1X11A

X11 ptb domain
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
170
structure length
135
Chain Sequence
MEDLIDGIIFAANYLGSTQLLSDKTPSKNVRMMQAQEAVSRIKMAQMTEVDLFILTQRIKVLNADTQETMMDHPLRTISYIADIGNIVVLMARDGKRQYKMICHVFESEDAQLIAQSIGQAFSVAYQEFLRANGI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Sequence-specific recognition of the internalization motif of the Alzheimer's amyloid precursor protein by the X11 PTB domain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Complex (peptide binding module/peptide)
molecule keywords X11
total genus 30
structure length 135
sequence length 170
chains with identical sequence B
ec nomenclature
pdb deposition date 1997-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00640 PID Phosphotyrosine interaction domain (PTB/PID)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 1x11A00
4K2PA 2DX1A 2N23A 1LW3A 4ZRKA 3O96A 2GJYA 1ZSQA 5HE0A 5DH9B 2DYQA 1B55A 3U8ZA 1P5TA 2RSGA 4CYEA 1EVHA 1GC7A 1TJ6A 2BCJA 1W1HA 2UZRA 1MIXA 4TYZA 2FJLA 3CXBB 3A8PA 1Y19B 4Z2MB 1V5UA 4F7HA 3LJUX 1GC6A 1M7RA 4K17A 2KUPA 3T06A 3PVWA 4K81A 2JP2A 3HW2B 2Y7BA 5FI0A 2Z0QA 3CIKA 2Y8GA 4HB2B 3D8EA 1UNQA 2L2IA 1UNRA 4PNKA 4L6EA 1V61A 3KZ1A 2ADZA 1ZC3B 2Z0PA 2YVCA 2COCA 3KRXA 3UZTA 1SHCA 2E2XA 5CLLB 1AWEA 4K2OA 5D27A 3NSUA 1DYNA 4H8SA 1Z87A 2DHIA 2G35A 1MK7B 2COFA 2CRFA 2W2XC 3DXDA 4KHBB 3FM8C 2D10A 2K2JA 5DHFB 2LOXA 2NMBA 3QWMA 3QIJA 2DYNA 1U5DA 1XKEA 4PQ0A 1ZM0A 1X05A 3PVUA 1WGUA 5LONB 4MY6A 1DDMA 3SO6A 2D9VA 4IFSA 1OQNA 1XCGA 2K00A 2YF0A 2MDXA 1W1DA 5J3TA 2DHKA 2RVBB 1FB8A 4HDOA 2CODA 1RJ2A 3GYOA 3KRWA 3SV1A 3VIAA 1WI1A 4HB3B 2I1JA 2M14A 3X23A 1KZ7A 2VRWB 2XQNM 1J19A 2ROZB 3FSSA 4Y94A 2P0FA 1MK9B 1BTKA 2DHJA 2J0JA 1IRSA 4ZRJA 3OANA 5JP4A 3PP2A 1P3RA 3D8FA 4P7IA 1BWNA 1I7AA 2DKQA 2HTHB 4NSWA 3VOQA 4D0NB 2RLOA 4XWXA 3MPXA 4HHVA 4HDQA 1FHOA 2NZ8B 1DBHA 2DKPA 2YS5A 3HK0A 1H10A 1FOEA 2N0YA 4KVGB 2OTXA 2KGXB 5D3YA 5JHHA 5HE3A 2DA0A 2Z0OA 1V5PA 2EC1A 1E5WA 3P7ZA 1X86A 1BAKA 2LKOA 1UPRA 1OMWA 2CY4A 2MWNB 3DXCA 2D9WA 2DFKA 4EMOA 4DX8A 1UPQA 5DHAB 3F5RA 5C5BB 3ZVRA 2EMTA 4GXBA 3BINA 5HE2A 3ULCA 2I5CA 5L81A 2EJ8A 4HAYB 4EJNA 4IAPA 3TFMA 2VKIA 2IYBA 2ROVA 1U2BA 1DDVA 2HE7A 1FGZA 1FAOA 1LB1A 2J59M 2Y8FA 2RNRB 4HAWB 1Y5OA 2K2UA 1WJMA 2YT0A 1UNPA 1KZGA 3BJIA 3PG7A 3PVLA 1NTVA 1Q67A 4YL8A 1XX0A 4F7GA 1K5DB 5J3QA 5C6RA 4WSFA 1WVHA 3WA0A 4HATB 4Z2NA 2QKMA 2W2WA 2LG1A 5HE1A 1EF1A 1OY2A 3ML4A 4TKNA 1V5MA 2D9ZA 2X18A 1J0WA 2M38A 4WVFB 2J0MA 3KY9A 1V89A 1SGHA 2AEHA 5CLQB 1WJ1A 2ELBA 2W2XD 2CAYA 5FI1A 3ODOA 2ELAA 1U5FA 2D9YA 3U7DA 2P0HA 4A6FB 1K5GB 1EAZA 2D11A 2V76A 3ULBA 2RUKB 1MIZB 3KSYA 4HB4B 1ISNA 2VSZA 1X1GA 1AQCA 1NU2A 4GMXB 1ZC4B 1XODA 2QKLA 5D3WA 3AU4A 3P6AA 2PZ1A 3TVVA 2D4QA 3SNHA 1DROA 3F0WA 3DXEA 4GMVA 2AL6A 2I5FA 2KCJA 4ZRIA 2R09A 3MDBC 4KAXB 4A6FA 2EMSA 3HQCA 4HAUB 1FHXA 2GS0A 2LYDA 2ZPYA 3WYFB 1WG7A 2CY5A 1XR0B 2L1CA 4IOYX 4HAVB 1PFJA 1QQGA 5C5BA 4CHJA 3RCPA 3TO1A 2GCJA 3SUZA 4KHAA 3TW1A 3PSCA 1W1GA 1ZVRA 4MK0A 2UVMA 3V5WA 1PMSA 1P6SA 1PLSA 3IVFA 2LULA 3ODXA 1H4RA 2MFQA 1KI1B 1BTNA 4A5KA 4HB0B 2IFSA 2DTCA 4BBKA 1I2HA 1N3HA 2MKRA 4KHOA 3N7CA 5LOPB 4NY0A 4EKUA 4A6HA 5C79A 3QBVB 2YSZA 3TCAA 4F7UP 4CHMA 4GZUA 4HAZB 2LOZA 3SYXA 1U29A 5DIFB 3ODWA 1FGYA 4MT7A 4DBBA 3M1IB 1X1FA 3FEHA 2Q13A 1MPHA 1M7EA 1TXDA 4HAXB 1TQZA 3PZDA 1U5GA 2YRYA 2COAA 2YS3A 3G9WA 4GPTB 2DN6A 5EFXA 3PEGA 2H7EA 5JHGA 2H7DA 3D8DA 5JLJB 1NTYA 3A98B 2P8VA 2R0DA 2J0KA 2YS1A 5KQ1A 2DLWA 5D3VA 5KCVA 2UZSA 1RRPB 4A6KA 1WGQA 1EGXA 2DX5A 1MKEA 2D2QA 1XD4A 3AJ4A 5D3XA 2OQBA 4DX90 1DDWA 2D9XA 1GG3A 2RGNB 1U5EA 4B6HA 2YT1A 1MAIA 1NI2A 4C0AA 1FHWA 4DXAB 2P0DA 3A8QA 4GN1A 5J3YA 3GYPA 1U27A 1QC6A 5DI9B 3ZDTA 4WJ7A 1X11A 1UEFA 2GCLA 4YONA 5GOWB 1V88A 5KQ4A 5C16A 2I1KA 3AU5A
chains in the Genus database with same CATH superfamily
4K2PA 2DX1A 2N23A 1LW3A 4ZRKA 4OT1A 3O96A 2GJYA 1ZSQA 5HE0A 5DH9B 2DYQA 1B55A 3U8ZA 1P5TA 4L1RA 2RSGA 4CYEA 5IRSA 1EVHA 1GC7A 1TJ6A 2BCJA 1W1HA 2UZRA 1MIXA 4TYZA 2FJLA 3CXBB 3A8PA 1Y19B 4Z2MB 1V5UA 4F7HA 3LJUX 1GC6A 1M7RA 4K17A 2KUPA 3T06A 3PVWA 4K81A 2JP2A 3HW2B 2Y7BA 5FI0A 2Z0QA 3CIKA 2Y8GA 4HB2B 3U12A 3D8EA 1UNQA 2L2IA 1UNRA 4PNKA 4L6EA 1V61A 3KZ1A 2FJUB 2ADZA 1ZC3B 2Z0PA 4KHBA 2YVCA 2COCA 3KRXA 3UZTA 1SHCA 2E2XA 5CLLB 1AWEA 4K2OA 5D27A 3NSUA 1DYNA 4H8SA 1Z87A 2DHIA 2G35A 1MK7B 2COFA 2KIGA 2CRFA 2W2XC 3DXDA 4KHBB 3FM8C 3DCXA 2D10A 4QJ5B 2K2JA 5DHFB 2LOXA 2NMBA 3QWMA 3QIJA 2DYNA 1U5DA 1XKEA 4PQ0A 1ZM0A 1X05A 3PVUA 1WGUA 5LONB 4MY6A 1DDMA 3SO6A 2D9VA 4IFSA 1OQNA 1XCGA 2K00A 2YF0A 2MDXA 1W1DA 4CSQA 5J3TA 2DHKA 2RVBB 1FB8A 4HDOA 2CODA 1RJ2A 3GYOA 3KRWA 3NWDA 3SV1A 3VIAA 4HSIA 1WI1A 4HB3B 2I1JA 2M14A 3X23A 1KZ7A 2VRWB 2XQNM 1J19A 2ROZB 3B77A 3FSSA 4Y94A 2P0FA 1MK9B 2Z59A 1BTKA 2DHJA 5M4YB 2NBVA 2J0JA 1IRSA 4ZRJA 3OANA 5JP4A 3PP2A 1P3RA 3D8FA 4P7IA 2KR0A 1BWNA 1I7AA 2DKQA 2HTHB 4NSWA 3VOQA 4D0NB 2RLOA 4XWXA 3MPXA 4GOUA 4HHVA 4HDQA 1FHOA 2NZ8B 1DBHA 2DKPA 2YS5A 3HK0A 1H10A 1FOEA 2N0YA 2YT2A 4KVGB 2OTXA 2KGXB 5D3YA 5JHHA 5HE3A 2DA0A 2Z0OA 1V5PA 2EC1A 1E5WA 3P7ZA 1X86A 1BAKA 2LKOA 1UPRA 1OMWA 2CY4A 2MWNB 3DXCA 2KUQA 2D9WA 2DFKA 4EMOA 4DX8A 1UPQA 5DHAB 3F5RA 5C5BB 3ZVRA 2EMTA 4GXBA 3BINA 5HE2A 3ULCA 2I5CA 5L81A 2ZKMX 2EJ8A 4HAYB 4EJNA 4IAPA 3TFMA 2VKIA 2IYBA 2ROVA 1U2BA 1DDVA 2HE7A 1FGZA 1FAOA 1LB1A 2J59M 2Y8FA 2RNRB 4HAWB 1Y5OA 2K2UA 1WJMA 2YT0A 1UNPA 1KZGA 3BJIA 3PG7A 3PVLA 1NTVA 1Q67A 4YL8A 1XX0A 4F7GA 1K5DB 5J3QA 5C6RA 4WSFA 1WVHA 3WA0A 4HATB 4Z2NA 2QKMA 4DIXA 2W2WA 2LG1A 5HE1A 1EF1A 1OY2A 3ML4A 4TKNA 1V5MA 2D9ZA 2X18A 1J0WA 2M38A 4WVFB 2J0MA 3KY9A 1V89A 1SGHA 2AEHA 5CLQB 1WJ1A 2ELBA 2W2XD 2CAYA 5FI1A 3ODOA 2ELAA 2K49A 1U5FA 2D9YA 3U7DA 2P0HA 4A6FB 1K5GB 1EAZA 2D11A 2V76A 2KIEA 3ULBA 2RUKB 1MIZB 3KSYA 4HB4B 1ISNA 2VSZA 1X1GA 1AQCA 1NU2A 4GMXB 1ZC4B 1XODA 2QKLA 5D3WA 3AU4A 3P6AA 2PZ1A 3TVVA 2D4QA 1ZYIA 3SNHA 1DROA 3F0WA 3DXEA 4GMVA 2AL6A 2I5FA 2KCJA 4ZRIA 2R09A 3MDBC 4KAXB 4A6FA 2EMSA 3HQCA 4HAUB 1FHXA 2GS0A 5I2MA 2LYDA 2ZPYA 3WYFB 1WG7A 2CY5A 2R2YA 1XR0B 2L1CA 4IOYX 2Z13A 4HAVB 1PFJA 1QQGA 5C5BA 4CHJA 3RCPA 3TO1A 3HIEA 2GCJA 3SUZA 4KHAA 3TW1A 4QJ4B 3PSCA 3NW8A 1W1GA 1ZVRA 2RRFA 4MK0A 2UVMA 3V5WA 1PMSA 1MI1A 1P6SA 1PLSA 3IVFA 2LULA 2Z14A 3ODXA 1H4RA 2Z4DA 2MFQA 1KI1B 3HSAA 1BTNA 3A58A 4A5KA 4HB0B 2IFSA 2DTCA 4BBKA 1T77A 1I2HA 1N3HA 2MKRA 4KHOA 3N7CA 3NWAA 4QXAB 5LOPB 4NY0A 4EKUA 4A6HA 5C79A 3QBVB 2YSZA 3TCAA 4F7UP 4CHMA 4GZUA 4HAZB 4QJ3B 2LOZA 3SYXA 1U29A 2GUMA 5DIFB 3ODWA 1FGYA 3NWFA 4MT7A 4DBBA 3M1IB 1X1FA 3FEHA 2Q13A 1MPHA 1M7EA 1TXDA 4HAXB 1TQZA 2K8EA 3PZDA 1U5GA 2YRYA 2COAA 2YS3A 3G9WA 4GPTB 2DN6A 5EFXA 3PEGA 2H7EA 5JHGA 2H7DA 3D8DA 5JLJB 1NTYA 3OHMB 3A98B 4D6WA 2P8VA 2R0DA 2J0KA 2YS1A 5KQ1A 2DLWA 5D3VA 5KCVA 2UZSA 1RRPB 4A6KA 5LG4B 1WGQA 1EGXA 2DX5A 3FVCA 1MKEA 2D2QA 1XD4A 3AJ4A 5D3XA 2OQBA 4OSNA 4DX90 1DDWA 2D9XA 1GG3A 2RGNB 4GNKB 1U5EA 4B6HA 5I2SA 2YT1A 1MAIA 1NI2A 4C0AA 1FHWA 4DXAB 2P0DA 3A8QA 4GN1A 5J3YA 3GYPA 1U27A 1QC6A 5DI9B 3ZDTA 4WJ7A 1X11A 1UEFA 2GCLA 4YONA 5GOWB 1V88A 5KQ4A 5C16A 2I1KA 3AU5A
chains in the Genus database with same CATH topology
4K2PA 2DX1A 2N23A 1LW3A 4ZRKA 3O96A 2GJYA 1ZSQA 5HE0A 5DH9B 2DYQA 1B55A 3U8ZA 1P5TA 2RSGA 4CYEA 1EVHA 1GC7A 1TJ6A 2BCJA 1W1HA 2UZRA 1MIXA 4TYZA 2FJLA 3CXBB 3A8PA 1Y19B 4Z2MB 1V5UA 4F7HA 3LJUX 1GC6A 1M7RA 4K17A 2KUPA 3T06A 3PVWA 4K81A 2JP2A 3HW2B 2Y7BA 5FI0A 2Z0QA 3CIKA 2Y8GA 4HB2B 3D8EA 1UNQA 2L2IA 1UNRA 4PNKA 4L6EA 1V61A 3KZ1A 2ADZA 1ZC3B 2Z0PA 2YVCA 2COCA 3KRXA 3UZTA 1SHCA 2E2XA 5CLLB 1AWEA 4K2OA 5D27A 3NSUA 1DYNA 4H8SA 1Z87A 2DHIA 2G35A 1MK7B 2COFA 2CRFA 2W2XC 3DXDA 4KHBB 3FM8C 2D10A 2K2JA 5DHFB 2LOXA 2NMBA 3QWMA 3QIJA 2DYNA 1U5DA 1XKEA 4PQ0A 1ZM0A 1X05A 3PVUA 1WGUA 5LONB 4MY6A 1DDMA 3SO6A 2D9VA 4IFSA 1OQNA 1XCGA 2K00A 2YF0A 2MDXA 1W1DA 5J3TA 2DHKA 2RVBB 1FB8A 4HDOA 2CODA 1RJ2A 3GYOA 3KRWA 3SV1A 3VIAA 1WI1A 4HB3B 2I1JA 2M14A 3X23A 1KZ7A 2VRWB 2XQNM 1J19A 2ROZB 3FSSA 4Y94A 2P0FA 1MK9B 1BTKA 2DHJA 2J0JA 1IRSA 4ZRJA 3OANA 5JP4A 3PP2A 1P3RA 3D8FA 4P7IA 1BWNA 1I7AA 2DKQA 2HTHB 4NSWA 3VOQA 4D0NB 2RLOA 4XWXA 3MPXA 4HHVA 4HDQA 1FHOA 2NZ8B 1DBHA 2DKPA 2YS5A 3HK0A 1H10A 1FOEA 2N0YA 4KVGB 2OTXA 2KGXB 5D3YA 5JHHA 5HE3A 2DA0A 2Z0OA 1V5PA 2EC1A 1E5WA 3P7ZA 1X86A 1BAKA 2LKOA 1UPRA 1OMWA 2CY4A 2MWNB 3DXCA 2D9WA 2DFKA 4EMOA 4DX8A 1UPQA 5DHAB 3F5RA 5C5BB 3ZVRA 2EMTA 4GXBA 3BINA 5HE2A 3ULCA 2I5CA 5L81A 2EJ8A 4HAYB 4EJNA 4IAPA 3TFMA 2VKIA 2IYBA 2ROVA 1U2BA 1DDVA 2HE7A 1FGZA 1FAOA 1LB1A 2J59M 2Y8FA 2RNRB 4HAWB 1Y5OA 2K2UA 1WJMA 2YT0A 1UNPA 1KZGA 3BJIA 3PG7A 3PVLA 1NTVA 1Q67A 4YL8A 1XX0A 4F7GA 1K5DB 5J3QA 5C6RA 4WSFA 1WVHA 3WA0A 4HATB 4Z2NA 2QKMA 2W2WA 2LG1A 5HE1A 1EF1A 1OY2A 3ML4A 4TKNA 1V5MA 2D9ZA 2X18A 1J0WA 2M38A 4WVFB 2J0MA 3KY9A 1V89A 1SGHA 2AEHA 5CLQB 1WJ1A 2ELBA 2W2XD 2CAYA 5FI1A 3ODOA 2ELAA 1U5FA 2D9YA 3U7DA 2P0HA 4A6FB 1K5GB 1EAZA 2D11A 2V76A 3ULBA 2RUKB 1MIZB 3KSYA 4HB4B 1ISNA 2VSZA 1X1GA 1AQCA 1NU2A 4GMXB 1ZC4B 1XODA 2QKLA 5D3WA 3AU4A 3P6AA 2PZ1A 3TVVA 2D4QA 3SNHA 1DROA 3F0WA 3DXEA 4GMVA 2AL6A 2I5FA 2KCJA 4ZRIA 2R09A 3MDBC 4KAXB 4A6FA 2EMSA 3HQCA 4HAUB 1FHXA 2GS0A 2LYDA 2ZPYA 3WYFB 1WG7A 2CY5A 1XR0B 2L1CA 4IOYX 4HAVB 1PFJA 1QQGA 5C5BA 4CHJA 3RCPA 3TO1A 2GCJA 3SUZA 4KHAA 3TW1A 3PSCA 1W1GA 1ZVRA 4MK0A 2UVMA 3V5WA 1PMSA 1P6SA 1PLSA 3IVFA 2LULA 3ODXA 1H4RA 2MFQA 1KI1B 1BTNA 4A5KA 4HB0B 2IFSA 2DTCA 4BBKA 1I2HA 1N3HA 2MKRA 4KHOA 3N7CA 5LOPB 4NY0A 4EKUA 4A6HA 5C79A 3QBVB 2YSZA 3TCAA 4F7UP 4CHMA 4GZUA 4HAZB 2LOZA 3SYXA 1U29A 5DIFB 3ODWA 1FGYA 4MT7A 4DBBA 3M1IB 1X1FA 3FEHA 2Q13A 1MPHA 1M7EA 1TXDA 4HAXB 1TQZA 3PZDA 1U5GA 2YRYA 2COAA 2YS3A 3G9WA 4GPTB 2DN6A 5EFXA 3PEGA 2H7EA 5JHGA 2H7DA 3D8DA 5JLJB 1NTYA 3A98B 2P8VA 2R0DA 2J0KA 2YS1A 5KQ1A 2DLWA 5D3VA 5KCVA 2UZSA 1RRPB 4A6KA 1WGQA 1EGXA 2DX5A 1MKEA 2D2QA 1XD4A 3AJ4A 5D3XA 2OQBA 4DX90 1DDWA 2D9XA 1GG3A 2RGNB 1U5EA 4B6HA 2YT1A 1MAIA 1NI2A 4C0AA 1FHWA 4DXAB 2P0DA 3A8QA 4GN1A 5J3YA 3GYPA 1U27A 1QC6A 5DI9B 3ZDTA 4WJ7A 1X11A 1UEFA 2GCLA 4YONA 5GOWB 1V88A 5KQ4A 5C16A 2I1KA 3AU5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4K2P A;  2DX1 A;  2N23 A;  1LW3 A;  4ZRK A;  3O96 A;  2GJY A;  1ZSQ A;  5HE0 A;  5DH9 B;  2DYQ A;  1B55 A;  3U8Z A;  1P5T A;  2RSG A;  4CYE A;  1EVH A;  1GC7 A;  1TJ6 A;  2BCJ A;  1W1H A;  2UZR A;  1MIX A;  4TYZ A;  2FJL A;  3CXB B;  3A8P A;  1Y19 B;  4Z2M B;  1V5U A;  4F7H A;  3LJU X;  1GC6 A;  1M7R A;  4K17 A;  2KUP A;  3T06 A;  3PVW A;  4K81 A;  2JP2 A;  3HW2 B;  2Y7B A;  5FI0 A;  2Z0Q A;  3CIK A;  2Y8G A;  4HB2 B;  3D8E A;  1UNQ A;  2L2I A;  1UNR A;  4PNK A;  4L6E A;  1V61 A;  3KZ1 A;  2ADZ A;  1ZC3 B;  2Z0P A;  2YVC A;  2COC A;  3KRX A;  3UZT A;  1SHC A;  2E2X A;  5CLL B;  1AWE A;  4K2O A;  5D27 A;  3NSU A;  1DYN A;  4H8S A;  1Z87 A;  2DHI A;  2G35 A;  1MK7 B;  2COF A;  2CRF A;  2W2X C;  3DXD A;  4KHB B;  3FM8 C;  2D10 A;  2K2J A;  5DHF B;  2LOX A;  2NMB A;  3QWM A;  3QIJ A;  2DYN A;  1U5D A;  1XKE A;  4PQ0 A;  1ZM0 A;  1X05 A;  3PVU A;  1WGU A;  5LON B;  4MY6 A;  1DDM A;  3SO6 A;  2D9V A;  4IFS A;  1OQN A;  1XCG A;  2K00 A;  2YF0 A;  2MDX A;  1W1D A;  5J3T A;  2DHK A;  2RVB B;  1FB8 A;  4HDO A;  2COD A;  1RJ2 A;  3GYO A;  3KRW A;  3SV1 A;  3VIA A;  1WI1 A;  4HB3 B;  2I1J A;  2M14 A;  3X23 A;  1KZ7 A;  2VRW B;  2XQN M;  1J19 A;  2ROZ B;  3FSS A;  4Y94 A;  2P0F A;  1MK9 B;  1BTK A;  2DHJ A;  2J0J A;  1IRS A;  4ZRJ A;  3OAN A;  5JP4 A;  3PP2 A;  1P3R A;  3D8F A;  4P7I A;  1BWN A;  1I7A A;  2DKQ A;  2HTH B;  4NSW A;  3VOQ A;  4D0N B;  2RLO A;  4XWX A;  3MPX A;  4HHV A;  4HDQ A;  1FHO A;  2NZ8 B;  1DBH A;  2DKP A;  2YS5 A;  3HK0 A;  1H10 A;  1FOE A;  2N0Y A;  4KVG B;  2OTX A;  2KGX B;  5D3Y A;  5JHH A;  5HE3 A;  2DA0 A;  2Z0O A;  1V5P A;  2EC1 A;  1E5W A;  3P7Z A;  1X86 A;  1BAK A;  2LKO A;  1UPR A;  1OMW A;  2CY4 A;  2MWN B;  3DXC A;  2D9W A;  2DFK A;  4EMO A;  4DX8 A;  1UPQ A;  5DHA B;  3F5R A;  5C5B B;  3ZVR A;  2EMT A;  4GXB A;  3BIN A;  5HE2 A;  3ULC A;  2I5C A;  5L81 A;  2EJ8 A;  4HAY B;  4EJN A;  4IAP A;  3TFM A;  2VKI A;  2IYB A;  2ROV A;  1U2B A;  1DDV A;  2HE7 A;  1FGZ A;  1FAO A;  1LB1 A;  2J59 M;  2Y8F A;  2RNR B;  4HAW B;  1Y5O A;  2K2U A;  1WJM A;  2YT0 A;  1UNP A;  1KZG A;  3BJI A;  3PG7 A;  3PVL A;  1NTV A;  1Q67 A;  4YL8 A;  1XX0 A;  4F7G A;  1K5D B;  5J3Q A;  5C6R A;  4WSF A;  1WVH A;  3WA0 A;  4HAT B;  4Z2N A;  2QKM A;  2W2W A;  2LG1 A;  5HE1 A;  1EF1 A;  1OY2 A;  3ML4 A;  4TKN A;  1V5M A;  2D9Z A;  2X18 A;  1J0W A;  2M38 A;  4WVF B;  2J0M A;  3KY9 A;  1V89 A;  1SGH A;  2AEH A;  5CLQ B;  1WJ1 A;  2ELB A;  2W2X D;  2CAY A;  5FI1 A;  3ODO A;  2ELA A;  1U5F A;  2D9Y A;  3U7D A;  2P0H A;  4A6F B;  1K5G B;  1EAZ A;  2D11 A;  2V76 A;  3ULB A;  2RUK B;  1MIZ B;  3KSY A;  4HB4 B;  1ISN A;  2VSZ A;  1X1G A;  1AQC A;  1NU2 A;  4GMX B;  1ZC4 B;  1XOD A;  2QKL A;  5D3W A;  3AU4 A;  3P6A A;  2PZ1 A;  3TVV A;  2D4Q A;  3SNH A;  1DRO A;  3F0W A;  3DXE A;  4GMV A;  2AL6 A;  2I5F A;  2KCJ A;  4ZRI A;  2R09 A;  3MDB C;  4KAX B;  4A6F A;  2EMS A;  3HQC A;  4HAU B;  1FHX A;  2GS0 A;  2LYD A;  2ZPY A;  3WYF B;  1WG7 A;  2CY5 A;  1XR0 B;  2L1C A;  4IOY X;  4HAV B;  1PFJ A;  1QQG A;  5C5B A;  4CHJ A;  3RCP A;  3TO1 A;  2GCJ A;  3SUZ A;  4KHA A;  3TW1 A;  3PSC A;  1W1G A;  1ZVR A;  4MK0 A;  2UVM A;  3V5W A;  1PMS A;  1P6S A;  1PLS A;  3IVF A;  2LUL A;  3ODX A;  1H4R A;  2MFQ A;  1KI1 B;  1BTN A;  4A5K A;  4HB0 B;  2IFS A;  2DTC A;  4BBK A;  1I2H A;  1N3H A;  2MKR A;  4KHO A;  3N7C A;  5LOP B;  4NY0 A;  4EKU A;  4A6H A;  5C79 A;  3QBV B;  2YSZ A;  3TCA A;  4F7U P;  4CHM A;  4GZU A;  4HAZ B;  2LOZ A;  3SYX A;  1U29 A;  5DIF B;  3ODW A;  1FGY A;  4MT7 A;  4DBB A;  3M1I B;  1X1F A;  3FEH A;  2Q13 A;  1MPH A;  1M7E A;  1TXD A;  4HAX B;  1TQZ A;  3PZD A;  1U5G A;  2YRY A;  2COA A;  2YS3 A;  3G9W A;  4GPT B;  2DN6 A;  5EFX A;  3PEG A;  2H7E A;  5JHG A;  2H7D A;  3D8D A;  5JLJ B;  1NTY A;  3A98 B;  2P8V A;  2R0D A;  2J0K A;  2YS1 A;  5KQ1 A;  2DLW A;  5D3V A;  5KCV A;  2UZS A;  1RRP B;  4A6K A;  1WGQ A;  1EGX A;  2DX5 A;  1MKE A;  2D2Q A;  1XD4 A;  3AJ4 A;  5D3X A;  2OQB A;  4DX9 0;  1DDW A;  2D9X A;  1GG3 A;  2RGN B;  1U5E A;  4B6H A;  2YT1 A;  1MAI A;  1NI2 A;  4C0A A;  1FHW A;  4DXA B;  2P0D A;  3A8Q A;  4GN1 A;  5J3Y A;  3GYP A;  1U27 A;  1QC6 A;  5DI9 B;  3ZDT A;  4WJ7 A;  1X11 A;  1UEF A;  2GCL A;  4YON A;  5GOW B;  1V88 A;  5KQ4 A;  5C16 A;  2I1K A;  3AU5 A; 
#chains in the Genus database with same CATH topology
 4K2P A;  2DX1 A;  2N23 A;  1LW3 A;  4ZRK A;  4OT1 A;  3O96 A;  2GJY A;  1ZSQ A;  5HE0 A;  5DH9 B;  2DYQ A;  1B55 A;  3U8Z A;  1P5T A;  4L1R A;  2RSG A;  4CYE A;  5IRS A;  1EVH A;  1GC7 A;  1TJ6 A;  2BCJ A;  1W1H A;  2UZR A;  1MIX A;  4TYZ A;  2FJL A;  3CXB B;  3A8P A;  1Y19 B;  4Z2M B;  1V5U A;  4F7H A;  3LJU X;  1GC6 A;  1M7R A;  4K17 A;  2KUP A;  3T06 A;  3PVW A;  4K81 A;  2JP2 A;  3HW2 B;  2Y7B A;  5FI0 A;  2Z0Q A;  3CIK A;  2Y8G A;  4HB2 B;  3U12 A;  3D8E A;  1UNQ A;  2L2I A;  1UNR A;  4PNK A;  4L6E A;  1V61 A;  3KZ1 A;  2FJU B;  2ADZ A;  1ZC3 B;  2Z0P A;  4KHB A;  2YVC A;  2COC A;  3KRX A;  3UZT A;  1SHC A;  2E2X A;  5CLL B;  1AWE A;  4K2O A;  5D27 A;  3NSU A;  1DYN A;  4H8S A;  1Z87 A;  2DHI A;  2G35 A;  1MK7 B;  2COF A;  2KIG A;  2CRF A;  2W2X C;  3DXD A;  4KHB B;  3FM8 C;  3DCX A;  2D10 A;  4QJ5 B;  2K2J A;  5DHF B;  2LOX A;  2NMB A;  3QWM A;  3QIJ A;  2DYN A;  1U5D A;  1XKE A;  4PQ0 A;  1ZM0 A;  1X05 A;  3PVU A;  1WGU A;  5LON B;  4MY6 A;  1DDM A;  3SO6 A;  2D9V A;  4IFS A;  1OQN A;  1XCG A;  2K00 A;  2YF0 A;  2MDX A;  1W1D A;  4CSQ A;  5J3T A;  2DHK A;  2RVB B;  1FB8 A;  4HDO A;  2COD A;  1RJ2 A;  3GYO A;  3KRW A;  3NWD A;  3SV1 A;  3VIA A;  4HSI A;  1WI1 A;  4HB3 B;  2I1J A;  2M14 A;  3X23 A;  1KZ7 A;  2VRW B;  2XQN M;  1J19 A;  2ROZ B;  3B77 A;  3FSS A;  4Y94 A;  2P0F A;  1MK9 B;  2Z59 A;  1BTK A;  2DHJ A;  5M4Y B;  2NBV A;  2J0J A;  1IRS A;  4ZRJ A;  3OAN A;  5JP4 A;  3PP2 A;  1P3R A;  3D8F A;  4P7I A;  2KR0 A;  1BWN A;  1I7A A;  2DKQ A;  2HTH B;  4NSW A;  3VOQ A;  4D0N B;  2RLO A;  4XWX A;  3MPX A;  4GOU A;  4HHV A;  4HDQ A;  1FHO A;  2NZ8 B;  1DBH A;  2DKP A;  2YS5 A;  3HK0 A;  1H10 A;  1FOE A;  2N0Y A;  2YT2 A;  4KVG B;  2OTX A;  2KGX B;  5D3Y A;  5JHH A;  5HE3 A;  2DA0 A;  2Z0O A;  1V5P A;  2EC1 A;  1E5W A;  3P7Z A;  1X86 A;  1BAK A;  2LKO A;  1UPR A;  1OMW A;  2CY4 A;  2MWN B;  3DXC A;  2KUQ A;  2D9W A;  2DFK A;  4EMO A;  4DX8 A;  1UPQ A;  5DHA B;  3F5R A;  5C5B B;  3ZVR A;  2EMT A;  4GXB A;  3BIN A;  5HE2 A;  3ULC A;  2I5C A;  5L81 A;  2ZKM X;  2EJ8 A;  4HAY B;  4EJN A;  4IAP A;  3TFM A;  2VKI A;  2IYB A;  2ROV A;  1U2B A;  1DDV A;  2HE7 A;  1FGZ A;  1FAO A;  1LB1 A;  2J59 M;  2Y8F A;  2RNR B;  4HAW B;  1Y5O A;  2K2U A;  1WJM A;  2YT0 A;  1UNP A;  1KZG A;  3BJI A;  3PG7 A;  3PVL A;  1NTV A;  1Q67 A;  4YL8 A;  1XX0 A;  4F7G A;  1K5D B;  5J3Q A;  5C6R A;  4WSF A;  1WVH A;  3WA0 A;  4HAT B;  4Z2N A;  2QKM A;  4DIX A;  2W2W A;  2LG1 A;  5HE1 A;  1EF1 A;  1OY2 A;  3ML4 A;  4TKN A;  1V5M A;  2D9Z A;  2X18 A;  1J0W A;  2M38 A;  4WVF B;  2J0M A;  3KY9 A;  1V89 A;  1SGH A;  2AEH A;  5CLQ B;  1WJ1 A;  2ELB A;  2W2X D;  2CAY A;  5FI1 A;  3ODO A;  2ELA A;  2K49 A;  1U5F A;  2D9Y A;  3U7D A;  2P0H A;  4A6F B;  1K5G B;  1EAZ A;  2D11 A;  2V76 A;  2KIE A;  3ULB A;  2RUK B;  1MIZ B;  3KSY A;  4HB4 B;  1ISN A;  2VSZ A;  1X1G A;  1AQC A;  1NU2 A;  4GMX B;  1ZC4 B;  1XOD A;  2QKL A;  5D3W A;  3AU4 A;  3P6A A;  2PZ1 A;  3TVV A;  2D4Q A;  1ZYI A;  3SNH A;  1DRO A;  3F0W A;  3DXE A;  4GMV A;  2AL6 A;  2I5F A;  2KCJ A;  4ZRI A;  2R09 A;  3MDB C;  4KAX B;  4A6F A;  2EMS A;  3HQC A;  4HAU B;  1FHX A;  2GS0 A;  5I2M A;  2LYD A;  2ZPY A;  3WYF B;  1WG7 A;  2CY5 A;  2R2Y A;  1XR0 B;  2L1C A;  4IOY X;  2Z13 A;  4HAV B;  1PFJ A;  1QQG A;  5C5B A;  4CHJ A;  3RCP A;  3TO1 A;  3HIE A;  2GCJ A;  3SUZ A;  4KHA A;  3TW1 A;  4QJ4 B;  3PSC A;  3NW8 A;  1W1G A;  1ZVR A;  2RRF A;  4MK0 A;  2UVM A;  3V5W A;  1PMS A;  1MI1 A;  1P6S A;  1PLS A;  3IVF A;  2LUL A;  2Z14 A;  3ODX A;  1H4R A;  2Z4D A;  2MFQ A;  1KI1 B;  3HSA A;  1BTN A;  3A58 A;  4A5K A;  4HB0 B;  2IFS A;  2DTC A;  4BBK A;  1T77 A;  1I2H A;  1N3H A;  2MKR A;  4KHO A;  3N7C A;  3NWA A;  4QXA B;  5LOP B;  4NY0 A;  4EKU A;  4A6H A;  5C79 A;  3QBV B;  2YSZ A;  3TCA A;  4F7U P;  4CHM A;  4GZU A;  4HAZ B;  4QJ3 B;  2LOZ A;  3SYX A;  1U29 A;  2GUM A;  5DIF B;  3ODW A;  1FGY A;  3NWF A;  4MT7 A;  4DBB A;  3M1I B;  1X1F A;  3FEH A;  2Q13 A;  1MPH A;  1M7E A;  1TXD A;  4HAX B;  1TQZ A;  2K8E A;  3PZD A;  1U5G A;  2YRY A;  2COA A;  2YS3 A;  3G9W A;  4GPT B;  2DN6 A;  5EFX A;  3PEG A;  2H7E A;  5JHG A;  2H7D A;  3D8D A;  5JLJ B;  1NTY A;  3OHM B;  3A98 B;  4D6W A;  2P8V A;  2R0D A;  2J0K A;  2YS1 A;  5KQ1 A;  2DLW A;  5D3V A;  5KCV A;  2UZS A;  1RRP B;  4A6K A;  5LG4 B;  1WGQ A;  1EGX A;  2DX5 A;  3FVC A;  1MKE A;  2D2Q A;  1XD4 A;  3AJ4 A;  5D3X A;  2OQB A;  4OSN A;  4DX9 0;  1DDW A;  2D9X A;  1GG3 A;  2RGN B;  4GNK B;  1U5E A;  4B6H A;  5I2S A;  2YT1 A;  1MAI A;  1NI2 A;  4C0A A;  1FHW A;  4DXA B;  2P0D A;  3A8Q A;  4GN1 A;  5J3Y A;  3GYP A;  1U27 A;  1QC6 A;  5DI9 B;  3ZDT A;  4WJ7 A;  1X11 A;  1UEF A;  2GCL A;  4YON A;  5GOW B;  1V88 A;  5KQ4 A;  5C16 A;  2I1K A;  3AU5 A; 
#chains in the Genus database with same CATH homology
 4K2P A;  2DX1 A;  2N23 A;  1LW3 A;  4ZRK A;  3O96 A;  2GJY A;  1ZSQ A;  5HE0 A;  5DH9 B;  2DYQ A;  1B55 A;  3U8Z A;  1P5T A;  2RSG A;  4CYE A;  1EVH A;  1GC7 A;  1TJ6 A;  2BCJ A;  1W1H A;  2UZR A;  1MIX A;  4TYZ A;  2FJL A;  3CXB B;  3A8P A;  1Y19 B;  4Z2M B;  1V5U A;  4F7H A;  3LJU X;  1GC6 A;  1M7R A;  4K17 A;  2KUP A;  3T06 A;  3PVW A;  4K81 A;  2JP2 A;  3HW2 B;  2Y7B A;  5FI0 A;  2Z0Q A;  3CIK A;  2Y8G A;  4HB2 B;  3D8E A;  1UNQ A;  2L2I A;  1UNR A;  4PNK A;  4L6E A;  1V61 A;  3KZ1 A;  2ADZ A;  1ZC3 B;  2Z0P A;  2YVC A;  2COC A;  3KRX A;  3UZT A;  1SHC A;  2E2X A;  5CLL B;  1AWE A;  4K2O A;  5D27 A;  3NSU A;  1DYN A;  4H8S A;  1Z87 A;  2DHI A;  2G35 A;  1MK7 B;  2COF A;  2CRF A;  2W2X C;  3DXD A;  4KHB B;  3FM8 C;  2D10 A;  2K2J A;  5DHF B;  2LOX A;  2NMB A;  3QWM A;  3QIJ A;  2DYN A;  1U5D A;  1XKE A;  4PQ0 A;  1ZM0 A;  1X05 A;  3PVU A;  1WGU A;  5LON B;  4MY6 A;  1DDM A;  3SO6 A;  2D9V A;  4IFS A;  1OQN A;  1XCG A;  2K00 A;  2YF0 A;  2MDX A;  1W1D A;  5J3T A;  2DHK A;  2RVB B;  1FB8 A;  4HDO A;  2COD A;  1RJ2 A;  3GYO A;  3KRW A;  3SV1 A;  3VIA A;  1WI1 A;  4HB3 B;  2I1J A;  2M14 A;  3X23 A;  1KZ7 A;  2VRW B;  2XQN M;  1J19 A;  2ROZ B;  3FSS A;  4Y94 A;  2P0F A;  1MK9 B;  1BTK A;  2DHJ A;  2J0J A;  1IRS A;  4ZRJ A;  3OAN A;  5JP4 A;  3PP2 A;  1P3R A;  3D8F A;  4P7I A;  1BWN A;  1I7A A;  2DKQ A;  2HTH B;  4NSW A;  3VOQ A;  4D0N B;  2RLO A;  4XWX A;  3MPX A;  4HHV A;  4HDQ A;  1FHO A;  2NZ8 B;  1DBH A;  2DKP A;  2YS5 A;  3HK0 A;  1H10 A;  1FOE A;  2N0Y A;  4KVG B;  2OTX A;  2KGX B;  5D3Y A;  5JHH A;  5HE3 A;  2DA0 A;  2Z0O A;  1V5P A;  2EC1 A;  1E5W A;  3P7Z A;  1X86 A;  1BAK A;  2LKO A;  1UPR A;  1OMW A;  2CY4 A;  2MWN B;  3DXC A;  2D9W A;  2DFK A;  4EMO A;  4DX8 A;  1UPQ A;  5DHA B;  3F5R A;  5C5B B;  3ZVR A;  2EMT A;  4GXB A;  3BIN A;  5HE2 A;  3ULC A;  2I5C A;  5L81 A;  2EJ8 A;  4HAY B;  4EJN A;  4IAP A;  3TFM A;  2VKI A;  2IYB A;  2ROV A;  1U2B A;  1DDV A;  2HE7 A;  1FGZ A;  1FAO A;  1LB1 A;  2J59 M;  2Y8F A;  2RNR B;  4HAW B;  1Y5O A;  2K2U A;  1WJM A;  2YT0 A;  1UNP A;  1KZG A;  3BJI A;  3PG7 A;  3PVL A;  1NTV A;  1Q67 A;  4YL8 A;  1XX0 A;  4F7G A;  1K5D B;  5J3Q A;  5C6R A;  4WSF A;  1WVH A;  3WA0 A;  4HAT B;  4Z2N A;  2QKM A;  2W2W A;  2LG1 A;  5HE1 A;  1EF1 A;  1OY2 A;  3ML4 A;  4TKN A;  1V5M A;  2D9Z A;  2X18 A;  1J0W A;  2M38 A;  4WVF B;  2J0M A;  3KY9 A;  1V89 A;  1SGH A;  2AEH A;  5CLQ B;  1WJ1 A;  2ELB A;  2W2X D;  2CAY A;  5FI1 A;  3ODO A;  2ELA A;  1U5F A;  2D9Y A;  3U7D A;  2P0H A;  4A6F B;  1K5G B;  1EAZ A;  2D11 A;  2V76 A;  3ULB A;  2RUK B;  1MIZ B;  3KSY A;  4HB4 B;  1ISN A;  2VSZ A;  1X1G A;  1AQC A;  1NU2 A;  4GMX B;  1ZC4 B;  1XOD A;  2QKL A;  5D3W A;  3AU4 A;  3P6A A;  2PZ1 A;  3TVV A;  2D4Q A;  3SNH A;  1DRO A;  3F0W A;  3DXE A;  4GMV A;  2AL6 A;  2I5F A;  2KCJ A;  4ZRI A;  2R09 A;  3MDB C;  4KAX B;  4A6F A;  2EMS A;  3HQC A;  4HAU B;  1FHX A;  2GS0 A;  2LYD A;  2ZPY A;  3WYF B;  1WG7 A;  2CY5 A;  1XR0 B;  2L1C A;  4IOY X;  4HAV B;  1PFJ A;  1QQG A;  5C5B A;  4CHJ A;  3RCP A;  3TO1 A;  2GCJ A;  3SUZ A;  4KHA A;  3TW1 A;  3PSC A;  1W1G A;  1ZVR A;  4MK0 A;  2UVM A;  3V5W A;  1PMS A;  1P6S A;  1PLS A;  3IVF A;  2LUL A;  3ODX A;  1H4R A;  2MFQ A;  1KI1 B;  1BTN A;  4A5K A;  4HB0 B;  2IFS A;  2DTC A;  4BBK A;  1I2H A;  1N3H A;  2MKR A;  4KHO A;  3N7C A;  5LOP B;  4NY0 A;  4EKU A;  4A6H A;  5C79 A;  3QBV B;  2YSZ A;  3TCA A;  4F7U P;  4CHM A;  4GZU A;  4HAZ B;  2LOZ A;  3SYX A;  1U29 A;  5DIF B;  3ODW A;  1FGY A;  4MT7 A;  4DBB A;  3M1I B;  1X1F A;  3FEH A;  2Q13 A;  1MPH A;  1M7E A;  1TXD A;  4HAX B;  1TQZ A;  3PZD A;  1U5G A;  2YRY A;  2COA A;  2YS3 A;  3G9W A;  4GPT B;  2DN6 A;  5EFX A;  3PEG A;  2H7E A;  5JHG A;  2H7D A;  3D8D A;  5JLJ B;  1NTY A;  3A98 B;  2P8V A;  2R0D A;  2J0K A;  2YS1 A;  5KQ1 A;  2DLW A;  5D3V A;  5KCV A;  2UZS A;  1RRP B;  4A6K A;  1WGQ A;  1EGX A;  2DX5 A;  1MKE A;  2D2Q A;  1XD4 A;  3AJ4 A;  5D3X A;  2OQB A;  4DX9 0;  1DDW A;  2D9X A;  1GG3 A;  2RGN B;  1U5E A;  4B6H A;  2YT1 A;  1MAI A;  1NI2 A;  4C0A A;  1FHW A;  4DXA B;  2P0D A;  3A8Q A;  4GN1 A;  5J3Y A;  3GYP A;  1U27 A;  1QC6 A;  5DI9 B;  3ZDT A;  4WJ7 A;  1X11 A;  1UEF A;  2GCL A;  4YON A;  5GOW B;  1V88 A;  5KQ4 A;  5C16 A;  2I1K A;  3AU5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...