1U5GA

Crystal structure of the ph domain of skap-hom
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
115
structure length
115
Chain Sequence
QFPPIAAQDLPFVIKAGYLEKRRKDHSFLGFEWQKRWCALSKTVFYYYGSDKDKQQKGEFAIDGYDVRMNNTLRKDGKKDCCFEICAPDKRIYQFTAASPKDAEEWVQQLKFILQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Skap-hom dimerization and PH domains comprise a 3'-phosphoinositide-gated molecular switch.
pubmed doi rcsb
source organism Mus musculus
molecule tags Signaling protein
molecule keywords Src-associated adaptor protein
total genus 26
structure length 115
sequence length 115
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2004-07-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00169 PH PH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 1u5gA01
2X18A 3SYXA 4KAXB 4IFSA 3OANA 2GJYA 4PNKA 4GPTB 4A5KA 4HHVA 1RRPB 5C79A 1AWEA 1FB8A 1FOEA 3AU5A 2W2XD 1J0WA 4D0NB 4XWXA 2W2XC 5L81A 1DROA 2COAA 2RGNB 2K2UA 3O96A 3PVLA 5HE1A 3D8DA 2CRFA 4KVGB 3KY9A 1RJ2A 1ZM0A 2ROVA 3CIKA 3A8QA 5J3TA 2YS1A 2QKMA 4HAVB 3GYOA 1XD4A 2RLOA 2H7DA 2R09A 3GYPA 5FI0A 1MIZB 3D8FA 1UNPA 2CY4A 3IVFA 1PLSA 2J0MA 1FAOA 5DI9B 4CHMA 5LOPB 5C5BB 2DLWA 4EJNA 1X1FA 1IRSA 3DXDA 4KHBB 2M14A 3ODXA 3TW1A 3D8EA 3T06A 4YONA 1X05A 5JLJB 1X86A 1H10A 1E5WA 2DHKA 4CYEA 2GCLA 2GS0A 4DX8A 3ULBA 2BCJA 2Q13A 2RNRB 2EC1A 2Z0PA 5EFXA 4MK0A 3SUZA 4MT7A 2MKRA 3WYFB 1ZVRA 2RVBB 1U2BA 2LOZA 1TQZA 2J59M 1MK7B 5D3VA 2NZ8B 2D9ZA 1DBHA 3VOQA 4IAPA 3HQCA 5LONB 1NTYA 4PQ0A 2P0DA 2EJ8A 1P5TA 2HE7A 4Z2NA 4IOYX 5JHGA 2LG1A 1X11A 4K81A 3A8PA 4HB0B 5HE2A 1DDWA 1P3RA 1MPHA 3PVWA 2LYDA 4A6HA 3ML4A 1DDVA 1AQCA 4EMOA 2UZSA 2EMTA 4KHOA 2QKLA 2P8VA 3PG7A 2YT0A 3QIJA 2D11A 2ROZB 4ZRJA 1SHCA 2DKPA 1Y5OA 1UPQA 2L2IA 3P6AA 2DN6A 4TKNA 4GZUA 2DKQA 1LB1A 2K00A 4HATB 2KCJA 4TYZA 2AEHA 2AL6A 1BAKA 4GMXB 5C16A 3DXEA 2D2QA 4HB2B 1NU2A 2K2JA 3ZVRA 5DHAB 5JHHA 4WSFA 3PEGA 2GCJA 2LKOA 2LULA 3PZDA 4K2PA 5DIFB 2M38A 1W1GA 4A6KA 1GC7A 1XODA 3TVVA 4HDQA 5DH9B 2DHJA 3MPXA 1ISNA 2YVCA 4HB3B 3F0WA 2COFA 2I5FA 1NTVA 4ZRIA 1P6SA 2IYBA 5JP4A 2FJLA 1V61A 1U5DA 2YS5A 1XX0A 4MY6A 1MKEA 2LOXA 4F7UP 4KHAA 1EAZA 1K5GB 1ZSQA 3ZDTA 3DXCA 3TO1A 1KZGA 1W1HA 3A98B 3PVUA 2CAYA 1H4RA 2HTHB 2N0YA 2I1KA 1V5UA 4HAXB 4F7GA 4HB4B 3G9WA 1X1GA 2E2XA 2YS3A 1OY2A 2P0HA 2RSGA 2D9XA 1WGUA 3KRWA 1WG7A 4ZRKA 3ODOA 2CODA 3BJIA 1N3HA 1SGHA 2DX1A 2YSZA 2ELBA 3ODWA 1FGZA 2G35A 4C0AA 4Y94A 2YRYA 2P0FA 1UEFA 2OTXA 4CHJA 2MWNB 2R0DA 4NY0A 1I7AA 1KZ7A 1U5EA 3BINA 1QC6A 1V89A 3U7DA 1OQNA 2RUKB 2YT1A 1FHOA 2DYQA 4EKUA 4A6FA 1ZC4B 4DXAB 2XQNM 1TJ6A 4Z2MB 1W1DA 5D3XA 3FSSA 2YF0A 1FHWA 3SO6A 1M7EA 5CLQB 5GOWB 3QBVB 1WJMA 3PP2A 2Z0QA 1UNRA 2D9VA 2H7EA 3AU4A 3CXBB 2JP2A 1V5MA 1ZC3B 1FGYA 2ZPYA 3KSYA 2UVMA 3KRXA 1EF1A 1UNQA 1FHXA 1PMSA 2L1CA 1GC6A 2D4QA 2ADZA 3KZ1A 4YL8A 4BBKA 2D10A 4WVFB 5C6RA 3TFMA 1U5FA 3NSUA 2CY5A 3QWMA 1LW3A 4DX90 2ELAA 3F5RA 5J3QA 4HAZB 1EGXA 3VIAA 3M1IB 4GN1A 3RCPA 3FEHA 3UZTA 2DYNA 1U27A 1MIXA 4DBBA 1B55A 1BWNA 1XCGA 4H8SA 2D9WA 1U29A 4WJ7A 1WVHA 2PZ1A 4L6EA 1XKEA 1WI1A 2COCA 3FM8C 1OMWA 3HW2B 5C5BA 1XR0B 3HK0A 5KCVA 2IFSA 2KUPA 5CLLB 4HDOA 1UPRA 1MAIA 2Y8FA 3N7CA 4GXBA 2DFKA 1QQGA 3V5WA 5HE0A 5KQ4A 5HE3A 1U5GA 5D3YA 1KI1B 4K17A 2I5CA 3SNHA 5J3YA 1J19A 1GG3A 2Y7BA 1WGQA 3P7ZA 3U8ZA 5DHFB 2UZRA 3PSCA 2DTCA 2OQBA 1EVHA 1Y19B 1BTNA 1WJ1A 1DYNA 4GMVA 4HAUB 3MDBC 3WA0A 2KGXB 1PFJA 5FI1A 1NI2A 2W2WA 1DDMA 2MFQA 2V76A 2Y8GA 1I2HA 2D9YA 3LJUX 1V5PA 2I1JA 4B6HA 2NMBA 4HAYB 2VKIA 4K2OA 5KQ1A 1V88A 4P7IA 4NSWA 3ULCA 1MK9B 1M7RA 4HAWB 3X23A 1BTKA 4F7HA 3AJ4A 3TCAA 2N23A 2DX5A 2DHIA 2EMSA 2J0KA 4A6FB 2DA0A 3SV1A 2MDXA 5D27A 5D3WA 2Z0OA 1K5DB 1TXDA 1Q67A 2VSZA 2J0JA 1Z87A 2VRWB
chains in the Genus database with same CATH superfamily
2X18A 3SYXA 4KAXB 4IFSA 3OANA 2GJYA 4PNKA 4GPTB 4A5KA 4HHVA 1RRPB 5C79A 1AWEA 1FB8A 4HSIA 1FOEA 3AU5A 2W2XD 1J0WA 4D0NB 4XWXA 2W2XC 5L81A 1DROA 2COAA 2RGNB 2K2UA 2KIEA 3O96A 3PVLA 5HE1A 3D8DA 2CRFA 4KVGB 3KY9A 1RJ2A 1ZM0A 2ROVA 3CIKA 3A8QA 5J3TA 2YS1A 2QKMA 4HAVB 3GYOA 1XD4A 3NWAA 2RLOA 3NWDA 2H7DA 2R09A 3FVCA 3GYPA 5FI0A 3HSAA 1MIZB 3D8FA 5I2MA 1UNPA 2CY4A 3IVFA 1PLSA 2J0MA 1FAOA 5DI9B 4CHMA 5LOPB 5C5BB 2DLWA 4EJNA 1X1FA 1IRSA 3DXDA 4KHBB 2M14A 3ODXA 3TW1A 3D8EA 3T06A 4YONA 1X05A 5JLJB 3DCXA 1X86A 5M4YB 1H10A 1E5WA 2DHKA 4CYEA 2GCLA 2GS0A 4DX8A 4QJ5B 3ULBA 2BCJA 2Q13A 4GNKB 2RNRB 2EC1A 2Z0PA 5EFXA 4MK0A 3SUZA 4MT7A 2MKRA 3WYFB 1ZVRA 2RVBB 1U2BA 2LOZA 1TQZA 2J59M 1MK7B 5D3VA 2NZ8B 2D9ZA 1DBHA 2Z13A 3VOQA 2NBVA 4IAPA 3HQCA 5LONB 1NTYA 1ZYIA 4PQ0A 2P0DA 2EJ8A 2KIGA 1P5TA 2KUQA 2HE7A 4CSQA 4Z2NA 4IOYX 5JHGA 2LG1A 3U12A 1X11A 4K81A 3A8PA 4HB0B 5HE2A 5IRSA 1DDWA 1P3RA 1MPHA 3PVWA 2LYDA 2K8EA 4A6HA 3ML4A 1DDVA 1AQCA 4EMOA 3OHMB 4OT1A 2UZSA 2EMTA 4KHOA 2QKLA 2P8VA 3NWFA 2YT0A 3PG7A 3QIJA 2D11A 2ROZB 4ZRJA 1SHCA 2DKPA 1Y5OA 2KR0A 3NW8A 1UPQA 2L2IA 3P6AA 2DN6A 4TKNA 4GZUA 2DKQA 1LB1A 2K00A 4HATB 2KCJA 4TYZA 2AEHA 2AL6A 1BAKA 4GMXB 5C16A 3DXEA 2D2QA 4HB2B 1NU2A 2K2JA 3ZVRA 5DHAB 5JHHA 4WSFA 1T77A 2FJUB 3PEGA 2GCJA 2LKOA 2K49A 2LULA 3PZDA 4K2PA 5DIFB 4DIXA 2M38A 1W1GA 4A6KA 1GC7A 1XODA 3TVVA 4HDQA 5DH9B 2DHJA 3MPXA 1ISNA 2YVCA 4HB3B 3F0WA 2COFA 2I5FA 1NTVA 4ZRIA 1P6SA 1MI1A 2IYBA 5JP4A 2FJLA 1V61A 1U5DA 2YS5A 1XX0A 4MY6A 1MKEA 2LOXA 4F7UP 4KHAA 1EAZA 1K5GB 1ZSQA 3ZDTA 2R2YA 3DXCA 3TO1A 1KZGA 1W1HA 3A98B 3PVUA 2CAYA 1H4RA 2HTHB 2N0YA 2I1KA 1V5UA 2YT2A 2RRFA 4HAXB 4F7GA 4HB4B 3G9WA 1X1GA 2E2XA 2YS3A 1OY2A 2P0HA 2RSGA 2D9XA 1WGUA 3KRWA 3HIEA 1WG7A 4ZRKA 3ODOA 2CODA 3BJIA 1N3HA 1SGHA 2DX1A 2YSZA 3A58A 2ELBA 3ODWA 1FGZA 2G35A 4C0AA 3B77A 4Y94A 2YRYA 2P0FA 1UEFA 2OTXA 4CHJA 2MWNB 2R0DA 2Z4DA 4NY0A 1I7AA 1KZ7A 1U5EA 3BINA 1QC6A 1V89A 3U7DA 1OQNA 2RUKB 2YT1A 1FHOA 4OSNA 2DYQA 4EKUA 4A6FA 1ZC4B 4DXAB 2XQNM 1TJ6A 4Z2MB 1W1DA 5D3XA 3FSSA 2YF0A 1FHWA 3SO6A 1M7EA 5CLQB 5GOWB 3QBVB 1WJMA 3PP2A 2Z0QA 1UNRA 2D9VA 2H7EA 3AU4A 3CXBB 4L1RA 2JP2A 1V5MA 1ZC3B 5I2SA 1FGYA 2Z59A 2ZPYA 3KSYA 2UVMA 3KRXA 1EF1A 1UNQA 1FHXA 1PMSA 2L1CA 1GC6A 2D4QA 2ADZA 3KZ1A 4YL8A 4BBKA 2D10A 4WVFB 5C6RA 3TFMA 1U5FA 3NSUA 2CY5A 3QWMA 1LW3A 4DX90 2ELAA 3F5RA 5LG4B 5J3QA 4HAZB 1EGXA 3VIAA 3M1IB 4GN1A 3RCPA 3FEHA 3UZTA 2DYNA 1U27A 1MIXA 4DBBA 1B55A 1BWNA 2Z14A 1XCGA 2D9WA 1U29A 4H8SA 4KHBA 4WJ7A 1WVHA 2PZ1A 4L6EA 1XKEA 1WI1A 2COCA 3FM8C 1OMWA 3HW2B 4GOUA 5C5BA 1XR0B 3HK0A 5KCVA 2IFSA 2KUPA 5CLLB 4HDOA 1UPRA 1MAIA 2Y8FA 3N7CA 4GXBA 2GUMA 2DFKA 1QQGA 3V5WA 5HE0A 5KQ4A 5HE3A 1U5GA 5D3YA 1KI1B 4K17A 2I5CA 3SNHA 5J3YA 1J19A 1GG3A 2Y7BA 1WGQA 3P7ZA 3U8ZA 5DHFB 2UZRA 3PSCA 2DTCA 2OQBA 1EVHA 1Y19B 1BTNA 1WJ1A 1DYNA 4D6WA 4GMVA 4HAUB 3MDBC 3WA0A 2KGXB 1PFJA 5FI1A 1NI2A 2W2WA 1DDMA 2MFQA 2V76A 2Y8GA 1I2HA 2D9YA 3LJUX 1V5PA 2I1JA 4B6HA 2NMBA 4HAYB 2VKIA 2ZKMX 4K2OA 5KQ1A 1V88A 4P7IA 4NSWA 3ULCA 1MK9B 1M7RA 4HAWB 3X23A 1BTKA 4F7HA 3AJ4A 3TCAA 2N23A 2DX5A 2DHIA 2EMSA 2J0KA 4A6FB 2DA0A 3SV1A 2MDXA 4QJ4B 5D27A 5D3WA 2Z0OA 1K5DB 4QJ3B 1TXDA 1Q67A 2VSZA 2J0JA 1Z87A 2VRWB 4QXAB
chains in the Genus database with same CATH topology
2X18A 3SYXA 4KAXB 4IFSA 3OANA 2GJYA 4PNKA 4GPTB 4A5KA 4HHVA 1RRPB 5C79A 1AWEA 1FB8A 1FOEA 3AU5A 2W2XD 1J0WA 4D0NB 4XWXA 2W2XC 5L81A 1DROA 2COAA 2RGNB 2K2UA 3O96A 3PVLA 5HE1A 3D8DA 2CRFA 4KVGB 3KY9A 1RJ2A 1ZM0A 2ROVA 3CIKA 3A8QA 5J3TA 2YS1A 2QKMA 4HAVB 3GYOA 1XD4A 2RLOA 2H7DA 2R09A 3GYPA 5FI0A 1MIZB 3D8FA 1UNPA 2CY4A 3IVFA 1PLSA 2J0MA 1FAOA 5DI9B 4CHMA 5LOPB 5C5BB 2DLWA 4EJNA 1X1FA 1IRSA 3DXDA 4KHBB 2M14A 3ODXA 3TW1A 3D8EA 3T06A 4YONA 1X05A 5JLJB 1X86A 1H10A 1E5WA 2DHKA 4CYEA 2GCLA 2GS0A 4DX8A 3ULBA 2BCJA 2Q13A 2RNRB 2EC1A 2Z0PA 5EFXA 4MK0A 3SUZA 4MT7A 2MKRA 3WYFB 1ZVRA 2RVBB 1U2BA 2LOZA 1TQZA 2J59M 1MK7B 5D3VA 2NZ8B 2D9ZA 1DBHA 3VOQA 4IAPA 3HQCA 5LONB 1NTYA 4PQ0A 2P0DA 2EJ8A 1P5TA 2HE7A 4Z2NA 4IOYX 5JHGA 2LG1A 1X11A 4K81A 3A8PA 4HB0B 5HE2A 1DDWA 1P3RA 1MPHA 3PVWA 2LYDA 4A6HA 3ML4A 1DDVA 1AQCA 4EMOA 2UZSA 2EMTA 4KHOA 2QKLA 2P8VA 3PG7A 2YT0A 3QIJA 2D11A 2ROZB 4ZRJA 1SHCA 2DKPA 1Y5OA 1UPQA 2L2IA 3P6AA 2DN6A 4TKNA 4GZUA 2DKQA 1LB1A 2K00A 4HATB 2KCJA 4TYZA 2AEHA 2AL6A 1BAKA 4GMXB 5C16A 3DXEA 2D2QA 4HB2B 1NU2A 2K2JA 3ZVRA 5DHAB 5JHHA 4WSFA 3PEGA 2GCJA 2LKOA 2LULA 3PZDA 4K2PA 5DIFB 2M38A 1W1GA 4A6KA 1GC7A 1XODA 3TVVA 4HDQA 5DH9B 2DHJA 3MPXA 1ISNA 2YVCA 4HB3B 3F0WA 2COFA 2I5FA 1NTVA 4ZRIA 1P6SA 2IYBA 5JP4A 2FJLA 1V61A 1U5DA 2YS5A 1XX0A 4MY6A 1MKEA 2LOXA 4F7UP 4KHAA 1EAZA 1K5GB 1ZSQA 3ZDTA 3DXCA 3TO1A 1KZGA 1W1HA 3A98B 3PVUA 2CAYA 1H4RA 2HTHB 2N0YA 2I1KA 1V5UA 4HAXB 4F7GA 4HB4B 3G9WA 1X1GA 2E2XA 2YS3A 1OY2A 2P0HA 2RSGA 2D9XA 1WGUA 3KRWA 1WG7A 4ZRKA 3ODOA 2CODA 3BJIA 1N3HA 1SGHA 2DX1A 2YSZA 2ELBA 3ODWA 1FGZA 2G35A 4C0AA 4Y94A 2YRYA 2P0FA 1UEFA 2OTXA 4CHJA 2MWNB 2R0DA 4NY0A 1I7AA 1KZ7A 1U5EA 3BINA 1QC6A 1V89A 3U7DA 1OQNA 2RUKB 2YT1A 1FHOA 2DYQA 4EKUA 4A6FA 1ZC4B 4DXAB 2XQNM 1TJ6A 4Z2MB 1W1DA 5D3XA 3FSSA 2YF0A 1FHWA 3SO6A 1M7EA 5CLQB 5GOWB 3QBVB 1WJMA 3PP2A 2Z0QA 1UNRA 2D9VA 2H7EA 3AU4A 3CXBB 2JP2A 1V5MA 1ZC3B 1FGYA 2ZPYA 3KSYA 2UVMA 3KRXA 1EF1A 1UNQA 1FHXA 1PMSA 2L1CA 1GC6A 2D4QA 2ADZA 3KZ1A 4YL8A 4BBKA 2D10A 4WVFB 5C6RA 3TFMA 1U5FA 3NSUA 2CY5A 3QWMA 1LW3A 4DX90 2ELAA 3F5RA 5J3QA 4HAZB 1EGXA 3VIAA 3M1IB 4GN1A 3RCPA 3FEHA 3UZTA 2DYNA 1U27A 1MIXA 4DBBA 1B55A 1BWNA 1XCGA 4H8SA 2D9WA 1U29A 4WJ7A 1WVHA 2PZ1A 4L6EA 1XKEA 1WI1A 2COCA 3FM8C 1OMWA 3HW2B 5C5BA 1XR0B 3HK0A 5KCVA 2IFSA 2KUPA 5CLLB 4HDOA 1UPRA 1MAIA 2Y8FA 3N7CA 4GXBA 2DFKA 1QQGA 3V5WA 5HE0A 5KQ4A 5HE3A 1U5GA 5D3YA 1KI1B 4K17A 2I5CA 3SNHA 5J3YA 1J19A 1GG3A 2Y7BA 1WGQA 3P7ZA 3U8ZA 5DHFB 2UZRA 3PSCA 2DTCA 2OQBA 1EVHA 1Y19B 1BTNA 1WJ1A 1DYNA 4GMVA 4HAUB 3MDBC 3WA0A 2KGXB 1PFJA 5FI1A 1NI2A 2W2WA 1DDMA 2MFQA 2V76A 2Y8GA 1I2HA 2D9YA 3LJUX 1V5PA 2I1JA 4B6HA 2NMBA 4HAYB 2VKIA 4K2OA 5KQ1A 1V88A 4P7IA 4NSWA 3ULCA 1MK9B 1M7RA 4HAWB 3X23A 1BTKA 4F7HA 3AJ4A 3TCAA 2N23A 2DX5A 2DHIA 2EMSA 2J0KA 4A6FB 2DA0A 3SV1A 2MDXA 5D27A 5D3WA 2Z0OA 1K5DB 1TXDA 1Q67A 2VSZA 2J0JA 1Z87A 2VRWB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2X18 A;  3SYX A;  4KAX B;  4IFS A;  3OAN A;  2GJY A;  4PNK A;  4GPT B;  4A5K A;  4HHV A;  1RRP B;  5C79 A;  1AWE A;  1FB8 A;  1FOE A;  3AU5 A;  2W2X D;  1J0W A;  4D0N B;  4XWX A;  2W2X C;  5L81 A;  1DRO A;  2COA A;  2RGN B;  2K2U A;  3O96 A;  3PVL A;  5HE1 A;  3D8D A;  2CRF A;  4KVG B;  3KY9 A;  1RJ2 A;  1ZM0 A;  2ROV A;  3CIK A;  3A8Q A;  5J3T A;  2YS1 A;  2QKM A;  4HAV B;  3GYO A;  1XD4 A;  2RLO A;  2H7D A;  2R09 A;  3GYP A;  5FI0 A;  1MIZ B;  3D8F A;  1UNP A;  2CY4 A;  3IVF A;  1PLS A;  2J0M A;  1FAO A;  5DI9 B;  4CHM A;  5LOP B;  5C5B B;  2DLW A;  4EJN A;  1X1F A;  1IRS A;  3DXD A;  4KHB B;  2M14 A;  3ODX A;  3TW1 A;  3D8E A;  3T06 A;  4YON A;  1X05 A;  5JLJ B;  1X86 A;  1H10 A;  1E5W A;  2DHK A;  4CYE A;  2GCL A;  2GS0 A;  4DX8 A;  3ULB A;  2BCJ A;  2Q13 A;  2RNR B;  2EC1 A;  2Z0P A;  5EFX A;  4MK0 A;  3SUZ A;  4MT7 A;  2MKR A;  3WYF B;  1ZVR A;  2RVB B;  1U2B A;  2LOZ A;  1TQZ A;  2J59 M;  1MK7 B;  5D3V A;  2NZ8 B;  2D9Z A;  1DBH A;  3VOQ A;  4IAP A;  3HQC A;  5LON B;  1NTY A;  4PQ0 A;  2P0D A;  2EJ8 A;  1P5T A;  2HE7 A;  4Z2N A;  4IOY X;  5JHG A;  2LG1 A;  1X11 A;  4K81 A;  3A8P A;  4HB0 B;  5HE2 A;  1DDW A;  1P3R A;  1MPH A;  3PVW A;  2LYD A;  4A6H A;  3ML4 A;  1DDV A;  1AQC A;  4EMO A;  2UZS A;  2EMT A;  4KHO A;  2QKL A;  2P8V A;  3PG7 A;  2YT0 A;  3QIJ A;  2D11 A;  2ROZ B;  4ZRJ A;  1SHC A;  2DKP A;  1Y5O A;  1UPQ A;  2L2I A;  3P6A A;  2DN6 A;  4TKN A;  4GZU A;  2DKQ A;  1LB1 A;  2K00 A;  4HAT B;  2KCJ A;  4TYZ A;  2AEH A;  2AL6 A;  1BAK A;  4GMX B;  5C16 A;  3DXE A;  2D2Q A;  4HB2 B;  1NU2 A;  2K2J A;  3ZVR A;  5DHA B;  5JHH A;  4WSF A;  3PEG A;  2GCJ A;  2LKO A;  2LUL A;  3PZD A;  4K2P A;  5DIF B;  2M38 A;  1W1G A;  4A6K A;  1GC7 A;  1XOD A;  3TVV A;  4HDQ A;  5DH9 B;  2DHJ A;  3MPX A;  1ISN A;  2YVC A;  4HB3 B;  3F0W A;  2COF A;  2I5F A;  1NTV A;  4ZRI A;  1P6S A;  2IYB A;  5JP4 A;  2FJL A;  1V61 A;  1U5D A;  2YS5 A;  1XX0 A;  4MY6 A;  1MKE A;  2LOX A;  4F7U P;  4KHA A;  1EAZ A;  1K5G B;  1ZSQ A;  3ZDT A;  3DXC A;  3TO1 A;  1KZG A;  1W1H A;  3A98 B;  3PVU A;  2CAY A;  1H4R A;  2HTH B;  2N0Y A;  2I1K A;  1V5U A;  4HAX B;  4F7G A;  4HB4 B;  3G9W A;  1X1G A;  2E2X A;  2YS3 A;  1OY2 A;  2P0H A;  2RSG A;  2D9X A;  1WGU A;  3KRW A;  1WG7 A;  4ZRK A;  3ODO A;  2COD A;  3BJI A;  1N3H A;  1SGH A;  2DX1 A;  2YSZ A;  2ELB A;  3ODW A;  1FGZ A;  2G35 A;  4C0A A;  4Y94 A;  2YRY A;  2P0F A;  1UEF A;  2OTX A;  4CHJ A;  2MWN B;  2R0D A;  4NY0 A;  1I7A A;  1KZ7 A;  1U5E A;  3BIN A;  1QC6 A;  1V89 A;  3U7D A;  1OQN A;  2RUK B;  2YT1 A;  1FHO A;  2DYQ A;  4EKU A;  4A6F A;  1ZC4 B;  4DXA B;  2XQN M;  1TJ6 A;  4Z2M B;  1W1D A;  5D3X A;  3FSS A;  2YF0 A;  1FHW A;  3SO6 A;  1M7E A;  5CLQ B;  5GOW B;  3QBV B;  1WJM A;  3PP2 A;  2Z0Q A;  1UNR A;  2D9V A;  2H7E A;  3AU4 A;  3CXB B;  2JP2 A;  1V5M A;  1ZC3 B;  1FGY A;  2ZPY A;  3KSY A;  2UVM A;  3KRX A;  1EF1 A;  1UNQ A;  1FHX A;  1PMS A;  2L1C A;  1GC6 A;  2D4Q A;  2ADZ A;  3KZ1 A;  4YL8 A;  4BBK A;  2D10 A;  4WVF B;  5C6R A;  3TFM A;  1U5F A;  3NSU A;  2CY5 A;  3QWM A;  1LW3 A;  4DX9 0;  2ELA A;  3F5R A;  5J3Q A;  4HAZ B;  1EGX A;  3VIA A;  3M1I B;  4GN1 A;  3RCP A;  3FEH A;  3UZT A;  2DYN A;  1U27 A;  1MIX A;  4DBB A;  1B55 A;  1BWN A;  1XCG A;  4H8S A;  2D9W A;  1U29 A;  4WJ7 A;  1WVH A;  2PZ1 A;  4L6E A;  1XKE A;  1WI1 A;  2COC A;  3FM8 C;  1OMW A;  3HW2 B;  5C5B A;  1XR0 B;  3HK0 A;  5KCV A;  2IFS A;  2KUP A;  5CLL B;  4HDO A;  1UPR A;  1MAI A;  2Y8F A;  3N7C A;  4GXB A;  2DFK A;  1QQG A;  3V5W A;  5HE0 A;  5KQ4 A;  5HE3 A;  1U5G A;  5D3Y A;  1KI1 B;  4K17 A;  2I5C A;  3SNH A;  5J3Y A;  1J19 A;  1GG3 A;  2Y7B A;  1WGQ A;  3P7Z A;  3U8Z A;  5DHF B;  2UZR A;  3PSC A;  2DTC A;  2OQB A;  1EVH A;  1Y19 B;  1BTN A;  1WJ1 A;  1DYN A;  4GMV A;  4HAU B;  3MDB C;  3WA0 A;  2KGX B;  1PFJ A;  5FI1 A;  1NI2 A;  2W2W A;  1DDM A;  2MFQ A;  2V76 A;  2Y8G A;  1I2H A;  2D9Y A;  3LJU X;  1V5P A;  2I1J A;  4B6H A;  2NMB A;  4HAY B;  2VKI A;  4K2O A;  5KQ1 A;  1V88 A;  4P7I A;  4NSW A;  3ULC A;  1MK9 B;  1M7R A;  4HAW B;  3X23 A;  1BTK A;  4F7H A;  3AJ4 A;  3TCA A;  2N23 A;  2DX5 A;  2DHI A;  2EMS A;  2J0K A;  4A6F B;  2DA0 A;  3SV1 A;  2MDX A;  5D27 A;  5D3W A;  2Z0O A;  1K5D B;  1TXD A;  1Q67 A;  2VSZ A;  2J0J A;  1Z87 A;  2VRW B; 
#chains in the Genus database with same CATH topology
 2X18 A;  3SYX A;  4KAX B;  4IFS A;  3OAN A;  2GJY A;  4PNK A;  4GPT B;  4A5K A;  4HHV A;  1RRP B;  5C79 A;  1AWE A;  1FB8 A;  4HSI A;  1FOE A;  3AU5 A;  2W2X D;  1J0W A;  4D0N B;  4XWX A;  2W2X C;  5L81 A;  1DRO A;  2COA A;  2RGN B;  2K2U A;  2KIE A;  3O96 A;  3PVL A;  5HE1 A;  3D8D A;  2CRF A;  4KVG B;  3KY9 A;  1RJ2 A;  1ZM0 A;  2ROV A;  3CIK A;  3A8Q A;  5J3T A;  2YS1 A;  2QKM A;  4HAV B;  3GYO A;  1XD4 A;  3NWA A;  2RLO A;  3NWD A;  2H7D A;  2R09 A;  3FVC A;  3GYP A;  5FI0 A;  3HSA A;  1MIZ B;  3D8F A;  5I2M A;  1UNP A;  2CY4 A;  3IVF A;  1PLS A;  2J0M A;  1FAO A;  5DI9 B;  4CHM A;  5LOP B;  5C5B B;  2DLW A;  4EJN A;  1X1F A;  1IRS A;  3DXD A;  4KHB B;  2M14 A;  3ODX A;  3TW1 A;  3D8E A;  3T06 A;  4YON A;  1X05 A;  5JLJ B;  3DCX A;  1X86 A;  5M4Y B;  1H10 A;  1E5W A;  2DHK A;  4CYE A;  2GCL A;  2GS0 A;  4DX8 A;  4QJ5 B;  3ULB A;  2BCJ A;  2Q13 A;  4GNK B;  2RNR B;  2EC1 A;  2Z0P A;  5EFX A;  4MK0 A;  3SUZ A;  4MT7 A;  2MKR A;  3WYF B;  1ZVR A;  2RVB B;  1U2B A;  2LOZ A;  1TQZ A;  2J59 M;  1MK7 B;  5D3V A;  2NZ8 B;  2D9Z A;  1DBH A;  2Z13 A;  3VOQ A;  2NBV A;  4IAP A;  3HQC A;  5LON B;  1NTY A;  1ZYI A;  4PQ0 A;  2P0D A;  2EJ8 A;  2KIG A;  1P5T A;  2KUQ A;  2HE7 A;  4CSQ A;  4Z2N A;  4IOY X;  5JHG A;  2LG1 A;  3U12 A;  1X11 A;  4K81 A;  3A8P A;  4HB0 B;  5HE2 A;  5IRS A;  1DDW A;  1P3R A;  1MPH A;  3PVW A;  2LYD A;  2K8E A;  4A6H A;  3ML4 A;  1DDV A;  1AQC A;  4EMO A;  3OHM B;  4OT1 A;  2UZS A;  2EMT A;  4KHO A;  2QKL A;  2P8V A;  3NWF A;  2YT0 A;  3PG7 A;  3QIJ A;  2D11 A;  2ROZ B;  4ZRJ A;  1SHC A;  2DKP A;  1Y5O A;  2KR0 A;  3NW8 A;  1UPQ A;  2L2I A;  3P6A A;  2DN6 A;  4TKN A;  4GZU A;  2DKQ A;  1LB1 A;  2K00 A;  4HAT B;  2KCJ A;  4TYZ A;  2AEH A;  2AL6 A;  1BAK A;  4GMX B;  5C16 A;  3DXE A;  2D2Q A;  4HB2 B;  1NU2 A;  2K2J A;  3ZVR A;  5DHA B;  5JHH A;  4WSF A;  1T77 A;  2FJU B;  3PEG A;  2GCJ A;  2LKO A;  2K49 A;  2LUL A;  3PZD A;  4K2P A;  5DIF B;  4DIX A;  2M38 A;  1W1G A;  4A6K A;  1GC7 A;  1XOD A;  3TVV A;  4HDQ A;  5DH9 B;  2DHJ A;  3MPX A;  1ISN A;  2YVC A;  4HB3 B;  3F0W A;  2COF A;  2I5F A;  1NTV A;  4ZRI A;  1P6S A;  1MI1 A;  2IYB A;  5JP4 A;  2FJL A;  1V61 A;  1U5D A;  2YS5 A;  1XX0 A;  4MY6 A;  1MKE A;  2LOX A;  4F7U P;  4KHA A;  1EAZ A;  1K5G B;  1ZSQ A;  3ZDT A;  2R2Y A;  3DXC A;  3TO1 A;  1KZG A;  1W1H A;  3A98 B;  3PVU A;  2CAY A;  1H4R A;  2HTH B;  2N0Y A;  2I1K A;  1V5U A;  2YT2 A;  2RRF A;  4HAX B;  4F7G A;  4HB4 B;  3G9W A;  1X1G A;  2E2X A;  2YS3 A;  1OY2 A;  2P0H A;  2RSG A;  2D9X A;  1WGU A;  3KRW A;  3HIE A;  1WG7 A;  4ZRK A;  3ODO A;  2COD A;  3BJI A;  1N3H A;  1SGH A;  2DX1 A;  2YSZ A;  3A58 A;  2ELB A;  3ODW A;  1FGZ A;  2G35 A;  4C0A A;  3B77 A;  4Y94 A;  2YRY A;  2P0F A;  1UEF A;  2OTX A;  4CHJ A;  2MWN B;  2R0D A;  2Z4D A;  4NY0 A;  1I7A A;  1KZ7 A;  1U5E A;  3BIN A;  1QC6 A;  1V89 A;  3U7D A;  1OQN A;  2RUK B;  2YT1 A;  1FHO A;  4OSN A;  2DYQ A;  4EKU A;  4A6F A;  1ZC4 B;  4DXA B;  2XQN M;  1TJ6 A;  4Z2M B;  1W1D A;  5D3X A;  3FSS A;  2YF0 A;  1FHW A;  3SO6 A;  1M7E A;  5CLQ B;  5GOW B;  3QBV B;  1WJM A;  3PP2 A;  2Z0Q A;  1UNR A;  2D9V A;  2H7E A;  3AU4 A;  3CXB B;  4L1R A;  2JP2 A;  1V5M A;  1ZC3 B;  5I2S A;  1FGY A;  2Z59 A;  2ZPY A;  3KSY A;  2UVM A;  3KRX A;  1EF1 A;  1UNQ A;  1FHX A;  1PMS A;  2L1C A;  1GC6 A;  2D4Q A;  2ADZ A;  3KZ1 A;  4YL8 A;  4BBK A;  2D10 A;  4WVF B;  5C6R A;  3TFM A;  1U5F A;  3NSU A;  2CY5 A;  3QWM A;  1LW3 A;  4DX9 0;  2ELA A;  3F5R A;  5LG4 B;  5J3Q A;  4HAZ B;  1EGX A;  3VIA A;  3M1I B;  4GN1 A;  3RCP A;  3FEH A;  3UZT A;  2DYN A;  1U27 A;  1MIX A;  4DBB A;  1B55 A;  1BWN A;  2Z14 A;  1XCG A;  2D9W A;  1U29 A;  4H8S A;  4KHB A;  4WJ7 A;  1WVH A;  2PZ1 A;  4L6E A;  1XKE A;  1WI1 A;  2COC A;  3FM8 C;  1OMW A;  3HW2 B;  4GOU A;  5C5B A;  1XR0 B;  3HK0 A;  5KCV A;  2IFS A;  2KUP A;  5CLL B;  4HDO A;  1UPR A;  1MAI A;  2Y8F A;  3N7C A;  4GXB A;  2GUM A;  2DFK A;  1QQG A;  3V5W A;  5HE0 A;  5KQ4 A;  5HE3 A;  1U5G A;  5D3Y A;  1KI1 B;  4K17 A;  2I5C A;  3SNH A;  5J3Y A;  1J19 A;  1GG3 A;  2Y7B A;  1WGQ A;  3P7Z A;  3U8Z A;  5DHF B;  2UZR A;  3PSC A;  2DTC A;  2OQB A;  1EVH A;  1Y19 B;  1BTN A;  1WJ1 A;  1DYN A;  4D6W A;  4GMV A;  4HAU B;  3MDB C;  3WA0 A;  2KGX B;  1PFJ A;  5FI1 A;  1NI2 A;  2W2W A;  1DDM A;  2MFQ A;  2V76 A;  2Y8G A;  1I2H A;  2D9Y A;  3LJU X;  1V5P A;  2I1J A;  4B6H A;  2NMB A;  4HAY B;  2VKI A;  2ZKM X;  4K2O A;  5KQ1 A;  1V88 A;  4P7I A;  4NSW A;  3ULC A;  1MK9 B;  1M7R A;  4HAW B;  3X23 A;  1BTK A;  4F7H A;  3AJ4 A;  3TCA A;  2N23 A;  2DX5 A;  2DHI A;  2EMS A;  2J0K A;  4A6F B;  2DA0 A;  3SV1 A;  2MDX A;  4QJ4 B;  5D27 A;  5D3W A;  2Z0O A;  1K5D B;  4QJ3 B;  1TXD A;  1Q67 A;  2VSZ A;  2J0J A;  1Z87 A;  2VRW B;  4QXA B; 
#chains in the Genus database with same CATH homology
 2X18 A;  3SYX A;  4KAX B;  4IFS A;  3OAN A;  2GJY A;  4PNK A;  4GPT B;  4A5K A;  4HHV A;  1RRP B;  5C79 A;  1AWE A;  1FB8 A;  1FOE A;  3AU5 A;  2W2X D;  1J0W A;  4D0N B;  4XWX A;  2W2X C;  5L81 A;  1DRO A;  2COA A;  2RGN B;  2K2U A;  3O96 A;  3PVL A;  5HE1 A;  3D8D A;  2CRF A;  4KVG B;  3KY9 A;  1RJ2 A;  1ZM0 A;  2ROV A;  3CIK A;  3A8Q A;  5J3T A;  2YS1 A;  2QKM A;  4HAV B;  3GYO A;  1XD4 A;  2RLO A;  2H7D A;  2R09 A;  3GYP A;  5FI0 A;  1MIZ B;  3D8F A;  1UNP A;  2CY4 A;  3IVF A;  1PLS A;  2J0M A;  1FAO A;  5DI9 B;  4CHM A;  5LOP B;  5C5B B;  2DLW A;  4EJN A;  1X1F A;  1IRS A;  3DXD A;  4KHB B;  2M14 A;  3ODX A;  3TW1 A;  3D8E A;  3T06 A;  4YON A;  1X05 A;  5JLJ B;  1X86 A;  1H10 A;  1E5W A;  2DHK A;  4CYE A;  2GCL A;  2GS0 A;  4DX8 A;  3ULB A;  2BCJ A;  2Q13 A;  2RNR B;  2EC1 A;  2Z0P A;  5EFX A;  4MK0 A;  3SUZ A;  4MT7 A;  2MKR A;  3WYF B;  1ZVR A;  2RVB B;  1U2B A;  2LOZ A;  1TQZ A;  2J59 M;  1MK7 B;  5D3V A;  2NZ8 B;  2D9Z A;  1DBH A;  3VOQ A;  4IAP A;  3HQC A;  5LON B;  1NTY A;  4PQ0 A;  2P0D A;  2EJ8 A;  1P5T A;  2HE7 A;  4Z2N A;  4IOY X;  5JHG A;  2LG1 A;  1X11 A;  4K81 A;  3A8P A;  4HB0 B;  5HE2 A;  1DDW A;  1P3R A;  1MPH A;  3PVW A;  2LYD A;  4A6H A;  3ML4 A;  1DDV A;  1AQC A;  4EMO A;  2UZS A;  2EMT A;  4KHO A;  2QKL A;  2P8V A;  3PG7 A;  2YT0 A;  3QIJ A;  2D11 A;  2ROZ B;  4ZRJ A;  1SHC A;  2DKP A;  1Y5O A;  1UPQ A;  2L2I A;  3P6A A;  2DN6 A;  4TKN A;  4GZU A;  2DKQ A;  1LB1 A;  2K00 A;  4HAT B;  2KCJ A;  4TYZ A;  2AEH A;  2AL6 A;  1BAK A;  4GMX B;  5C16 A;  3DXE A;  2D2Q A;  4HB2 B;  1NU2 A;  2K2J A;  3ZVR A;  5DHA B;  5JHH A;  4WSF A;  3PEG A;  2GCJ A;  2LKO A;  2LUL A;  3PZD A;  4K2P A;  5DIF B;  2M38 A;  1W1G A;  4A6K A;  1GC7 A;  1XOD A;  3TVV A;  4HDQ A;  5DH9 B;  2DHJ A;  3MPX A;  1ISN A;  2YVC A;  4HB3 B;  3F0W A;  2COF A;  2I5F A;  1NTV A;  4ZRI A;  1P6S A;  2IYB A;  5JP4 A;  2FJL A;  1V61 A;  1U5D A;  2YS5 A;  1XX0 A;  4MY6 A;  1MKE A;  2LOX A;  4F7U P;  4KHA A;  1EAZ A;  1K5G B;  1ZSQ A;  3ZDT A;  3DXC A;  3TO1 A;  1KZG A;  1W1H A;  3A98 B;  3PVU A;  2CAY A;  1H4R A;  2HTH B;  2N0Y A;  2I1K A;  1V5U A;  4HAX B;  4F7G A;  4HB4 B;  3G9W A;  1X1G A;  2E2X A;  2YS3 A;  1OY2 A;  2P0H A;  2RSG A;  2D9X A;  1WGU A;  3KRW A;  1WG7 A;  4ZRK A;  3ODO A;  2COD A;  3BJI A;  1N3H A;  1SGH A;  2DX1 A;  2YSZ A;  2ELB A;  3ODW A;  1FGZ A;  2G35 A;  4C0A A;  4Y94 A;  2YRY A;  2P0F A;  1UEF A;  2OTX A;  4CHJ A;  2MWN B;  2R0D A;  4NY0 A;  1I7A A;  1KZ7 A;  1U5E A;  3BIN A;  1QC6 A;  1V89 A;  3U7D A;  1OQN A;  2RUK B;  2YT1 A;  1FHO A;  2DYQ A;  4EKU A;  4A6F A;  1ZC4 B;  4DXA B;  2XQN M;  1TJ6 A;  4Z2M B;  1W1D A;  5D3X A;  3FSS A;  2YF0 A;  1FHW A;  3SO6 A;  1M7E A;  5CLQ B;  5GOW B;  3QBV B;  1WJM A;  3PP2 A;  2Z0Q A;  1UNR A;  2D9V A;  2H7E A;  3AU4 A;  3CXB B;  2JP2 A;  1V5M A;  1ZC3 B;  1FGY A;  2ZPY A;  3KSY A;  2UVM A;  3KRX A;  1EF1 A;  1UNQ A;  1FHX A;  1PMS A;  2L1C A;  1GC6 A;  2D4Q A;  2ADZ A;  3KZ1 A;  4YL8 A;  4BBK A;  2D10 A;  4WVF B;  5C6R A;  3TFM A;  1U5F A;  3NSU A;  2CY5 A;  3QWM A;  1LW3 A;  4DX9 0;  2ELA A;  3F5R A;  5J3Q A;  4HAZ B;  1EGX A;  3VIA A;  3M1I B;  4GN1 A;  3RCP A;  3FEH A;  3UZT A;  2DYN A;  1U27 A;  1MIX A;  4DBB A;  1B55 A;  1BWN A;  1XCG A;  4H8S A;  2D9W A;  1U29 A;  4WJ7 A;  1WVH A;  2PZ1 A;  4L6E A;  1XKE A;  1WI1 A;  2COC A;  3FM8 C;  1OMW A;  3HW2 B;  5C5B A;  1XR0 B;  3HK0 A;  5KCV A;  2IFS A;  2KUP A;  5CLL B;  4HDO A;  1UPR A;  1MAI A;  2Y8F A;  3N7C A;  4GXB A;  2DFK A;  1QQG A;  3V5W A;  5HE0 A;  5KQ4 A;  5HE3 A;  1U5G A;  5D3Y A;  1KI1 B;  4K17 A;  2I5C A;  3SNH A;  5J3Y A;  1J19 A;  1GG3 A;  2Y7B A;  1WGQ A;  3P7Z A;  3U8Z A;  5DHF B;  2UZR A;  3PSC A;  2DTC A;  2OQB A;  1EVH A;  1Y19 B;  1BTN A;  1WJ1 A;  1DYN A;  4GMV A;  4HAU B;  3MDB C;  3WA0 A;  2KGX B;  1PFJ A;  5FI1 A;  1NI2 A;  2W2W A;  1DDM A;  2MFQ A;  2V76 A;  2Y8G A;  1I2H A;  2D9Y A;  3LJU X;  1V5P A;  2I1J A;  4B6H A;  2NMB A;  4HAY B;  2VKI A;  4K2O A;  5KQ1 A;  1V88 A;  4P7I A;  4NSW A;  3ULC A;  1MK9 B;  1M7R A;  4HAW B;  3X23 A;  1BTK A;  4F7H A;  3AJ4 A;  3TCA A;  2N23 A;  2DX5 A;  2DHI A;  2EMS A;  2J0K A;  4A6F B;  2DA0 A;  3SV1 A;  2MDX A;  5D27 A;  5D3W A;  2Z0O A;  1K5D B;  1TXD A;  1Q67 A;  2VSZ A;  2J0J A;  1Z87 A;  2VRW B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...