1U5GA

Crystal structure of the ph domain of skap-hom
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
115
structure length
115
Chain Sequence
b'QFPPIAAQDLPFVIKAGYLEKRRKDHSFLGFEWQKRWCALSKTVFYYYGSDKDKQQKGEFAIDGYDVRMNNTLRKDGKKDCCFEICAPDKRIYQFTAASPKDAEEWVQQLKFILQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Src-associated adaptor protein
publication title The Skap-hom dimerization and PH domains comprise a 3'-phosphoinositide-gated molecular switch.
pubmed doi rcsb
source organism Mus musculus
molecule tags Signaling protein
total genus 26
structure length 115
sequence length 115
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2004-07-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00169 PH PH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 1u5gA01
4IAPA 5HE0A 2GCLA 2YVCA 1Z87A 4EMOA 2YS1A 4WVFB 2MKRA 2P8VA 5JP4A 2OQBA 2KUPA 1WG7A 3TCAA 3SYXA 3ODXA 5J3QA 1WJ1A 4K2PA 4HB2B 2D2QA 1V61A 1N3HA 1J0WA 4F7GA 3A8PA 5EFXA 2M14A 3D8FA 5DH9B 1X05A 1Y19B 2YSZA 4HDQA 3CIKA 2LG1A 4ZRJA 2UZSA 1KZGA 2L2IA 1OQNA 2H7EA 3TVVA 4BBKA 3MPXA 3PVUA 3KSYA 1RJ2A 1X11A 2Y8GA 3FEHA 2Z0PA 1WGQA 4HB3B 4NY0A 2R0DA 2QKLA 4DBBA 4A6FB 2I1JA 3SNHA 1ZM0A 1U27A 5DHAB 4A6KA 4YL8A 3DXDA 3KZ1A 3KRXA 3D8DA 3FM8C 1U5DA 1NTYA 2D9ZA 1FAOA 3RCPA 2IFSA 4KVGB 1SHCA 1PLSA 1U2BA 1QQGA 5JHHA 1UPQA 3ZDTA 2HE7A 3DXEA 4DX8A 1AWEA 2J0MA 5DIFB 1MPHA 1DYNA 1DDWA 2EMSA 4GXBA 5JHGA 1I2HA 2ELAA 1KI1B 3BINA 2KCJA 4XWXA 2QKMA 4HDOA 2X18A 2D9WA 2RNRB 4F7HA 3HK0A 2J0JA 1DDMA 2P0FA 1E5WA 2HTHB 3D8EA 4WJ7A 4HATB 5D27A 4MY6A 1UPRA 2W2XC 4P7IA 1GC6A 1UNRA 2W2XD 3A98B 2ZPYA 4KHOA 3IVFA 4HB0B 5FI0A 1H10A 5CLQB 3LJUX 1K5DB 1LB1A 1X86A 1V88A 3AU5A 1IRSA 5HE2A 3ODOA 4GMVA 5DHFB 3QWMA 2Z0QA 2ELBA 4GZUA 1MAIA 3F0WA 3PG7A 1EAZA 5D3YA 2ADZA 3WA0A 2I5FA 4EKUA 2DYQA 1ZSQA 4IOYX 1XKEA 3ZVRA 5C6RA 2Z0OA 4NSWA 1X1GA 2AL6A 2MDXA 3M1IB 5C5BB 1H4RA 1TJ6A 2W2WA 1Y5OA 4HAVB 5C16A 2RLOA 4KHBB 4K2OA 4HAXB 2CY5A 3VIAA 2COFA 1FHOA 1BAKA 1J19A 4HHVA 3NSUA 3PVLA 1XR0B 2DHIA 1LW3A 1DDVA 5FI1A 1OMWA 5JLJB 3U7DA 4L6EA 1OY2A 1U29A 4KHAA 1MK7B 2EJ8A 4TYZA 2L1CA 4CHJA 4HAYB 2GS0A 5KCVA 4Z2NA 1FHXA 1PFJA 1W1HA 3DXCA 2LULA 5LONB 3T06A 2OTXA 1EF1A 1FOEA 2JP2A 4GN1A 2CODA 5CLLB 5J3TA 4DXAB 4YONA 1Q67A 2DHJA 2J59M 1UNQA 2KGXB 1ZC4B 3P7ZA 5KQ1A 1WJMA 2ROZB 1M7RA 1TQZA 4Y94A 5D3WA 1MIXA 2M38A 1V5MA 4B6HA 1NU2A 2YF0A 3TFMA 1SGHA 1XD4A 1W1DA 2COCA 3MDBC 5D3VA 1WGUA 1V5PA 2Y7BA 1ZVRA 3TW1A 2DN6A 3ULCA 2I5CA 3OANA 1PMSA 3BJIA 2H7DA 2YRYA 3GYPA 3N7CA 2D10A 2DYNA 4EJNA 3AU4A 3PVWA 2P0HA 2LOXA 2GJYA 1XODA 2RVBB 3CXBB 4GMXB 1XCGA 2RUKB 1ISNA 3SUZA 3HQCA 2FJLA 1MK9B 3QBVB 3PSCA 1P6SA 3QIJA 1ZC3B 1BTNA 2DFKA 2XQNM 4DX90 5LOPB 1QC6A 4K81A 2D9VA 2RSGA 1MKEA 2VSZA 2D9XA 2VRWB 2BCJA 2D11A 2K00A 2CRFA 2Q13A 4TKNA 2D9YA 2IYBA 4A5KA 1EVHA 3A8QA 5GOWB 3WYFB 2N23A 1BWNA 2RGNB 4WSFA 1DROA 4ZRIA 1NTVA 2EMTA 4F7UP 2LOZA 2J0KA 2EC1A 5KQ4A 2G35A 2YS5A 3KY9A 5HE3A 4GPTB 2AEHA 4HAZB 3SO6A 1KZ7A 2NMBA 5J3YA 4MT7A 1FGYA 4MK0A 2DTCA 1DBHA 3F5RA 3P6AA 3PZDA 1BTKA 3O96A 4HAUB 4D0NB 2YT1A 2D4QA 2P0DA 2CAYA 5C79A 3ODWA 2N0YA 2R09A 3ULBA 4A6FA 3AJ4A 1RRPB 1P3RA 2VKIA 5HE1A 4H8SA 1GG3A 5D3XA 1XX0A 2ROVA 1FHWA 3FSSA 5L81A 2K2UA 2K2JA 2NZ8B 2MFQA 1AQCA 2UVMA 2GCJA 4HB4B 2V76A 1U5GA 2LKOA 2DX1A 1UNPA 3U8ZA 1NI2A 3UZTA 1V5UA 2YS3A 4ZRKA 1MIZB 3G9WA 4PNKA 1U5FA 1FGZA 4K17A 2YT0A 3HW2B 1B55A 2MWNB 1W1GA 4IFSA 4Z2MB 4CHMA 1TXDA 1WI1A 4CYEA 2DLWA 1U5EA 2E2XA 3VOQA 1GC7A 1I7AA 2UZRA 3SV1A 1M7EA 4C0AA 1UEFA 3TO1A 2LYDA 2COAA 2DHKA 3GYOA 2DA0A 3PEGA 3X23A 3KRWA 1V89A 5DI9B 2DKQA 3PP2A 2PZ1A 3ML4A 1P5TA 1X1FA 4PQ0A 1EGXA 4KAXB 5C5BA 4A6HA 4HAWB 2DX5A 2DKPA 2CY4A 1K5GB 1FB8A 1WVHA 2Y8FA 2I1KA 3V5WA
chains in the Genus database with same CATH superfamily
4IAPA 5HE0A 2GCLA 2RRFA 2YVCA 1Z87A 5IRSA 4EMOA 2YS1A 4WVFB 2MKRA 2P8VA 5JP4A 2OQBA 2KUPA 1WG7A 3TCAA 3SYXA 3ODXA 5J3QA 1WJ1A 4K2PA 4HB2B 2D2QA 1V61A 1N3HA 1J0WA 4F7GA 3A8PA 5EFXA 2M14A 3D8FA 5DH9B 1X05A 1Y19B 2YSZA 4HDQA 3CIKA 2LG1A 4ZRJA 2UZSA 1T77A 1KZGA 2L2IA 1OQNA 2H7EA 3TVVA 4BBKA 3MPXA 2Z13A 3PVUA 3KSYA 4QXAB 1RJ2A 1X11A 2Y8GA 3FEHA 2Z0PA 1WGQA 4HB3B 4NY0A 2R0DA 2QKLA 4DBBA 4OSNA 4A6FB 2I1JA 3SNHA 1ZM0A 2K49A 1U27A 5DHAB 4A6KA 4YL8A 3DXDA 3KZ1A 3KRXA 3D8DA 3FM8C 1U5DA 1NTYA 2D9ZA 2Z14A 1FAOA 3RCPA 2IFSA 2YT2A 4KVGB 1SHCA 1PLSA 1U2BA 1QQGA 5JHHA 2R2YA 1UPQA 3ZDTA 2HE7A 3DXEA 4DX8A 1AWEA 2J0MA 5DIFB 1MPHA 1DYNA 1DDWA 2EMSA 4GXBA 5JHGA 1I2HA 2ELAA 1KI1B 3BINA 2KCJA 4XWXA 4HSIA 2QKMA 2K8EA 4HDOA 2X18A 2D9WA 2RNRB 4F7HA 3HK0A 2Z59A 4QJ3B 2J0JA 1DDMA 2P0FA 1E5WA 2HTHB 3NW8A 3D8EA 4WJ7A 3NWFA 4HATB 5D27A 2GUMA 4MY6A 1UPRA 2W2XC 4P7IA 1GC6A 1UNRA 2W2XD 3A98B 2ZPYA 4KHOA 3IVFA 4HB0B 5FI0A 1H10A 5CLQB 3LJUX 1K5DB 1LB1A 1X86A 1V88A 3AU5A 1IRSA 5HE2A 3ODOA 4GMVA 5DHFB 3QWMA 2Z0QA 2ELBA 4GZUA 1MAIA 3F0WA 3PG7A 1EAZA 5D3YA 2ADZA 3WA0A 2I5FA 4EKUA 2DYQA 4GOUA 1ZSQA 4IOYX 1XKEA 3ZVRA 5C6RA 2Z0OA 3B77A 4NSWA 1X1GA 2AL6A 2MDXA 3M1IB 1ZYIA 5C5BB 1H4RA 1TJ6A 2W2WA 1Y5OA 4HAVB 5C16A 2RLOA 4KHBB 4K2OA 4HAXB 2CY5A 3VIAA 2COFA 1FHOA 1BAKA 1J19A 4HHVA 3NSUA 3PVLA 1XR0B 2NBVA 2DHIA 1LW3A 1DDVA 5FI1A 5I2MA 1OMWA 5JLJB 3U7DA 4L6EA 1OY2A 1U29A 4KHAA 1MK7B 2EJ8A 4TYZA 2KIGA 2L1CA 4CHJA 3HSAA 4HAYB 2GS0A 5KCVA 4Z2NA 1FHXA 3HIEA 1PFJA 1W1HA 3DXCA 2LULA 3FVCA 2KIEA 5LONB 3T06A 2OTXA 1EF1A 1FOEA 2JP2A 4GN1A 2CODA 5CLLB 5J3TA 4DXAB 4YONA 1Q67A 1MI1A 2DHJA 2J59M 1UNQA 2KGXB 1ZC4B 3P7ZA 5KQ1A 1WJMA 2ROZB 1M7RA 1TQZA 4Y94A 5D3WA 1MIXA 2M38A 1V5MA 4B6HA 1NU2A 4QJ4B 2YF0A 3TFMA 1SGHA 1XD4A 1W1DA 2COCA 3MDBC 5D3VA 1WGUA 1V5PA 2Y7BA 1ZVRA 3TW1A 2KR0A 2DN6A 3ULCA 2I5CA 1PMSA 3BJIA 3OANA 3DCXA 2H7DA 2YRYA 3GYPA 3N7CA 2D10A 2DYNA 4EJNA 3AU4A 3PVWA 2P0HA 2LOXA 2GJYA 1XODA 2RVBB 3CXBB 4GMXB 1XCGA 2RUKB 1ISNA 3SUZA 3HQCA 2FJLA 1MK9B 3QBVB 3PSCA 1P6SA 3QIJA 1ZC3B 1BTNA 2DFKA 2XQNM 4DX90 5LOPB 1QC6A 4K81A 2D9VA 2RSGA 1MKEA 2VSZA 2D9XA 2VRWB 2BCJA 2D11A 2K00A 2CRFA 2Q13A 4TKNA 2D9YA 2IYBA 4A5KA 1EVHA 3A8QA 5GOWB 3WYFB 2N23A 1BWNA 2RGNB 4WSFA 1DROA 3OHMB 4ZRIA 1NTVA 3NWDA 5LG4B 2EMTA 4F7UP 2LOZA 2J0KA 2EC1A 5KQ4A 2G35A 2YS5A 3KY9A 5HE3A 4GPTB 2AEHA 4HAZB 3SO6A 1KZ7A 2NMBA 2Z4DA 5J3YA 4MT7A 1FGYA 4MK0A 2DTCA 1DBHA 5M4YB 3F5RA 3P6AA 3PZDA 1BTKA 3O96A 4HAUB 4D0NB 2YT1A 2D4QA 2P0DA 2CAYA 5C79A 3ODWA 2N0YA 2R09A 3ULBA 4A6FA 3NWAA 3AJ4A 1RRPB 1P3RA 2VKIA 5HE1A 4DIXA 4H8SA 1GG3A 5D3XA 1XX0A 2ROVA 1FHWA 3FSSA 4D6WA 5L81A 2K2UA 2K2JA 2NZ8B 2MFQA 1AQCA 2UVMA 2GCJA 4HB4B 3A58A 2V76A 1U5GA 2LKOA 2DX1A 1UNPA 3U12A 3U8ZA 1NI2A 3UZTA 1V5UA 2YS3A 4ZRKA 1MIZB 3G9WA 4OT1A 1U5FA 4PNKA 1FGZA 4K17A 2YT0A 2ZKMX 3HW2B 1B55A 2MWNB 1W1GA 2FJUB 4IFSA 4Z2MB 4CHMA 1TXDA 1WI1A 4CYEA 4L1RA 5I2SA 2DLWA 1U5EA 2E2XA 3VOQA 1GC7A 1I7AA 2UZRA 3SV1A 1M7EA 4C0AA 1UEFA 2KUQA 3TO1A 4CSQA 2LYDA 2COAA 2DHKA 3GYOA 2DA0A 3PEGA 3X23A 4QJ5B 3KRWA 1V89A 5DI9B 2DKQA 3PP2A 2PZ1A 3ML4A 1P5TA 1X1FA 4PQ0A 1EGXA 4KAXB 4GNKB 5C5BA 4A6HA 4HAWB 2DX5A 2DKPA 2CY4A 1K5GB 1FB8A 1WVHA 4KHBA 2Y8FA 2I1KA 3V5WA
chains in the Genus database with same CATH topology
4IAPA 5HE0A 2GCLA 2YVCA 1Z87A 4EMOA 2YS1A 4WVFB 2MKRA 2P8VA 5JP4A 2OQBA 2KUPA 1WG7A 3TCAA 3SYXA 3ODXA 5J3QA 1WJ1A 4K2PA 4HB2B 2D2QA 1V61A 1N3HA 1J0WA 4F7GA 3A8PA 5EFXA 2M14A 3D8FA 5DH9B 1X05A 1Y19B 2YSZA 4HDQA 3CIKA 2LG1A 4ZRJA 2UZSA 1KZGA 2L2IA 1OQNA 2H7EA 3TVVA 4BBKA 3MPXA 3PVUA 3KSYA 1RJ2A 1X11A 2Y8GA 3FEHA 2Z0PA 1WGQA 4HB3B 4NY0A 2R0DA 2QKLA 4DBBA 4A6FB 2I1JA 3SNHA 1ZM0A 1U27A 5DHAB 4A6KA 4YL8A 3DXDA 3KZ1A 3KRXA 3D8DA 3FM8C 1U5DA 1NTYA 2D9ZA 1FAOA 3RCPA 2IFSA 4KVGB 1SHCA 1PLSA 1U2BA 1QQGA 5JHHA 1UPQA 3ZDTA 2HE7A 3DXEA 4DX8A 1AWEA 2J0MA 5DIFB 1MPHA 1DYNA 1DDWA 2EMSA 4GXBA 5JHGA 1I2HA 2ELAA 1KI1B 3BINA 2KCJA 4XWXA 2QKMA 4HDOA 2X18A 2D9WA 2RNRB 4F7HA 3HK0A 2J0JA 1DDMA 2P0FA 1E5WA 2HTHB 3D8EA 4WJ7A 4HATB 5D27A 4MY6A 1UPRA 2W2XC 4P7IA 1GC6A 1UNRA 2W2XD 3A98B 2ZPYA 4KHOA 3IVFA 4HB0B 5FI0A 1H10A 5CLQB 3LJUX 1K5DB 1LB1A 1X86A 1V88A 3AU5A 1IRSA 5HE2A 3ODOA 4GMVA 5DHFB 3QWMA 2Z0QA 2ELBA 4GZUA 1MAIA 3F0WA 3PG7A 1EAZA 5D3YA 2ADZA 3WA0A 2I5FA 4EKUA 2DYQA 1ZSQA 4IOYX 1XKEA 3ZVRA 5C6RA 2Z0OA 4NSWA 1X1GA 2AL6A 2MDXA 3M1IB 5C5BB 1H4RA 1TJ6A 2W2WA 1Y5OA 4HAVB 5C16A 2RLOA 4KHBB 4K2OA 4HAXB 2CY5A 3VIAA 2COFA 1FHOA 1BAKA 1J19A 4HHVA 3NSUA 3PVLA 1XR0B 2DHIA 1LW3A 1DDVA 5FI1A 1OMWA 5JLJB 3U7DA 4L6EA 1OY2A 1U29A 4KHAA 1MK7B 2EJ8A 4TYZA 2L1CA 4CHJA 4HAYB 2GS0A 5KCVA 4Z2NA 1FHXA 1PFJA 1W1HA 3DXCA 2LULA 5LONB 3T06A 2OTXA 1EF1A 1FOEA 2JP2A 4GN1A 2CODA 5CLLB 5J3TA 4DXAB 4YONA 1Q67A 2DHJA 2J59M 1UNQA 2KGXB 1ZC4B 3P7ZA 5KQ1A 1WJMA 2ROZB 1M7RA 1TQZA 4Y94A 5D3WA 1MIXA 2M38A 1V5MA 4B6HA 1NU2A 2YF0A 3TFMA 1SGHA 1XD4A 1W1DA 2COCA 3MDBC 5D3VA 1WGUA 1V5PA 2Y7BA 1ZVRA 3TW1A 2DN6A 3ULCA 2I5CA 3OANA 1PMSA 3BJIA 2H7DA 2YRYA 3GYPA 3N7CA 2D10A 2DYNA 4EJNA 3AU4A 3PVWA 2P0HA 2LOXA 2GJYA 1XODA 2RVBB 3CXBB 4GMXB 1XCGA 2RUKB 1ISNA 3SUZA 3HQCA 2FJLA 1MK9B 3QBVB 3PSCA 1P6SA 3QIJA 1ZC3B 1BTNA 2DFKA 2XQNM 4DX90 5LOPB 1QC6A 4K81A 2D9VA 2RSGA 1MKEA 2VSZA 2D9XA 2VRWB 2BCJA 2D11A 2K00A 2CRFA 2Q13A 4TKNA 2D9YA 2IYBA 4A5KA 1EVHA 3A8QA 5GOWB 3WYFB 2N23A 1BWNA 2RGNB 4WSFA 1DROA 4ZRIA 1NTVA 2EMTA 4F7UP 2LOZA 2J0KA 2EC1A 5KQ4A 2G35A 2YS5A 3KY9A 5HE3A 4GPTB 2AEHA 4HAZB 3SO6A 1KZ7A 2NMBA 5J3YA 4MT7A 1FGYA 4MK0A 2DTCA 1DBHA 3F5RA 3P6AA 3PZDA 1BTKA 3O96A 4HAUB 4D0NB 2YT1A 2D4QA 2P0DA 2CAYA 5C79A 3ODWA 2N0YA 2R09A 3ULBA 4A6FA 3AJ4A 1RRPB 1P3RA 2VKIA 5HE1A 4H8SA 1GG3A 5D3XA 1XX0A 2ROVA 1FHWA 3FSSA 5L81A 2K2UA 2K2JA 2NZ8B 2MFQA 1AQCA 2UVMA 2GCJA 4HB4B 2V76A 1U5GA 2LKOA 2DX1A 1UNPA 3U8ZA 1NI2A 3UZTA 1V5UA 2YS3A 4ZRKA 1MIZB 3G9WA 4PNKA 1U5FA 1FGZA 4K17A 2YT0A 3HW2B 1B55A 2MWNB 1W1GA 4IFSA 4Z2MB 4CHMA 1TXDA 1WI1A 4CYEA 2DLWA 1U5EA 2E2XA 3VOQA 1GC7A 1I7AA 2UZRA 3SV1A 1M7EA 4C0AA 1UEFA 3TO1A 2LYDA 2COAA 2DHKA 3GYOA 2DA0A 3PEGA 3X23A 3KRWA 1V89A 5DI9B 2DKQA 3PP2A 2PZ1A 3ML4A 1P5TA 1X1FA 4PQ0A 1EGXA 4KAXB 5C5BA 4A6HA 4HAWB 2DX5A 2DKPA 2CY4A 1K5GB 1FB8A 1WVHA 2Y8FA 2I1KA 3V5WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IAP A;  5HE0 A;  2GCL A;  2YVC A;  1Z87 A;  4EMO A;  2YS1 A;  4WVF B;  2MKR A;  2P8V A;  5JP4 A;  2OQB A;  2KUP A;  1WG7 A;  3TCA A;  3SYX A;  3ODX A;  5J3Q A;  1WJ1 A;  4K2P A;  4HB2 B;  2D2Q A;  1V61 A;  1N3H A;  1J0W A;  4F7G A;  3A8P A;  5EFX A;  2M14 A;  3D8F A;  5DH9 B;  1X05 A;  1Y19 B;  2YSZ A;  4HDQ A;  3CIK A;  2LG1 A;  4ZRJ A;  2UZS A;  1KZG A;  2L2I A;  1OQN A;  2H7E A;  3TVV A;  4BBK A;  3MPX A;  3PVU A;  3KSY A;  1RJ2 A;  1X11 A;  2Y8G A;  3FEH A;  2Z0P A;  1WGQ A;  4HB3 B;  4NY0 A;  2R0D A;  2QKL A;  4DBB A;  4A6F B;  2I1J A;  3SNH A;  1ZM0 A;  1U27 A;  5DHA B;  4A6K A;  4YL8 A;  3DXD A;  3KZ1 A;  3KRX A;  3D8D A;  3FM8 C;  1U5D A;  1NTY A;  2D9Z A;  1FAO A;  3RCP A;  2IFS A;  4KVG B;  1SHC A;  1PLS A;  1U2B A;  1QQG A;  5JHH A;  1UPQ A;  3ZDT A;  2HE7 A;  3DXE A;  4DX8 A;  1AWE A;  2J0M A;  5DIF B;  1MPH A;  1DYN A;  1DDW A;  2EMS A;  4GXB A;  5JHG A;  1I2H A;  2ELA A;  1KI1 B;  3BIN A;  2KCJ A;  4XWX A;  2QKM A;  4HDO A;  2X18 A;  2D9W A;  2RNR B;  4F7H A;  3HK0 A;  2J0J A;  1DDM A;  2P0F A;  1E5W A;  2HTH B;  3D8E A;  4WJ7 A;  4HAT B;  5D27 A;  4MY6 A;  1UPR A;  2W2X C;  4P7I A;  1GC6 A;  1UNR A;  2W2X D;  3A98 B;  2ZPY A;  4KHO A;  3IVF A;  4HB0 B;  5FI0 A;  1H10 A;  5CLQ B;  3LJU X;  1K5D B;  1LB1 A;  1X86 A;  1V88 A;  3AU5 A;  1IRS A;  5HE2 A;  3ODO A;  4GMV A;  5DHF B;  3QWM A;  2Z0Q A;  2ELB A;  4GZU A;  1MAI A;  3F0W A;  3PG7 A;  1EAZ A;  5D3Y A;  2ADZ A;  3WA0 A;  2I5F A;  4EKU A;  2DYQ A;  1ZSQ A;  4IOY X;  1XKE A;  3ZVR A;  5C6R A;  2Z0O A;  4NSW A;  1X1G A;  2AL6 A;  2MDX A;  3M1I B;  5C5B B;  1H4R A;  1TJ6 A;  2W2W A;  1Y5O A;  4HAV B;  5C16 A;  2RLO A;  4KHB B;  4K2O A;  4HAX B;  2CY5 A;  3VIA A;  2COF A;  1FHO A;  1BAK A;  1J19 A;  4HHV A;  3NSU A;  3PVL A;  1XR0 B;  2DHI A;  1LW3 A;  1DDV A;  5FI1 A;  1OMW A;  5JLJ B;  3U7D A;  4L6E A;  1OY2 A;  1U29 A;  4KHA A;  1MK7 B;  2EJ8 A;  4TYZ A;  2L1C A;  4CHJ A;  4HAY B;  2GS0 A;  5KCV A;  4Z2N A;  1FHX A;  1PFJ A;  1W1H A;  3DXC A;  2LUL A;  5LON B;  3T06 A;  2OTX A;  1EF1 A;  1FOE A;  2JP2 A;  4GN1 A;  2COD A;  5CLL B;  5J3T A;  4DXA B;  4YON A;  1Q67 A;  2DHJ A;  2J59 M;  1UNQ A;  2KGX B;  1ZC4 B;  3P7Z A;  5KQ1 A;  1WJM A;  2ROZ B;  1M7R A;  1TQZ A;  4Y94 A;  5D3W A;  1MIX A;  2M38 A;  1V5M A;  4B6H A;  1NU2 A;  2YF0 A;  3TFM A;  1SGH A;  1XD4 A;  1W1D A;  2COC A;  3MDB C;  5D3V A;  1WGU A;  1V5P A;  2Y7B A;  1ZVR A;  3TW1 A;  2DN6 A;  3ULC A;  2I5C A;  3OAN A;  1PMS A;  3BJI A;  2H7D A;  2YRY A;  3GYP A;  3N7C A;  2D10 A;  2DYN A;  4EJN A;  3AU4 A;  3PVW A;  2P0H A;  2LOX A;  2GJY A;  1XOD A;  2RVB B;  3CXB B;  4GMX B;  1XCG A;  2RUK B;  1ISN A;  3SUZ A;  3HQC A;  2FJL A;  1MK9 B;  3QBV B;  3PSC A;  1P6S A;  3QIJ A;  1ZC3 B;  1BTN A;  2DFK A;  2XQN M;  4DX9 0;  5LOP B;  1QC6 A;  4K81 A;  2D9V A;  2RSG A;  1MKE A;  2VSZ A;  2D9X A;  2VRW B;  2BCJ A;  2D11 A;  2K00 A;  2CRF A;  2Q13 A;  4TKN A;  2D9Y A;  2IYB A;  4A5K A;  1EVH A;  3A8Q A;  5GOW B;  3WYF B;  2N23 A;  1BWN A;  2RGN B;  4WSF A;  1DRO A;  4ZRI A;  1NTV A;  2EMT A;  4F7U P;  2LOZ A;  2J0K A;  2EC1 A;  5KQ4 A;  2G35 A;  2YS5 A;  3KY9 A;  5HE3 A;  4GPT B;  2AEH A;  4HAZ B;  3SO6 A;  1KZ7 A;  2NMB A;  5J3Y A;  4MT7 A;  1FGY A;  4MK0 A;  2DTC A;  1DBH A;  3F5R A;  3P6A A;  3PZD A;  1BTK A;  3O96 A;  4HAU B;  4D0N B;  2YT1 A;  2D4Q A;  2P0D A;  2CAY A;  5C79 A;  3ODW A;  2N0Y A;  2R09 A;  3ULB A;  4A6F A;  3AJ4 A;  1RRP B;  1P3R A;  2VKI A;  5HE1 A;  4H8S A;  1GG3 A;  5D3X A;  1XX0 A;  2ROV A;  1FHW A;  3FSS A;  5L81 A;  2K2U A;  2K2J A;  2NZ8 B;  2MFQ A;  1AQC A;  2UVM A;  2GCJ A;  4HB4 B;  2V76 A;  1U5G A;  2LKO A;  2DX1 A;  1UNP A;  3U8Z A;  1NI2 A;  3UZT A;  1V5U A;  2YS3 A;  4ZRK A;  1MIZ B;  3G9W A;  4PNK A;  1U5F A;  1FGZ A;  4K17 A;  2YT0 A;  3HW2 B;  1B55 A;  2MWN B;  1W1G A;  4IFS A;  4Z2M B;  4CHM A;  1TXD A;  1WI1 A;  4CYE A;  2DLW A;  1U5E A;  2E2X A;  3VOQ A;  1GC7 A;  1I7A A;  2UZR A;  3SV1 A;  1M7E A;  4C0A A;  1UEF A;  3TO1 A;  2LYD A;  2COA A;  2DHK A;  3GYO A;  2DA0 A;  3PEG A;  3X23 A;  3KRW A;  1V89 A;  5DI9 B;  2DKQ A;  3PP2 A;  2PZ1 A;  3ML4 A;  1P5T A;  1X1F A;  4PQ0 A;  1EGX A;  4KAX B;  5C5B A;  4A6H A;  4HAW B;  2DX5 A;  2DKP A;  2CY4 A;  1K5G B;  1FB8 A;  1WVH A;  2Y8F A;  2I1K A;  3V5W A; 
#chains in the Genus database with same CATH topology
 4IAP A;  5HE0 A;  2GCL A;  2RRF A;  2YVC A;  1Z87 A;  5IRS A;  4EMO A;  2YS1 A;  4WVF B;  2MKR A;  2P8V A;  5JP4 A;  2OQB A;  2KUP A;  1WG7 A;  3TCA A;  3SYX A;  3ODX A;  5J3Q A;  1WJ1 A;  4K2P A;  4HB2 B;  2D2Q A;  1V61 A;  1N3H A;  1J0W A;  4F7G A;  3A8P A;  5EFX A;  2M14 A;  3D8F A;  5DH9 B;  1X05 A;  1Y19 B;  2YSZ A;  4HDQ A;  3CIK A;  2LG1 A;  4ZRJ A;  2UZS A;  1T77 A;  1KZG A;  2L2I A;  1OQN A;  2H7E A;  3TVV A;  4BBK A;  3MPX A;  2Z13 A;  3PVU A;  3KSY A;  4QXA B;  1RJ2 A;  1X11 A;  2Y8G A;  3FEH A;  2Z0P A;  1WGQ A;  4HB3 B;  4NY0 A;  2R0D A;  2QKL A;  4DBB A;  4OSN A;  4A6F B;  2I1J A;  3SNH A;  1ZM0 A;  2K49 A;  1U27 A;  5DHA B;  4A6K A;  4YL8 A;  3DXD A;  3KZ1 A;  3KRX A;  3D8D A;  3FM8 C;  1U5D A;  1NTY A;  2D9Z A;  2Z14 A;  1FAO A;  3RCP A;  2IFS A;  2YT2 A;  4KVG B;  1SHC A;  1PLS A;  1U2B A;  1QQG A;  5JHH A;  2R2Y A;  1UPQ A;  3ZDT A;  2HE7 A;  3DXE A;  4DX8 A;  1AWE A;  2J0M A;  5DIF B;  1MPH A;  1DYN A;  1DDW A;  2EMS A;  4GXB A;  5JHG A;  1I2H A;  2ELA A;  1KI1 B;  3BIN A;  2KCJ A;  4XWX A;  4HSI A;  2QKM A;  2K8E A;  4HDO A;  2X18 A;  2D9W A;  2RNR B;  4F7H A;  3HK0 A;  2Z59 A;  4QJ3 B;  2J0J A;  1DDM A;  2P0F A;  1E5W A;  2HTH B;  3NW8 A;  3D8E A;  4WJ7 A;  3NWF A;  4HAT B;  5D27 A;  2GUM A;  4MY6 A;  1UPR A;  2W2X C;  4P7I A;  1GC6 A;  1UNR A;  2W2X D;  3A98 B;  2ZPY A;  4KHO A;  3IVF A;  4HB0 B;  5FI0 A;  1H10 A;  5CLQ B;  3LJU X;  1K5D B;  1LB1 A;  1X86 A;  1V88 A;  3AU5 A;  1IRS A;  5HE2 A;  3ODO A;  4GMV A;  5DHF B;  3QWM A;  2Z0Q A;  2ELB A;  4GZU A;  1MAI A;  3F0W A;  3PG7 A;  1EAZ A;  5D3Y A;  2ADZ A;  3WA0 A;  2I5F A;  4EKU A;  2DYQ A;  4GOU A;  1ZSQ A;  4IOY X;  1XKE A;  3ZVR A;  5C6R A;  2Z0O A;  3B77 A;  4NSW A;  1X1G A;  2AL6 A;  2MDX A;  3M1I B;  1ZYI A;  5C5B B;  1H4R A;  1TJ6 A;  2W2W A;  1Y5O A;  4HAV B;  5C16 A;  2RLO A;  4KHB B;  4K2O A;  4HAX B;  2CY5 A;  3VIA A;  2COF A;  1FHO A;  1BAK A;  1J19 A;  4HHV A;  3NSU A;  3PVL A;  1XR0 B;  2NBV A;  2DHI A;  1LW3 A;  1DDV A;  5FI1 A;  5I2M A;  1OMW A;  5JLJ B;  3U7D A;  4L6E A;  1OY2 A;  1U29 A;  4KHA A;  1MK7 B;  2EJ8 A;  4TYZ A;  2KIG A;  2L1C A;  4CHJ A;  3HSA A;  4HAY B;  2GS0 A;  5KCV A;  4Z2N A;  1FHX A;  3HIE A;  1PFJ A;  1W1H A;  3DXC A;  2LUL A;  3FVC A;  2KIE A;  5LON B;  3T06 A;  2OTX A;  1EF1 A;  1FOE A;  2JP2 A;  4GN1 A;  2COD A;  5CLL B;  5J3T A;  4DXA B;  4YON A;  1Q67 A;  1MI1 A;  2DHJ A;  2J59 M;  1UNQ A;  2KGX B;  1ZC4 B;  3P7Z A;  5KQ1 A;  1WJM A;  2ROZ B;  1M7R A;  1TQZ A;  4Y94 A;  5D3W A;  1MIX A;  2M38 A;  1V5M A;  4B6H A;  1NU2 A;  4QJ4 B;  2YF0 A;  3TFM A;  1SGH A;  1XD4 A;  1W1D A;  2COC A;  3MDB C;  5D3V A;  1WGU A;  1V5P A;  2Y7B A;  1ZVR A;  3TW1 A;  2KR0 A;  2DN6 A;  3ULC A;  2I5C A;  1PMS A;  3BJI A;  3OAN A;  3DCX A;  2H7D A;  2YRY A;  3GYP A;  3N7C A;  2D10 A;  2DYN A;  4EJN A;  3AU4 A;  3PVW A;  2P0H A;  2LOX A;  2GJY A;  1XOD A;  2RVB B;  3CXB B;  4GMX B;  1XCG A;  2RUK B;  1ISN A;  3SUZ A;  3HQC A;  2FJL A;  1MK9 B;  3QBV B;  3PSC A;  1P6S A;  3QIJ A;  1ZC3 B;  1BTN A;  2DFK A;  2XQN M;  4DX9 0;  5LOP B;  1QC6 A;  4K81 A;  2D9V A;  2RSG A;  1MKE A;  2VSZ A;  2D9X A;  2VRW B;  2BCJ A;  2D11 A;  2K00 A;  2CRF A;  2Q13 A;  4TKN A;  2D9Y A;  2IYB A;  4A5K A;  1EVH A;  3A8Q A;  5GOW B;  3WYF B;  2N23 A;  1BWN A;  2RGN B;  4WSF A;  1DRO A;  3OHM B;  4ZRI A;  1NTV A;  3NWD A;  5LG4 B;  2EMT A;  4F7U P;  2LOZ A;  2J0K A;  2EC1 A;  5KQ4 A;  2G35 A;  2YS5 A;  3KY9 A;  5HE3 A;  4GPT B;  2AEH A;  4HAZ B;  3SO6 A;  1KZ7 A;  2NMB A;  2Z4D A;  5J3Y A;  4MT7 A;  1FGY A;  4MK0 A;  2DTC A;  1DBH A;  5M4Y B;  3F5R A;  3P6A A;  3PZD A;  1BTK A;  3O96 A;  4HAU B;  4D0N B;  2YT1 A;  2D4Q A;  2P0D A;  2CAY A;  5C79 A;  3ODW A;  2N0Y A;  2R09 A;  3ULB A;  4A6F A;  3NWA A;  3AJ4 A;  1RRP B;  1P3R A;  2VKI A;  5HE1 A;  4DIX A;  4H8S A;  1GG3 A;  5D3X A;  1XX0 A;  2ROV A;  1FHW A;  3FSS A;  4D6W A;  5L81 A;  2K2U A;  2K2J A;  2NZ8 B;  2MFQ A;  1AQC A;  2UVM A;  2GCJ A;  4HB4 B;  3A58 A;  2V76 A;  1U5G A;  2LKO A;  2DX1 A;  1UNP A;  3U12 A;  3U8Z A;  1NI2 A;  3UZT A;  1V5U A;  2YS3 A;  4ZRK A;  1MIZ B;  3G9W A;  4OT1 A;  1U5F A;  4PNK A;  1FGZ A;  4K17 A;  2YT0 A;  2ZKM X;  3HW2 B;  1B55 A;  2MWN B;  1W1G A;  2FJU B;  4IFS A;  4Z2M B;  4CHM A;  1TXD A;  1WI1 A;  4CYE A;  4L1R A;  5I2S A;  2DLW A;  1U5E A;  2E2X A;  3VOQ A;  1GC7 A;  1I7A A;  2UZR A;  3SV1 A;  1M7E A;  4C0A A;  1UEF A;  2KUQ A;  3TO1 A;  4CSQ A;  2LYD A;  2COA A;  2DHK A;  3GYO A;  2DA0 A;  3PEG A;  3X23 A;  4QJ5 B;  3KRW A;  1V89 A;  5DI9 B;  2DKQ A;  3PP2 A;  2PZ1 A;  3ML4 A;  1P5T A;  1X1F A;  4PQ0 A;  1EGX A;  4KAX B;  4GNK B;  5C5B A;  4A6H A;  4HAW B;  2DX5 A;  2DKP A;  2CY4 A;  1K5G B;  1FB8 A;  1WVH A;  4KHB A;  2Y8F A;  2I1K A;  3V5W A; 
#chains in the Genus database with same CATH homology
 4IAP A;  5HE0 A;  2GCL A;  2YVC A;  1Z87 A;  4EMO A;  2YS1 A;  4WVF B;  2MKR A;  2P8V A;  5JP4 A;  2OQB A;  2KUP A;  1WG7 A;  3TCA A;  3SYX A;  3ODX A;  5J3Q A;  1WJ1 A;  4K2P A;  4HB2 B;  2D2Q A;  1V61 A;  1N3H A;  1J0W A;  4F7G A;  3A8P A;  5EFX A;  2M14 A;  3D8F A;  5DH9 B;  1X05 A;  1Y19 B;  2YSZ A;  4HDQ A;  3CIK A;  2LG1 A;  4ZRJ A;  2UZS A;  1KZG A;  2L2I A;  1OQN A;  2H7E A;  3TVV A;  4BBK A;  3MPX A;  3PVU A;  3KSY A;  1RJ2 A;  1X11 A;  2Y8G A;  3FEH A;  2Z0P A;  1WGQ A;  4HB3 B;  4NY0 A;  2R0D A;  2QKL A;  4DBB A;  4A6F B;  2I1J A;  3SNH A;  1ZM0 A;  1U27 A;  5DHA B;  4A6K A;  4YL8 A;  3DXD A;  3KZ1 A;  3KRX A;  3D8D A;  3FM8 C;  1U5D A;  1NTY A;  2D9Z A;  1FAO A;  3RCP A;  2IFS A;  4KVG B;  1SHC A;  1PLS A;  1U2B A;  1QQG A;  5JHH A;  1UPQ A;  3ZDT A;  2HE7 A;  3DXE A;  4DX8 A;  1AWE A;  2J0M A;  5DIF B;  1MPH A;  1DYN A;  1DDW A;  2EMS A;  4GXB A;  5JHG A;  1I2H A;  2ELA A;  1KI1 B;  3BIN A;  2KCJ A;  4XWX A;  2QKM A;  4HDO A;  2X18 A;  2D9W A;  2RNR B;  4F7H A;  3HK0 A;  2J0J A;  1DDM A;  2P0F A;  1E5W A;  2HTH B;  3D8E A;  4WJ7 A;  4HAT B;  5D27 A;  4MY6 A;  1UPR A;  2W2X C;  4P7I A;  1GC6 A;  1UNR A;  2W2X D;  3A98 B;  2ZPY A;  4KHO A;  3IVF A;  4HB0 B;  5FI0 A;  1H10 A;  5CLQ B;  3LJU X;  1K5D B;  1LB1 A;  1X86 A;  1V88 A;  3AU5 A;  1IRS A;  5HE2 A;  3ODO A;  4GMV A;  5DHF B;  3QWM A;  2Z0Q A;  2ELB A;  4GZU A;  1MAI A;  3F0W A;  3PG7 A;  1EAZ A;  5D3Y A;  2ADZ A;  3WA0 A;  2I5F A;  4EKU A;  2DYQ A;  1ZSQ A;  4IOY X;  1XKE A;  3ZVR A;  5C6R A;  2Z0O A;  4NSW A;  1X1G A;  2AL6 A;  2MDX A;  3M1I B;  5C5B B;  1H4R A;  1TJ6 A;  2W2W A;  1Y5O A;  4HAV B;  5C16 A;  2RLO A;  4KHB B;  4K2O A;  4HAX B;  2CY5 A;  3VIA A;  2COF A;  1FHO A;  1BAK A;  1J19 A;  4HHV A;  3NSU A;  3PVL A;  1XR0 B;  2DHI A;  1LW3 A;  1DDV A;  5FI1 A;  1OMW A;  5JLJ B;  3U7D A;  4L6E A;  1OY2 A;  1U29 A;  4KHA A;  1MK7 B;  2EJ8 A;  4TYZ A;  2L1C A;  4CHJ A;  4HAY B;  2GS0 A;  5KCV A;  4Z2N A;  1FHX A;  1PFJ A;  1W1H A;  3DXC A;  2LUL A;  5LON B;  3T06 A;  2OTX A;  1EF1 A;  1FOE A;  2JP2 A;  4GN1 A;  2COD A;  5CLL B;  5J3T A;  4DXA B;  4YON A;  1Q67 A;  2DHJ A;  2J59 M;  1UNQ A;  2KGX B;  1ZC4 B;  3P7Z A;  5KQ1 A;  1WJM A;  2ROZ B;  1M7R A;  1TQZ A;  4Y94 A;  5D3W A;  1MIX A;  2M38 A;  1V5M A;  4B6H A;  1NU2 A;  2YF0 A;  3TFM A;  1SGH A;  1XD4 A;  1W1D A;  2COC A;  3MDB C;  5D3V A;  1WGU A;  1V5P A;  2Y7B A;  1ZVR A;  3TW1 A;  2DN6 A;  3ULC A;  2I5C A;  3OAN A;  1PMS A;  3BJI A;  2H7D A;  2YRY A;  3GYP A;  3N7C A;  2D10 A;  2DYN A;  4EJN A;  3AU4 A;  3PVW A;  2P0H A;  2LOX A;  2GJY A;  1XOD A;  2RVB B;  3CXB B;  4GMX B;  1XCG A;  2RUK B;  1ISN A;  3SUZ A;  3HQC A;  2FJL A;  1MK9 B;  3QBV B;  3PSC A;  1P6S A;  3QIJ A;  1ZC3 B;  1BTN A;  2DFK A;  2XQN M;  4DX9 0;  5LOP B;  1QC6 A;  4K81 A;  2D9V A;  2RSG A;  1MKE A;  2VSZ A;  2D9X A;  2VRW B;  2BCJ A;  2D11 A;  2K00 A;  2CRF A;  2Q13 A;  4TKN A;  2D9Y A;  2IYB A;  4A5K A;  1EVH A;  3A8Q A;  5GOW B;  3WYF B;  2N23 A;  1BWN A;  2RGN B;  4WSF A;  1DRO A;  4ZRI A;  1NTV A;  2EMT A;  4F7U P;  2LOZ A;  2J0K A;  2EC1 A;  5KQ4 A;  2G35 A;  2YS5 A;  3KY9 A;  5HE3 A;  4GPT B;  2AEH A;  4HAZ B;  3SO6 A;  1KZ7 A;  2NMB A;  5J3Y A;  4MT7 A;  1FGY A;  4MK0 A;  2DTC A;  1DBH A;  3F5R A;  3P6A A;  3PZD A;  1BTK A;  3O96 A;  4HAU B;  4D0N B;  2YT1 A;  2D4Q A;  2P0D A;  2CAY A;  5C79 A;  3ODW A;  2N0Y A;  2R09 A;  3ULB A;  4A6F A;  3AJ4 A;  1RRP B;  1P3R A;  2VKI A;  5HE1 A;  4H8S A;  1GG3 A;  5D3X A;  1XX0 A;  2ROV A;  1FHW A;  3FSS A;  5L81 A;  2K2U A;  2K2J A;  2NZ8 B;  2MFQ A;  1AQC A;  2UVM A;  2GCJ A;  4HB4 B;  2V76 A;  1U5G A;  2LKO A;  2DX1 A;  1UNP A;  3U8Z A;  1NI2 A;  3UZT A;  1V5U A;  2YS3 A;  4ZRK A;  1MIZ B;  3G9W A;  4PNK A;  1U5F A;  1FGZ A;  4K17 A;  2YT0 A;  3HW2 B;  1B55 A;  2MWN B;  1W1G A;  4IFS A;  4Z2M B;  4CHM A;  1TXD A;  1WI1 A;  4CYE A;  2DLW A;  1U5E A;  2E2X A;  3VOQ A;  1GC7 A;  1I7A A;  2UZR A;  3SV1 A;  1M7E A;  4C0A A;  1UEF A;  3TO1 A;  2LYD A;  2COA A;  2DHK A;  3GYO A;  2DA0 A;  3PEG A;  3X23 A;  3KRW A;  1V89 A;  5DI9 B;  2DKQ A;  3PP2 A;  2PZ1 A;  3ML4 A;  1P5T A;  1X1F A;  4PQ0 A;  1EGX A;  4KAX B;  5C5B A;  4A6H A;  4HAW B;  2DX5 A;  2DKP A;  2CY4 A;  1K5G B;  1FB8 A;  1WVH A;  2Y8F A;  2I1K A;  3V5W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...