GYOA 3SO6A 1N3HA 4GMXB 4F7GA 1NTYA 3ML4A 2Y7BA 1FB8A 3HK0A 1FHXA 4EMOA 1GG3A 5DI9B 1UPQA 2Y8GA 1Q67A 3KZ1A 1TQZA 2CY5A 3TW1A 1RJ2A 4HHVA 3BINA 3O96A 2DX1A 1TJ6A 2Q13A 4HAWB 2VKIA 1OQNA 1ZVRA 2ADZA 1MPHA 4Z2MB 1MKEA 4HAVB 1MIXA 2J59M 1UNQA 2RUKB 4CYEA 4ZRIA 4Y94A 1ZSQA 5FI1A 3D8DA 2QKLA 2YSZA 2KGXB 4NY0A 2L2IA 4DX8A 3PSCA 2RNRB 5GOWB 3ZDTA 4K81A 2DHIA 3ODXA 1KI1B 4K2OA 1UNPA 2EJ8A 3T06A 2M14A 1XKEA 2LYDA 1BWNA 1WJ1A 3FM8C 1PFJA 3AU5A 4IFSA 2ZPYA 2K2UA 2I5FA 3A8QA 1GC7A 1TXDA 2FJLA 4WVFB 1WVHA 5DHFB 2J0MA 4GN1A 4GPTB 2DLWA 3A98B 4EKUA 2ROVA 2G35A 1PLSA 1M7EA 2CRFA 3WA0A 5C6RA 1XCGA 2Z0PA 1BAKA 2YS1A 2UVMA 2COAA 3MPXA 3PZDA 1QC6A 1FGZA 5HE3A 2GCLA 2ROZB 3AJ4A 3VIAA 1WGUA 1W1DA 3WYFB 4IOYX 1V89A 3TFMA 2YVCA 2K2JA 4F7HA 1FGYA 3ULCA 2MKRA 3ODOA 2MWNB 1Y5OA 2GS0A 4A5KA 1U27A 3SYXA 2Z0QA 1EVHA 3QIJA 3ODWA 4HB0B 1B55A 4D0NB 1FHWA 1QQGA 3SUZA 3QWMA 1FAOA 5LONB 2V76A 2BCJA 4HAUB 5DIFB 2N0YA 3HW2B 4TYZA 1U5GA 2IYBA 4K17A 4TKNA 1DBHA 4KHAA 4BBKA 2RSGA 1U29A 4CHJA 2L1CA 5J3YA 2W2XD 4B6HA 2ELBA 5C79A 4H8SA 3P6AA 2AL6A 1W1GA 4HAXB 2YS3A 3U7DA 1FOEA 2W2WA 4HB4B 5J3TA 4A6KA 2P0HA 3IVFA 2DX5A 2CODA 2W2XC 3DXEA 5LOPB 2D9WA 1W1HA 2PZ1A 1SGHA 3ZVRA 4WSFA 1P6SA 3HQCA 2YS5A 4L6EA 3RCPA 1Z87A 1MIZB 2DKQA 2M38A 2Y8FA 2EMTA 5HE2A 1H4RA 4GZUA 2H7EA 4WJ7A 1V5PA 5L81A 2DA0A 1DDVA 2LULA 5D27A 1WJMA 2MDXA 3FSSA 2LOXA 2COCA 2J0KA 3F0WA 2YRYA 1H10A 2IFSA 2YT0A 3D8EA 2N23A 5D3XA 2X18A 1RRPB 3F5RA 3N7CA 2KCJA 1P3RA 5JHHA 2R09A 5C16A 5J3QA 3LJUX 5KQ1A 3MDBC 1KZGA 2MFQA 3SV1A 3TO1A 2D10A 4HATB 4A6HA 1V5UA 2GCJA 3OANA 2LG1A 3DXDA 4CHMA 4KVGB 1XX0A 1DYNA 3PVWA 2QKMA 1MK7B 1MAIA 5DHAB 1E5WA 4P7IA 1WGQA 1BTKA 1WG7A 4HB2B 4A6FA 5D3YA 4GXBA 2P8VA 2RGNB 4MK0A 1EGXA 1IRSA 5CLLB 1MK9B 1ZM0A 3GYPA 1UPRA 1NTVA 2RVBB 1X1FA 3CXBB 3DXCA 2DKPA 2EMSA 4MY6A 5CLQB 2COFA 1LB1A 4DBBA 2YF0A 2K00A 2EC1A 3QBVB 2LKOA 1BTNA 2OTXA 4HAZB 5JP4A 2HE7A 5EFXA 5D3VA 1XODA 3G9WA 3TCAA 2DYNA 2KUPA 5C5BA 1UNRA 4PQ0A 1X1GA 2R0DA 1X05A 2D2QA 3U8ZA 1SHCA 4IAPA 1UEFA 1ISNA 5DH9B 2LOZA 1K5DB 4DXAB 1U5EA 1AQCA 4Z2NA 1EF1A 2DYQA 1J19A 1ZC4B 1U5DA 5KCVA 2VSZA 2Z0OA 1Y19B 1P5TA 5JHGA 4XWXA 3KRWA 3KSYA 4EJNA
chains in the Genus database with same CATH superfamily
2I5CA 2ELAA 1DROA 2NBVA 1GC6A 1KZ7A 1NI2A 3KRXA 2HTHB 2DTCA 2E2XA 1U2BA 3M1IB 5D3WA 1DDWA 1I2HA 2YT2A 2I1KA 2OQBA 2I1JA 2RLOA 2KIEA 3UZTA 1M7RA 3A8PA 2Z13A 4NSWA 4KAXB 4A6FB 1XR0B 3PEGA 2DFKA 3PP2A 5JLJB 2DHKA 4MT7A 1EAZA 2D4QA 1FHOA 3PVUA 3V5WA 2H7DA 1LW3A 4HAYB 1V5MA 3PVLA 1AWEA 4YONA 1PMSA 2DN6A 2VRWB 3P7ZA 3D8FA 2GJYA 3AU4A 4GNKB 1OY2A 4YL8A 5HE1A 2DHJA 2UZRA 4ZRKA 4F7UP 3ULBA 3PG7A 4KHBB 1DDMA 1T77A 4C0AA 3CIKA 2D9VA 1K5GB 2D9ZA 1NU2A 1X11A 2NZ8B 3TVVA 4HDQA 2D11A 4HB3B 5FI0A 1XD4A 1WI1A 2P0FA 2D9XA 2FJUB 2XQNM 1X86A 4HDOA 5C5BB 2D9YA 4KHOA 2AEHA 2YT1A 1V61A 2CY4A 5LG4B 1U5FA 2NMBA 3SNHA 1I7AA 3BJIA 4K2PA 2CAYA 2UZSA 3NSUA 1J0WA 1ZC3B 2J0JA 3VOQA 3KY9A 2P0DA 4PNKA 3FEHA 4DX90 2JP2A 4GMVA 4ZRJA 1OMWA 5KQ4A 4KHBA 5HE0A 1V88A 3X23A 3GYOA 3SO6A 1N3HA 4GMXB 3A58A 4F7GA 1NTYA 3ML4A 2Y7BA 1FB8A 3HK0A 1FHXA 4EMOA 1GG3A 5DI9B 3FVCA 1UPQA 2Y8GA 1Q67A 3KZ1A 1TQZA 2CY5A 4HSIA 3TW1A 1RJ2A 4HHVA 3BINA 3O96A 2DX1A 1TJ6A 2Q13A 4HAWB 2VKIA 1OQNA 1ZVRA 3NWDA 2ADZA 4DIXA 4QJ3B 1MPHA 4Z2MB 1MKEA 4OT1A 2Z14A 1MIXA 4HAVB 2J59M 1UNQA 2RUKB 4CYEA 4ZRIA 4Y94A 1ZSQA 5FI1A 3D8DA 2QKLA 2YSZA 2KGXB 4NY0A 2L2IA 4DX8A 3PSCA 2RNRB 5GOWB 3ZDTA 4K81A 4CSQA 2DHIA 3ODXA 1KI1B 4K2OA 1UNPA 2EJ8A 3T06A 2M14A 3HIEA 1XKEA 2LYDA 1BWNA 1WJ1A 3FM8C 1PFJA 3AU5A 4IFSA 2ZPYA 2K2UA 2I5FA 3A8QA 5M4YB 3U12A 1GC7A 1TXDA 2FJLA 4WVFB 1WVHA 5DHFB 2J0MA 4GN1A 2K49A 4GPTB 2DLWA 3A98B 4EKUA 2ROVA 3DCXA 2G35A 1PLSA 1M7EA 2CRFA 3WA0A 5C6RA 1XCGA 2K8EA 2Z0PA 1BAKA 2RRFA 2YS1A 2Z4DA 2UVMA 3NWAA 2COAA 3MPXA 3PZDA 1QC6A 1FGZA 4D6WA 5HE3A 2GCLA 2ROZB 3AJ4A 3VIAA 1WGUA 1W1DA 3WYFB 4IOYX 1V89A 3TFMA 2YVCA 2K2JA 4F7HA 1FGYA 3ULCA 2MKRA 3ODOA 2MWNB 1Y5OA 2GS0A 4A5KA 1U27A 3SYXA 2Z0QA 1EVHA 3QIJA 5I2SA 3ODWA 4HB0B 1B55A 4D0NB 1FHWA 1QQGA 3SUZA 3QWMA 1FAOA 5LONB 2V76A 2BCJA 4HAUB 5DIFB 2N0YA 3HW2B 4TYZA 1U5GA 4GOUA 2IYBA 4K17A 4TKNA 1DBHA 4KHAA 4BBKA 2RSGA 1U29A 4CHJA 2L1CA 5J3YA 2KUQA 2W2XD 4B6HA 2ELBA 5C79A 4H8SA 3P6AA 2AL6A 1W1GA 4HAXB 4QJ4B 2YS3A 3U7DA 1FOEA 2W2WA 4HB4B 5J3TA 4A6KA 5IRSA 2P0HA 3IVFA 4QXAB 2DX5A 2CODA 2W2XC 3DXEA 5LOPB 2D9WA 1W1HA 2PZ1A 1SGHA 3ZVRA 2Z59A 4WSFA 1P6SA 3NWFA 3HQCA 2YS5A 4L6EA 3RCPA 1Z87A 1MIZB 2DKQA 2M38A 2Y8FA 2EMTA 5HE2A 1H4RA 4GZUA 2H7EA 4WJ7A 1V5PA 5L81A 2DA0A 1DDVA 2LULA 5D27A 1WJMA 2MDXA 3FSSA 2LOXA 2COCA 2J0KA 3F0WA 2YRYA 1H10A 4L1RA 2IFSA 2YT0A 3D8EA 2N23A 5D3XA 2X18A 1RRPB 3F5RA 3N7CA 2KCJA 1P3RA 5I2MA 5JHHA 2R09A 3B77A 5C16A 2KR0A 5J3QA 3LJUX 5KQ1A 3MDBC 1KZGA 2MFQA 3SV1A 3TO1A 2D10A 4HATB 4A6HA 1V5UA 1ZYIA 2GCJA 3OANA 2LG1A 3DXDA 4CHMA 4KVGB 1XX0A 3HSAA 1DYNA 3PVWA 2QKMA 1MK7B 1MAIA 5DHAB 1E5WA 4P7IA 1WGQA 1BTKA 1WG7A 4HB2B 4A6FA 5D3YA 4GXBA 2P8VA 2RGNB 4MK0A 1EGXA 1IRSA 5CLLB 1MK9B 1ZM0A 3GYPA 1UPRA 1NTVA 2RVBB 1X1FA 3CXBB 3DXCA 1MI1A 2DKPA 2EMSA 4MY6A 5CLQB 2COFA 1LB1A 4DBBA 4QJ5B 2YF0A 2K00A 2EC1A 3QBVB 2LKOA 1BTNA 2OTXA 4HAZB 5JP4A 2HE7A 5EFXA 5D3VA 1XODA 2ZKMX 3G9WA 3TCAA 2DYNA 4OSNA 2KUPA 5C5BA 1UNRA 3OHMB 4PQ0A 1X1GA 2R0DA 1X05A 2KIGA 2D2QA 3U8ZA 1SHCA 4IAPA 1UEFA 1ISNA 5DH9B 2LOZA 1K5DB 4DXAB 1U5EA 1AQCA 4Z2NA 1EF1A 2DYQA 1J19A 1ZC4B 2R2YA 1U5DA 5KCVA 2VSZA 2Z0OA 1Y19B 1P5TA 3NW8A 5JHGA 4XWXA 3KRWA 3KSYA 2GUMA 4EJNA
chains in the Genus database with same CATH topology
2I5CA 2ELAA 1DROA 1GC6A 1KZ7A 1NI2A 3KRXA 2HTHB 2DTCA 2E2XA 1U2BA 3M1IB 5D3WA 1DDWA 1I2HA 2I1KA 2OQBA 2I1JA 2RLOA 3UZTA 1M7RA 3A8PA 4NSWA 4KAXB 4A6FB 1XR0B 3PEGA 2DFKA 3PP2A 5JLJB 2DHKA 4MT7A 1EAZA 2D4QA 1FHOA 3PVUA 3V5WA 2H7DA 1LW3A 4HAYB 1V5MA 3PVLA 1AWEA 4YONA 1PMSA 2DN6A 2VRWB 3P7ZA 3D8FA 2GJYA 3AU4A 1OY2A 4YL8A 5HE1A 2DHJA 2UZRA 4ZRKA 4F7UP 3ULBA 3PG7A 4KHBB 1DDMA 4C0AA 3CIKA 2D9VA 1K5GB 2D9ZA 1NU2A 1X11A 2NZ8B 3TVVA 4HDQA 2D11A 4HB3B 5FI0A 1XD4A 1WI1A 2P0FA 2D9XA 2XQNM 1X86A 4HDOA 5C5BB 2D9YA 4KHOA 2AEHA 2YT1A 1V61A 2CY4A 1U5FA 2NMBA 3SNHA 1I7AA 3BJIA 4K2PA 2CAYA 2UZSA 3NSUA 1J0WA 1ZC3B 2J0JA 3VOQA 3KY9A 2P0DA 4PNKA 3FEHA 4DX90 2JP2A 4GMVA 4ZRJA 1OMWA 5KQ4A 5HE0A 1V88A 3X23A 3GYOA 3SO6A 1N3HA 4GMXB 4F7GA 1NTYA 3ML4A 2Y7BA 1FB8A 3HK0A 1FHXA 4EMOA 1GG3A 5DI9B 1UPQA 2Y8GA 1Q67A 3KZ1A 1TQZA 2CY5A 3TW1A 1RJ2A 4HHVA 3BINA 3O96A 2DX1A 1TJ6A 2Q13A 4HAWB 2VKIA 1OQNA 1ZVRA 2ADZA 1MPHA 4Z2MB 1MKEA 4HAVB 1MIXA 2J59M 1UNQA 2RUKB 4CYEA 4ZRIA 4Y94A 1ZSQA 5FI1A 3D8DA 2QKLA 2YSZA 2KGXB 4NY0A 2L2IA 4DX8A 3PSCA 2RNRB 5GOWB 3ZDTA 4K81A 2DHIA 3ODXA 1KI1B 4K2OA 1UNPA 2EJ8A 3T06A 2M14A 1XKEA 2LYDA 1BWNA 1WJ1A 3FM8C 1PFJA 3AU5A 4IFSA 2ZPYA 2K2UA 2I5FA 3A8QA 1GC7A 1TXDA 2FJLA 4WVFB 1WVHA 5DHFB 2J0MA 4GN1A 4GPTB 2DLWA 3A98B 4EKUA 2ROVA 2G35A 1PLSA 1M7EA 2CRFA 3WA0A 5C6RA 1XCGA 2Z0PA 1BAKA 2YS1A 2UVMA 2COAA 3MPXA 3PZDA 1QC6A 1FGZA 5HE3A 2GCLA 2ROZB 3AJ4A 3VIAA 1WGUA 1W1DA 3WYFB 4IOYX 1V89A 3TFMA 2YVCA 2K2JA 4F7HA 1FGYA 3ULCA 2MKRA 3ODOA 2MWNB 1Y5OA 2GS0A 4A5KA 1U27A 3SYXA 2Z0QA 1EVHA 3QIJA 3ODWA 4HB0B 1B55A 4D0NB 1FHWA 1QQGA 3SUZA 3QWMA 1FAOA 5LONB 2V76A 2BCJA 4HAUB 5DIFB 2N0YA 3HW2B 4TYZA 1U5GA 2IYBA 4K17A 4TKNA 1DBHA 4KHAA 4BBKA 2RSGA 1U29A 4CHJA 2L1CA 5J3YA 2W2XD 4B6HA 2ELBA 5C79A 4H8SA 3P6AA 2AL6A 1W1GA 4HAXB 2YS3A 3U7DA 1FOEA 2W2WA 4HB4B 5J3TA 4A6KA 2P0HA 3IVFA 2DX5A 2CODA 2W2XC 3DXEA 5LOPB 2D9WA 1W1HA 2PZ1A 1SGHA 3ZVRA 4WSFA 1P6SA 3HQCA 2YS5A 4L6EA 3RCPA 1Z87A 1MIZB 2DKQA 2M38A 2Y8FA 2EMTA 5HE2A 1H4RA 4GZUA 2H7EA 4WJ7A 1V5PA 5L81A 2DA0A 1DDVA 2LULA 5D27A 1WJMA 2MDXA 3FSSA 2LOXA 2COCA 2J0KA 3F0WA 2YRYA 1H10A 2IFSA 2YT0A 3D8EA 2N23A 5D3XA 2X18A 1RRPB 3F5RA 3N7CA 2KCJA 1P3RA 5JHHA 2R09A 5C16A 5J3QA 3LJUX 5KQ1A 3MDBC 1KZGA 2MFQA 3SV1A 3TO1A 2D10A 4HATB 4A6HA 1V5UA 2GCJA 3OANA 2LG1A 3DXDA 4CHMA 4KVGB 1XX0A 1DYNA 3PVWA 2QKMA 1MK7B 1MAIA 5DHAB 1E5WA 4P7IA 1WGQA 1BTKA 1WG7A 4HB2B 4A6FA 5D3YA 4GXBA 2P8VA 2RGNB 4MK0A 1EGXA 1IRSA 5CLLB 1MK9B 1ZM0A 3GYPA 1UPRA 1NTVA 2RVBB 1X1FA 3CXBB 3DXCA 2DKPA 2EMSA 4MY6A 5CLQB 2COFA 1LB1A 4DBBA 2YF0A 2K00A 2EC1A 3QBVB 2LKOA 1BTNA 2OTXA 4HAZB 5JP4A 2HE7A 5EFXA 5D3VA 1XODA 3G9WA 3TCAA 2DYNA 2KUPA 5C5BA 1UNRA 4PQ0A 1X1GA 2R0DA 1X05A 2D2QA 3U8ZA 1SHCA 4IAPA 1UEFA 1ISNA 5DH9B 2LOZA 1K5DB 4DXAB 1U5EA 1AQCA 4Z2NA 1EF1A 2DYQA 1J19A 1ZC4B 1U5DA 5KCVA 2VSZA 2Z0OA 1Y19B 1P5TA 5JHGA 4XWXA 3KRWA 3KSYA 4EJNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2I5C A;  2ELA A;  1DRO A;  1GC6 A;  1KZ7 A;  1NI2 A;  3KRX A;  2HTH B;  2DTC A;  2E2X A;  1U2B A;  3M1I B;  5D3W A;  1DDW A;  1I2H A;  2I1K A;  2OQB A;  2I1J A;  2RLO A;  3UZT A;  1M7R A;  3A8P A;  4NSW A;  4KAX B;  4A6F B;  1XR0 B;  3PEG A;  2DFK A;  3PP2 A;  5JLJ B;  2DHK A;  4MT7 A;  1EAZ A;  2D4Q A;  1FHO A;  3PVU A;  3V5W A;  2H7D A;  1LW3 A;  4HAY B;  1V5M A;  3PVL A;  1AWE A;  4YON A;  1PMS A;  2DN6 A;  2VRW B;  3P7Z A;  3D8F A;  2GJY A;  3AU4 A;  1OY2 A;  4YL8 A;  5HE1 A;  2DHJ A;  2UZR A;  4ZRK A;  4F7U P;  3ULB A;  3PG7 A;  4KHB B;  1DDM A;  4C0A A;  3CIK A;  2D9V A;  1K5G B;  2D9Z A;  1NU2 A;  1X11 A;  2NZ8 B;  3TVV A;  4HDQ A;  2D11 A;  4HB3 B;  5FI0 A;  1XD4 A;  1WI1 A;  2P0F A;  2D9X A;  2XQN M;  1X86 A;  4HDO A;  5C5B B;  2D9Y A;  4KHO A;  2AEH A;  2YT1 A;  1V61 A;  2CY4 A;  1U5F A;  2NMB A;  3SNH A;  1I7A A;  3BJI A;  4K2P A;  2CAY A;  2UZS A;  3NSU A;  1J0W A;  1ZC3 B;  2J0J A;  3VOQ A;  3KY9 A;  2P0D A;  4PNK A;  3FEH A;  4DX9 0;  2JP2 A;  4GMV A;  4ZRJ A;  1OMW A;  5KQ4 A;  5HE0 A;  1V88 A;  3X23 A;  3GYO A;  3SO6 A;  1N3H A;  4GMX B;  4F7G A;  1NTY A;  3ML4 A;  2Y7B A;  1FB8 A;  3HK0 A;  1FHX A;  4EMO A;  1GG3 A;  5DI9 B;  1UPQ A;  2Y8G A;  1Q67 A;  3KZ1 A;  1TQZ A;  2CY5 A;  3TW1 A;  1RJ2 A;  4HHV A;  3BIN A;  3O96 A;  2DX1 A;  1TJ6 A;  2Q13 A;  4HAW B;  2VKI A;  1OQN A;  1ZVR A;  2ADZ A;  1MPH A;  4Z2M B;  1MKE A;  4HAV B;  1MIX A;  2J59 M;  1UNQ A;  2RUK B;  4CYE A;  4ZRI A;  4Y94 A;  1ZSQ A;  5FI1 A;  3D8D A;  2QKL A;  2YSZ A;  2KGX B;  4NY0 A;  2L2I A;  4DX8 A;  3PSC A;  2RNR B;  5GOW B;  3ZDT A;  4K81 A;  2DHI A;  3ODX A;  1KI1 B;  4K2O A;  1UNP A;  2EJ8 A;  3T06 A;  2M14 A;  1XKE A;  2LYD A;  1BWN A;  1WJ1 A;  3FM8 C;  1PFJ A;  3AU5 A;  4IFS A;  2ZPY A;  2K2U A;  2I5F A;  3A8Q A;  1GC7 A;  1TXD A;  2FJL A;  4WVF B;  1WVH A;  5DHF B;  2J0M A;  4GN1 A;  4GPT B;  2DLW A;  3A98 B;  4EKU A;  2ROV A;  2G35 A;  1PLS A;  1M7E A;  2CRF A;  3WA0 A;  5C6R A;  1XCG A;  2Z0P A;  1BAK A;  2YS1 A;  2UVM A;  2COA A;  3MPX A;  3PZD A;  1QC6 A;  1FGZ A;  5HE3 A;  2GCL A;  2ROZ B;  3AJ4 A;  3VIA A;  1WGU A;  1W1D A;  3WYF B;  4IOY X;  1V89 A;  3TFM A;  2YVC A;  2K2J A;  4F7H A;  1FGY A;  3ULC A;  2MKR A;  3ODO A;  2MWN B;  1Y5O A;  2GS0 A;  4A5K A;  1U27 A;  3SYX A;  2Z0Q A;  1EVH A;  3QIJ A;  3ODW A;  4HB0 B;  1B55 A;  4D0N B;  1FHW A;  1QQG A;  3SUZ A;  3QWM A;  1FAO A;  5LON B;  2V76 A;  2BCJ A;  4HAU B;  5DIF B;  2N0Y A;  3HW2 B;  4TYZ A;  1U5G A;  2IYB A;  4K17 A;  4TKN A;  1DBH A;  4KHA A;  4BBK A;  2RSG A;  1U29 A;  4CHJ A;  2L1C A;  5J3Y A;  2W2X D;  4B6H A;  2ELB A;  5C79 A;  4H8S A;  3P6A A;  2AL6 A;  1W1G A;  4HAX B;  2YS3 A;  3U7D A;  1FOE A;  2W2W A;  4HB4 B;  5J3T A;  4A6K A;  2P0H A;  3IVF A;  2DX5 A;  2COD A;  2W2X C;  3DXE A;  5LOP B;  2D9W A;  1W1H A;  2PZ1 A;  1SGH A;  3ZVR A;  4WSF A;  1P6S A;  3HQC A;  2YS5 A;  4L6E A;  3RCP A;  1Z87 A;  1MIZ B;  2DKQ A;  2M38 A;  2Y8F A;  2EMT A;  5HE2 A;  1H4R A;  4GZU A;  2H7E A;  4WJ7 A;  1V5P A;  5L81 A;  2DA0 A;  1DDV A;  2LUL A;  5D27 A;  1WJM A;  2MDX A;  3FSS A;  2LOX A;  2COC A;  2J0K A;  3F0W A;  2YRY A;  1H10 A;  2IFS A;  2YT0 A;  3D8E A;  2N23 A;  5D3X A;  2X18 A;  1RRP B;  3F5R A;  3N7C A;  2KCJ A;  1P3R A;  5JHH A;  2R09 A;  5C16 A;  5J3Q A;  3LJU X;  5KQ1 A;  3MDB C;  1KZG A;  2MFQ A;  3SV1 A;  3TO1 A;  2D10 A;  4HAT B;  4A6H A;  1V5U A;  2GCJ A;  3OAN A;  2LG1 A;  3DXD A;  4CHM A;  4KVG B;  1XX0 A;  1DYN A;  3PVW A;  2QKM A;  1MK7 B;  1MAI A;  5DHA B;  1E5W A;  4P7I A;  1WGQ A;  1BTK A;  1WG7 A;  4HB2 B;  4A6F A;  5D3Y A;  4GXB A;  2P8V A;  2RGN B;  4MK0 A;  1EGX A;  1IRS A;  5CLL B;  1MK9 B;  1ZM0 A;  3GYP A;  1UPR A;  1NTV A;  2RVB B;  1X1F A;  3CXB B;  3DXC A;  2DKP A;  2EMS A;  4MY6 A;  5CLQ B;  2COF A;  1LB1 A;  4DBB A;  2YF0 A;  2K00 A;  2EC1 A;  3QBV B;  2LKO A;  1BTN A;  2OTX A;  4HAZ B;  5JP4 A;  2HE7 A;  5EFX A;  5D3V A;  1XOD A;  3G9W A;  3TCA A;  2DYN A;  2KUP A;  5C5B A;  1UNR A;  4PQ0 A;  1X1G A;  2R0D A;  1X05 A;  2D2Q A;  3U8Z A;  1SHC A;  4IAP A;  1UEF A;  1ISN A;  5DH9 B;  2LOZ A;  1K5D B;  4DXA B;  1U5E A;  1AQC A;  4Z2N A;  1EF1 A;  2DYQ A;  1J19 A;  1ZC4 B;  1U5D A;  5KCV A;  2VSZ A;  2Z0O A;  1Y19 B;  1P5T A;  5JHG A;  4XWX A;  3KRW A;  3KSY A;  4EJN A; 
#chains in the Genus database with same CATH topology
 2I5C A;  2ELA A;  1DRO A;  2NBV A;  1GC6 A;  1KZ7 A;  1NI2 A;  3KRX A;  2HTH B;  2DTC A;  2E2X A;  1U2B A;  3M1I B;  5D3W A;  1DDW A;  1I2H A;  2YT2 A;  2I1K A;  2OQB A;  2I1J A;  2RLO A;  2KIE A;  3UZT A;  1M7R A;  3A8P A;  2Z13 A;  4NSW A;  4KAX B;  4A6F B;  1XR0 B;  3PEG A;  2DFK A;  3PP2 A;  5JLJ B;  2DHK A;  4MT7 A;  1EAZ A;  2D4Q A;  1FHO A;  3PVU A;  3V5W A;  2H7D A;  1LW3 A;  4HAY B;  1V5M A;  3PVL A;  1AWE A;  4YON A;  1PMS A;  2DN6 A;  2VRW B;  3P7Z A;  3D8F A;  2GJY A;  3AU4 A;  4GNK B;  1OY2 A;  4YL8 A;  5HE1 A;  2DHJ A;  2UZR A;  4ZRK A;  4F7U P;  3ULB A;  3PG7 A;  4KHB B;  1DDM A;  1T77 A;  4C0A A;  3CIK A;  2D9V A;  1K5G B;  2D9Z A;  1NU2 A;  1X11 A;  2NZ8 B;  3TVV A;  4HDQ A;  2D11 A;  4HB3 B;  5FI0 A;  1XD4 A;  1WI1 A;  2P0F A;  2D9X A;  2FJU B;  2XQN M;  1X86 A;  4HDO A;  5C5B B;  2D9Y A;  4KHO A;  2AEH A;  2YT1 A;  1V61 A;  2CY4 A;  5LG4 B;  1U5F A;  2NMB A;  3SNH A;  1I7A A;  3BJI A;  4K2P A;  2CAY A;  2UZS A;  3NSU A;  1J0W A;  1ZC3 B;  2J0J A;  3VOQ A;  3KY9 A;  2P0D A;  4PNK A;  3FEH A;  4DX9 0;  2JP2 A;  4GMV A;  4ZRJ A;  1OMW A;  5KQ4 A;  4KHB A;  5HE0 A;  1V88 A;  3X23 A;  3GYO A;  3SO6 A;  1N3H A;  4GMX B;  3A58 A;  4F7G A;  1NTY A;  3ML4 A;  2Y7B A;  1FB8 A;  3HK0 A;  1FHX A;  4EMO A;  1GG3 A;  5DI9 B;  3FVC A;  1UPQ A;  2Y8G A;  1Q67 A;  3KZ1 A;  1TQZ A;  2CY5 A;  4HSI A;  3TW1 A;  1RJ2 A;  4HHV A;  3BIN A;  3O96 A;  2DX1 A;  1TJ6 A;  2Q13 A;  4HAW B;  2VKI A;  1OQN A;  1ZVR A;  3NWD A;  2ADZ A;  4DIX A;  4QJ3 B;  1MPH A;  4Z2M B;  1MKE A;  4OT1 A;  2Z14 A;  1MIX A;  4HAV B;  2J59 M;  1UNQ A;  2RUK B;  4CYE A;  4ZRI A;  4Y94 A;  1ZSQ A;  5FI1 A;  3D8D A;  2QKL A;  2YSZ A;  2KGX B;  4NY0 A;  2L2I A;  4DX8 A;  3PSC A;  2RNR B;  5GOW B;  3ZDT A;  4K81 A;  4CSQ A;  2DHI A;  3ODX A;  1KI1 B;  4K2O A;  1UNP A;  2EJ8 A;  3T06 A;  2M14 A;  3HIE A;  1XKE A;  2LYD A;  1BWN A;  1WJ1 A;  3FM8 C;  1PFJ A;  3AU5 A;  4IFS A;  2ZPY A;  2K2U A;  2I5F A;  3A8Q A;  5M4Y B;  3U12 A;  1GC7 A;  1TXD A;  2FJL A;  4WVF B;  1WVH A;  5DHF B;  2J0M A;  4GN1 A;  2K49 A;  4GPT B;  2DLW A;  3A98 B;  4EKU A;  2ROV A;  3DCX A;  2G35 A;  1PLS A;  1M7E A;  2CRF A;  3WA0 A;  5C6R A;  1XCG A;  2K8E A;  2Z0P A;  1BAK A;  2RRF A;  2YS1 A;  2Z4D A;  2UVM A;  3NWA A;  2COA A;  3MPX A;  3PZD A;  1QC6 A;  1FGZ A;  4D6W A;  5HE3 A;  2GCL A;  2ROZ B;  3AJ4 A;  3VIA A;  1WGU A;  1W1D A;  3WYF B;  4IOY X;  1V89 A;  3TFM A;  2YVC A;  2K2J A;  4F7H A;  1FGY A;  3ULC A;  2MKR A;  3ODO A;  2MWN B;  1Y5O A;  2GS0 A;  4A5K A;  1U27 A;  3SYX A;  2Z0Q A;  1EVH A;  3QIJ A;  5I2S A;  3ODW A;  4HB0 B;  1B55 A;  4D0N B;  1FHW A;  1QQG A;  3SUZ A;  3QWM A;  1FAO A;  5LON B;  2V76 A;  2BCJ A;  4HAU B;  5DIF B;  2N0Y A;  3HW2 B;  4TYZ A;  1U5G A;  4GOU A;  2IYB A;  4K17 A;  4TKN A;  1DBH A;  4KHA A;  4BBK A;  2RSG A;  1U29 A;  4CHJ A;  2L1C A;  5J3Y A;  2KUQ A;  2W2X D;  4B6H A;  2ELB A;  5C79 A;  4H8S A;  3P6A A;  2AL6 A;  1W1G A;  4HAX B;  4QJ4 B;  2YS3 A;  3U7D A;  1FOE A;  2W2W A;  4HB4 B;  5J3T A;  4A6K A;  5IRS A;  2P0H A;  3IVF A;  4QXA B;  2DX5 A;  2COD A;  2W2X C;  3DXE A;  5LOP B;  2D9W A;  1W1H A;  2PZ1 A;  1SGH A;  3ZVR A;  2Z59 A;  4WSF A;  1P6S A;  3NWF A;  3HQC A;  2YS5 A;  4L6E A;  3RCP A;  1Z87 A;  1MIZ B;  2DKQ A;  2M38 A;  2Y8F A;  2EMT A;  5HE2 A;  1H4R A;  4GZU A;  2H7E A;  4WJ7 A;  1V5P A;  5L81 A;  2DA0 A;  1DDV A;  2LUL A;  5D27 A;  1WJM A;  2MDX A;  3FSS A;  2LOX A;  2COC A;  2J0K A;  3F0W A;  2YRY A;  1H10 A;  4L1R A;  2IFS A;  2YT0 A;  3D8E A;  2N23 A;  5D3X A;  2X18 A;  1RRP B;  3F5R A;  3N7C A;  2KCJ A;  1P3R A;  5I2M A;  5JHH A;  2R09 A;  3B77 A;  5C16 A;  2KR0 A;  5J3Q A;  3LJU X;  5KQ1 A;  3MDB C;  1KZG A;  2MFQ A;  3SV1 A;  3TO1 A;  2D10 A;  4HAT B;  4A6H A;  1V5U A;  1ZYI A;  2GCJ A;  3OAN A;  2LG1 A;  3DXD A;  4CHM A;  4KVG B;  1XX0 A;  3HSA A;  1DYN A;  3PVW A;  2QKM A;  1MK7 B;  1MAI A;  5DHA B;  1E5W A;  4P7I A;  1WGQ A;  1BTK A;  1WG7 A;  4HB2 B;  4A6F A;  5D3Y A;  4GXB A;  2P8V A;  2RGN B;  4MK0 A;  1EGX A;  1IRS A;  5CLL B;  1MK9 B;  1ZM0 A;  3GYP A;  1UPR A;  1NTV A;  2RVB B;  1X1F A;  3CXB B;  3DXC A;  1MI1 A;  2DKP A;  2EMS A;  4MY6 A;  5CLQ B;  2COF A;  1LB1 A;  4DBB A;  4QJ5 B;  2YF0 A;  2K00 A;  2EC1 A;  3QBV B;  2LKO A;  1BTN A;  2OTX A;  4HAZ B;  5JP4 A;  2HE7 A;  5EFX A;  5D3V A;  1XOD A;  2ZKM X;  3G9W A;  3TCA A;  2DYN A;  4OSN A;  2KUP A;  5C5B A;  1UNR A;  3OHM B;  4PQ0 A;  1X1G A;  2R0D A;  1X05 A;  2KIG A;  2D2Q A;  3U8Z A;  1SHC A;  4IAP A;  1UEF A;  1ISN A;  5DH9 B;  2LOZ A;  1K5D B;  4DXA B;  1U5E A;  1AQC A;  4Z2N A;  1EF1 A;  2DYQ A;  1J19 A;  1ZC4 B;  2R2Y A;  1U5D A;  5KCV A;  2VSZ A;  2Z0O A;  1Y19 B;  1P5T A;  3NW8 A;  5JHG A;  4XWX A;  3KRW A;  3KSY A;  2GUM A;  4EJN A; 
#chains in the Genus database with same CATH homology
 2I5C A;  2ELA A;  1DRO A;  1GC6 A;  1KZ7 A;  1NI2 A;  3KRX A;  2HTH B;  2DTC A;  2E2X A;  1U2B A;  3M1I B;  5D3W A;  1DDW A;  1I2H A;  2I1K A;  2OQB A;  2I1J A;  2RLO A;  3UZT A;  1M7R A;  3A8P A;  4NSW A;  4KAX B;  4A6F B;  1XR0 B;  3PEG A;  2DFK A;  3PP2 A;  5JLJ B;  2DHK A;  4MT7 A;  1EAZ A;  2D4Q A;  1FHO A;  3PVU A;  3V5W A;  2H7D A;  1LW3 A;  4HAY B;  1V5M A;  3PVL A;  1AWE A;  4YON A;  1PMS A;  2DN6 A;  2VRW B;  3P7Z A;  3D8F A;  2GJY A;  3AU4 A;  1OY2 A;  4YL8 A;  5HE1 A;  2DHJ A;  2UZR A;  4ZRK A;  4F7U P;  3ULB A;  3PG7 A;  4KHB B;  1DDM A;  4C0A A;  3CIK A;  2D9V A;  1K5G B;  2D9Z A;  1NU2 A;  1X11 A;  2NZ8 B;  3TVV A;  4HDQ A;  2D11 A;  4HB3 B;  5FI0 A;  1XD4 A;  1WI1 A;  2P0F A;  2D9X A;  2XQN M;  1X86 A;  4HDO A;  5C5B B;  2D9Y A;  4KHO A;  2AEH A;  2YT1 A;  1V61 A;  2CY4 A;  1U5F A;  2NMB A;  3SNH A;  1I7A A;  3BJI A;  4K2P A;  2CAY A;  2UZS A;  3NSU A;  1J0W A;  1ZC3 B;  2J0J A;  3VOQ A;  3KY9 A;  2P0D A;  4PNK A;  3FEH A;  4DX9 0;  2JP2 A;  4GMV A;  4ZRJ A;  1OMW A;  5KQ4 A;  5HE0 A;  1V88 A;  3X23 A;  3GYO A;  3SO6 A;  1N3H A;  4GMX B;  4F7G A;  1NTY A;  3ML4 A;  2Y7B A;  1FB8 A;  3HK0 A;  1FHX A;  4EMO A;  1GG3 A;  5DI9 B;  1UPQ A;  2Y8G A;  1Q67 A;  3KZ1 A;  1TQZ A;  2CY5 A;  3TW1 A;  1RJ2 A;  4HHV A;  3BIN A;  3O96 A;  2DX1 A;  1TJ6 A;  2Q13 A;  4HAW B;  2VKI A;  1OQN A;  1ZVR A;  2ADZ A;  1MPH A;  4Z2M B;  1MKE A;  4HAV B;  1MIX A;  2J59 M;  1UNQ A;  2RUK B;  4CYE A;  4ZRI A;  4Y94 A;  1ZSQ A;  5FI1 A;  3D8D A;  2QKL A;  2YSZ A;  2KGX B;  4NY0 A;  2L2I A;  4DX8 A;  3PSC A;  2RNR B;  5GOW B;  3ZDT A;  4K81 A;  2DHI A;  3ODX A;  1KI1 B;  4K2O A;  1UNP A;  2EJ8 A;  3T06 A;  2M14 A;  1XKE A;  2LYD A;  1BWN A;  1WJ1 A;  3FM8 C;  1PFJ A;  3AU5 A;  4IFS A;  2ZPY A;  2K2U A;  2I5F A;  3A8Q A;  1GC7 A;  1TXD A;  2FJL A;  4WVF B;  1WVH A;  5DHF B;  2J0M A;  4GN1 A;  4GPT B;  2DLW A;  3A98 B;  4EKU A;  2ROV A;  2G35 A;  1PLS A;  1M7E A;  2CRF A;  3WA0 A;  5C6R A;  1XCG A;  2Z0P A;  1BAK A;  2YS1 A;  2UVM A;  2COA A;  3MPX A;  3PZD A;  1QC6 A;  1FGZ A;  5HE3 A;  2GCL A;  2ROZ B;  3AJ4 A;  3VIA A;  1WGU A;  1W1D A;  3WYF B;  4IOY X;  1V89 A;  3TFM A;  2YVC A;  2K2J A;  4F7H A;  1FGY A;  3ULC A;  2MKR A;  3ODO A;  2MWN B;  1Y5O A;  2GS0 A;  4A5K A;  1U27 A;  3SYX A;  2Z0Q A;  1EVH A;  3QIJ A;  3ODW A;  4HB0 B;  1B55 A;  4D0N B;  1FHW A;  1QQG A;  3SUZ A;  3QWM A;  1FAO A;  5LON B;  2V76 A;  2BCJ A;  4HAU B;  5DIF B;  2N0Y A;  3HW2 B;  4TYZ A;  1U5G A;  2IYB A;  4K17 A;  4TKN A;  1DBH A;  4KHA A;  4BBK A;  2RSG A;  1U29 A;  4CHJ A;  2L1C A;  5J3Y A;  2W2X D;  4B6H A;  2ELB A;  5C79 A;  4H8S A;  3P6A A;  2AL6 A;  1W1G A;  4HAX B;  2YS3 A;  3U7D A;  1FOE A;  2W2W A;  4HB4 B;  5J3T A;  4A6K A;  2P0H A;  3IVF A;  2DX5 A;  2COD A;  2W2X C;  3DXE A;  5LOP B;  2D9W A;  1W1H A;  2PZ1 A;  1SGH A;  3ZVR A;  4WSF A;  1P6S A;  3HQC A;  2YS5 A;  4L6E A;  3RCP A;  1Z87 A;  1MIZ B;  2DKQ A;  2M38 A;  2Y8F A;  2EMT A;  5HE2 A;  1H4R A;  4GZU A;  2H7E A;  4WJ7 A;  1V5P A;  5L81 A;  2DA0 A;  1DDV A;  2LUL A;  5D27 A;  1WJM A;  2MDX A;  3FSS A;  2LOX A;  2COC A;  2J0K A;  3F0W A;  2YRY A;  1H10 A;  2IFS A;  2YT0 A;  3D8E A;  2N23 A;  5D3X A;  2X18 A;  1RRP B;  3F5R A;  3N7C A;  2KCJ A;  1P3R A;  5JHH A;  2R09 A;  5C16 A;  5J3Q A;  3LJU X;  5KQ1 A;  3MDB C;  1KZG A;  2MFQ A;  3SV1 A;  3TO1 A;  2D10 A;  4HAT B;  4A6H A;  1V5U A;  2GCJ A;  3OAN A;  2LG1 A;  3DXD A;  4CHM A;  4KVG B;  1XX0 A;  1DYN A;  3PVW A;  2QKM A;  1MK7 B;  1MAI A;  5DHA B;  1E5W A;  4P7I A;  1WGQ A;  1BTK A;  1WG7 A;  4HB2 B;  4A6F A;  5D3Y A;  4GXB A;  2P8V A;  2RGN B;  4MK0 A;  1EGX A;  1IRS A;  5CLL B;  1MK9 B;  1ZM0 A;  3GYP A;  1UPR A;  1NTV A;  2RVB B;  1X1F A;  3CXB B;  3DXC A;  2DKP A;  2EMS A;  4MY6 A;  5CLQ B;  2COF A;  1LB1 A;  4DBB A;  2YF0 A;  2K00 A;  2EC1 A;  3QBV B;  2LKO A;  1BTN A;  2OTX A;  4HAZ B;  5JP4 A;  2HE7 A;  5EFX A;  5D3V A;  1XOD A;  3G9W A;  3TCA A;  2DYN A;  2KUP A;  5C5B A;  1UNR A;  4PQ0 A;  1X1G A;  2R0D A;  1X05 A;  2D2Q A;  3U8Z A;  1SHC A;  4IAP A;  1UEF A;  1ISN A;  5DH9 B;  2LOZ A;  1K5D B;  4DXA B;  1U5E A;  1AQC A;  4Z2N A;  1EF1 A;  2DYQ A;  1J19 A;  1ZC4 B;  1U5D A;  5KCV A;  2VSZ A;  2Z0O A;  1Y19 B;  1P5T A;  5JHG A;  4XWX A;  3KRW A;  3KSY A;  4EJN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...