1U5GA

Crystal structure of the ph domain of skap-hom
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
115
structure length
115
Chain Sequence
QFPPIAAQDLPFVIKAGYLEKRRKDHSFLGFEWQKRWCALSKTVFYYYGSDKDKQQKGEFAIDGYDVRMNNTLRKDGKKDCCFEICAPDKRIYQFTAASPKDAEEWVQQLKFILQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords Src-associated adaptor protein
publication title The Skap-hom dimerization and PH domains comprise a 3'-phosphoinositide-gated molecular switch.
pubmed doi rcsb
source organism Mus musculus
total genus 26
structure length 115
sequence length 115
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2004-07-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00169 PH PH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 1u5gA01
4Z2NA 5D3XA 3G9WA 1KZ7A 2QKMA 2LKOA 4GMVA 1FHXA 2IYBA 1FB8A 3FSSA 4F7UP 4A5KA 4KHOA 2P0DA 1NI2A 5HE1A 1EGXA 4EMOA 1DBHA 4MT7A 2MDXA 4DXAB 4KHBB 1SGHA 1K5GB 3PVUA 1OQNA 1LW3A 3X23A 1BWNA 2PZ1A 3PVWA 2P8VA 1WJMA 3HQCA 4EKUA 1WJ1A 1ZSQA 2COFA 2J0KA 2HE7A 2XQNM 5KQ1A 5C6RA 1FOEA 5DHAB 2YVCA 2DA0A 4GZUA 1ZC3B 2N23A 4HAWB 1DDWA 4K2PA 4HAXB 2ROZB 1AQCA 2RVBB 2KCJA 1DDMA 1V5MA 4KHAA 1WVHA 5DHFB 2Y8FA 3ZVRA 3T06A 1DROA 1KI1B 2YT0A 3P6AA 1EF1A 1X11A 1V61A 1H4RA 1QQGA 2OQBA 2DHKA 4K17A 1DYNA 2DX1A 1XX0A 2W2XC 3P7ZA 2GJYA 4HB0B 1UPRA 1XCGA 2UZRA 1U5DA 1UPQA 2D9XA 5FI1A 4WVFB 1PMSA 2J0JA 4HB3B 1RJ2A 1RRPB 2Q13A 3BINA 4Z2MB 2NMBA 2ZPYA 3AU4A 4HDOA 1X86A 3A8QA 5EFXA 3PZDA 4NY0A 2D2QA 1ZM0A 2AEHA 2H7EA 1P3RA 4MK0A 2Y7BA 5D3WA 3PVLA 3U8ZA 1ZVRA 2YS3A 5J3QA 2L1CA 1N3HA 2GS0A 5J3YA 1XD4A 1X1GA 4Y94A 2IFSA 2Z0PA 5JHHA 2LYDA 4K2OA 1X1FA 1P5TA 3U7DA 1WI1A 4HHVA 2K2JA 4PQ0A 4HATB 5HE2A 5HE0A 1NU2A 3VOQA 2LG1A 3TCAA 3ULBA 2LOXA 3F5RA 3QWMA 3WYFB 2LULA 5D27A 1B55A 1W1GA 2ELAA 3M1IB 4D0NB 1TXDA 2RSGA 1BAKA 2YSZA 4BBKA 3DXDA 4P7IA 4TKNA 3WA0A 2D9YA 2M14A 4F7GA 3TO1A 4HB4B 5CLQB 1ZC4B 2D4QA 2W2XD 3PEGA 2D9WA 2EJ8A 2I5CA 4A6FB 2DHJA 1XR0B 1I7AA 1Q67A 2VRWB 1PFJA 3QBVB 4CHMA 2YT1A 2MWNB 1BTKA 1Y5OA 3ODWA 1V88A 1U27A 2W2WA 2H7DA 2DLWA 3NSUA 5J3TA 2DYNA 3A8PA 1I2HA 4CYEA 2UZSA 2GCLA 3ML4A 4HAUB 4GMXB 1MK9B 1FAOA 3DXCA 2DX5A 3D8DA 1UNPA 2YRYA 3GYPA 1TJ6A 5KQ4A 2I1JA 2ADZA 3PSCA 1V5PA 2X18A 2UVMA 1WG7A 2D9ZA 3KZ1A 3O96A 2D11A 1NTVA 1U2BA 3D8FA 3PG7A 5KCVA 2ROVA 1J19A 4HDQA 1OY2A 5JHGA 4A6KA 2MKRA 1TQZA 4ZRIA 1U5FA 4CHJA 1P6SA 3V5WA 1FGZA 1OMWA 2DYQA 1GC6A 3MPXA 3FM8C 1PLSA 1AWEA 3KRXA 3SO6A 2VSZA 4HAZB 3IVFA 1MIZB 3N7CA 3ULCA 2K2UA 2Z0QA 1K5DB 4DX90 4MY6A 2YS1A 3VIAA 4YONA 1J0WA 2YF0A 2NZ8B 2YS5A 5HE3A 1MPHA 2KGXB 4WSFA 1W1HA 1X05A 4GXBA 2EMSA 1XODA 5D3VA 3A98B 3CIKA 4IFSA 1ISNA 2DTCA 3TVVA 2Y8GA 4GN1A 2BCJA 4HAYB 4TYZA 1UNQA 1UEFA 2DKPA 2JP2A 4DBBA 1V5UA 5C5BB 2J0MA 2E2XA 5LOPB 1BTNA 2J59M 1W1DA 1MAIA 2CODA 3FEHA 2HTHB 3F0WA 4DX8A 2DN6A 5C79A 1DDVA 3KSYA 3AU5A 3SNHA 1KZGA 1WGQA 3SV1A 2M38A 5DH9B 1Y19B 4A6FA 2OTXA 3SUZA 3OANA 2R09A 5FI0A 5DI9B 2DHIA 3ZDTA 2FJLA 3TW1A 1QC6A 2P0FA 4A6HA 2DKQA 1NTYA 2GCJA 1U29A 2RGNB 1FHOA 1EAZA 1MK7B 4C0AA 3KRWA 3KY9A 2I1KA 1GG3A 3MDBC 2LOZA 2EMTA 5CLLB 2CRFA 3PP2A 4KVGB 3TFMA 4F7HA 2CAYA 1FGYA 1UNRA 3DXEA 2ELBA 2MFQA 2EC1A 1Z87A 2RNRB 3CXBB 1SHCA 1MKEA 4ZRJA 1XKEA 3HW2B 1M7RA 5LONB 2P0HA 3AJ4A 2N0YA 2COAA 2CY5A 2R0DA 1MIXA 1FHWA 3RCPA 2K00A 3HK0A 5D3YA 2AL6A 2L2IA 1LB1A 2D9VA 1E5WA 1IRSA 3ODXA 4ZRKA 3GYOA 4GPTB 1WGUA 1M7EA 2RUKB 2Z0OA 4PNKA 4IOYX 1EVHA 2QKLA 2G35A 4WJ7A 2I5FA 4KAXB 5C16A 4EJNA 5DIFB 3ODOA 1U5EA 4HB2B 1GC7A 2RLOA 3BJIA 1H10A 4H8SA 4K81A 2VKIA 5JP4A 2CY4A 5C5BA 4XWXA 2V76A 1V89A 3UZTA 4YL8A 4IAPA 2DFKA 4HAVB 5GOWB 4B6HA 3SYXA 1U5GA 5JLJB 3D8EA 4L6EA 2D10A 2COCA 3QIJA 5L81A 2KUPA 3LJUX 4NSWA
chains in the Genus database with same CATH superfamily
4Z2NA 2YT2A 5D3XA 3G9WA 1KZ7A 2QKMA 2LKOA 4GMVA 1FHXA 2IYBA 1FB8A 3FSSA 4F7UP 4A5KA 4KHOA 2P0DA 1NI2A 5HE1A 1EGXA 4EMOA 1DBHA 4MT7A 2Z14A 2MDXA 4DXAB 4KHBB 1SGHA 1K5GB 3PVUA 1OQNA 3B77A 1LW3A 2KR0A 3X23A 1BWNA 2PZ1A 3PVWA 2P8VA 1WJMA 3HQCA 4EKUA 1WJ1A 1ZSQA 4QJ3B 2COFA 2J0KA 2HE7A 2XQNM 5KQ1A 5C6RA 1FOEA 5DHAB 2YVCA 4OSNA 2DA0A 4GZUA 1ZC3B 2N23A 2NBVA 4HAWB 1DDWA 4K2PA 4HAXB 2ROZB 2ZKMX 1AQCA 2RVBB 2KCJA 1DDMA 1V5MA 4KHAA 1WVHA 5DHFB 2Y8FA 3ZVRA 3T06A 1DROA 1KI1B 2YT0A 3P6AA 1EF1A 1X11A 1V61A 1H4RA 1QQGA 2OQBA 2DHKA 4K17A 1DYNA 2DX1A 1XX0A 2W2XC 3P7ZA 2GJYA 4HB0B 1UPRA 2KIGA 1XCGA 2UZRA 1U5DA 1UPQA 2D9XA 5FI1A 4WVFB 1PMSA 2J0JA 4HB3B 1RJ2A 1RRPB 2Q13A 3BINA 4Z2MB 2NMBA 2ZPYA 3AU4A 4HDOA 1X86A 3A8QA 5EFXA 3PZDA 4QXAB 4NY0A 2D2QA 1ZM0A 2AEHA 2H7EA 1P3RA 4MK0A 2Y7BA 5D3WA 3PVLA 3U8ZA 1ZVRA 2YS3A 5J3QA 2L1CA 2GUMA 1N3HA 2GS0A 5J3YA 1XD4A 1X1GA 4Y94A 2IFSA 2Z0PA 5JHHA 5LG4B 2LYDA 4K2OA 1X1FA 4DIXA 1P5TA 3NW8A 1WI1A 4HHVA 3U7DA 2K2JA 4PQ0A 4HATB 5HE2A 2KUQA 5HE0A 1NU2A 1T77A 3VOQA 2LG1A 3NWFA 3TCAA 3ULBA 2LOXA 3F5RA 4KHBA 3QWMA 3WYFB 2LULA 5D27A 1B55A 1W1GA 2ELAA 3M1IB 4D0NB 1TXDA 2RSGA 1BAKA 2YSZA 4BBKA 3DXDA 4P7IA 4TKNA 3WA0A 2D9YA 2M14A 4F7GA 3TO1A 4HB4B 5CLQB 1ZC4B 2D4QA 2W2XD 3PEGA 2D9WA 2EJ8A 2I5CA 4A6FB 2DHJA 1XR0B 1I7AA 1Q67A 2VRWB 1PFJA 3QBVB 4CHMA 2YT1A 2MWNB 1BTKA 1Y5OA 3ODWA 1V88A 1U27A 2W2WA 2H7DA 2DLWA 3NSUA 5J3TA 2DYNA 3A8PA 3A58A 1I2HA 4CYEA 2UZSA 2GCLA 3ML4A 4HAUB 4GMXB 1MK9B 1FAOA 3DXCA 2DX5A 3D8DA 1UNPA 2YRYA 3GYPA 1TJ6A 5KQ4A 2I1JA 2ADZA 3PSCA 1V5PA 1MI1A 2X18A 2R2YA 2UVMA 1WG7A 2D9ZA 3KZ1A 3O96A 2D11A 1NTVA 1U2BA 3D8FA 3PG7A 5KCVA 2ROVA 1J19A 4HDQA 1OY2A 5JHGA 4A6KA 2MKRA 1TQZA 4ZRIA 1U5FA 4CHJA 1P6SA 3V5WA 1FGZA 1OMWA 2DYQA 1GC6A 3MPXA 3FM8C 1PLSA 1AWEA 3KRXA 3SO6A 2VSZA 4HAZB 3IVFA 1MIZB 3N7CA 4HSIA 3ULCA 2K2UA 2Z0QA 1K5DB 4DX90 4MY6A 2YS1A 3VIAA 4QJ4B 4YONA 2Z59A 1J0WA 2YF0A 2NZ8B 4OT1A 2YS5A 3HIEA 3HSAA 2K49A 5HE3A 1MPHA 2KGXB 4WSFA 1W1HA 1X05A 4GXBA 2EMSA 1XODA 5D3VA 3A98B 3CIKA 4IFSA 1ISNA 2DTCA 3TVVA 2Y8GA 4GN1A 2BCJA 4HAYB 4TYZA 1UNQA 1UEFA 2DKPA 2JP2A 4DBBA 1V5UA 5C5BB 2J0MA 2E2XA 5LOPB 3U12A 1BTNA 2J59M 1W1DA 1MAIA 2CODA 3FEHA 2HTHB 3F0WA 4DX8A 2DN6A 5C79A 1DDVA 3KSYA 5I2MA 4QJ5B 3AU5A 3SNHA 3NWAA 1KZGA 1WGQA 2Z4DA 3SV1A 2M38A 5DH9B 1Y19B 4A6FA 2OTXA 3SUZA 3OANA 2RRFA 2R09A 2KIEA 5FI0A 5DI9B 2DHIA 3ZDTA 2FJLA 3TW1A 1QC6A 2P0FA 4A6HA 2DKQA 1NTYA 2GCJA 1U29A 2RGNB 1FHOA 1EAZA 1MK7B 4C0AA 3KRWA 3KY9A 2FJUB 2I1KA 1GG3A 3MDBC 2LOZA 2EMTA 5CLLB 2CRFA 3PP2A 4KVGB 3TFMA 4F7HA 2CAYA 1FGYA 4GOUA 4CSQA 1UNRA 3DXEA 2ELBA 2MFQA 2EC1A 1Z87A 3DCXA 2RNRB 3CXBB 1SHCA 1MKEA 3NWDA 4D6WA 4ZRJA 1XKEA 3HW2B 5IRSA 5M4YB 1M7RA 5LONB 2P0HA 3AJ4A 2N0YA 2COAA 2CY5A 2R0DA 1MIXA 1FHWA 4L1RA 2K00A 3RCPA 3HK0A 5D3YA 2AL6A 2L2IA 1LB1A 2D9VA 1E5WA 1IRSA 3ODXA 4ZRKA 3GYOA 4GPTB 1WGUA 1M7EA 2RUKB 2Z0OA 4PNKA 4IOYX 1EVHA 3OHMB 2QKLA 2G35A 4GNKB 4WJ7A 2I5FA 4KAXB 5C16A 4EJNA 2Z13A 3ODOA 5DIFB 1U5EA 4HB2B 1GC7A 2RLOA 3BJIA 1H10A 4H8SA 4K81A 2VKIA 5JP4A 5I2SA 2CY4A 5C5BA 4XWXA 2V76A 1V89A 3UZTA 4YL8A 4IAPA 2DFKA 4HAVB 5GOWB 4B6HA 3SYXA 1U5GA 5JLJB 3D8EA 4L6EA 2D10A 3FVCA 2COCA 3QIJA 5L81A 1ZYIA 2KUPA 3LJUX 4NSWA 2K8EA
chains in the Genus database with same CATH topology
4Z2NA 5D3XA 3G9WA 1KZ7A 2QKMA 2LKOA 4GMVA 1FHXA 2IYBA 1FB8A 3FSSA 4F7UP 4A5KA 4KHOA 2P0DA 1NI2A 5HE1A 1EGXA 4EMOA 1DBHA 4MT7A 2MDXA 4DXAB 4KHBB 1SGHA 1K5GB 3PVUA 1OQNA 1LW3A 3X23A 1BWNA 2PZ1A 3PVWA 2P8VA 1WJMA 3HQCA 4EKUA 1WJ1A 1ZSQA 2COFA 2J0KA 2HE7A 2XQNM 5KQ1A 5C6RA 1FOEA 5DHAB 2YVCA 2DA0A 4GZUA 1ZC3B 2N23A 4HAWB 1DDWA 4K2PA 4HAXB 2ROZB 1AQCA 2RVBB 2KCJA 1DDMA 1V5MA 4KHAA 1WVHA 5DHFB 2Y8FA 3ZVRA 3T06A 1DROA 1KI1B 2YT0A 3P6AA 1EF1A 1X11A 1V61A 1H4RA 1QQGA 2OQBA 2DHKA 4K17A 1DYNA 2DX1A 1XX0A 2W2XC 3P7ZA 2GJYA 4HB0B 1UPRA 1XCGA 2UZRA 1U5DA 1UPQA 2D9XA 5FI1A 4WVFB 1PMSA 2J0JA 4HB3B 1RJ2A 1RRPB 2Q13A 3BINA 4Z2MB 2NMBA 2ZPYA 3AU4A 4HDOA 1X86A 3A8QA 5EFXA 3PZDA 4NY0A 2D2QA 1ZM0A 2AEHA 2H7EA 1P3RA 4MK0A 2Y7BA 5D3WA 3PVLA 3U8ZA 1ZVRA 2YS3A 5J3QA 2L1CA 1N3HA 2GS0A 5J3YA 1XD4A 1X1GA 4Y94A 2IFSA 2Z0PA 5JHHA 2LYDA 4K2OA 1X1FA 1P5TA 3U7DA 1WI1A 4HHVA 2K2JA 4PQ0A 4HATB 5HE2A 5HE0A 1NU2A 3VOQA 2LG1A 3TCAA 3ULBA 2LOXA 3F5RA 3QWMA 3WYFB 2LULA 5D27A 1B55A 1W1GA 2ELAA 3M1IB 4D0NB 1TXDA 2RSGA 1BAKA 2YSZA 4BBKA 3DXDA 4P7IA 4TKNA 3WA0A 2D9YA 2M14A 4F7GA 3TO1A 4HB4B 5CLQB 1ZC4B 2D4QA 2W2XD 3PEGA 2D9WA 2EJ8A 2I5CA 4A6FB 2DHJA 1XR0B 1I7AA 1Q67A 2VRWB 1PFJA 3QBVB 4CHMA 2YT1A 2MWNB 1BTKA 1Y5OA 3ODWA 1V88A 1U27A 2W2WA 2H7DA 2DLWA 3NSUA 5J3TA 2DYNA 3A8PA 1I2HA 4CYEA 2UZSA 2GCLA 3ML4A 4HAUB 4GMXB 1MK9B 1FAOA 3DXCA 2DX5A 3D8DA 1UNPA 2YRYA 3GYPA 1TJ6A 5KQ4A 2I1JA 2ADZA 3PSCA 1V5PA 2X18A 2UVMA 1WG7A 2D9ZA 3KZ1A 3O96A 2D11A 1NTVA 1U2BA 3D8FA 3PG7A 5KCVA 2ROVA 1J19A 4HDQA 1OY2A 5JHGA 4A6KA 2MKRA 1TQZA 4ZRIA 1U5FA 4CHJA 1P6SA 3V5WA 1FGZA 1OMWA 2DYQA 1GC6A 3MPXA 3FM8C 1PLSA 1AWEA 3KRXA 3SO6A 2VSZA 4HAZB 3IVFA 1MIZB 3N7CA 3ULCA 2K2UA 2Z0QA 1K5DB 4DX90 4MY6A 2YS1A 3VIAA 4YONA 1J0WA 2YF0A 2NZ8B 2YS5A 5HE3A 1MPHA 2KGXB 4WSFA 1W1HA 1X05A 4GXBA 2EMSA 1XODA 5D3VA 3A98B 3CIKA 4IFSA 1ISNA 2DTCA 3TVVA 2Y8GA 4GN1A 2BCJA 4HAYB 4TYZA 1UNQA 1UEFA 2DKPA 2JP2A 4DBBA 1V5UA 5C5BB 2J0MA 2E2XA 5LOPB 1BTNA 2J59M 1W1DA 1MAIA 2CODA 3FEHA 2HTHB 3F0WA 4DX8A 2DN6A 5C79A 1DDVA 3KSYA 3AU5A 3SNHA 1KZGA 1WGQA 3SV1A 2M38A 5DH9B 1Y19B 4A6FA 2OTXA 3SUZA 3OANA 2R09A 5FI0A 5DI9B 2DHIA 3ZDTA 2FJLA 3TW1A 1QC6A 2P0FA 4A6HA 2DKQA 1NTYA 2GCJA 1U29A 2RGNB 1FHOA 1EAZA 1MK7B 4C0AA 3KRWA 3KY9A 2I1KA 1GG3A 3MDBC 2LOZA 2EMTA 5CLLB 2CRFA 3PP2A 4KVGB 3TFMA 4F7HA 2CAYA 1FGYA 1UNRA 3DXEA 2ELBA 2MFQA 2EC1A 1Z87A 2RNRB 3CXBB 1SHCA 1MKEA 4ZRJA 1XKEA 3HW2B 1M7RA 5LONB 2P0HA 3AJ4A 2N0YA 2COAA 2CY5A 2R0DA 1MIXA 1FHWA 3RCPA 2K00A 3HK0A 5D3YA 2AL6A 2L2IA 1LB1A 2D9VA 1E5WA 1IRSA 3ODXA 4ZRKA 3GYOA 4GPTB 1WGUA 1M7EA 2RUKB 2Z0OA 4PNKA 4IOYX 1EVHA 2QKLA 2G35A 4WJ7A 2I5FA 4KAXB 5C16A 4EJNA 5DIFB 3ODOA 1U5EA 4HB2B 1GC7A 2RLOA 3BJIA 1H10A 4H8SA 4K81A 2VKIA 5JP4A 2CY4A 5C5BA 4XWXA 2V76A 1V89A 3UZTA 4YL8A 4IAPA 2DFKA 4HAVB 5GOWB 4B6HA 3SYXA 1U5GA 5JLJB 3D8EA 4L6EA 2D10A 2COCA 3QIJA 5L81A 2KUPA 3LJUX 4NSWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Z2N A;  5D3X A;  3G9W A;  1KZ7 A;  2QKM A;  2LKO A;  4GMV A;  1FHX A;  2IYB A;  1FB8 A;  3FSS A;  4F7U P;  4A5K A;  4KHO A;  2P0D A;  1NI2 A;  5HE1 A;  1EGX A;  4EMO A;  1DBH A;  4MT7 A;  2MDX A;  4DXA B;  4KHB B;  1SGH A;  1K5G B;  3PVU A;  1OQN A;  1LW3 A;  3X23 A;  1BWN A;  2PZ1 A;  3PVW A;  2P8V A;  1WJM A;  3HQC A;  4EKU A;  1WJ1 A;  1ZSQ A;  2COF A;  2J0K A;  2HE7 A;  2XQN M;  5KQ1 A;  5C6R A;  1FOE A;  5DHA B;  2YVC A;  2DA0 A;  4GZU A;  1ZC3 B;  2N23 A;  4HAW B;  1DDW A;  4K2P A;  4HAX B;  2ROZ B;  1AQC A;  2RVB B;  2KCJ A;  1DDM A;  1V5M A;  4KHA A;  1WVH A;  5DHF B;  2Y8F A;  3ZVR A;  3T06 A;  1DRO A;  1KI1 B;  2YT0 A;  3P6A A;  1EF1 A;  1X11 A;  1V61 A;  1H4R A;  1QQG A;  2OQB A;  2DHK A;  4K17 A;  1DYN A;  2DX1 A;  1XX0 A;  2W2X C;  3P7Z A;  2GJY A;  4HB0 B;  1UPR A;  1XCG A;  2UZR A;  1U5D A;  1UPQ A;  2D9X A;  5FI1 A;  4WVF B;  1PMS A;  2J0J A;  4HB3 B;  1RJ2 A;  1RRP B;  2Q13 A;  3BIN A;  4Z2M B;  2NMB A;  2ZPY A;  3AU4 A;  4HDO A;  1X86 A;  3A8Q A;  5EFX A;  3PZD A;  4NY0 A;  2D2Q A;  1ZM0 A;  2AEH A;  2H7E A;  1P3R A;  4MK0 A;  2Y7B A;  5D3W A;  3PVL A;  3U8Z A;  1ZVR A;  2YS3 A;  5J3Q A;  2L1C A;  1N3H A;  2GS0 A;  5J3Y A;  1XD4 A;  1X1G A;  4Y94 A;  2IFS A;  2Z0P A;  5JHH A;  2LYD A;  4K2O A;  1X1F A;  1P5T A;  3U7D A;  1WI1 A;  4HHV A;  2K2J A;  4PQ0 A;  4HAT B;  5HE2 A;  5HE0 A;  1NU2 A;  3VOQ A;  2LG1 A;  3TCA A;  3ULB A;  2LOX A;  3F5R A;  3QWM A;  3WYF B;  2LUL A;  5D27 A;  1B55 A;  1W1G A;  2ELA A;  3M1I B;  4D0N B;  1TXD A;  2RSG A;  1BAK A;  2YSZ A;  4BBK A;  3DXD A;  4P7I A;  4TKN A;  3WA0 A;  2D9Y A;  2M14 A;  4F7G A;  3TO1 A;  4HB4 B;  5CLQ B;  1ZC4 B;  2D4Q A;  2W2X D;  3PEG A;  2D9W A;  2EJ8 A;  2I5C A;  4A6F B;  2DHJ A;  1XR0 B;  1I7A A;  1Q67 A;  2VRW B;  1PFJ A;  3QBV B;  4CHM A;  2YT1 A;  2MWN B;  1BTK A;  1Y5O A;  3ODW A;  1V88 A;  1U27 A;  2W2W A;  2H7D A;  2DLW A;  3NSU A;  5J3T A;  2DYN A;  3A8P A;  1I2H A;  4CYE A;  2UZS A;  2GCL A;  3ML4 A;  4HAU B;  4GMX B;  1MK9 B;  1FAO A;  3DXC A;  2DX5 A;  3D8D A;  1UNP A;  2YRY A;  3GYP A;  1TJ6 A;  5KQ4 A;  2I1J A;  2ADZ A;  3PSC A;  1V5P A;  2X18 A;  2UVM A;  1WG7 A;  2D9Z A;  3KZ1 A;  3O96 A;  2D11 A;  1NTV A;  1U2B A;  3D8F A;  3PG7 A;  5KCV A;  2ROV A;  1J19 A;  4HDQ A;  1OY2 A;  5JHG A;  4A6K A;  2MKR A;  1TQZ A;  4ZRI A;  1U5F A;  4CHJ A;  1P6S A;  3V5W A;  1FGZ A;  1OMW A;  2DYQ A;  1GC6 A;  3MPX A;  3FM8 C;  1PLS A;  1AWE A;  3KRX A;  3SO6 A;  2VSZ A;  4HAZ B;  3IVF A;  1MIZ B;  3N7C A;  3ULC A;  2K2U A;  2Z0Q A;  1K5D B;  4DX9 0;  4MY6 A;  2YS1 A;  3VIA A;  4YON A;  1J0W A;  2YF0 A;  2NZ8 B;  2YS5 A;  5HE3 A;  1MPH A;  2KGX B;  4WSF A;  1W1H A;  1X05 A;  4GXB A;  2EMS A;  1XOD A;  5D3V A;  3A98 B;  3CIK A;  4IFS A;  1ISN A;  2DTC A;  3TVV A;  2Y8G A;  4GN1 A;  2BCJ A;  4HAY B;  4TYZ A;  1UNQ A;  1UEF A;  2DKP A;  2JP2 A;  4DBB A;  1V5U A;  5C5B B;  2J0M A;  2E2X A;  5LOP B;  1BTN A;  2J59 M;  1W1D A;  1MAI A;  2COD A;  3FEH A;  2HTH B;  3F0W A;  4DX8 A;  2DN6 A;  5C79 A;  1DDV A;  3KSY A;  3AU5 A;  3SNH A;  1KZG A;  1WGQ A;  3SV1 A;  2M38 A;  5DH9 B;  1Y19 B;  4A6F A;  2OTX A;  3SUZ A;  3OAN A;  2R09 A;  5FI0 A;  5DI9 B;  2DHI A;  3ZDT A;  2FJL A;  3TW1 A;  1QC6 A;  2P0F A;  4A6H A;  2DKQ A;  1NTY A;  2GCJ A;  1U29 A;  2RGN B;  1FHO A;  1EAZ A;  1MK7 B;  4C0A A;  3KRW A;  3KY9 A;  2I1K A;  1GG3 A;  3MDB C;  2LOZ A;  2EMT A;  5CLL B;  2CRF A;  3PP2 A;  4KVG B;  3TFM A;  4F7H A;  2CAY A;  1FGY A;  1UNR A;  3DXE A;  2ELB A;  2MFQ A;  2EC1 A;  1Z87 A;  2RNR B;  3CXB B;  1SHC A;  1MKE A;  4ZRJ A;  1XKE A;  3HW2 B;  1M7R A;  5LON B;  2P0H A;  3AJ4 A;  2N0Y A;  2COA A;  2CY5 A;  2R0D A;  1MIX A;  1FHW A;  3RCP A;  2K00 A;  3HK0 A;  5D3Y A;  2AL6 A;  2L2I A;  1LB1 A;  2D9V A;  1E5W A;  1IRS A;  3ODX A;  4ZRK A;  3GYO A;  4GPT B;  1WGU A;  1M7E A;  2RUK B;  2Z0O A;  4PNK A;  4IOY X;  1EVH A;  2QKL A;  2G35 A;  4WJ7 A;  2I5F A;  4KAX B;  5C16 A;  4EJN A;  5DIF B;  3ODO A;  1U5E A;  4HB2 B;  1GC7 A;  2RLO A;  3BJI A;  1H10 A;  4H8S A;  4K81 A;  2VKI A;  5JP4 A;  2CY4 A;  5C5B A;  4XWX A;  2V76 A;  1V89 A;  3UZT A;  4YL8 A;  4IAP A;  2DFK A;  4HAV B;  5GOW B;  4B6H A;  3SYX A;  1U5G A;  5JLJ B;  3D8E A;  4L6E A;  2D10 A;  2COC A;  3QIJ A;  5L81 A;  2KUP A;  3LJU X;  4NSW A; 
#chains in the Genus database with same CATH topology
 4Z2N A;  2YT2 A;  5D3X A;  3G9W A;  1KZ7 A;  2QKM A;  2LKO A;  4GMV A;  1FHX A;  2IYB A;  1FB8 A;  3FSS A;  4F7U P;  4A5K A;  4KHO A;  2P0D A;  1NI2 A;  5HE1 A;  1EGX A;  4EMO A;  1DBH A;  4MT7 A;  2Z14 A;  2MDX A;  4DXA B;  4KHB B;  1SGH A;  1K5G B;  3PVU A;  1OQN A;  3B77 A;  1LW3 A;  2KR0 A;  3X23 A;  1BWN A;  2PZ1 A;  3PVW A;  2P8V A;  1WJM A;  3HQC A;  4EKU A;  1WJ1 A;  1ZSQ A;  4QJ3 B;  2COF A;  2J0K A;  2HE7 A;  2XQN M;  5KQ1 A;  5C6R A;  1FOE A;  5DHA B;  2YVC A;  4OSN A;  2DA0 A;  4GZU A;  1ZC3 B;  2N23 A;  2NBV A;  4HAW B;  1DDW A;  4K2P A;  4HAX B;  2ROZ B;  2ZKM X;  1AQC A;  2RVB B;  2KCJ A;  1DDM A;  1V5M A;  4KHA A;  1WVH A;  5DHF B;  2Y8F A;  3ZVR A;  3T06 A;  1DRO A;  1KI1 B;  2YT0 A;  3P6A A;  1EF1 A;  1X11 A;  1V61 A;  1H4R A;  1QQG A;  2OQB A;  2DHK A;  4K17 A;  1DYN A;  2DX1 A;  1XX0 A;  2W2X C;  3P7Z A;  2GJY A;  4HB0 B;  1UPR A;  2KIG A;  1XCG A;  2UZR A;  1U5D A;  1UPQ A;  2D9X A;  5FI1 A;  4WVF B;  1PMS A;  2J0J A;  4HB3 B;  1RJ2 A;  1RRP B;  2Q13 A;  3BIN A;  4Z2M B;  2NMB A;  2ZPY A;  3AU4 A;  4HDO A;  1X86 A;  3A8Q A;  5EFX A;  3PZD A;  4QXA B;  4NY0 A;  2D2Q A;  1ZM0 A;  2AEH A;  2H7E A;  1P3R A;  4MK0 A;  2Y7B A;  5D3W A;  3PVL A;  3U8Z A;  1ZVR A;  2YS3 A;  5J3Q A;  2L1C A;  2GUM A;  1N3H A;  2GS0 A;  5J3Y A;  1XD4 A;  1X1G A;  4Y94 A;  2IFS A;  2Z0P A;  5JHH A;  5LG4 B;  2LYD A;  4K2O A;  1X1F A;  4DIX A;  1P5T A;  3NW8 A;  1WI1 A;  4HHV A;  3U7D A;  2K2J A;  4PQ0 A;  4HAT B;  5HE2 A;  2KUQ A;  5HE0 A;  1NU2 A;  1T77 A;  3VOQ A;  2LG1 A;  3NWF A;  3TCA A;  3ULB A;  2LOX A;  3F5R A;  4KHB A;  3QWM A;  3WYF B;  2LUL A;  5D27 A;  1B55 A;  1W1G A;  2ELA A;  3M1I B;  4D0N B;  1TXD A;  2RSG A;  1BAK A;  2YSZ A;  4BBK A;  3DXD A;  4P7I A;  4TKN A;  3WA0 A;  2D9Y A;  2M14 A;  4F7G A;  3TO1 A;  4HB4 B;  5CLQ B;  1ZC4 B;  2D4Q A;  2W2X D;  3PEG A;  2D9W A;  2EJ8 A;  2I5C A;  4A6F B;  2DHJ A;  1XR0 B;  1I7A A;  1Q67 A;  2VRW B;  1PFJ A;  3QBV B;  4CHM A;  2YT1 A;  2MWN B;  1BTK A;  1Y5O A;  3ODW A;  1V88 A;  1U27 A;  2W2W A;  2H7D A;  2DLW A;  3NSU A;  5J3T A;  2DYN A;  3A8P A;  3A58 A;  1I2H A;  4CYE A;  2UZS A;  2GCL A;  3ML4 A;  4HAU B;  4GMX B;  1MK9 B;  1FAO A;  3DXC A;  2DX5 A;  3D8D A;  1UNP A;  2YRY A;  3GYP A;  1TJ6 A;  5KQ4 A;  2I1J A;  2ADZ A;  3PSC A;  1V5P A;  1MI1 A;  2X18 A;  2R2Y A;  2UVM A;  1WG7 A;  2D9Z A;  3KZ1 A;  3O96 A;  2D11 A;  1NTV A;  1U2B A;  3D8F A;  3PG7 A;  5KCV A;  2ROV A;  1J19 A;  4HDQ A;  1OY2 A;  5JHG A;  4A6K A;  2MKR A;  1TQZ A;  4ZRI A;  1U5F A;  4CHJ A;  1P6S A;  3V5W A;  1FGZ A;  1OMW A;  2DYQ A;  1GC6 A;  3MPX A;  3FM8 C;  1PLS A;  1AWE A;  3KRX A;  3SO6 A;  2VSZ A;  4HAZ B;  3IVF A;  1MIZ B;  3N7C A;  4HSI A;  3ULC A;  2K2U A;  2Z0Q A;  1K5D B;  4DX9 0;  4MY6 A;  2YS1 A;  3VIA A;  4QJ4 B;  4YON A;  2Z59 A;  1J0W A;  2YF0 A;  2NZ8 B;  4OT1 A;  2YS5 A;  3HIE A;  3HSA A;  2K49 A;  5HE3 A;  1MPH A;  2KGX B;  4WSF A;  1W1H A;  1X05 A;  4GXB A;  2EMS A;  1XOD A;  5D3V A;  3A98 B;  3CIK A;  4IFS A;  1ISN A;  2DTC A;  3TVV A;  2Y8G A;  4GN1 A;  2BCJ A;  4HAY B;  4TYZ A;  1UNQ A;  1UEF A;  2DKP A;  2JP2 A;  4DBB A;  1V5U A;  5C5B B;  2J0M A;  2E2X A;  5LOP B;  3U12 A;  1BTN A;  2J59 M;  1W1D A;  1MAI A;  2COD A;  3FEH A;  2HTH B;  3F0W A;  4DX8 A;  2DN6 A;  5C79 A;  1DDV A;  3KSY A;  5I2M A;  4QJ5 B;  3AU5 A;  3SNH A;  3NWA A;  1KZG A;  1WGQ A;  2Z4D A;  3SV1 A;  2M38 A;  5DH9 B;  1Y19 B;  4A6F A;  2OTX A;  3SUZ A;  3OAN A;  2RRF A;  2R09 A;  2KIE A;  5FI0 A;  5DI9 B;  2DHI A;  3ZDT A;  2FJL A;  3TW1 A;  1QC6 A;  2P0F A;  4A6H A;  2DKQ A;  1NTY A;  2GCJ A;  1U29 A;  2RGN B;  1FHO A;  1EAZ A;  1MK7 B;  4C0A A;  3KRW A;  3KY9 A;  2FJU B;  2I1K A;  1GG3 A;  3MDB C;  2LOZ A;  2EMT A;  5CLL B;  2CRF A;  3PP2 A;  4KVG B;  3TFM A;  4F7H A;  2CAY A;  1FGY A;  4GOU A;  4CSQ A;  1UNR A;  3DXE A;  2ELB A;  2MFQ A;  2EC1 A;  1Z87 A;  3DCX A;  2RNR B;  3CXB B;  1SHC A;  1MKE A;  3NWD A;  4D6W A;  4ZRJ A;  1XKE A;  3HW2 B;  5IRS A;  5M4Y B;  1M7R A;  5LON B;  2P0H A;  3AJ4 A;  2N0Y A;  2COA A;  2CY5 A;  2R0D A;  1MIX A;  1FHW A;  4L1R A;  2K00 A;  3RCP A;  3HK0 A;  5D3Y A;  2AL6 A;  2L2I A;  1LB1 A;  2D9V A;  1E5W A;  1IRS A;  3ODX A;  4ZRK A;  3GYO A;  4GPT B;  1WGU A;  1M7E A;  2RUK B;  2Z0O A;  4PNK A;  4IOY X;  1EVH A;  3OHM B;  2QKL A;  2G35 A;  4GNK B;  4WJ7 A;  2I5F A;  4KAX B;  5C16 A;  4EJN A;  2Z13 A;  3ODO A;  5DIF B;  1U5E A;  4HB2 B;  1GC7 A;  2RLO A;  3BJI A;  1H10 A;  4H8S A;  4K81 A;  2VKI A;  5JP4 A;  5I2S A;  2CY4 A;  5C5B A;  4XWX A;  2V76 A;  1V89 A;  3UZT A;  4YL8 A;  4IAP A;  2DFK A;  4HAV B;  5GOW B;  4B6H A;  3SYX A;  1U5G A;  5JLJ B;  3D8E A;  4L6E A;  2D10 A;  3FVC A;  2COC A;  3QIJ A;  5L81 A;  1ZYI A;  2KUP A;  3LJU X;  4NSW A;  2K8E A; 
#chains in the Genus database with same CATH homology
 4Z2N A;  5D3X A;  3G9W A;  1KZ7 A;  2QKM A;  2LKO A;  4GMV A;  1FHX A;  2IYB A;  1FB8 A;  3FSS A;  4F7U P;  4A5K A;  4KHO A;  2P0D A;  1NI2 A;  5HE1 A;  1EGX A;  4EMO A;  1DBH A;  4MT7 A;  2MDX A;  4DXA B;  4KHB B;  1SGH A;  1K5G B;  3PVU A;  1OQN A;  1LW3 A;  3X23 A;  1BWN A;  2PZ1 A;  3PVW A;  2P8V A;  1WJM A;  3HQC A;  4EKU A;  1WJ1 A;  1ZSQ A;  2COF A;  2J0K A;  2HE7 A;  2XQN M;  5KQ1 A;  5C6R A;  1FOE A;  5DHA B;  2YVC A;  2DA0 A;  4GZU A;  1ZC3 B;  2N23 A;  4HAW B;  1DDW A;  4K2P A;  4HAX B;  2ROZ B;  1AQC A;  2RVB B;  2KCJ A;  1DDM A;  1V5M A;  4KHA A;  1WVH A;  5DHF B;  2Y8F A;  3ZVR A;  3T06 A;  1DRO A;  1KI1 B;  2YT0 A;  3P6A A;  1EF1 A;  1X11 A;  1V61 A;  1H4R A;  1QQG A;  2OQB A;  2DHK A;  4K17 A;  1DYN A;  2DX1 A;  1XX0 A;  2W2X C;  3P7Z A;  2GJY A;  4HB0 B;  1UPR A;  1XCG A;  2UZR A;  1U5D A;  1UPQ A;  2D9X A;  5FI1 A;  4WVF B;  1PMS A;  2J0J A;  4HB3 B;  1RJ2 A;  1RRP B;  2Q13 A;  3BIN A;  4Z2M B;  2NMB A;  2ZPY A;  3AU4 A;  4HDO A;  1X86 A;  3A8Q A;  5EFX A;  3PZD A;  4NY0 A;  2D2Q A;  1ZM0 A;  2AEH A;  2H7E A;  1P3R A;  4MK0 A;  2Y7B A;  5D3W A;  3PVL A;  3U8Z A;  1ZVR A;  2YS3 A;  5J3Q A;  2L1C A;  1N3H A;  2GS0 A;  5J3Y A;  1XD4 A;  1X1G A;  4Y94 A;  2IFS A;  2Z0P A;  5JHH A;  2LYD A;  4K2O A;  1X1F A;  1P5T A;  3U7D A;  1WI1 A;  4HHV A;  2K2J A;  4PQ0 A;  4HAT B;  5HE2 A;  5HE0 A;  1NU2 A;  3VOQ A;  2LG1 A;  3TCA A;  3ULB A;  2LOX A;  3F5R A;  3QWM A;  3WYF B;  2LUL A;  5D27 A;  1B55 A;  1W1G A;  2ELA A;  3M1I B;  4D0N B;  1TXD A;  2RSG A;  1BAK A;  2YSZ A;  4BBK A;  3DXD A;  4P7I A;  4TKN A;  3WA0 A;  2D9Y A;  2M14 A;  4F7G A;  3TO1 A;  4HB4 B;  5CLQ B;  1ZC4 B;  2D4Q A;  2W2X D;  3PEG A;  2D9W A;  2EJ8 A;  2I5C A;  4A6F B;  2DHJ A;  1XR0 B;  1I7A A;  1Q67 A;  2VRW B;  1PFJ A;  3QBV B;  4CHM A;  2YT1 A;  2MWN B;  1BTK A;  1Y5O A;  3ODW A;  1V88 A;  1U27 A;  2W2W A;  2H7D A;  2DLW A;  3NSU A;  5J3T A;  2DYN A;  3A8P A;  1I2H A;  4CYE A;  2UZS A;  2GCL A;  3ML4 A;  4HAU B;  4GMX B;  1MK9 B;  1FAO A;  3DXC A;  2DX5 A;  3D8D A;  1UNP A;  2YRY A;  3GYP A;  1TJ6 A;  5KQ4 A;  2I1J A;  2ADZ A;  3PSC A;  1V5P A;  2X18 A;  2UVM A;  1WG7 A;  2D9Z A;  3KZ1 A;  3O96 A;  2D11 A;  1NTV A;  1U2B A;  3D8F A;  3PG7 A;  5KCV A;  2ROV A;  1J19 A;  4HDQ A;  1OY2 A;  5JHG A;  4A6K A;  2MKR A;  1TQZ A;  4ZRI A;  1U5F A;  4CHJ A;  1P6S A;  3V5W A;  1FGZ A;  1OMW A;  2DYQ A;  1GC6 A;  3MPX A;  3FM8 C;  1PLS A;  1AWE A;  3KRX A;  3SO6 A;  2VSZ A;  4HAZ B;  3IVF A;  1MIZ B;  3N7C A;  3ULC A;  2K2U A;  2Z0Q A;  1K5D B;  4DX9 0;  4MY6 A;  2YS1 A;  3VIA A;  4YON A;  1J0W A;  2YF0 A;  2NZ8 B;  2YS5 A;  5HE3 A;  1MPH A;  2KGX B;  4WSF A;  1W1H A;  1X05 A;  4GXB A;  2EMS A;  1XOD A;  5D3V A;  3A98 B;  3CIK A;  4IFS A;  1ISN A;  2DTC A;  3TVV A;  2Y8G A;  4GN1 A;  2BCJ A;  4HAY B;  4TYZ A;  1UNQ A;  1UEF A;  2DKP A;  2JP2 A;  4DBB A;  1V5U A;  5C5B B;  2J0M A;  2E2X A;  5LOP B;  1BTN A;  2J59 M;  1W1D A;  1MAI A;  2COD A;  3FEH A;  2HTH B;  3F0W A;  4DX8 A;  2DN6 A;  5C79 A;  1DDV A;  3KSY A;  3AU5 A;  3SNH A;  1KZG A;  1WGQ A;  3SV1 A;  2M38 A;  5DH9 B;  1Y19 B;  4A6F A;  2OTX A;  3SUZ A;  3OAN A;  2R09 A;  5FI0 A;  5DI9 B;  2DHI A;  3ZDT A;  2FJL A;  3TW1 A;  1QC6 A;  2P0F A;  4A6H A;  2DKQ A;  1NTY A;  2GCJ A;  1U29 A;  2RGN B;  1FHO A;  1EAZ A;  1MK7 B;  4C0A A;  3KRW A;  3KY9 A;  2I1K A;  1GG3 A;  3MDB C;  2LOZ A;  2EMT A;  5CLL B;  2CRF A;  3PP2 A;  4KVG B;  3TFM A;  4F7H A;  2CAY A;  1FGY A;  1UNR A;  3DXE A;  2ELB A;  2MFQ A;  2EC1 A;  1Z87 A;  2RNR B;  3CXB B;  1SHC A;  1MKE A;  4ZRJ A;  1XKE A;  3HW2 B;  1M7R A;  5LON B;  2P0H A;  3AJ4 A;  2N0Y A;  2COA A;  2CY5 A;  2R0D A;  1MIX A;  1FHW A;  3RCP A;  2K00 A;  3HK0 A;  5D3Y A;  2AL6 A;  2L2I A;  1LB1 A;  2D9V A;  1E5W A;  1IRS A;  3ODX A;  4ZRK A;  3GYO A;  4GPT B;  1WGU A;  1M7E A;  2RUK B;  2Z0O A;  4PNK A;  4IOY X;  1EVH A;  2QKL A;  2G35 A;  4WJ7 A;  2I5F A;  4KAX B;  5C16 A;  4EJN A;  5DIF B;  3ODO A;  1U5E A;  4HB2 B;  1GC7 A;  2RLO A;  3BJI A;  1H10 A;  4H8S A;  4K81 A;  2VKI A;  5JP4 A;  2CY4 A;  5C5B A;  4XWX A;  2V76 A;  1V89 A;  3UZT A;  4YL8 A;  4IAP A;  2DFK A;  4HAV B;  5GOW B;  4B6H A;  3SYX A;  1U5G A;  5JLJ B;  3D8E A;  4L6E A;  2D10 A;  2COC A;  3QIJ A;  5L81 A;  2KUP A;  3LJU X;  4NSW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...