1U5GA

Crystal structure of the ph domain of skap-hom
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
115
structure length
115
Chain Sequence
QFPPIAAQDLPFVIKAGYLEKRRKDHSFLGFEWQKRWCALSKTVFYYYGSDKDKQQKGEFAIDGYDVRMNNTLRKDGKKDCCFEICAPDKRIYQFTAASPKDAEEWVQQLKFILQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Src-associated adaptor protein
publication title The Skap-hom dimerization and PH domains comprise a 3'-phosphoinositide-gated molecular switch.
pubmed doi rcsb
source organism Mus musculus
molecule tags Signaling protein
total genus 26
structure length 115
sequence length 115
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2004-07-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00169 PH PH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 1u5gA01
2G35A 2YF0A 1UPQA 3TW1A 1U5EA 2W2XD 1V5MA 5JHHA 4HAYB 4CHJA 2DYQA 1H10A 3SUZA 5C5BB 4ZRJA 1NTYA 2EMTA 2KUPA 4Y94A 2GCJA 2YVCA 1W1HA 2VRWB 3U8ZA 3KRXA 2CY5A 4NSWA 5D3VA 5KQ4A 5C16A 2MWNB 2OTXA 4KVGB 3ZVRA 4WSFA 3SNHA 4A6KA 2Z0PA 2VKIA 3AU5A 2ADZA 2UVMA 1SHCA 1NU2A 2J0JA 1GC6A 1FAOA 1QC6A 1BWNA 1MK9B 2DKPA 2JP2A 1AQCA 5J3QA 2CRFA 1AWEA 2D10A 2J0KA 4WVFB 5LOPB 1UNRA 5CLLB 2N0YA 3X23A 1W1GA 1X11A 1PMSA 2P8VA 2NZ8B 2D9XA 4K81A 5GOWB 2GCLA 1V61A 1ISNA 2Z0OA 3AU4A 3PG7A 4HAUB 1OQNA 2XQNM 3TO1A 1XODA 2IYBA 4MK0A 3LJUX 2Y8GA 4KHAA 4CYEA 1U5FA 4DBBA 2RSGA 2YS5A 1XCGA 4IFSA 5JHGA 2DFKA 3VOQA 1P5TA 3QBVB 2RVBB 3KY9A 2I5CA 1PLSA 1MIXA 3PZDA 2Q13A 4DX8A 1TXDA 3HK0A 2RUKB 4Z2NA 1EGXA 1I2HA 3A8QA 3NSUA 3QIJA 3AJ4A 3P6AA 1OMWA 3KRWA 4HDOA 2IFSA 5D27A 2MDXA 1V89A 3WA0A 2X18A 2HTHB 4HHVA 2LYDA 4GMXB 2YS3A 4DX90 1KZGA 3SYXA 1BTKA 2AL6A 4GPTB 4KHOA 2E2XA 2W2XC 4B6HA 3TCAA 2D9YA 3D8EA 2VSZA 2Y8FA 2Z0QA 1KI1B 3TVVA 3HW2B 2K2JA 3ULBA 1MPHA 2R09A 4P7IA 3QWMA 5HE0A 2YSZA 1FB8A 1RJ2A 5EFXA 2V76A 1UPRA 1M7EA 2YT0A 1UNPA 4EJNA 3M1IB 1BAKA 1GG3A 1GC7A 4HAWB 1DDVA 2D2QA 2CAYA 2M38A 1PFJA 5D3WA 3UZTA 1H4RA 4MT7A 2J59M 2PZ1A 3F0WA 4DXAB 5J3TA 2I1KA 1FHWA 3A8PA 3MDBC 5JLJB 2FJLA 3O96A 2ZPYA 4C0AA 3CXBB 2LOXA 1X1GA 5DIFB 3FEHA 1V5PA 1DDWA 1TQZA 1ZM0A 4HAVB 1KZ7A 2ROVA 1NI2A 3WYFB 3MPXA 5DHAB 4L6EA 2D9WA 1ZVRA 4HAXB 4TYZA 2M14A 4HAZB 2RGNB 1QQGA 1Y5OA 3VIAA 5HE2A 1DYNA 1LW3A 4CHMA 4EMOA 2DKQA 1N3HA 5HE1A 3FM8C 1NTVA 1M7RA 2RLOA 3IVFA 5C79A 3FSSA 4NY0A 4PQ0A 4K2OA 1TJ6A 3SO6A 4ZRIA 1XD4A 2YS1A 1P6SA 3D8DA 2GS0A 2BCJA 5HE3A 4YONA 1RRPB 1WGUA 4HB4B 5FI0A 4XWXA 5CLQB 1WVHA 1E5WA 2P0FA 1J0WA 1UNQA 4BBKA 4PNKA 1Y19B 2I1JA 1K5GB 2CY4A 3PVWA 1WI1A 1FHOA 3DXCA 2MKRA 4H8SA 2D11A 5J3YA 2RNRB 2COCA 2R0DA 1V5UA 1MAIA 1U5DA 2LOZA 4F7HA 4EKUA 3HQCA 1FGYA 1J19A 4K17A 2K2UA 1U2BA 3PVUA 1ZC3B 1U29A 3PVLA 1ZSQA 1MK7B 3PP2A 1X05A 4HB3B 5DI9B 1WJMA 2DX1A 3GYOA 4F7UP 2COFA 3ULCA 5L81A 4HB0B 3RCPA 3SV1A 1V88A 1MIZB 4A6FA 3G9WA 3DXDA 1FHXA 1FGZA 4GXBA 2I5FA 1XX0A 2H7DA 4A5KA 2MFQA 2QKMA 3DXEA 1LB1A 3KZ1A 1Z87A 2YRYA 4KHBB 4TKNA 2HE7A 2ELAA 2OQBA 2AEHA 4GN1A 2ELBA 2LKOA 2DHJA 3BINA 5LONB 3CIKA 2LG1A 4F7GA 2L2IA 5C5BA 1B55A 3ML4A 4GMVA 2DX5A 1EVHA 5KCVA 3U7DA 4YL8A 2J0MA 3TFMA 1WJ1A 2N23A 4ZRKA 3P7ZA 4HDQA 1SGHA 4Z2MB 5DH9B 1X86A 3ODOA 2KCJA 2YT1A 3ODXA 1MKEA 5DHFB 2P0HA 2QKLA 2UZSA 1XKEA 3A98B 4K2PA 4IAPA 2DHIA 4WJ7A 2DN6A 3V5WA 1U27A 3BJIA 1K5DB 5C6RA 3KSYA 2DLWA 4HB2B 2EJ8A 2LULA 3ZDTA 2H7EA 3PEGA 4KAXB 1I7AA 5FI1A 1UEFA 3ODWA 2EC1A 1XR0B 2P0DA 2DHKA 5KQ1A 2GJYA 1DROA 1P3RA 1OY2A 2COAA 5D3YA 2W2WA 2Y7BA 2D9VA 2NMBA 1WG7A 4MY6A 2EMSA 1EF1A 2KGXB 1DDMA 3T06A 2K00A 2ROZB 2D4QA 2DYNA 1X1FA 2UZRA 4HATB 4IOYX 2DTCA 4D0NB 3OANA 4A6FB 1BTNA 1WGQA 1EAZA 3F5RA 3GYPA 2DA0A 1FOEA 1DBHA 5JP4A 1W1DA 1U5GA 3D8FA 4A6HA 1Q67A 5D3XA 3N7CA 2L1CA 1IRSA 3PSCA 2D9ZA 1ZC4B 2CODA 4GZUA
chains in the Genus database with same CATH superfamily
2G35A 2YF0A 1UPQA 4QJ4B 3TW1A 1U5EA 2W2XD 1V5MA 5JHHA 4HAYB 4CHJA 2DYQA 1H10A 3SUZA 5C5BB 4ZRJA 1NTYA 2EMTA 2KUPA 4Y94A 2GCJA 2YVCA 1W1HA 2VRWB 3U8ZA 3KRXA 2CY5A 4NSWA 5D3VA 5KQ4A 2Z14A 3HSAA 5C16A 2MWNB 2OTXA 4KVGB 3NWFA 3ZVRA 3NW8A 4WSFA 3SNHA 4A6KA 2Z0PA 2VKIA 3AU5A 2ADZA 2UVMA 1SHCA 1NU2A 2J0JA 1GC6A 1FAOA 1QC6A 1BWNA 1MK9B 2DKPA 4HSIA 2JP2A 1AQCA 5J3QA 2CRFA 1AWEA 2D10A 2J0KA 4WVFB 5LOPB 1UNRA 5CLLB 2N0YA 3X23A 3HIEA 1W1GA 1X11A 1PMSA 2P8VA 2NZ8B 2D9XA 4K81A 5GOWB 2GCLA 4CSQA 1V61A 1ISNA 2Z0OA 3AU4A 3PG7A 4HAUB 1OQNA 2XQNM 3TO1A 1XODA 2IYBA 4MK0A 2Z4DA 3LJUX 2Y8GA 4KHAA 4CYEA 1U5FA 4DBBA 2RSGA 2YS5A 1XCGA 4IFSA 5JHGA 2DFKA 3VOQA 1P5TA 3QBVB 2RVBB 3KY9A 3NWAA 2I5CA 1PLSA 1MIXA 3PZDA 2Q13A 4DX8A 1TXDA 3HK0A 2KIEA 2RUKB 4Z2NA 1EGXA 1I2HA 3A8QA 3NSUA 3QIJA 3AJ4A 3P6AA 1OMWA 3KRWA 4HDOA 2IFSA 5D27A 2MDXA 1V89A 5I2SA 3WA0A 2X18A 2HTHB 4HHVA 2LYDA 4GMXB 2YS3A 4DX90 1KZGA 3SYXA 1BTKA 2AL6A 4GPTB 4KHOA 2E2XA 2W2XC 4B6HA 3TCAA 2D9YA 3D8EA 2RRFA 2VSZA 3NWDA 2Y8FA 2Z0QA 2KIGA 1KI1B 3TVVA 3HW2B 2K2JA 3ULBA 4GOUA 1MPHA 4OT1A 2R09A 4P7IA 3QWMA 5HE0A 2NBVA 2YSZA 1FB8A 1RJ2A 5EFXA 2V76A 1UPRA 1M7EA 2YT0A 1UNPA 4EJNA 2YT2A 3M1IB 1BAKA 1GG3A 1GC7A 4HAWB 1DDVA 2D2QA 2CAYA 2M38A 1PFJA 5D3WA 3UZTA 1H4RA 4MT7A 2J59M 2PZ1A 3F0WA 4DXAB 5J3TA 2I1KA 1FHWA 3A8PA 3MDBC 5JLJB 2FJLA 3O96A 2ZPYA 4C0AA 3CXBB 2R2YA 2LOXA 1X1GA 5DIFB 3FEHA 1V5PA 1DDWA 1TQZA 1ZM0A 4HAVB 1KZ7A 2ROVA 1NI2A 3OHMB 4KHBA 3WYFB 3MPXA 5DHAB 4L6EA 2D9WA 1ZVRA 4HAXB 4TYZA 2M14A 4HAZB 2RGNB 1QQGA 1Y5OA 3VIAA 5HE2A 1DYNA 1LW3A 4CHMA 4EMOA 2DKQA 1N3HA 5HE1A 3FM8C 1NTVA 1M7RA 4GNKB 2RLOA 3IVFA 5C79A 2K49A 3FSSA 4NY0A 4PQ0A 2ZKMX 4K2OA 1TJ6A 3SO6A 4ZRIA 1XD4A 2YS1A 1P6SA 3D8DA 2GS0A 2BCJA 5HE3A 4YONA 1RRPB 1WGUA 4HB4B 5FI0A 4XWXA 4DIXA 5CLQB 1ZYIA 1WVHA 1E5WA 5IRSA 2P0FA 1J0WA 4L1RA 1UNQA 4BBKA 4PNKA 1Y19B 2I1JA 1K5GB 2CY4A 3PVWA 1WI1A 1FHOA 3DXCA 2MKRA 2FJUB 4H8SA 2D11A 5J3YA 2RNRB 2COCA 2R0DA 1V5UA 1MAIA 1U5DA 2LOZA 4F7HA 4EKUA 3HQCA 1FGYA 1J19A 4K17A 2K2UA 1U2BA 3PVUA 1ZC3B 1U29A 3PVLA 1ZSQA 1MK7B 3PP2A 1X05A 4HB3B 5DI9B 1WJMA 2DX1A 1T77A 3GYOA 4QJ3B 2COFA 4F7UP 3ULCA 5L81A 2Z13A 4HB0B 3RCPA 3SV1A 1V88A 1MI1A 1MIZB 4A6FA 3G9WA 3DXDA 1FHXA 1FGZA 4GXBA 2I5FA 1XX0A 2KR0A 2H7DA 4A5KA 2MFQA 2QKMA 3DXEA 1LB1A 3KZ1A 2GUMA 1Z87A 2YRYA 4KHBB 4TKNA 2HE7A 2ELAA 2OQBA 2AEHA 4GN1A 2ELBA 2LKOA 2DHJA 3BINA 5LONB 3CIKA 3DCXA 2LG1A 4F7GA 2L2IA 5C5BA 1B55A 3ML4A 4GMVA 2DX5A 1EVHA 5KCVA 3U7DA 4YL8A 2J0MA 3TFMA 2KUQA 1WJ1A 2N23A 4ZRKA 3P7ZA 4HDQA 1SGHA 4Z2MB 5DH9B 1X86A 3ODOA 2KCJA 2YT1A 3ODXA 1MKEA 2K8EA 4QJ5B 5DHFB 2P0HA 2QKLA 2UZSA 1XKEA 3A98B 4K2PA 4IAPA 3U12A 2DHIA 3B77A 4WJ7A 2Z59A 2DN6A 3V5WA 1U27A 3BJIA 1K5DB 5C6RA 3KSYA 2DLWA 4HB2B 2EJ8A 2LULA 3ZDTA 2H7EA 3PEGA 4KAXB 1I7AA 5FI1A 1UEFA 4QXAB 3ODWA 2EC1A 1XR0B 3A58A 2P0DA 4D6WA 2DHKA 5KQ1A 2GJYA 1DROA 1P3RA 1OY2A 2COAA 5D3YA 2W2WA 2Y7BA 2D9VA 2NMBA 1WG7A 4MY6A 2EMSA 1EF1A 2KGXB 1DDMA 3T06A 2K00A 2ROZB 2D4QA 2DYNA 1X1FA 2UZRA 4HATB 4IOYX 2DTCA 4D0NB 3OANA 4A6FB 1BTNA 1WGQA 1EAZA 3F5RA 3GYPA 2DA0A 1FOEA 1DBHA 3FVCA 5JP4A 1W1DA 1U5GA 3D8FA 5LG4B 4A6HA 1Q67A 5D3XA 3N7CA 2L1CA 1IRSA 3PSCA 4OSNA 2D9ZA 5I2MA 1ZC4B 2CODA 4GZUA 5M4YB
chains in the Genus database with same CATH topology
2G35A 2YF0A 1UPQA 3TW1A 1U5EA 2W2XD 1V5MA 5JHHA 4HAYB 4CHJA 2DYQA 1H10A 3SUZA 5C5BB 4ZRJA 1NTYA 2EMTA 2KUPA 4Y94A 2GCJA 2YVCA 1W1HA 2VRWB 3U8ZA 3KRXA 2CY5A 4NSWA 5D3VA 5KQ4A 5C16A 2MWNB 2OTXA 4KVGB 3ZVRA 4WSFA 3SNHA 4A6KA 2Z0PA 2VKIA 3AU5A 2ADZA 2UVMA 1SHCA 1NU2A 2J0JA 1GC6A 1FAOA 1QC6A 1BWNA 1MK9B 2DKPA 2JP2A 1AQCA 5J3QA 2CRFA 1AWEA 2D10A 2J0KA 4WVFB 5LOPB 1UNRA 5CLLB 2N0YA 3X23A 1W1GA 1X11A 1PMSA 2P8VA 2NZ8B 2D9XA 4K81A 5GOWB 2GCLA 1V61A 1ISNA 2Z0OA 3AU4A 3PG7A 4HAUB 1OQNA 2XQNM 3TO1A 1XODA 2IYBA 4MK0A 3LJUX 2Y8GA 4KHAA 4CYEA 1U5FA 4DBBA 2RSGA 2YS5A 1XCGA 4IFSA 5JHGA 2DFKA 3VOQA 1P5TA 3QBVB 2RVBB 3KY9A 2I5CA 1PLSA 1MIXA 3PZDA 2Q13A 4DX8A 1TXDA 3HK0A 2RUKB 4Z2NA 1EGXA 1I2HA 3A8QA 3NSUA 3QIJA 3AJ4A 3P6AA 1OMWA 3KRWA 4HDOA 2IFSA 5D27A 2MDXA 1V89A 3WA0A 2X18A 2HTHB 4HHVA 2LYDA 4GMXB 2YS3A 4DX90 1KZGA 3SYXA 1BTKA 2AL6A 4GPTB 4KHOA 2E2XA 2W2XC 4B6HA 3TCAA 2D9YA 3D8EA 2VSZA 2Y8FA 2Z0QA 1KI1B 3TVVA 3HW2B 2K2JA 3ULBA 1MPHA 2R09A 4P7IA 3QWMA 5HE0A 2YSZA 1FB8A 1RJ2A 5EFXA 2V76A 1UPRA 1M7EA 2YT0A 1UNPA 4EJNA 3M1IB 1BAKA 1GG3A 1GC7A 4HAWB 1DDVA 2D2QA 2CAYA 2M38A 1PFJA 5D3WA 3UZTA 1H4RA 4MT7A 2J59M 2PZ1A 3F0WA 4DXAB 5J3TA 2I1KA 1FHWA 3A8PA 3MDBC 5JLJB 2FJLA 3O96A 2ZPYA 4C0AA 3CXBB 2LOXA 1X1GA 5DIFB 3FEHA 1V5PA 1DDWA 1TQZA 1ZM0A 4HAVB 1KZ7A 2ROVA 1NI2A 3WYFB 3MPXA 5DHAB 4L6EA 2D9WA 1ZVRA 4HAXB 4TYZA 2M14A 4HAZB 2RGNB 1QQGA 1Y5OA 3VIAA 5HE2A 1DYNA 1LW3A 4CHMA 4EMOA 2DKQA 1N3HA 5HE1A 3FM8C 1NTVA 1M7RA 2RLOA 3IVFA 5C79A 3FSSA 4NY0A 4PQ0A 4K2OA 1TJ6A 3SO6A 4ZRIA 1XD4A 2YS1A 1P6SA 3D8DA 2GS0A 2BCJA 5HE3A 4YONA 1RRPB 1WGUA 4HB4B 5FI0A 4XWXA 5CLQB 1WVHA 1E5WA 2P0FA 1J0WA 1UNQA 4BBKA 4PNKA 1Y19B 2I1JA 1K5GB 2CY4A 3PVWA 1WI1A 1FHOA 3DXCA 2MKRA 4H8SA 2D11A 5J3YA 2RNRB 2COCA 2R0DA 1V5UA 1MAIA 1U5DA 2LOZA 4F7HA 4EKUA 3HQCA 1FGYA 1J19A 4K17A 2K2UA 1U2BA 3PVUA 1ZC3B 1U29A 3PVLA 1ZSQA 1MK7B 3PP2A 1X05A 4HB3B 5DI9B 1WJMA 2DX1A 3GYOA 4F7UP 2COFA 3ULCA 5L81A 4HB0B 3RCPA 3SV1A 1V88A 1MIZB 4A6FA 3G9WA 3DXDA 1FHXA 1FGZA 4GXBA 2I5FA 1XX0A 2H7DA 4A5KA 2MFQA 2QKMA 3DXEA 1LB1A 3KZ1A 1Z87A 2YRYA 4KHBB 4TKNA 2HE7A 2ELAA 2OQBA 2AEHA 4GN1A 2ELBA 2LKOA 2DHJA 3BINA 5LONB 3CIKA 2LG1A 4F7GA 2L2IA 5C5BA 1B55A 3ML4A 4GMVA 2DX5A 1EVHA 5KCVA 3U7DA 4YL8A 2J0MA 3TFMA 1WJ1A 2N23A 4ZRKA 3P7ZA 4HDQA 1SGHA 4Z2MB 5DH9B 1X86A 3ODOA 2KCJA 2YT1A 3ODXA 1MKEA 5DHFB 2P0HA 2QKLA 2UZSA 1XKEA 3A98B 4K2PA 4IAPA 2DHIA 4WJ7A 2DN6A 3V5WA 1U27A 3BJIA 1K5DB 5C6RA 3KSYA 2DLWA 4HB2B 2EJ8A 2LULA 3ZDTA 2H7EA 3PEGA 4KAXB 1I7AA 5FI1A 1UEFA 3ODWA 2EC1A 1XR0B 2P0DA 2DHKA 5KQ1A 2GJYA 1DROA 1P3RA 1OY2A 2COAA 5D3YA 2W2WA 2Y7BA 2D9VA 2NMBA 1WG7A 4MY6A 2EMSA 1EF1A 2KGXB 1DDMA 3T06A 2K00A 2ROZB 2D4QA 2DYNA 1X1FA 2UZRA 4HATB 4IOYX 2DTCA 4D0NB 3OANA 4A6FB 1BTNA 1WGQA 1EAZA 3F5RA 3GYPA 2DA0A 1FOEA 1DBHA 5JP4A 1W1DA 1U5GA 3D8FA 4A6HA 1Q67A 5D3XA 3N7CA 2L1CA 1IRSA 3PSCA 2D9ZA 1ZC4B 2CODA 4GZUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2G35 A;  2YF0 A;  1UPQ A;  3TW1 A;  1U5E A;  2W2X D;  1V5M A;  5JHH A;  4HAY B;  4CHJ A;  2DYQ A;  1H10 A;  3SUZ A;  5C5B B;  4ZRJ A;  1NTY A;  2EMT A;  2KUP A;  4Y94 A;  2GCJ A;  2YVC A;  1W1H A;  2VRW B;  3U8Z A;  3KRX A;  2CY5 A;  4NSW A;  5D3V A;  5KQ4 A;  5C16 A;  2MWN B;  2OTX A;  4KVG B;  3ZVR A;  4WSF A;  3SNH A;  4A6K A;  2Z0P A;  2VKI A;  3AU5 A;  2ADZ A;  2UVM A;  1SHC A;  1NU2 A;  2J0J A;  1GC6 A;  1FAO A;  1QC6 A;  1BWN A;  1MK9 B;  2DKP A;  2JP2 A;  1AQC A;  5J3Q A;  2CRF A;  1AWE A;  2D10 A;  2J0K A;  4WVF B;  5LOP B;  1UNR A;  5CLL B;  2N0Y A;  3X23 A;  1W1G A;  1X11 A;  1PMS A;  2P8V A;  2NZ8 B;  2D9X A;  4K81 A;  5GOW B;  2GCL A;  1V61 A;  1ISN A;  2Z0O A;  3AU4 A;  3PG7 A;  4HAU B;  1OQN A;  2XQN M;  3TO1 A;  1XOD A;  2IYB A;  4MK0 A;  3LJU X;  2Y8G A;  4KHA A;  4CYE A;  1U5F A;  4DBB A;  2RSG A;  2YS5 A;  1XCG A;  4IFS A;  5JHG A;  2DFK A;  3VOQ A;  1P5T A;  3QBV B;  2RVB B;  3KY9 A;  2I5C A;  1PLS A;  1MIX A;  3PZD A;  2Q13 A;  4DX8 A;  1TXD A;  3HK0 A;  2RUK B;  4Z2N A;  1EGX A;  1I2H A;  3A8Q A;  3NSU A;  3QIJ A;  3AJ4 A;  3P6A A;  1OMW A;  3KRW A;  4HDO A;  2IFS A;  5D27 A;  2MDX A;  1V89 A;  3WA0 A;  2X18 A;  2HTH B;  4HHV A;  2LYD A;  4GMX B;  2YS3 A;  4DX9 0;  1KZG A;  3SYX A;  1BTK A;  2AL6 A;  4GPT B;  4KHO A;  2E2X A;  2W2X C;  4B6H A;  3TCA A;  2D9Y A;  3D8E A;  2VSZ A;  2Y8F A;  2Z0Q A;  1KI1 B;  3TVV A;  3HW2 B;  2K2J A;  3ULB A;  1MPH A;  2R09 A;  4P7I A;  3QWM A;  5HE0 A;  2YSZ A;  1FB8 A;  1RJ2 A;  5EFX A;  2V76 A;  1UPR A;  1M7E A;  2YT0 A;  1UNP A;  4EJN A;  3M1I B;  1BAK A;  1GG3 A;  1GC7 A;  4HAW B;  1DDV A;  2D2Q A;  2CAY A;  2M38 A;  1PFJ A;  5D3W A;  3UZT A;  1H4R A;  4MT7 A;  2J59 M;  2PZ1 A;  3F0W A;  4DXA B;  5J3T A;  2I1K A;  1FHW A;  3A8P A;  3MDB C;  5JLJ B;  2FJL A;  3O96 A;  2ZPY A;  4C0A A;  3CXB B;  2LOX A;  1X1G A;  5DIF B;  3FEH A;  1V5P A;  1DDW A;  1TQZ A;  1ZM0 A;  4HAV B;  1KZ7 A;  2ROV A;  1NI2 A;  3WYF B;  3MPX A;  5DHA B;  4L6E A;  2D9W A;  1ZVR A;  4HAX B;  4TYZ A;  2M14 A;  4HAZ B;  2RGN B;  1QQG A;  1Y5O A;  3VIA A;  5HE2 A;  1DYN A;  1LW3 A;  4CHM A;  4EMO A;  2DKQ A;  1N3H A;  5HE1 A;  3FM8 C;  1NTV A;  1M7R A;  2RLO A;  3IVF A;  5C79 A;  3FSS A;  4NY0 A;  4PQ0 A;  4K2O A;  1TJ6 A;  3SO6 A;  4ZRI A;  1XD4 A;  2YS1 A;  1P6S A;  3D8D A;  2GS0 A;  2BCJ A;  5HE3 A;  4YON A;  1RRP B;  1WGU A;  4HB4 B;  5FI0 A;  4XWX A;  5CLQ B;  1WVH A;  1E5W A;  2P0F A;  1J0W A;  1UNQ A;  4BBK A;  4PNK A;  1Y19 B;  2I1J A;  1K5G B;  2CY4 A;  3PVW A;  1WI1 A;  1FHO A;  3DXC A;  2MKR A;  4H8S A;  2D11 A;  5J3Y A;  2RNR B;  2COC A;  2R0D A;  1V5U A;  1MAI A;  1U5D A;  2LOZ A;  4F7H A;  4EKU A;  3HQC A;  1FGY A;  1J19 A;  4K17 A;  2K2U A;  1U2B A;  3PVU A;  1ZC3 B;  1U29 A;  3PVL A;  1ZSQ A;  1MK7 B;  3PP2 A;  1X05 A;  4HB3 B;  5DI9 B;  1WJM A;  2DX1 A;  3GYO A;  4F7U P;  2COF A;  3ULC A;  5L81 A;  4HB0 B;  3RCP A;  3SV1 A;  1V88 A;  1MIZ B;  4A6F A;  3G9W A;  3DXD A;  1FHX A;  1FGZ A;  4GXB A;  2I5F A;  1XX0 A;  2H7D A;  4A5K A;  2MFQ A;  2QKM A;  3DXE A;  1LB1 A;  3KZ1 A;  1Z87 A;  2YRY A;  4KHB B;  4TKN A;  2HE7 A;  2ELA A;  2OQB A;  2AEH A;  4GN1 A;  2ELB A;  2LKO A;  2DHJ A;  3BIN A;  5LON B;  3CIK A;  2LG1 A;  4F7G A;  2L2I A;  5C5B A;  1B55 A;  3ML4 A;  4GMV A;  2DX5 A;  1EVH A;  5KCV A;  3U7D A;  4YL8 A;  2J0M A;  3TFM A;  1WJ1 A;  2N23 A;  4ZRK A;  3P7Z A;  4HDQ A;  1SGH A;  4Z2M B;  5DH9 B;  1X86 A;  3ODO A;  2KCJ A;  2YT1 A;  3ODX A;  1MKE A;  5DHF B;  2P0H A;  2QKL A;  2UZS A;  1XKE A;  3A98 B;  4K2P A;  4IAP A;  2DHI A;  4WJ7 A;  2DN6 A;  3V5W A;  1U27 A;  3BJI A;  1K5D B;  5C6R A;  3KSY A;  2DLW A;  4HB2 B;  2EJ8 A;  2LUL A;  3ZDT A;  2H7E A;  3PEG A;  4KAX B;  1I7A A;  5FI1 A;  1UEF A;  3ODW A;  2EC1 A;  1XR0 B;  2P0D A;  2DHK A;  5KQ1 A;  2GJY A;  1DRO A;  1P3R A;  1OY2 A;  2COA A;  5D3Y A;  2W2W A;  2Y7B A;  2D9V A;  2NMB A;  1WG7 A;  4MY6 A;  2EMS A;  1EF1 A;  2KGX B;  1DDM A;  3T06 A;  2K00 A;  2ROZ B;  2D4Q A;  2DYN A;  1X1F A;  2UZR A;  4HAT B;  4IOY X;  2DTC A;  4D0N B;  3OAN A;  4A6F B;  1BTN A;  1WGQ A;  1EAZ A;  3F5R A;  3GYP A;  2DA0 A;  1FOE A;  1DBH A;  5JP4 A;  1W1D A;  1U5G A;  3D8F A;  4A6H A;  1Q67 A;  5D3X A;  3N7C A;  2L1C A;  1IRS A;  3PSC A;  2D9Z A;  1ZC4 B;  2COD A;  4GZU A; 
#chains in the Genus database with same CATH topology
 2G35 A;  2YF0 A;  1UPQ A;  4QJ4 B;  3TW1 A;  1U5E A;  2W2X D;  1V5M A;  5JHH A;  4HAY B;  4CHJ A;  2DYQ A;  1H10 A;  3SUZ A;  5C5B B;  4ZRJ A;  1NTY A;  2EMT A;  2KUP A;  4Y94 A;  2GCJ A;  2YVC A;  1W1H A;  2VRW B;  3U8Z A;  3KRX A;  2CY5 A;  4NSW A;  5D3V A;  5KQ4 A;  2Z14 A;  3HSA A;  5C16 A;  2MWN B;  2OTX A;  4KVG B;  3NWF A;  3ZVR A;  3NW8 A;  4WSF A;  3SNH A;  4A6K A;  2Z0P A;  2VKI A;  3AU5 A;  2ADZ A;  2UVM A;  1SHC A;  1NU2 A;  2J0J A;  1GC6 A;  1FAO A;  1QC6 A;  1BWN A;  1MK9 B;  2DKP A;  4HSI A;  2JP2 A;  1AQC A;  5J3Q A;  2CRF A;  1AWE A;  2D10 A;  2J0K A;  4WVF B;  5LOP B;  1UNR A;  5CLL B;  2N0Y A;  3X23 A;  3HIE A;  1W1G A;  1X11 A;  1PMS A;  2P8V A;  2NZ8 B;  2D9X A;  4K81 A;  5GOW B;  2GCL A;  4CSQ A;  1V61 A;  1ISN A;  2Z0O A;  3AU4 A;  3PG7 A;  4HAU B;  1OQN A;  2XQN M;  3TO1 A;  1XOD A;  2IYB A;  4MK0 A;  2Z4D A;  3LJU X;  2Y8G A;  4KHA A;  4CYE A;  1U5F A;  4DBB A;  2RSG A;  2YS5 A;  1XCG A;  4IFS A;  5JHG A;  2DFK A;  3VOQ A;  1P5T A;  3QBV B;  2RVB B;  3KY9 A;  3NWA A;  2I5C A;  1PLS A;  1MIX A;  3PZD A;  2Q13 A;  4DX8 A;  1TXD A;  3HK0 A;  2KIE A;  2RUK B;  4Z2N A;  1EGX A;  1I2H A;  3A8Q A;  3NSU A;  3QIJ A;  3AJ4 A;  3P6A A;  1OMW A;  3KRW A;  4HDO A;  2IFS A;  5D27 A;  2MDX A;  1V89 A;  5I2S A;  3WA0 A;  2X18 A;  2HTH B;  4HHV A;  2LYD A;  4GMX B;  2YS3 A;  4DX9 0;  1KZG A;  3SYX A;  1BTK A;  2AL6 A;  4GPT B;  4KHO A;  2E2X A;  2W2X C;  4B6H A;  3TCA A;  2D9Y A;  3D8E A;  2RRF A;  2VSZ A;  3NWD A;  2Y8F A;  2Z0Q A;  2KIG A;  1KI1 B;  3TVV A;  3HW2 B;  2K2J A;  3ULB A;  4GOU A;  1MPH A;  4OT1 A;  2R09 A;  4P7I A;  3QWM A;  5HE0 A;  2NBV A;  2YSZ A;  1FB8 A;  1RJ2 A;  5EFX A;  2V76 A;  1UPR A;  1M7E A;  2YT0 A;  1UNP A;  4EJN A;  2YT2 A;  3M1I B;  1BAK A;  1GG3 A;  1GC7 A;  4HAW B;  1DDV A;  2D2Q A;  2CAY A;  2M38 A;  1PFJ A;  5D3W A;  3UZT A;  1H4R A;  4MT7 A;  2J59 M;  2PZ1 A;  3F0W A;  4DXA B;  5J3T A;  2I1K A;  1FHW A;  3A8P A;  3MDB C;  5JLJ B;  2FJL A;  3O96 A;  2ZPY A;  4C0A A;  3CXB B;  2R2Y A;  2LOX A;  1X1G A;  5DIF B;  3FEH A;  1V5P A;  1DDW A;  1TQZ A;  1ZM0 A;  4HAV B;  1KZ7 A;  2ROV A;  1NI2 A;  3OHM B;  4KHB A;  3WYF B;  3MPX A;  5DHA B;  4L6E A;  2D9W A;  1ZVR A;  4HAX B;  4TYZ A;  2M14 A;  4HAZ B;  2RGN B;  1QQG A;  1Y5O A;  3VIA A;  5HE2 A;  1DYN A;  1LW3 A;  4CHM A;  4EMO A;  2DKQ A;  1N3H A;  5HE1 A;  3FM8 C;  1NTV A;  1M7R A;  4GNK B;  2RLO A;  3IVF A;  5C79 A;  2K49 A;  3FSS A;  4NY0 A;  4PQ0 A;  2ZKM X;  4K2O A;  1TJ6 A;  3SO6 A;  4ZRI A;  1XD4 A;  2YS1 A;  1P6S A;  3D8D A;  2GS0 A;  2BCJ A;  5HE3 A;  4YON A;  1RRP B;  1WGU A;  4HB4 B;  5FI0 A;  4XWX A;  4DIX A;  5CLQ B;  1ZYI A;  1WVH A;  1E5W A;  5IRS A;  2P0F A;  1J0W A;  4L1R A;  1UNQ A;  4BBK A;  4PNK A;  1Y19 B;  2I1J A;  1K5G B;  2CY4 A;  3PVW A;  1WI1 A;  1FHO A;  3DXC A;  2MKR A;  2FJU B;  4H8S A;  2D11 A;  5J3Y A;  2RNR B;  2COC A;  2R0D A;  1V5U A;  1MAI A;  1U5D A;  2LOZ A;  4F7H A;  4EKU A;  3HQC A;  1FGY A;  1J19 A;  4K17 A;  2K2U A;  1U2B A;  3PVU A;  1ZC3 B;  1U29 A;  3PVL A;  1ZSQ A;  1MK7 B;  3PP2 A;  1X05 A;  4HB3 B;  5DI9 B;  1WJM A;  2DX1 A;  1T77 A;  3GYO A;  4QJ3 B;  2COF A;  4F7U P;  3ULC A;  5L81 A;  2Z13 A;  4HB0 B;  3RCP A;  3SV1 A;  1V88 A;  1MI1 A;  1MIZ B;  4A6F A;  3G9W A;  3DXD A;  1FHX A;  1FGZ A;  4GXB A;  2I5F A;  1XX0 A;  2KR0 A;  2H7D A;  4A5K A;  2MFQ A;  2QKM A;  3DXE A;  1LB1 A;  3KZ1 A;  2GUM A;  1Z87 A;  2YRY A;  4KHB B;  4TKN A;  2HE7 A;  2ELA A;  2OQB A;  2AEH A;  4GN1 A;  2ELB A;  2LKO A;  2DHJ A;  3BIN A;  5LON B;  3CIK A;  3DCX A;  2LG1 A;  4F7G A;  2L2I A;  5C5B A;  1B55 A;  3ML4 A;  4GMV A;  2DX5 A;  1EVH A;  5KCV A;  3U7D A;  4YL8 A;  2J0M A;  3TFM A;  2KUQ A;  1WJ1 A;  2N23 A;  4ZRK A;  3P7Z A;  4HDQ A;  1SGH A;  4Z2M B;  5DH9 B;  1X86 A;  3ODO A;  2KCJ A;  2YT1 A;  3ODX A;  1MKE A;  2K8E A;  4QJ5 B;  5DHF B;  2P0H A;  2QKL A;  2UZS A;  1XKE A;  3A98 B;  4K2P A;  4IAP A;  3U12 A;  2DHI A;  3B77 A;  4WJ7 A;  2Z59 A;  2DN6 A;  3V5W A;  1U27 A;  3BJI A;  1K5D B;  5C6R A;  3KSY A;  2DLW A;  4HB2 B;  2EJ8 A;  2LUL A;  3ZDT A;  2H7E A;  3PEG A;  4KAX B;  1I7A A;  5FI1 A;  1UEF A;  4QXA B;  3ODW A;  2EC1 A;  1XR0 B;  3A58 A;  2P0D A;  4D6W A;  2DHK A;  5KQ1 A;  2GJY A;  1DRO A;  1P3R A;  1OY2 A;  2COA A;  5D3Y A;  2W2W A;  2Y7B A;  2D9V A;  2NMB A;  1WG7 A;  4MY6 A;  2EMS A;  1EF1 A;  2KGX B;  1DDM A;  3T06 A;  2K00 A;  2ROZ B;  2D4Q A;  2DYN A;  1X1F A;  2UZR A;  4HAT B;  4IOY X;  2DTC A;  4D0N B;  3OAN A;  4A6F B;  1BTN A;  1WGQ A;  1EAZ A;  3F5R A;  3GYP A;  2DA0 A;  1FOE A;  1DBH A;  3FVC A;  5JP4 A;  1W1D A;  1U5G A;  3D8F A;  5LG4 B;  4A6H A;  1Q67 A;  5D3X A;  3N7C A;  2L1C A;  1IRS A;  3PSC A;  4OSN A;  2D9Z A;  5I2M A;  1ZC4 B;  2COD A;  4GZU A;  5M4Y B; 
#chains in the Genus database with same CATH homology
 2G35 A;  2YF0 A;  1UPQ A;  3TW1 A;  1U5E A;  2W2X D;  1V5M A;  5JHH A;  4HAY B;  4CHJ A;  2DYQ A;  1H10 A;  3SUZ A;  5C5B B;  4ZRJ A;  1NTY A;  2EMT A;  2KUP A;  4Y94 A;  2GCJ A;  2YVC A;  1W1H A;  2VRW B;  3U8Z A;  3KRX A;  2CY5 A;  4NSW A;  5D3V A;  5KQ4 A;  5C16 A;  2MWN B;  2OTX A;  4KVG B;  3ZVR A;  4WSF A;  3SNH A;  4A6K A;  2Z0P A;  2VKI A;  3AU5 A;  2ADZ A;  2UVM A;  1SHC A;  1NU2 A;  2J0J A;  1GC6 A;  1FAO A;  1QC6 A;  1BWN A;  1MK9 B;  2DKP A;  2JP2 A;  1AQC A;  5J3Q A;  2CRF A;  1AWE A;  2D10 A;  2J0K A;  4WVF B;  5LOP B;  1UNR A;  5CLL B;  2N0Y A;  3X23 A;  1W1G A;  1X11 A;  1PMS A;  2P8V A;  2NZ8 B;  2D9X A;  4K81 A;  5GOW B;  2GCL A;  1V61 A;  1ISN A;  2Z0O A;  3AU4 A;  3PG7 A;  4HAU B;  1OQN A;  2XQN M;  3TO1 A;  1XOD A;  2IYB A;  4MK0 A;  3LJU X;  2Y8G A;  4KHA A;  4CYE A;  1U5F A;  4DBB A;  2RSG A;  2YS5 A;  1XCG A;  4IFS A;  5JHG A;  2DFK A;  3VOQ A;  1P5T A;  3QBV B;  2RVB B;  3KY9 A;  2I5C A;  1PLS A;  1MIX A;  3PZD A;  2Q13 A;  4DX8 A;  1TXD A;  3HK0 A;  2RUK B;  4Z2N A;  1EGX A;  1I2H A;  3A8Q A;  3NSU A;  3QIJ A;  3AJ4 A;  3P6A A;  1OMW A;  3KRW A;  4HDO A;  2IFS A;  5D27 A;  2MDX A;  1V89 A;  3WA0 A;  2X18 A;  2HTH B;  4HHV A;  2LYD A;  4GMX B;  2YS3 A;  4DX9 0;  1KZG A;  3SYX A;  1BTK A;  2AL6 A;  4GPT B;  4KHO A;  2E2X A;  2W2X C;  4B6H A;  3TCA A;  2D9Y A;  3D8E A;  2VSZ A;  2Y8F A;  2Z0Q A;  1KI1 B;  3TVV A;  3HW2 B;  2K2J A;  3ULB A;  1MPH A;  2R09 A;  4P7I A;  3QWM A;  5HE0 A;  2YSZ A;  1FB8 A;  1RJ2 A;  5EFX A;  2V76 A;  1UPR A;  1M7E A;  2YT0 A;  1UNP A;  4EJN A;  3M1I B;  1BAK A;  1GG3 A;  1GC7 A;  4HAW B;  1DDV A;  2D2Q A;  2CAY A;  2M38 A;  1PFJ A;  5D3W A;  3UZT A;  1H4R A;  4MT7 A;  2J59 M;  2PZ1 A;  3F0W A;  4DXA B;  5J3T A;  2I1K A;  1FHW A;  3A8P A;  3MDB C;  5JLJ B;  2FJL A;  3O96 A;  2ZPY A;  4C0A A;  3CXB B;  2LOX A;  1X1G A;  5DIF B;  3FEH A;  1V5P A;  1DDW A;  1TQZ A;  1ZM0 A;  4HAV B;  1KZ7 A;  2ROV A;  1NI2 A;  3WYF B;  3MPX A;  5DHA B;  4L6E A;  2D9W A;  1ZVR A;  4HAX B;  4TYZ A;  2M14 A;  4HAZ B;  2RGN B;  1QQG A;  1Y5O A;  3VIA A;  5HE2 A;  1DYN A;  1LW3 A;  4CHM A;  4EMO A;  2DKQ A;  1N3H A;  5HE1 A;  3FM8 C;  1NTV A;  1M7R A;  2RLO A;  3IVF A;  5C79 A;  3FSS A;  4NY0 A;  4PQ0 A;  4K2O A;  1TJ6 A;  3SO6 A;  4ZRI A;  1XD4 A;  2YS1 A;  1P6S A;  3D8D A;  2GS0 A;  2BCJ A;  5HE3 A;  4YON A;  1RRP B;  1WGU A;  4HB4 B;  5FI0 A;  4XWX A;  5CLQ B;  1WVH A;  1E5W A;  2P0F A;  1J0W A;  1UNQ A;  4BBK A;  4PNK A;  1Y19 B;  2I1J A;  1K5G B;  2CY4 A;  3PVW A;  1WI1 A;  1FHO A;  3DXC A;  2MKR A;  4H8S A;  2D11 A;  5J3Y A;  2RNR B;  2COC A;  2R0D A;  1V5U A;  1MAI A;  1U5D A;  2LOZ A;  4F7H A;  4EKU A;  3HQC A;  1FGY A;  1J19 A;  4K17 A;  2K2U A;  1U2B A;  3PVU A;  1ZC3 B;  1U29 A;  3PVL A;  1ZSQ A;  1MK7 B;  3PP2 A;  1X05 A;  4HB3 B;  5DI9 B;  1WJM A;  2DX1 A;  3GYO A;  4F7U P;  2COF A;  3ULC A;  5L81 A;  4HB0 B;  3RCP A;  3SV1 A;  1V88 A;  1MIZ B;  4A6F A;  3G9W A;  3DXD A;  1FHX A;  1FGZ A;  4GXB A;  2I5F A;  1XX0 A;  2H7D A;  4A5K A;  2MFQ A;  2QKM A;  3DXE A;  1LB1 A;  3KZ1 A;  1Z87 A;  2YRY A;  4KHB B;  4TKN A;  2HE7 A;  2ELA A;  2OQB A;  2AEH A;  4GN1 A;  2ELB A;  2LKO A;  2DHJ A;  3BIN A;  5LON B;  3CIK A;  2LG1 A;  4F7G A;  2L2I A;  5C5B A;  1B55 A;  3ML4 A;  4GMV A;  2DX5 A;  1EVH A;  5KCV A;  3U7D A;  4YL8 A;  2J0M A;  3TFM A;  1WJ1 A;  2N23 A;  4ZRK A;  3P7Z A;  4HDQ A;  1SGH A;  4Z2M B;  5DH9 B;  1X86 A;  3ODO A;  2KCJ A;  2YT1 A;  3ODX A;  1MKE A;  5DHF B;  2P0H A;  2QKL A;  2UZS A;  1XKE A;  3A98 B;  4K2P A;  4IAP A;  2DHI A;  4WJ7 A;  2DN6 A;  3V5W A;  1U27 A;  3BJI A;  1K5D B;  5C6R A;  3KSY A;  2DLW A;  4HB2 B;  2EJ8 A;  2LUL A;  3ZDT A;  2H7E A;  3PEG A;  4KAX B;  1I7A A;  5FI1 A;  1UEF A;  3ODW A;  2EC1 A;  1XR0 B;  2P0D A;  2DHK A;  5KQ1 A;  2GJY A;  1DRO A;  1P3R A;  1OY2 A;  2COA A;  5D3Y A;  2W2W A;  2Y7B A;  2D9V A;  2NMB A;  1WG7 A;  4MY6 A;  2EMS A;  1EF1 A;  2KGX B;  1DDM A;  3T06 A;  2K00 A;  2ROZ B;  2D4Q A;  2DYN A;  1X1F A;  2UZR A;  4HAT B;  4IOY X;  2DTC A;  4D0N B;  3OAN A;  4A6F B;  1BTN A;  1WGQ A;  1EAZ A;  3F5R A;  3GYP A;  2DA0 A;  1FOE A;  1DBH A;  5JP4 A;  1W1D A;  1U5G A;  3D8F A;  4A6H A;  1Q67 A;  5D3X A;  3N7C A;  2L1C A;  1IRS A;  3PSC A;  2D9Z A;  1ZC4 B;  2COD A;  4GZU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...