2D9XA

Solution structure of the ph domain of oxysterol binding protein-related protein 11 from human
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
120
structure length
120
Chain Sequence
GSSGSSGENVYGYLMKYTNLVTGWQYRFFVLNNEAGLLEYFVNEQSRNQKPRGTLQLAGAVISPSDEDSHTFTVNAASGEQYKLRATDAKERQHWVSRLQICTQHHTEAIGKNNSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lipid transport
molecule keywords Oxysterol binding protein-related protein 11
publication title Solution structure of the PH domain of Oxysterol binding protein-related protein 11 from human
rcsb
source organism Homo sapiens
total genus 16
structure length 120
sequence length 120
ec nomenclature
pdb deposition date 2005-12-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00169 PH PH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2d9xA01
2YVCA 3WA0A 1DDVA 1ZM0A 5FI0A 1MPHA 4Z2MB 1W1DA 1WJ1A 4EMOA 2RSGA 5J3QA 2DX1A 2MFQA 3N7CA 2QKMA 3RCPA 2LULA 3T06A 2P0DA 3KY9A 2M38A 5C79A 1W1GA 2CY5A 2H7DA 2K2UA 3UZTA 2Z0QA 1EVHA 1UNPA 4HAYB 4ZRKA 1PLSA 1N3HA 1P6SA 2P0HA 4PQ0A 2D9VA 1B55A 4BBKA 3GYOA 3FSSA 1FHWA 2DKPA 1FOEA 3FEHA 5DHFB 1K5GB 1NI2A 1EAZA 1MIZB 1MK7B 1J19A 2P0FA 5D3WA 1ZC3B 5J3TA 3CIKA 2L1CA 2I1JA 1I7AA 1WGUA 1XCGA 2HE7A 4HAWB 1BTNA 1OQNA 2DHIA 2IYBA 2Z0OA 1V89A 4L6EA 4ZRIA 5JLJB 1H4RA 1FAOA 3QWMA 3ULBA 1Y19B 3D8EA 1XODA 1V5PA 1NTYA 3AU4A 3F0WA 2D9YA 5HE2A 5DI9B 1X86A 2D9WA 3ODXA 3HK0A 1LW3A 5JHGA 1P5TA 4B6HA 5C16A 1V5UA 1P3RA 1X11A 1Z87A 5FI1A 3NSUA 4WVFB 2K00A 4WJ7A 2VSZA 1V5MA 4MT7A 2GS0A 4K81A 2ADZA 5HE0A 3V5WA 2H7EA 2RNRB 2AL6A 4F7HA 2LKOA 1LB1A 1TQZA 2AEHA 2HTHB 5KCVA 1SHCA 1EGXA 4NSWA 1OY2A 4HB4B 4MY6A 4EJNA 2DHJA 3SO6A 4H8SA 4HB2B 2JP2A 3MPXA 2D2QA 3ULCA 1QC6A 3GYPA 1WJMA 2CODA 2DLWA 2Y8FA 3AU5A 5CLLB 3WYFB 2M14A 5D27A 3BJIA 4HAVB 3DXEA 1GC7A 2CRFA 2J0MA 5JHHA 5EFXA 2NZ8B 3OANA 4HB0B 2DX5A 5D3XA 2EMSA 2DKQA 1ZC4B 4TYZA 1U5DA 2RLOA 4A6FA 4KHBB 5KQ4A 1K5DB 5L81A 1BAKA 5HE1A 4D0NB 1DDMA 1U2BA 1TJ6A 3QIJA 1XX0A 1MIXA 3U8ZA 2D9XA 1Q67A 4ZRJA 1QQGA 2DHKA 1NU2A 1V88A 4A6FB 2LOXA 4NY0A 4HAXB 4A6KA 2GCJA 3A98B 2OTXA 1X1GA 5D3VA 3U7DA 3AJ4A 3TVVA 5D3YA 4KHAA 4A5KA 4HAUB 3D8DA 1KZ7A 5DIFB 2W2XD 1NTVA 3PSCA 1UPQA 1MKEA 2DTCA 2W2WA 1PMSA 2J0KA 5DHAB 5JP4A 4DXAB 1WGQA 2COAA 1DDWA 2KCJA 3TCAA 4DX8A 2D9ZA 2RGNB 3PEGA 3SYXA 1RRPB 5LONB 5KQ1A 3TFMA 1EF1A 2N0YA 1XR0B 2I5FA 1UPRA 2GJYA 4HATB 2ROZB 2UVMA 2D10A 2DN6A 2R0DA 1GC6A 1ISNA 3ML4A 1OMWA 2X18A 2P8VA 4CYEA 1MAIA 2ELBA 3KRWA 1PFJA 2VKIA 3PZDA 4DX90 2UZSA 1GG3A 1ZSQA 2COCA 3MDBC 1M7EA 2DFKA 4C0AA 4CHMA 4YL8A 2I1KA 2D4QA 4Z2NA 4K17A 3CXBB 2DA0A 4EKUA 3HW2B 4KHOA 2YRYA 3IVFA 2ROVA 5LOPB 2CY4A 2D11A 1MK9B 3SUZA 2DYNA 5C5BB 1U27A 4HB3B 3PVUA 2FJLA 2J59M 3PVWA 1U29A 3VIAA 1M7RA 3ZVRA 5J3YA 4HHVA 4F7GA 2PZ1A 4IFSA 4XWXA 1V61A 1FHOA 3SV1A 2YF0A 4HAZB 4F7UP 3SNHA 2XQNM 1RJ2A 4A6HA 1X05A 3D8FA 4IAPA 2VRWB 4GN1A 2LOZA 4TKNA 3P6AA 3ODOA 1XKEA 3KRXA 1BTKA 3M1IB 2COFA 2MWNB 2GCLA 3O96A 2N23A 3A8QA 2W2XC 3DXDA 2NMBA 1FGZA 2YT0A 2RUKB 2CAYA 4GPTB 1IRSA 4K2PA 1W1HA 4WSFA 1AQCA 2EC1A 5DH9B 3ZDTA 1UNRA 1FHXA 1E5WA 1J0WA 3KSYA 3BINA 1TXDA 4P7IA 2UZRA 3LJUX 2Q13A 1WG7A 2YSZA 1UEFA 5HE3A 2EJ8A 2YS5A 2LYDA 2QKLA 4MK0A 1U5FA 4PNKA 3TW1A 3PVLA 1SGHA 2ELAA 4KAXB 1ZVRA 2MKRA 2R09A 4K2OA 1WI1A 4HDOA 2DYQA 2EMTA 4CHJA 1U5EA 2YS1A 3A8PA 2LG1A 2YS3A 1DYNA 3TO1A 1BWNA 3ODWA 4HDQA 2Y7BA 1DBHA 2ZPYA 1WVHA 1FB8A 2KGXB 2J0JA 4GMXB 1UNQA 1I2HA 1H10A 2K2JA 4KVGB 4GZUA 4IOYX 1XD4A 3FM8C 4Y94A 5C5BA 1DROA 2G35A 4YONA 3G9WA 3P7ZA 4DBBA 1KI1B 2KUPA 3PG7A 3X23A 3KZ1A 1X1FA 4GMVA 2Z0PA 3PP2A 3VOQA 2Y8GA 2BCJA 5GOWB 2RVBB 5CLQB 3HQCA 1KZGA 1FGYA 2IFSA 2I5CA 2L2IA 2YT1A 1U5GA 2OQBA 1Y5OA 4GXBA 2MDXA 3QBVB 2V76A 1AWEA 3DXCA 2E2XA 3F5RA 5C6RA
chains in the Genus database with same CATH superfamily
2YVCA 3WA0A 1DDVA 1ZM0A 5FI0A 1MPHA 4Z2MB 1W1DA 1WJ1A 4EMOA 2RSGA 5J3QA 2DX1A 2MFQA 3N7CA 2QKMA 3RCPA 2LULA 3T06A 2P0DA 3KY9A 2GUMA 2M38A 5C79A 1W1GA 2CY5A 2H7DA 2K2UA 3UZTA 2Z0QA 1EVHA 1UNPA 4HSIA 4HAYB 4ZRKA 1PLSA 3FVCA 1N3HA 1P6SA 2P0HA 4PQ0A 2D9VA 1B55A 4BBKA 2KR0A 3GYOA 3FSSA 1FHWA 2DKPA 1FOEA 3FEHA 5DHFB 1K5GB 1NI2A 1EAZA 1MIZB 1MK7B 1J19A 2P0FA 5D3WA 1ZC3B 5J3TA 3CIKA 2L1CA 2I1JA 1I7AA 1WGUA 1XCGA 2HE7A 4HAWB 1BTNA 1MI1A 1OQNA 2DHIA 2IYBA 5LG4B 2Z0OA 2Z59A 1V89A 4L6EA 4ZRIA 5JLJB 1H4RA 1FAOA 3QWMA 3ULBA 1Y19B 3D8EA 1XODA 1V5PA 1NTYA 3AU4A 3F0WA 4CSQA 2D9YA 5HE2A 5DI9B 1X86A 2D9WA 3ODXA 4GNKB 3HK0A 1LW3A 5JHGA 2KIGA 4QJ3B 3HSAA 1P5TA 4B6HA 5C16A 1V5UA 1P3RA 1X11A 1Z87A 5FI1A 3NSUA 4DIXA 4WVFB 2K00A 4WJ7A 2VSZA 1V5MA 4MT7A 2GS0A 4K81A 2ADZA 5HE0A 3V5WA 2NBVA 2Z14A 2H7EA 2RNRB 2AL6A 4F7HA 2LKOA 1LB1A 1TQZA 2AEHA 2HTHB 5KCVA 3U12A 1SHCA 1EGXA 4D6WA 4NSWA 1OY2A 4HB4B 4MY6A 4EJNA 2K8EA 2DHJA 3SO6A 4H8SA 4L1RA 4HB2B 2JP2A 3MPXA 2D2QA 3ULCA 1QC6A 3GYPA 1WJMA 2CODA 2DLWA 2Y8FA 3AU5A 1ZYIA 5CLLB 3WYFB 2M14A 3OHMB 5D27A 3BJIA 4HAVB 3DXEA 1GC7A 4KHBA 2CRFA 2J0MA 5JHHA 5EFXA 3HIEA 2NZ8B 3OANA 4HB0B 2DX5A 5D3XA 2EMSA 2DKQA 1ZC4B 4TYZA 1U5DA 2RLOA 4A6FA 5I2SA 4KHBB 5KQ4A 1K5DB 5I2MA 5L81A 1BAKA 5HE1A 4D0NB 1DDMA 1U2BA 1TJ6A 3QIJA 1XX0A 1MIXA 3U8ZA 2D9XA 1Q67A 4ZRJA 1QQGA 2DHKA 1NU2A 1V88A 4A6FB 2LOXA 4NY0A 4HAXB 4A6KA 2R2YA 2GCJA 4OT1A 3A98B 2OTXA 1X1GA 5D3VA 3U7DA 3AJ4A 3TVVA 5D3YA 4KHAA 4A5KA 4HAUB 3D8DA 1KZ7A 5DIFB 2W2XD 1NTVA 3PSCA 3B77A 1UPQA 1MKEA 2DTCA 2W2WA 1PMSA 2J0KA 5DHAB 5JP4A 4DXAB 1WGQA 2COAA 1DDWA 2KCJA 3TCAA 4DX8A 2D9ZA 2RGNB 3DCXA 3PEGA 3SYXA 1RRPB 5LONB 5KQ1A 3TFMA 1EF1A 2N0YA 1XR0B 2I5FA 1UPRA 2GJYA 4HATB 2ROZB 2UVMA 2D10A 2DN6A 2R0DA 2KIEA 1GC6A 1ISNA 3ML4A 1OMWA 2X18A 2P8VA 4CYEA 1MAIA 2ELBA 3KRWA 1PFJA 2VKIA 3PZDA 4DX90 2UZSA 2RRFA 1GG3A 1ZSQA 4OSNA 2COCA 3MDBC 1M7EA 2DFKA 4QXAB 4C0AA 4CHMA 4YL8A 1T77A 2I1KA 2D4QA 4Z2NA 4K17A 3CXBB 2DA0A 4EKUA 3HW2B 4KHOA 5IRSA 2YRYA 3IVFA 2ROVA 2Z13A 5LOPB 2CY4A 2D11A 1MK9B 3SUZA 2DYNA 5C5BB 1U27A 4HB3B 3PVUA 2FJLA 2J59M 3PVWA 1U29A 3VIAA 1M7RA 3ZVRA 5J3YA 4HHVA 4F7GA 2PZ1A 4IFSA 4XWXA 1V61A 1FHOA 3SV1A 2YF0A 4HAZB 4F7UP 3SNHA 3A58A 2XQNM 1RJ2A 4A6HA 1X05A 3D8FA 4IAPA 2VRWB 4GN1A 2LOZA 4TKNA 3P6AA 3ODOA 1XKEA 3KRXA 1BTKA 3M1IB 2COFA 2MWNB 2GCLA 3O96A 2N23A 3A8QA 2W2XC 3NWFA 3DXDA 2NMBA 1FGZA 2YT0A 2RUKB 2CAYA 4GPTB 1IRSA 4K2PA 1W1HA 4WSFA 1AQCA 2EC1A 5DH9B 3ZDTA 1UNRA 1FHXA 1E5WA 1J0WA 3KSYA 3BINA 1TXDA 4P7IA 4GOUA 2UZRA 3LJUX 2Q13A 1WG7A 2YSZA 1UEFA 5HE3A 2EJ8A 2YS5A 2LYDA 2QKLA 4MK0A 1U5FA 4PNKA 3TW1A 2Z4DA 3PVLA 1SGHA 2ELAA 4KAXB 5M4YB 1ZVRA 2MKRA 2R09A 2ZKMX 4K2OA 1WI1A 4HDOA 2DYQA 2EMTA 4CHJA 1U5EA 2YS1A 3A8PA 2LG1A 2YS3A 1DYNA 3TO1A 1BWNA 3NWDA 3ODWA 4HDQA 2Y7BA 1DBHA 2ZPYA 1WVHA 2K49A 1FB8A 2KGXB 2J0JA 4GMXB 1UNQA 1I2HA 1H10A 2K2JA 4KVGB 4GZUA 4IOYX 2FJUB 1XD4A 3FM8C 4Y94A 2YT2A 4QJ5B 5C5BA 1DROA 2G35A 4YONA 3G9WA 3P7ZA 4DBBA 1KI1B 2KUPA 3PG7A 3X23A 3KZ1A 1X1FA 4GMVA 2Z0PA 3PP2A 3VOQA 4QJ4B 2Y8GA 2KUQA 2BCJA 5GOWB 2RVBB 5CLQB 3HQCA 1KZGA 1FGYA 2IFSA 2I5CA 2L2IA 2YT1A 1U5GA 2OQBA 1Y5OA 3NW8A 4GXBA 2MDXA 3QBVB 2V76A 3NWAA 1AWEA 3DXCA 2E2XA 3F5RA 5C6RA
chains in the Genus database with same CATH topology
2YVCA 3WA0A 1DDVA 1ZM0A 5FI0A 1MPHA 4Z2MB 1W1DA 1WJ1A 4EMOA 2RSGA 5J3QA 2DX1A 2MFQA 3N7CA 2QKMA 3RCPA 2LULA 3T06A 2P0DA 3KY9A 2M38A 5C79A 1W1GA 2CY5A 2H7DA 2K2UA 3UZTA 2Z0QA 1EVHA 1UNPA 4HAYB 4ZRKA 1PLSA 1N3HA 1P6SA 2P0HA 4PQ0A 2D9VA 1B55A 4BBKA 3GYOA 3FSSA 1FHWA 2DKPA 1FOEA 3FEHA 5DHFB 1K5GB 1NI2A 1EAZA 1MIZB 1MK7B 1J19A 2P0FA 5D3WA 1ZC3B 5J3TA 3CIKA 2L1CA 2I1JA 1I7AA 1WGUA 1XCGA 2HE7A 4HAWB 1BTNA 1OQNA 2DHIA 2IYBA 2Z0OA 1V89A 4L6EA 4ZRIA 5JLJB 1H4RA 1FAOA 3QWMA 3ULBA 1Y19B 3D8EA 1XODA 1V5PA 1NTYA 3AU4A 3F0WA 2D9YA 5HE2A 5DI9B 1X86A 2D9WA 3ODXA 3HK0A 1LW3A 5JHGA 1P5TA 4B6HA 5C16A 1V5UA 1P3RA 1X11A 1Z87A 5FI1A 3NSUA 4WVFB 2K00A 4WJ7A 2VSZA 1V5MA 4MT7A 2GS0A 4K81A 2ADZA 5HE0A 3V5WA 2H7EA 2RNRB 2AL6A 4F7HA 2LKOA 1LB1A 1TQZA 2AEHA 2HTHB 5KCVA 1SHCA 1EGXA 4NSWA 1OY2A 4HB4B 4MY6A 4EJNA 2DHJA 3SO6A 4H8SA 4HB2B 2JP2A 3MPXA 2D2QA 3ULCA 1QC6A 3GYPA 1WJMA 2CODA 2DLWA 2Y8FA 3AU5A 5CLLB 3WYFB 2M14A 5D27A 3BJIA 4HAVB 3DXEA 1GC7A 2CRFA 2J0MA 5JHHA 5EFXA 2NZ8B 3OANA 4HB0B 2DX5A 5D3XA 2EMSA 2DKQA 1ZC4B 4TYZA 1U5DA 2RLOA 4A6FA 4KHBB 5KQ4A 1K5DB 5L81A 1BAKA 5HE1A 4D0NB 1DDMA 1U2BA 1TJ6A 3QIJA 1XX0A 1MIXA 3U8ZA 2D9XA 1Q67A 4ZRJA 1QQGA 2DHKA 1NU2A 1V88A 4A6FB 2LOXA 4NY0A 4HAXB 4A6KA 2GCJA 3A98B 2OTXA 1X1GA 5D3VA 3U7DA 3AJ4A 3TVVA 5D3YA 4KHAA 4A5KA 4HAUB 3D8DA 1KZ7A 5DIFB 2W2XD 1NTVA 3PSCA 1UPQA 1MKEA 2DTCA 2W2WA 1PMSA 2J0KA 5DHAB 5JP4A 4DXAB 1WGQA 2COAA 1DDWA 2KCJA 3TCAA 4DX8A 2D9ZA 2RGNB 3PEGA 3SYXA 1RRPB 5LONB 5KQ1A 3TFMA 1EF1A 2N0YA 1XR0B 2I5FA 1UPRA 2GJYA 4HATB 2ROZB 2UVMA 2D10A 2DN6A 2R0DA 1GC6A 1ISNA 3ML4A 1OMWA 2X18A 2P8VA 4CYEA 1MAIA 2ELBA 3KRWA 1PFJA 2VKIA 3PZDA 4DX90 2UZSA 1GG3A 1ZSQA 2COCA 3MDBC 1M7EA 2DFKA 4C0AA 4CHMA 4YL8A 2I1KA 2D4QA 4Z2NA 4K17A 3CXBB 2DA0A 4EKUA 3HW2B 4KHOA 2YRYA 3IVFA 2ROVA 5LOPB 2CY4A 2D11A 1MK9B 3SUZA 2DYNA 5C5BB 1U27A 4HB3B 3PVUA 2FJLA 2J59M 3PVWA 1U29A 3VIAA 1M7RA 3ZVRA 5J3YA 4HHVA 4F7GA 2PZ1A 4IFSA 4XWXA 1V61A 1FHOA 3SV1A 2YF0A 4HAZB 4F7UP 3SNHA 2XQNM 1RJ2A 4A6HA 1X05A 3D8FA 4IAPA 2VRWB 4GN1A 2LOZA 4TKNA 3P6AA 3ODOA 1XKEA 3KRXA 1BTKA 3M1IB 2COFA 2MWNB 2GCLA 3O96A 2N23A 3A8QA 2W2XC 3DXDA 2NMBA 1FGZA 2YT0A 2RUKB 2CAYA 4GPTB 1IRSA 4K2PA 1W1HA 4WSFA 1AQCA 2EC1A 5DH9B 3ZDTA 1UNRA 1FHXA 1E5WA 1J0WA 3KSYA 3BINA 1TXDA 4P7IA 2UZRA 3LJUX 2Q13A 1WG7A 2YSZA 1UEFA 5HE3A 2EJ8A 2YS5A 2LYDA 2QKLA 4MK0A 1U5FA 4PNKA 3TW1A 3PVLA 1SGHA 2ELAA 4KAXB 1ZVRA 2MKRA 2R09A 4K2OA 1WI1A 4HDOA 2DYQA 2EMTA 4CHJA 1U5EA 2YS1A 3A8PA 2LG1A 2YS3A 1DYNA 3TO1A 1BWNA 3ODWA 4HDQA 2Y7BA 1DBHA 2ZPYA 1WVHA 1FB8A 2KGXB 2J0JA 4GMXB 1UNQA 1I2HA 1H10A 2K2JA 4KVGB 4GZUA 4IOYX 1XD4A 3FM8C 4Y94A 5C5BA 1DROA 2G35A 4YONA 3G9WA 3P7ZA 4DBBA 1KI1B 2KUPA 3PG7A 3X23A 3KZ1A 1X1FA 4GMVA 2Z0PA 3PP2A 3VOQA 2Y8GA 2BCJA 5GOWB 2RVBB 5CLQB 3HQCA 1KZGA 1FGYA 2IFSA 2I5CA 2L2IA 2YT1A 1U5GA 2OQBA 1Y5OA 4GXBA 2MDXA 3QBVB 2V76A 1AWEA 3DXCA 2E2XA 3F5RA 5C6RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YVC A;  3WA0 A;  1DDV A;  1ZM0 A;  5FI0 A;  1MPH A;  4Z2M B;  1W1D A;  1WJ1 A;  4EMO A;  2RSG A;  5J3Q A;  2DX1 A;  2MFQ A;  3N7C A;  2QKM A;  3RCP A;  2LUL A;  3T06 A;  2P0D A;  3KY9 A;  2M38 A;  5C79 A;  1W1G A;  2CY5 A;  2H7D A;  2K2U A;  3UZT A;  2Z0Q A;  1EVH A;  1UNP A;  4HAY B;  4ZRK A;  1PLS A;  1N3H A;  1P6S A;  2P0H A;  4PQ0 A;  2D9V A;  1B55 A;  4BBK A;  3GYO A;  3FSS A;  1FHW A;  2DKP A;  1FOE A;  3FEH A;  5DHF B;  1K5G B;  1NI2 A;  1EAZ A;  1MIZ B;  1MK7 B;  1J19 A;  2P0F A;  5D3W A;  1ZC3 B;  5J3T A;  3CIK A;  2L1C A;  2I1J A;  1I7A A;  1WGU A;  1XCG A;  2HE7 A;  4HAW B;  1BTN A;  1OQN A;  2DHI A;  2IYB A;  2Z0O A;  1V89 A;  4L6E A;  4ZRI A;  5JLJ B;  1H4R A;  1FAO A;  3QWM A;  3ULB A;  1Y19 B;  3D8E A;  1XOD A;  1V5P A;  1NTY A;  3AU4 A;  3F0W A;  2D9Y A;  5HE2 A;  5DI9 B;  1X86 A;  2D9W A;  3ODX A;  3HK0 A;  1LW3 A;  5JHG A;  1P5T A;  4B6H A;  5C16 A;  1V5U A;  1P3R A;  1X11 A;  1Z87 A;  5FI1 A;  3NSU A;  4WVF B;  2K00 A;  4WJ7 A;  2VSZ A;  1V5M A;  4MT7 A;  2GS0 A;  4K81 A;  2ADZ A;  5HE0 A;  3V5W A;  2H7E A;  2RNR B;  2AL6 A;  4F7H A;  2LKO A;  1LB1 A;  1TQZ A;  2AEH A;  2HTH B;  5KCV A;  1SHC A;  1EGX A;  4NSW A;  1OY2 A;  4HB4 B;  4MY6 A;  4EJN A;  2DHJ A;  3SO6 A;  4H8S A;  4HB2 B;  2JP2 A;  3MPX A;  2D2Q A;  3ULC A;  1QC6 A;  3GYP A;  1WJM A;  2COD A;  2DLW A;  2Y8F A;  3AU5 A;  5CLL B;  3WYF B;  2M14 A;  5D27 A;  3BJI A;  4HAV B;  3DXE A;  1GC7 A;  2CRF A;  2J0M A;  5JHH A;  5EFX A;  2NZ8 B;  3OAN A;  4HB0 B;  2DX5 A;  5D3X A;  2EMS A;  2DKQ A;  1ZC4 B;  4TYZ A;  1U5D A;  2RLO A;  4A6F A;  4KHB B;  5KQ4 A;  1K5D B;  5L81 A;  1BAK A;  5HE1 A;  4D0N B;  1DDM A;  1U2B A;  1TJ6 A;  3QIJ A;  1XX0 A;  1MIX A;  3U8Z A;  2D9X A;  1Q67 A;  4ZRJ A;  1QQG A;  2DHK A;  1NU2 A;  1V88 A;  4A6F B;  2LOX A;  4NY0 A;  4HAX B;  4A6K A;  2GCJ A;  3A98 B;  2OTX A;  1X1G A;  5D3V A;  3U7D A;  3AJ4 A;  3TVV A;  5D3Y A;  4KHA A;  4A5K A;  4HAU B;  3D8D A;  1KZ7 A;  5DIF B;  2W2X D;  1NTV A;  3PSC A;  1UPQ A;  1MKE A;  2DTC A;  2W2W A;  1PMS A;  2J0K A;  5DHA B;  5JP4 A;  4DXA B;  1WGQ A;  2COA A;  1DDW A;  2KCJ A;  3TCA A;  4DX8 A;  2D9Z A;  2RGN B;  3PEG A;  3SYX A;  1RRP B;  5LON B;  5KQ1 A;  3TFM A;  1EF1 A;  2N0Y A;  1XR0 B;  2I5F A;  1UPR A;  2GJY A;  4HAT B;  2ROZ B;  2UVM A;  2D10 A;  2DN6 A;  2R0D A;  1GC6 A;  1ISN A;  3ML4 A;  1OMW A;  2X18 A;  2P8V A;  4CYE A;  1MAI A;  2ELB A;  3KRW A;  1PFJ A;  2VKI A;  3PZD A;  4DX9 0;  2UZS A;  1GG3 A;  1ZSQ A;  2COC A;  3MDB C;  1M7E A;  2DFK A;  4C0A A;  4CHM A;  4YL8 A;  2I1K A;  2D4Q A;  4Z2N A;  4K17 A;  3CXB B;  2DA0 A;  4EKU A;  3HW2 B;  4KHO A;  2YRY A;  3IVF A;  2ROV A;  5LOP B;  2CY4 A;  2D11 A;  1MK9 B;  3SUZ A;  2DYN A;  5C5B B;  1U27 A;  4HB3 B;  3PVU A;  2FJL A;  2J59 M;  3PVW A;  1U29 A;  3VIA A;  1M7R A;  3ZVR A;  5J3Y A;  4HHV A;  4F7G A;  2PZ1 A;  4IFS A;  4XWX A;  1V61 A;  1FHO A;  3SV1 A;  2YF0 A;  4HAZ B;  4F7U P;  3SNH A;  2XQN M;  1RJ2 A;  4A6H A;  1X05 A;  3D8F A;  4IAP A;  2VRW B;  4GN1 A;  2LOZ A;  4TKN A;  3P6A A;  3ODO A;  1XKE A;  3KRX A;  1BTK A;  3M1I B;  2COF A;  2MWN B;  2GCL A;  3O96 A;  2N23 A;  3A8Q A;  2W2X C;  3DXD A;  2NMB A;  1FGZ A;  2YT0 A;  2RUK B;  2CAY A;  4GPT B;  1IRS A;  4K2P A;  1W1H A;  4WSF A;  1AQC A;  2EC1 A;  5DH9 B;  3ZDT A;  1UNR A;  1FHX A;  1E5W A;  1J0W A;  3KSY A;  3BIN A;  1TXD A;  4P7I A;  2UZR A;  3LJU X;  2Q13 A;  1WG7 A;  2YSZ A;  1UEF A;  5HE3 A;  2EJ8 A;  2YS5 A;  2LYD A;  2QKL A;  4MK0 A;  1U5F A;  4PNK A;  3TW1 A;  3PVL A;  1SGH A;  2ELA A;  4KAX B;  1ZVR A;  2MKR A;  2R09 A;  4K2O A;  1WI1 A;  4HDO A;  2DYQ A;  2EMT A;  4CHJ A;  1U5E A;  2YS1 A;  3A8P A;  2LG1 A;  2YS3 A;  1DYN A;  3TO1 A;  1BWN A;  3ODW A;  4HDQ A;  2Y7B A;  1DBH A;  2ZPY A;  1WVH A;  1FB8 A;  2KGX B;  2J0J A;  4GMX B;  1UNQ A;  1I2H A;  1H10 A;  2K2J A;  4KVG B;  4GZU A;  4IOY X;  1XD4 A;  3FM8 C;  4Y94 A;  5C5B A;  1DRO A;  2G35 A;  4YON A;  3G9W A;  3P7Z A;  4DBB A;  1KI1 B;  2KUP A;  3PG7 A;  3X23 A;  3KZ1 A;  1X1F A;  4GMV A;  2Z0P A;  3PP2 A;  3VOQ A;  2Y8G A;  2BCJ A;  5GOW B;  2RVB B;  5CLQ B;  3HQC A;  1KZG A;  1FGY A;  2IFS A;  2I5C A;  2L2I A;  2YT1 A;  1U5G A;  2OQB A;  1Y5O A;  4GXB A;  2MDX A;  3QBV B;  2V76 A;  1AWE A;  3DXC A;  2E2X A;  3F5R A;  5C6R A; 
#chains in the Genus database with same CATH topology
 2YVC A;  3WA0 A;  1DDV A;  1ZM0 A;  5FI0 A;  1MPH A;  4Z2M B;  1W1D A;  1WJ1 A;  4EMO A;  2RSG A;  5J3Q A;  2DX1 A;  2MFQ A;  3N7C A;  2QKM A;  3RCP A;  2LUL A;  3T06 A;  2P0D A;  3KY9 A;  2GUM A;  2M38 A;  5C79 A;  1W1G A;  2CY5 A;  2H7D A;  2K2U A;  3UZT A;  2Z0Q A;  1EVH A;  1UNP A;  4HSI A;  4HAY B;  4ZRK A;  1PLS A;  3FVC A;  1N3H A;  1P6S A;  2P0H A;  4PQ0 A;  2D9V A;  1B55 A;  4BBK A;  2KR0 A;  3GYO A;  3FSS A;  1FHW A;  2DKP A;  1FOE A;  3FEH A;  5DHF B;  1K5G B;  1NI2 A;  1EAZ A;  1MIZ B;  1MK7 B;  1J19 A;  2P0F A;  5D3W A;  1ZC3 B;  5J3T A;  3CIK A;  2L1C A;  2I1J A;  1I7A A;  1WGU A;  1XCG A;  2HE7 A;  4HAW B;  1BTN A;  1MI1 A;  1OQN A;  2DHI A;  2IYB A;  5LG4 B;  2Z0O A;  2Z59 A;  1V89 A;  4L6E A;  4ZRI A;  5JLJ B;  1H4R A;  1FAO A;  3QWM A;  3ULB A;  1Y19 B;  3D8E A;  1XOD A;  1V5P A;  1NTY A;  3AU4 A;  3F0W A;  4CSQ A;  2D9Y A;  5HE2 A;  5DI9 B;  1X86 A;  2D9W A;  3ODX A;  4GNK B;  3HK0 A;  1LW3 A;  5JHG A;  2KIG A;  4QJ3 B;  3HSA A;  1P5T A;  4B6H A;  5C16 A;  1V5U A;  1P3R A;  1X11 A;  1Z87 A;  5FI1 A;  3NSU A;  4DIX A;  4WVF B;  2K00 A;  4WJ7 A;  2VSZ A;  1V5M A;  4MT7 A;  2GS0 A;  4K81 A;  2ADZ A;  5HE0 A;  3V5W A;  2NBV A;  2Z14 A;  2H7E A;  2RNR B;  2AL6 A;  4F7H A;  2LKO A;  1LB1 A;  1TQZ A;  2AEH A;  2HTH B;  5KCV A;  3U12 A;  1SHC A;  1EGX A;  4D6W A;  4NSW A;  1OY2 A;  4HB4 B;  4MY6 A;  4EJN A;  2K8E A;  2DHJ A;  3SO6 A;  4H8S A;  4L1R A;  4HB2 B;  2JP2 A;  3MPX A;  2D2Q A;  3ULC A;  1QC6 A;  3GYP A;  1WJM A;  2COD A;  2DLW A;  2Y8F A;  3AU5 A;  1ZYI A;  5CLL B;  3WYF B;  2M14 A;  3OHM B;  5D27 A;  3BJI A;  4HAV B;  3DXE A;  1GC7 A;  4KHB A;  2CRF A;  2J0M A;  5JHH A;  5EFX A;  3HIE A;  2NZ8 B;  3OAN A;  4HB0 B;  2DX5 A;  5D3X A;  2EMS A;  2DKQ A;  1ZC4 B;  4TYZ A;  1U5D A;  2RLO A;  4A6F A;  5I2S A;  4KHB B;  5KQ4 A;  1K5D B;  5I2M A;  5L81 A;  1BAK A;  5HE1 A;  4D0N B;  1DDM A;  1U2B A;  1TJ6 A;  3QIJ A;  1XX0 A;  1MIX A;  3U8Z A;  2D9X A;  1Q67 A;  4ZRJ A;  1QQG A;  2DHK A;  1NU2 A;  1V88 A;  4A6F B;  2LOX A;  4NY0 A;  4HAX B;  4A6K A;  2R2Y A;  2GCJ A;  4OT1 A;  3A98 B;  2OTX A;  1X1G A;  5D3V A;  3U7D A;  3AJ4 A;  3TVV A;  5D3Y A;  4KHA A;  4A5K A;  4HAU B;  3D8D A;  1KZ7 A;  5DIF B;  2W2X D;  1NTV A;  3PSC A;  3B77 A;  1UPQ A;  1MKE A;  2DTC A;  2W2W A;  1PMS A;  2J0K A;  5DHA B;  5JP4 A;  4DXA B;  1WGQ A;  2COA A;  1DDW A;  2KCJ A;  3TCA A;  4DX8 A;  2D9Z A;  2RGN B;  3DCX A;  3PEG A;  3SYX A;  1RRP B;  5LON B;  5KQ1 A;  3TFM A;  1EF1 A;  2N0Y A;  1XR0 B;  2I5F A;  1UPR A;  2GJY A;  4HAT B;  2ROZ B;  2UVM A;  2D10 A;  2DN6 A;  2R0D A;  2KIE A;  1GC6 A;  1ISN A;  3ML4 A;  1OMW A;  2X18 A;  2P8V A;  4CYE A;  1MAI A;  2ELB A;  3KRW A;  1PFJ A;  2VKI A;  3PZD A;  4DX9 0;  2UZS A;  2RRF A;  1GG3 A;  1ZSQ A;  4OSN A;  2COC A;  3MDB C;  1M7E A;  2DFK A;  4QXA B;  4C0A A;  4CHM A;  4YL8 A;  1T77 A;  2I1K A;  2D4Q A;  4Z2N A;  4K17 A;  3CXB B;  2DA0 A;  4EKU A;  3HW2 B;  4KHO A;  5IRS A;  2YRY A;  3IVF A;  2ROV A;  2Z13 A;  5LOP B;  2CY4 A;  2D11 A;  1MK9 B;  3SUZ A;  2DYN A;  5C5B B;  1U27 A;  4HB3 B;  3PVU A;  2FJL A;  2J59 M;  3PVW A;  1U29 A;  3VIA A;  1M7R A;  3ZVR A;  5J3Y A;  4HHV A;  4F7G A;  2PZ1 A;  4IFS A;  4XWX A;  1V61 A;  1FHO A;  3SV1 A;  2YF0 A;  4HAZ B;  4F7U P;  3SNH A;  3A58 A;  2XQN M;  1RJ2 A;  4A6H A;  1X05 A;  3D8F A;  4IAP A;  2VRW B;  4GN1 A;  2LOZ A;  4TKN A;  3P6A A;  3ODO A;  1XKE A;  3KRX A;  1BTK A;  3M1I B;  2COF A;  2MWN B;  2GCL A;  3O96 A;  2N23 A;  3A8Q A;  2W2X C;  3NWF A;  3DXD A;  2NMB A;  1FGZ A;  2YT0 A;  2RUK B;  2CAY A;  4GPT B;  1IRS A;  4K2P A;  1W1H A;  4WSF A;  1AQC A;  2EC1 A;  5DH9 B;  3ZDT A;  1UNR A;  1FHX A;  1E5W A;  1J0W A;  3KSY A;  3BIN A;  1TXD A;  4P7I A;  4GOU A;  2UZR A;  3LJU X;  2Q13 A;  1WG7 A;  2YSZ A;  1UEF A;  5HE3 A;  2EJ8 A;  2YS5 A;  2LYD A;  2QKL A;  4MK0 A;  1U5F A;  4PNK A;  3TW1 A;  2Z4D A;  3PVL A;  1SGH A;  2ELA A;  4KAX B;  5M4Y B;  1ZVR A;  2MKR A;  2R09 A;  2ZKM X;  4K2O A;  1WI1 A;  4HDO A;  2DYQ A;  2EMT A;  4CHJ A;  1U5E A;  2YS1 A;  3A8P A;  2LG1 A;  2YS3 A;  1DYN A;  3TO1 A;  1BWN A;  3NWD A;  3ODW A;  4HDQ A;  2Y7B A;  1DBH A;  2ZPY A;  1WVH A;  2K49 A;  1FB8 A;  2KGX B;  2J0J A;  4GMX B;  1UNQ A;  1I2H A;  1H10 A;  2K2J A;  4KVG B;  4GZU A;  4IOY X;  2FJU B;  1XD4 A;  3FM8 C;  4Y94 A;  2YT2 A;  4QJ5 B;  5C5B A;  1DRO A;  2G35 A;  4YON A;  3G9W A;  3P7Z A;  4DBB A;  1KI1 B;  2KUP A;  3PG7 A;  3X23 A;  3KZ1 A;  1X1F A;  4GMV A;  2Z0P A;  3PP2 A;  3VOQ A;  4QJ4 B;  2Y8G A;  2KUQ A;  2BCJ A;  5GOW B;  2RVB B;  5CLQ B;  3HQC A;  1KZG A;  1FGY A;  2IFS A;  2I5C A;  2L2I A;  2YT1 A;  1U5G A;  2OQB A;  1Y5O A;  3NW8 A;  4GXB A;  2MDX A;  3QBV B;  2V76 A;  3NWA A;  1AWE A;  3DXC A;  2E2X A;  3F5R A;  5C6R A; 
#chains in the Genus database with same CATH homology
 2YVC A;  3WA0 A;  1DDV A;  1ZM0 A;  5FI0 A;  1MPH A;  4Z2M B;  1W1D A;  1WJ1 A;  4EMO A;  2RSG A;  5J3Q A;  2DX1 A;  2MFQ A;  3N7C A;  2QKM A;  3RCP A;  2LUL A;  3T06 A;  2P0D A;  3KY9 A;  2M38 A;  5C79 A;  1W1G A;  2CY5 A;  2H7D A;  2K2U A;  3UZT A;  2Z0Q A;  1EVH A;  1UNP A;  4HAY B;  4ZRK A;  1PLS A;  1N3H A;  1P6S A;  2P0H A;  4PQ0 A;  2D9V A;  1B55 A;  4BBK A;  3GYO A;  3FSS A;  1FHW A;  2DKP A;  1FOE A;  3FEH A;  5DHF B;  1K5G B;  1NI2 A;  1EAZ A;  1MIZ B;  1MK7 B;  1J19 A;  2P0F A;  5D3W A;  1ZC3 B;  5J3T A;  3CIK A;  2L1C A;  2I1J A;  1I7A A;  1WGU A;  1XCG A;  2HE7 A;  4HAW B;  1BTN A;  1OQN A;  2DHI A;  2IYB A;  2Z0O A;  1V89 A;  4L6E A;  4ZRI A;  5JLJ B;  1H4R A;  1FAO A;  3QWM A;  3ULB A;  1Y19 B;  3D8E A;  1XOD A;  1V5P A;  1NTY A;  3AU4 A;  3F0W A;  2D9Y A;  5HE2 A;  5DI9 B;  1X86 A;  2D9W A;  3ODX A;  3HK0 A;  1LW3 A;  5JHG A;  1P5T A;  4B6H A;  5C16 A;  1V5U A;  1P3R A;  1X11 A;  1Z87 A;  5FI1 A;  3NSU A;  4WVF B;  2K00 A;  4WJ7 A;  2VSZ A;  1V5M A;  4MT7 A;  2GS0 A;  4K81 A;  2ADZ A;  5HE0 A;  3V5W A;  2H7E A;  2RNR B;  2AL6 A;  4F7H A;  2LKO A;  1LB1 A;  1TQZ A;  2AEH A;  2HTH B;  5KCV A;  1SHC A;  1EGX A;  4NSW A;  1OY2 A;  4HB4 B;  4MY6 A;  4EJN A;  2DHJ A;  3SO6 A;  4H8S A;  4HB2 B;  2JP2 A;  3MPX A;  2D2Q A;  3ULC A;  1QC6 A;  3GYP A;  1WJM A;  2COD A;  2DLW A;  2Y8F A;  3AU5 A;  5CLL B;  3WYF B;  2M14 A;  5D27 A;  3BJI A;  4HAV B;  3DXE A;  1GC7 A;  2CRF A;  2J0M A;  5JHH A;  5EFX A;  2NZ8 B;  3OAN A;  4HB0 B;  2DX5 A;  5D3X A;  2EMS A;  2DKQ A;  1ZC4 B;  4TYZ A;  1U5D A;  2RLO A;  4A6F A;  4KHB B;  5KQ4 A;  1K5D B;  5L81 A;  1BAK A;  5HE1 A;  4D0N B;  1DDM A;  1U2B A;  1TJ6 A;  3QIJ A;  1XX0 A;  1MIX A;  3U8Z A;  2D9X A;  1Q67 A;  4ZRJ A;  1QQG A;  2DHK A;  1NU2 A;  1V88 A;  4A6F B;  2LOX A;  4NY0 A;  4HAX B;  4A6K A;  2GCJ A;  3A98 B;  2OTX A;  1X1G A;  5D3V A;  3U7D A;  3AJ4 A;  3TVV A;  5D3Y A;  4KHA A;  4A5K A;  4HAU B;  3D8D A;  1KZ7 A;  5DIF B;  2W2X D;  1NTV A;  3PSC A;  1UPQ A;  1MKE A;  2DTC A;  2W2W A;  1PMS A;  2J0K A;  5DHA B;  5JP4 A;  4DXA B;  1WGQ A;  2COA A;  1DDW A;  2KCJ A;  3TCA A;  4DX8 A;  2D9Z A;  2RGN B;  3PEG A;  3SYX A;  1RRP B;  5LON B;  5KQ1 A;  3TFM A;  1EF1 A;  2N0Y A;  1XR0 B;  2I5F A;  1UPR A;  2GJY A;  4HAT B;  2ROZ B;  2UVM A;  2D10 A;  2DN6 A;  2R0D A;  1GC6 A;  1ISN A;  3ML4 A;  1OMW A;  2X18 A;  2P8V A;  4CYE A;  1MAI A;  2ELB A;  3KRW A;  1PFJ A;  2VKI A;  3PZD A;  4DX9 0;  2UZS A;  1GG3 A;  1ZSQ A;  2COC A;  3MDB C;  1M7E A;  2DFK A;  4C0A A;  4CHM A;  4YL8 A;  2I1K A;  2D4Q A;  4Z2N A;  4K17 A;  3CXB B;  2DA0 A;  4EKU A;  3HW2 B;  4KHO A;  2YRY A;  3IVF A;  2ROV A;  5LOP B;  2CY4 A;  2D11 A;  1MK9 B;  3SUZ A;  2DYN A;  5C5B B;  1U27 A;  4HB3 B;  3PVU A;  2FJL A;  2J59 M;  3PVW A;  1U29 A;  3VIA A;  1M7R A;  3ZVR A;  5J3Y A;  4HHV A;  4F7G A;  2PZ1 A;  4IFS A;  4XWX A;  1V61 A;  1FHO A;  3SV1 A;  2YF0 A;  4HAZ B;  4F7U P;  3SNH A;  2XQN M;  1RJ2 A;  4A6H A;  1X05 A;  3D8F A;  4IAP A;  2VRW B;  4GN1 A;  2LOZ A;  4TKN A;  3P6A A;  3ODO A;  1XKE A;  3KRX A;  1BTK A;  3M1I B;  2COF A;  2MWN B;  2GCL A;  3O96 A;  2N23 A;  3A8Q A;  2W2X C;  3DXD A;  2NMB A;  1FGZ A;  2YT0 A;  2RUK B;  2CAY A;  4GPT B;  1IRS A;  4K2P A;  1W1H A;  4WSF A;  1AQC A;  2EC1 A;  5DH9 B;  3ZDT A;  1UNR A;  1FHX A;  1E5W A;  1J0W A;  3KSY A;  3BIN A;  1TXD A;  4P7I A;  2UZR A;  3LJU X;  2Q13 A;  1WG7 A;  2YSZ A;  1UEF A;  5HE3 A;  2EJ8 A;  2YS5 A;  2LYD A;  2QKL A;  4MK0 A;  1U5F A;  4PNK A;  3TW1 A;  3PVL A;  1SGH A;  2ELA A;  4KAX B;  1ZVR A;  2MKR A;  2R09 A;  4K2O A;  1WI1 A;  4HDO A;  2DYQ A;  2EMT A;  4CHJ A;  1U5E A;  2YS1 A;  3A8P A;  2LG1 A;  2YS3 A;  1DYN A;  3TO1 A;  1BWN A;  3ODW A;  4HDQ A;  2Y7B A;  1DBH A;  2ZPY A;  1WVH A;  1FB8 A;  2KGX B;  2J0J A;  4GMX B;  1UNQ A;  1I2H A;  1H10 A;  2K2J A;  4KVG B;  4GZU A;  4IOY X;  1XD4 A;  3FM8 C;  4Y94 A;  5C5B A;  1DRO A;  2G35 A;  4YON A;  3G9W A;  3P7Z A;  4DBB A;  1KI1 B;  2KUP A;  3PG7 A;  3X23 A;  3KZ1 A;  1X1F A;  4GMV A;  2Z0P A;  3PP2 A;  3VOQ A;  2Y8G A;  2BCJ A;  5GOW B;  2RVB B;  5CLQ B;  3HQC A;  1KZG A;  1FGY A;  2IFS A;  2I5C A;  2L2I A;  2YT1 A;  1U5G A;  2OQB A;  1Y5O A;  4GXB A;  2MDX A;  3QBV B;  2V76 A;  1AWE A;  3DXC A;  2E2X A;  3F5R A;  5C6R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...