1U5GA

Crystal structure of the ph domain of skap-hom
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
115
structure length
115
Chain Sequence
QFPPIAAQDLPFVIKAGYLEKRRKDHSFLGFEWQKRWCALSKTVFYYYGSDKDKQQKGEFAIDGYDVRMNNTLRKDGKKDCCFEICAPDKRIYQFTAASPKDAEEWVQQLKFILQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Src-associated adaptor protein
publication title The Skap-hom dimerization and PH domains comprise a 3'-phosphoinositide-gated molecular switch.
pubmed doi rcsb
source organism Mus musculus
molecule tags Signaling protein
total genus 26
structure length 115
sequence length 115
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2004-07-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00169 PH PH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 1u5gA01
3D8DA 1FHWA 1TJ6A 4B6HA 4DXAB 3KY9A 5C5BB 2NZ8B 5L81A 4H8SA 5EFXA 5D3WA 2LULA 2P8VA 1PMSA 2IFSA 1WVHA 3AU4A 2J0MA 1X1GA 2W2XD 3HW2B 1W1GA 1ZSQA 2HE7A 2LKOA 1MKEA 1NU2A 3SUZA 2MKRA 2R0DA 1X86A 2YS3A 1PFJA 3ODWA 3GYOA 4HDOA 1V5MA 1X11A 4DX8A 3PP2A 4TKNA 2ELAA 2D4QA 1TQZA 3ZVRA 1OMWA 1AQCA 4CHMA 2DKQA 4HB2B 1EF1A 1RJ2A 1Z87A 1J19A 5DHAB 1SHCA 1M7EA 2CAYA 2CRFA 1WG7A 1MPHA 2AL6A 5LOPB 1N3HA 1IRSA 2DN6A 2DYQA 1ZVRA 2XQNM 2LG1A 3VOQA 2J59M 2W2WA 2RNRB 1U5FA 4GMVA 1NTYA 2Q13A 4KHOA 2M14A 2K00A 4HB0B 5D3XA 1V5PA 3ULCA 2EMSA 5JP4A 1NI2A 4MY6A 2CY5A 3PSCA 2H7EA 2P0HA 1FGZA 1V88A 2EMTA 3FEHA 2ROZB 2KUPA 2GCLA 3F5RA 3PVWA 2Y8FA 2LYDA 3A8PA 5C79A 2YRYA 1H10A 2L2IA 2EC1A 4HAXB 4KHBB 4EKUA 4A6FA 1GC7A 5DIFB 1ZM0A 3BINA 4K2PA 1J0WA 2J0KA 2Z0QA 2UVMA 3V5WA 1MK7B 2COAA 1FOEA 2DTCA 2RUKB 4A6HA 2AEHA 1M7RA 1DBHA 4IFSA 5D3VA 4GN1A 4HHVA 1ZC3B 2YT0A 3T06A 3RCPA 4A6KA 2ELBA 4NY0A 2YT1A 4K81A 5C6RA 4YL8A 1UEFA 2GS0A 2L1CA 3ODOA 4YONA 2BCJA 1X05A 1EAZA 1LW3A 1XKEA 1BTKA 1Y5OA 3ODXA 3AJ4A 1FAOA 3CIKA 2DA0A 1UPRA 2D9VA 4HAVB 3PVLA 3D8EA 4GPTB 1WGUA 3AU5A 2NMBA 1U27A 2YF0A 2N0YA 2YVCA 3DXEA 4NSWA 3SYXA 5DI9B 5J3TA 5DHFB 5CLLB 2RGNB 1KI1B 5C16A 2DHIA 3MPXA 3DXDA 2D2QA 2DHKA 3QWMA 1K5GB 5CLQB 4A6FB 3TFMA 2ZPYA 1WGQA 4HB4B 2P0FA 1OQNA 3QIJA 2D10A 1BWNA 1FB8A 1X1FA 5D3YA 1P5TA 1B55A 4IOYX 1V89A 4CYEA 2D9WA 3KZ1A 1UPQA 1V5UA 1QQGA 3PEGA 2YS5A 3GYPA 2IYBA 1K5DB 3G9WA 4WVFB 5KQ1A 1AWEA 2N23A 1I2HA 4Z2NA 1WJ1A 2VRWB 2I1KA 3WYFB 3TCAA 1MK9B 4HB3B 2RVBB 2K2UA 1ZC4B 4MT7A 3HQCA 3F0WA 3U7DA 3BJIA 1XD4A 1UNRA 5JHHA 2DX1A 4CHJA 1FHOA 3KSYA 2MFQA 4EJNA 3N7CA 3DXCA 3SV1A 1W1HA 5HE3A 2Y7BA 2QKLA 2DFKA 4WSFA 1SGHA 2VSZA 1FHXA 3TO1A 2QKMA 5KCVA 4ZRIA 2K2JA 2OQBA 2EJ8A 1WJMA 4P7IA 2ROVA 4PQ0A 1XR0B 2VKIA 3ULBA 2CY4A 1DYNA 2M38A 3PG7A 2D9XA 4DX90 1ISNA 4HAWB 4DBBA 4TYZA 3PZDA 1UNQA 4GXBA 4A5KA 4F7GA 1Q67A 5JLJB 5LONB 3D8FA 4D0NB 4GZUA 1P3RA 4MK0A 1WI1A 4BBKA 3P7ZA 4KVGB 3SNHA 5HE0A 1DDWA 2R09A 4IAPA 2Z0PA 2KCJA 1BAKA 5HE2A 5J3QA 5J3YA 2MWNB 4PNKA 2RLOA 1EGXA 1GG3A 3ZDTA 2D9YA 5KQ4A 2LOXA 1OY2A 5FI1A 1NTVA 5FI0A 3CXBB 1U5DA 3A8QA 3KRXA 2DLWA 5HE1A 2RSGA 2V76A 3TW1A 2DYNA 1KZGA 1PLSA 3FSSA 2D11A 2CODA 1U29A 1BTNA 1W1DA 4HAUB 3FM8C 4K17A 2D9ZA 1MIXA 5GOWB 2H7DA 1U5EA 1XX0A 4XWXA 3LJUX 5DH9B 1DROA 4Z2MB 3P6AA 1XODA 1GC6A 2LOZA 2FJLA 4F7UP 3WA0A 2GCJA 2J0JA 2X18A 2ADZA 4HATB 1V61A 2I5FA 1RRPB 1E5WA 1U2BA 2YSZA 5C5BA 3UZTA 1UNPA 2DHJA 4C0AA 1I7AA 3O96A 2E2XA 3U8ZA 3HK0A 1U5GA 1MIZB 2Y8GA 4HAZB 4KAXB 2YS1A 3PVUA 2Z0OA 1KZ7A 1Y19B 3SO6A 4WJ7A 1P6SA 1TXDA 5D27A 2HTHB 2P0DA 1DDMA 2KGXB 2UZRA 4F7HA 4EMOA 4KHAA 2I5CA 3ML4A 3X23A 2G35A 2GJYA 3TVVA 1DDVA 2JP2A 4HAYB 2I1JA 4K2OA 4HDQA 4Y94A 4L6EA 2OTXA 3QBVB 1LB1A 3M1IB 1FGYA 3IVFA 1EVHA 4ZRKA 2W2XC 4GMXB 2DKPA 5JHGA 2PZ1A 1MAIA 2COFA 4ZRJA 3A98B 3OANA 1QC6A 3NSUA 2UZSA 2DX5A 3MDBC 2MDXA 3VIAA 1XCGA 1H4RA 2COCA 3KRWA
chains in the Genus database with same CATH superfamily
3D8DA 1FHWA 1TJ6A 4B6HA 2NBVA 4DXAB 3KY9A 5C5BB 4QJ4B 2NZ8B 5L81A 4H8SA 2YT2A 5EFXA 5D3WA 2LULA 2P8VA 2K49A 1PMSA 5I2MA 2IFSA 1WVHA 3AU4A 2R2YA 2J0MA 4OSNA 1X1GA 2W2XD 3HW2B 1W1GA 1ZSQA 2HE7A 2LKOA 3FVCA 1MKEA 4KHBA 1NU2A 3SUZA 4GNKB 2MKRA 2R0DA 1X86A 2YS3A 1PFJA 3ODWA 3GYOA 4HDOA 1V5MA 1X11A 4DX8A 4D6WA 3PP2A 2KUQA 3NWDA 4TKNA 2ELAA 2D4QA 1TQZA 3ZVRA 1OMWA 1AQCA 4CHMA 2DKQA 4HB2B 1EF1A 1RJ2A 1Z87A 1J19A 5DHAB 1SHCA 1M7EA 2CAYA 2CRFA 1WG7A 1MPHA 2AL6A 5LOPB 1N3HA 1IRSA 2DN6A 2DYQA 1ZVRA 2XQNM 2LG1A 3VOQA 2J59M 2W2WA 2RNRB 1U5FA 4GMVA 1NTYA 2Q13A 4KHOA 2M14A 4CSQA 2K00A 4HB0B 5D3XA 1V5PA 3ULCA 2EMSA 5JP4A 1NI2A 4MY6A 2CY5A 2H7EA 2P0HA 1V88A 1FGZA 3PSCA 3FEHA 2EMTA 1MI1A 2ROZB 2KUPA 2GCLA 3F5RA 3PVWA 2Y8FA 2LYDA 3A8PA 5C79A 2YRYA 1H10A 2L2IA 3U12A 2EC1A 4HAXB 4KHBB 4EKUA 4A6FA 1GC7A 5DIFB 1ZM0A 3BINA 4K2PA 1J0WA 2J0KA 2Z0QA 2UVMA 3V5WA 1MK7B 2COAA 1FOEA 2DTCA 3HSAA 2RUKB 5LG4B 4A6HA 2AEHA 1M7RA 1DBHA 2KR0A 4IFSA 4GN1A 4HHVA 4QXAB 5D3VA 1ZC3B 2YT0A 2ZKMX 3T06A 3RCPA 4A6KA 2ELBA 4NY0A 2YT1A 4K81A 2Z13A 5C6RA 4QJ3B 4YL8A 1UEFA 2GS0A 2L1CA 3ODOA 4YONA 2BCJA 1X05A 1EAZA 1LW3A 1XKEA 1BTKA 1Y5OA 3ODXA 3AJ4A 1FAOA 3CIKA 2DA0A 1UPRA 2D9VA 4HAVB 3PVLA 3D8EA 4GPTB 1WGUA 3AU5A 2NMBA 1U27A 2YF0A 2N0YA 2YVCA 4L1RA 3DXEA 4NSWA 3SYXA 2FJUB 5DI9B 5J3TA 5DHFB 5CLLB 2RGNB 1KI1B 5C16A 2DHIA 3MPXA 3DXDA 2D2QA 2DHKA 3HIEA 3QWMA 1K5GB 5CLQB 4A6FB 3TFMA 2ZPYA 1WGQA 4HB4B 2P0FA 1OQNA 3QIJA 2D10A 1BWNA 1FB8A 1X1FA 5D3YA 1P5TA 1B55A 4IOYX 1V89A 4CYEA 2D9WA 3KZ1A 1UPQA 1V5UA 1QQGA 2Z4DA 3PEGA 2YS5A 3GYPA 2IYBA 1K5DB 3G9WA 2RRFA 4WVFB 4HSIA 5KQ1A 1AWEA 2GUMA 2N23A 1I2HA 4Z2NA 1WJ1A 2VRWB 2I1KA 3WYFB 3NWAA 3TCAA 1MK9B 4HB3B 2K8EA 2RVBB 2K2UA 1ZC4B 4MT7A 3HQCA 3F0WA 3U7DA 3BJIA 1XD4A 1UNRA 5JHHA 2DX1A 4DIXA 4CHJA 1FHOA 2KIGA 3KSYA 2MFQA 4EJNA 3N7CA 3DXCA 3SV1A 1W1HA 4QJ5B 5HE3A 4OT1A 2Y7BA 2QKLA 2DFKA 4WSFA 1SGHA 2VSZA 1FHXA 3TO1A 2QKMA 5KCVA 4ZRIA 2K2JA 3NW8A 2OQBA 2EJ8A 1WJMA 4P7IA 2ROVA 5I2SA 4PQ0A 1XR0B 2VKIA 3ULBA 2CY4A 1DYNA 2M38A 3PG7A 2D9XA 4DX90 1ISNA 4HAWB 4DBBA 4TYZA 3PZDA 1UNQA 4GXBA 4A5KA 4F7GA 1Q67A 5JLJB 5LONB 3D8FA 4D0NB 1T77A 2KIEA 4GZUA 1P3RA 4MK0A 1WI1A 4BBKA 3P7ZA 4KVGB 3SNHA 5HE0A 1DDWA 2R09A 4IAPA 2Z0PA 2KCJA 5M4YB 1BAKA 5HE2A 5J3QA 5J3YA 2MWNB 4PNKA 2RLOA 1EGXA 1GG3A 3ZDTA 2D9YA 5KQ4A 2LOXA 1OY2A 5FI1A 1NTVA 5FI0A 3CXBB 1U5DA 3A8QA 3KRXA 2DLWA 5HE1A 2RSGA 2V76A 3TW1A 2DYNA 1KZGA 1PLSA 3FSSA 2D11A 2CODA 1U29A 1BTNA 1W1DA 4HAUB 3FM8C 3OHMB 4K17A 2D9ZA 1MIXA 5GOWB 2H7DA 1U5EA 1XX0A 4XWXA 3LJUX 5DH9B 1DROA 4Z2MB 3P6AA 1XODA 1GC6A 2LOZA 2FJLA 4F7UP 3WA0A 2GCJA 4GOUA 5IRSA 2J0JA 2X18A 2ADZA 4HATB 1V61A 2I5FA 1RRPB 1E5WA 1U2BA 2YSZA 5C5BA 3UZTA 1UNPA 2DHJA 4C0AA 1I7AA 3O96A 3NWFA 3A58A 2E2XA 3U8ZA 3HK0A 1U5GA 1MIZB 2Y8GA 4HAZB 4KAXB 2YS1A 3PVUA 2Z0OA 1KZ7A 1Y19B 3SO6A 4WJ7A 1P6SA 1TXDA 5D27A 2HTHB 2P0DA 1DDMA 2KGXB 2UZRA 4F7HA 4EMOA 4KHAA 2I5CA 3ML4A 3X23A 2G35A 2GJYA 3TVVA 3DCXA 2Z59A 1DDVA 2JP2A 4HAYB 2I1JA 1ZYIA 4K2OA 3B77A 4HDQA 4Y94A 4L6EA 2OTXA 3QBVB 1LB1A 3M1IB 1FGYA 3IVFA 1EVHA 4ZRKA 2W2XC 4GMXB 2DKPA 5JHGA 2PZ1A 1MAIA 2COFA 4ZRJA 3A98B 3OANA 1QC6A 3NSUA 2UZSA 2DX5A 3MDBC 2MDXA 2Z14A 3VIAA 1XCGA 1H4RA 2COCA 3KRWA
chains in the Genus database with same CATH topology
3D8DA 1FHWA 1TJ6A 4B6HA 4DXAB 3KY9A 5C5BB 2NZ8B 5L81A 4H8SA 5EFXA 5D3WA 2LULA 2P8VA 1PMSA 2IFSA 1WVHA 3AU4A 2J0MA 1X1GA 2W2XD 3HW2B 1W1GA 1ZSQA 2HE7A 2LKOA 1MKEA 1NU2A 3SUZA 2MKRA 2R0DA 1X86A 2YS3A 1PFJA 3ODWA 3GYOA 4HDOA 1V5MA 1X11A 4DX8A 3PP2A 4TKNA 2ELAA 2D4QA 1TQZA 3ZVRA 1OMWA 1AQCA 4CHMA 2DKQA 4HB2B 1EF1A 1RJ2A 1Z87A 1J19A 5DHAB 1SHCA 1M7EA 2CAYA 2CRFA 1WG7A 1MPHA 2AL6A 5LOPB 1N3HA 1IRSA 2DN6A 2DYQA 1ZVRA 2XQNM 2LG1A 3VOQA 2J59M 2W2WA 2RNRB 1U5FA 4GMVA 1NTYA 2Q13A 4KHOA 2M14A 2K00A 4HB0B 5D3XA 1V5PA 3ULCA 2EMSA 5JP4A 1NI2A 4MY6A 2CY5A 3PSCA 2H7EA 2P0HA 1FGZA 1V88A 2EMTA 3FEHA 2ROZB 2KUPA 2GCLA 3F5RA 3PVWA 2Y8FA 2LYDA 3A8PA 5C79A 2YRYA 1H10A 2L2IA 2EC1A 4HAXB 4KHBB 4EKUA 4A6FA 1GC7A 5DIFB 1ZM0A 3BINA 4K2PA 1J0WA 2J0KA 2Z0QA 2UVMA 3V5WA 1MK7B 2COAA 1FOEA 2DTCA 2RUKB 4A6HA 2AEHA 1M7RA 1DBHA 4IFSA 5D3VA 4GN1A 4HHVA 1ZC3B 2YT0A 3T06A 3RCPA 4A6KA 2ELBA 4NY0A 2YT1A 4K81A 5C6RA 4YL8A 1UEFA 2GS0A 2L1CA 3ODOA 4YONA 2BCJA 1X05A 1EAZA 1LW3A 1XKEA 1BTKA 1Y5OA 3ODXA 3AJ4A 1FAOA 3CIKA 2DA0A 1UPRA 2D9VA 4HAVB 3PVLA 3D8EA 4GPTB 1WGUA 3AU5A 2NMBA 1U27A 2YF0A 2N0YA 2YVCA 3DXEA 4NSWA 3SYXA 5DI9B 5J3TA 5DHFB 5CLLB 2RGNB 1KI1B 5C16A 2DHIA 3MPXA 3DXDA 2D2QA 2DHKA 3QWMA 1K5GB 5CLQB 4A6FB 3TFMA 2ZPYA 1WGQA 4HB4B 2P0FA 1OQNA 3QIJA 2D10A 1BWNA 1FB8A 1X1FA 5D3YA 1P5TA 1B55A 4IOYX 1V89A 4CYEA 2D9WA 3KZ1A 1UPQA 1V5UA 1QQGA 3PEGA 2YS5A 3GYPA 2IYBA 1K5DB 3G9WA 4WVFB 5KQ1A 1AWEA 2N23A 1I2HA 4Z2NA 1WJ1A 2VRWB 2I1KA 3WYFB 3TCAA 1MK9B 4HB3B 2RVBB 2K2UA 1ZC4B 4MT7A 3HQCA 3F0WA 3U7DA 3BJIA 1XD4A 1UNRA 5JHHA 2DX1A 4CHJA 1FHOA 3KSYA 2MFQA 4EJNA 3N7CA 3DXCA 3SV1A 1W1HA 5HE3A 2Y7BA 2QKLA 2DFKA 4WSFA 1SGHA 2VSZA 1FHXA 3TO1A 2QKMA 5KCVA 4ZRIA 2K2JA 2OQBA 2EJ8A 1WJMA 4P7IA 2ROVA 4PQ0A 1XR0B 2VKIA 3ULBA 2CY4A 1DYNA 2M38A 3PG7A 2D9XA 4DX90 1ISNA 4HAWB 4DBBA 4TYZA 3PZDA 1UNQA 4GXBA 4A5KA 4F7GA 1Q67A 5JLJB 5LONB 3D8FA 4D0NB 4GZUA 1P3RA 4MK0A 1WI1A 4BBKA 3P7ZA 4KVGB 3SNHA 5HE0A 1DDWA 2R09A 4IAPA 2Z0PA 2KCJA 1BAKA 5HE2A 5J3QA 5J3YA 2MWNB 4PNKA 2RLOA 1EGXA 1GG3A 3ZDTA 2D9YA 5KQ4A 2LOXA 1OY2A 5FI1A 1NTVA 5FI0A 3CXBB 1U5DA 3A8QA 3KRXA 2DLWA 5HE1A 2RSGA 2V76A 3TW1A 2DYNA 1KZGA 1PLSA 3FSSA 2D11A 2CODA 1U29A 1BTNA 1W1DA 4HAUB 3FM8C 4K17A 2D9ZA 1MIXA 5GOWB 2H7DA 1U5EA 1XX0A 4XWXA 3LJUX 5DH9B 1DROA 4Z2MB 3P6AA 1XODA 1GC6A 2LOZA 2FJLA 4F7UP 3WA0A 2GCJA 2J0JA 2X18A 2ADZA 4HATB 1V61A 2I5FA 1RRPB 1E5WA 1U2BA 2YSZA 5C5BA 3UZTA 1UNPA 2DHJA 4C0AA 1I7AA 3O96A 2E2XA 3U8ZA 3HK0A 1U5GA 1MIZB 2Y8GA 4HAZB 4KAXB 2YS1A 3PVUA 2Z0OA 1KZ7A 1Y19B 3SO6A 4WJ7A 1P6SA 1TXDA 5D27A 2HTHB 2P0DA 1DDMA 2KGXB 2UZRA 4F7HA 4EMOA 4KHAA 2I5CA 3ML4A 3X23A 2G35A 2GJYA 3TVVA 1DDVA 2JP2A 4HAYB 2I1JA 4K2OA 4HDQA 4Y94A 4L6EA 2OTXA 3QBVB 1LB1A 3M1IB 1FGYA 3IVFA 1EVHA 4ZRKA 2W2XC 4GMXB 2DKPA 5JHGA 2PZ1A 1MAIA 2COFA 4ZRJA 3A98B 3OANA 1QC6A 3NSUA 2UZSA 2DX5A 3MDBC 2MDXA 3VIAA 1XCGA 1H4RA 2COCA 3KRWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3D8D A;  1FHW A;  1TJ6 A;  4B6H A;  4DXA B;  3KY9 A;  5C5B B;  2NZ8 B;  5L81 A;  4H8S A;  5EFX A;  5D3W A;  2LUL A;  2P8V A;  1PMS A;  2IFS A;  1WVH A;  3AU4 A;  2J0M A;  1X1G A;  2W2X D;  3HW2 B;  1W1G A;  1ZSQ A;  2HE7 A;  2LKO A;  1MKE A;  1NU2 A;  3SUZ A;  2MKR A;  2R0D A;  1X86 A;  2YS3 A;  1PFJ A;  3ODW A;  3GYO A;  4HDO A;  1V5M A;  1X11 A;  4DX8 A;  3PP2 A;  4TKN A;  2ELA A;  2D4Q A;  1TQZ A;  3ZVR A;  1OMW A;  1AQC A;  4CHM A;  2DKQ A;  4HB2 B;  1EF1 A;  1RJ2 A;  1Z87 A;  1J19 A;  5DHA B;  1SHC A;  1M7E A;  2CAY A;  2CRF A;  1WG7 A;  1MPH A;  2AL6 A;  5LOP B;  1N3H A;  1IRS A;  2DN6 A;  2DYQ A;  1ZVR A;  2XQN M;  2LG1 A;  3VOQ A;  2J59 M;  2W2W A;  2RNR B;  1U5F A;  4GMV A;  1NTY A;  2Q13 A;  4KHO A;  2M14 A;  2K00 A;  4HB0 B;  5D3X A;  1V5P A;  3ULC A;  2EMS A;  5JP4 A;  1NI2 A;  4MY6 A;  2CY5 A;  3PSC A;  2H7E A;  2P0H A;  1FGZ A;  1V88 A;  2EMT A;  3FEH A;  2ROZ B;  2KUP A;  2GCL A;  3F5R A;  3PVW A;  2Y8F A;  2LYD A;  3A8P A;  5C79 A;  2YRY A;  1H10 A;  2L2I A;  2EC1 A;  4HAX B;  4KHB B;  4EKU A;  4A6F A;  1GC7 A;  5DIF B;  1ZM0 A;  3BIN A;  4K2P A;  1J0W A;  2J0K A;  2Z0Q A;  2UVM A;  3V5W A;  1MK7 B;  2COA A;  1FOE A;  2DTC A;  2RUK B;  4A6H A;  2AEH A;  1M7R A;  1DBH A;  4IFS A;  5D3V A;  4GN1 A;  4HHV A;  1ZC3 B;  2YT0 A;  3T06 A;  3RCP A;  4A6K A;  2ELB A;  4NY0 A;  2YT1 A;  4K81 A;  5C6R A;  4YL8 A;  1UEF A;  2GS0 A;  2L1C A;  3ODO A;  4YON A;  2BCJ A;  1X05 A;  1EAZ A;  1LW3 A;  1XKE A;  1BTK A;  1Y5O A;  3ODX A;  3AJ4 A;  1FAO A;  3CIK A;  2DA0 A;  1UPR A;  2D9V A;  4HAV B;  3PVL A;  3D8E A;  4GPT B;  1WGU A;  3AU5 A;  2NMB A;  1U27 A;  2YF0 A;  2N0Y A;  2YVC A;  3DXE A;  4NSW A;  3SYX A;  5DI9 B;  5J3T A;  5DHF B;  5CLL B;  2RGN B;  1KI1 B;  5C16 A;  2DHI A;  3MPX A;  3DXD A;  2D2Q A;  2DHK A;  3QWM A;  1K5G B;  5CLQ B;  4A6F B;  3TFM A;  2ZPY A;  1WGQ A;  4HB4 B;  2P0F A;  1OQN A;  3QIJ A;  2D10 A;  1BWN A;  1FB8 A;  1X1F A;  5D3Y A;  1P5T A;  1B55 A;  4IOY X;  1V89 A;  4CYE A;  2D9W A;  3KZ1 A;  1UPQ A;  1V5U A;  1QQG A;  3PEG A;  2YS5 A;  3GYP A;  2IYB A;  1K5D B;  3G9W A;  4WVF B;  5KQ1 A;  1AWE A;  2N23 A;  1I2H A;  4Z2N A;  1WJ1 A;  2VRW B;  2I1K A;  3WYF B;  3TCA A;  1MK9 B;  4HB3 B;  2RVB B;  2K2U A;  1ZC4 B;  4MT7 A;  3HQC A;  3F0W A;  3U7D A;  3BJI A;  1XD4 A;  1UNR A;  5JHH A;  2DX1 A;  4CHJ A;  1FHO A;  3KSY A;  2MFQ A;  4EJN A;  3N7C A;  3DXC A;  3SV1 A;  1W1H A;  5HE3 A;  2Y7B A;  2QKL A;  2DFK A;  4WSF A;  1SGH A;  2VSZ A;  1FHX A;  3TO1 A;  2QKM A;  5KCV A;  4ZRI A;  2K2J A;  2OQB A;  2EJ8 A;  1WJM A;  4P7I A;  2ROV A;  4PQ0 A;  1XR0 B;  2VKI A;  3ULB A;  2CY4 A;  1DYN A;  2M38 A;  3PG7 A;  2D9X A;  4DX9 0;  1ISN A;  4HAW B;  4DBB A;  4TYZ A;  3PZD A;  1UNQ A;  4GXB A;  4A5K A;  4F7G A;  1Q67 A;  5JLJ B;  5LON B;  3D8F A;  4D0N B;  4GZU A;  1P3R A;  4MK0 A;  1WI1 A;  4BBK A;  3P7Z A;  4KVG B;  3SNH A;  5HE0 A;  1DDW A;  2R09 A;  4IAP A;  2Z0P A;  2KCJ A;  1BAK A;  5HE2 A;  5J3Q A;  5J3Y A;  2MWN B;  4PNK A;  2RLO A;  1EGX A;  1GG3 A;  3ZDT A;  2D9Y A;  5KQ4 A;  2LOX A;  1OY2 A;  5FI1 A;  1NTV A;  5FI0 A;  3CXB B;  1U5D A;  3A8Q A;  3KRX A;  2DLW A;  5HE1 A;  2RSG A;  2V76 A;  3TW1 A;  2DYN A;  1KZG A;  1PLS A;  3FSS A;  2D11 A;  2COD A;  1U29 A;  1BTN A;  1W1D A;  4HAU B;  3FM8 C;  4K17 A;  2D9Z A;  1MIX A;  5GOW B;  2H7D A;  1U5E A;  1XX0 A;  4XWX A;  3LJU X;  5DH9 B;  1DRO A;  4Z2M B;  3P6A A;  1XOD A;  1GC6 A;  2LOZ A;  2FJL A;  4F7U P;  3WA0 A;  2GCJ A;  2J0J A;  2X18 A;  2ADZ A;  4HAT B;  1V61 A;  2I5F A;  1RRP B;  1E5W A;  1U2B A;  2YSZ A;  5C5B A;  3UZT A;  1UNP A;  2DHJ A;  4C0A A;  1I7A A;  3O96 A;  2E2X A;  3U8Z A;  3HK0 A;  1U5G A;  1MIZ B;  2Y8G A;  4HAZ B;  4KAX B;  2YS1 A;  3PVU A;  2Z0O A;  1KZ7 A;  1Y19 B;  3SO6 A;  4WJ7 A;  1P6S A;  1TXD A;  5D27 A;  2HTH B;  2P0D A;  1DDM A;  2KGX B;  2UZR A;  4F7H A;  4EMO A;  4KHA A;  2I5C A;  3ML4 A;  3X23 A;  2G35 A;  2GJY A;  3TVV A;  1DDV A;  2JP2 A;  4HAY B;  2I1J A;  4K2O A;  4HDQ A;  4Y94 A;  4L6E A;  2OTX A;  3QBV B;  1LB1 A;  3M1I B;  1FGY A;  3IVF A;  1EVH A;  4ZRK A;  2W2X C;  4GMX B;  2DKP A;  5JHG A;  2PZ1 A;  1MAI A;  2COF A;  4ZRJ A;  3A98 B;  3OAN A;  1QC6 A;  3NSU A;  2UZS A;  2DX5 A;  3MDB C;  2MDX A;  3VIA A;  1XCG A;  1H4R A;  2COC A;  3KRW A; 
#chains in the Genus database with same CATH topology
 3D8D A;  1FHW A;  1TJ6 A;  4B6H A;  2NBV A;  4DXA B;  3KY9 A;  5C5B B;  4QJ4 B;  2NZ8 B;  5L81 A;  4H8S A;  2YT2 A;  5EFX A;  5D3W A;  2LUL A;  2P8V A;  2K49 A;  1PMS A;  5I2M A;  2IFS A;  1WVH A;  3AU4 A;  2R2Y A;  2J0M A;  4OSN A;  1X1G A;  2W2X D;  3HW2 B;  1W1G A;  1ZSQ A;  2HE7 A;  2LKO A;  3FVC A;  1MKE A;  4KHB A;  1NU2 A;  3SUZ A;  4GNK B;  2MKR A;  2R0D A;  1X86 A;  2YS3 A;  1PFJ A;  3ODW A;  3GYO A;  4HDO A;  1V5M A;  1X11 A;  4DX8 A;  4D6W A;  3PP2 A;  2KUQ A;  3NWD A;  4TKN A;  2ELA A;  2D4Q A;  1TQZ A;  3ZVR A;  1OMW A;  1AQC A;  4CHM A;  2DKQ A;  4HB2 B;  1EF1 A;  1RJ2 A;  1Z87 A;  1J19 A;  5DHA B;  1SHC A;  1M7E A;  2CAY A;  2CRF A;  1WG7 A;  1MPH A;  2AL6 A;  5LOP B;  1N3H A;  1IRS A;  2DN6 A;  2DYQ A;  1ZVR A;  2XQN M;  2LG1 A;  3VOQ A;  2J59 M;  2W2W A;  2RNR B;  1U5F A;  4GMV A;  1NTY A;  2Q13 A;  4KHO A;  2M14 A;  4CSQ A;  2K00 A;  4HB0 B;  5D3X A;  1V5P A;  3ULC A;  2EMS A;  5JP4 A;  1NI2 A;  4MY6 A;  2CY5 A;  2H7E A;  2P0H A;  1V88 A;  1FGZ A;  3PSC A;  3FEH A;  2EMT A;  1MI1 A;  2ROZ B;  2KUP A;  2GCL A;  3F5R A;  3PVW A;  2Y8F A;  2LYD A;  3A8P A;  5C79 A;  2YRY A;  1H10 A;  2L2I A;  3U12 A;  2EC1 A;  4HAX B;  4KHB B;  4EKU A;  4A6F A;  1GC7 A;  5DIF B;  1ZM0 A;  3BIN A;  4K2P A;  1J0W A;  2J0K A;  2Z0Q A;  2UVM A;  3V5W A;  1MK7 B;  2COA A;  1FOE A;  2DTC A;  3HSA A;  2RUK B;  5LG4 B;  4A6H A;  2AEH A;  1M7R A;  1DBH A;  2KR0 A;  4IFS A;  4GN1 A;  4HHV A;  4QXA B;  5D3V A;  1ZC3 B;  2YT0 A;  2ZKM X;  3T06 A;  3RCP A;  4A6K A;  2ELB A;  4NY0 A;  2YT1 A;  4K81 A;  2Z13 A;  5C6R A;  4QJ3 B;  4YL8 A;  1UEF A;  2GS0 A;  2L1C A;  3ODO A;  4YON A;  2BCJ A;  1X05 A;  1EAZ A;  1LW3 A;  1XKE A;  1BTK A;  1Y5O A;  3ODX A;  3AJ4 A;  1FAO A;  3CIK A;  2DA0 A;  1UPR A;  2D9V A;  4HAV B;  3PVL A;  3D8E A;  4GPT B;  1WGU A;  3AU5 A;  2NMB A;  1U27 A;  2YF0 A;  2N0Y A;  2YVC A;  4L1R A;  3DXE A;  4NSW A;  3SYX A;  2FJU B;  5DI9 B;  5J3T A;  5DHF B;  5CLL B;  2RGN B;  1KI1 B;  5C16 A;  2DHI A;  3MPX A;  3DXD A;  2D2Q A;  2DHK A;  3HIE A;  3QWM A;  1K5G B;  5CLQ B;  4A6F B;  3TFM A;  2ZPY A;  1WGQ A;  4HB4 B;  2P0F A;  1OQN A;  3QIJ A;  2D10 A;  1BWN A;  1FB8 A;  1X1F A;  5D3Y A;  1P5T A;  1B55 A;  4IOY X;  1V89 A;  4CYE A;  2D9W A;  3KZ1 A;  1UPQ A;  1V5U A;  1QQG A;  2Z4D A;  3PEG A;  2YS5 A;  3GYP A;  2IYB A;  1K5D B;  3G9W A;  2RRF A;  4WVF B;  4HSI A;  5KQ1 A;  1AWE A;  2GUM A;  2N23 A;  1I2H A;  4Z2N A;  1WJ1 A;  2VRW B;  2I1K A;  3WYF B;  3NWA A;  3TCA A;  1MK9 B;  4HB3 B;  2K8E A;  2RVB B;  2K2U A;  1ZC4 B;  4MT7 A;  3HQC A;  3F0W A;  3U7D A;  3BJI A;  1XD4 A;  1UNR A;  5JHH A;  2DX1 A;  4DIX A;  4CHJ A;  1FHO A;  2KIG A;  3KSY A;  2MFQ A;  4EJN A;  3N7C A;  3DXC A;  3SV1 A;  1W1H A;  4QJ5 B;  5HE3 A;  4OT1 A;  2Y7B A;  2QKL A;  2DFK A;  4WSF A;  1SGH A;  2VSZ A;  1FHX A;  3TO1 A;  2QKM A;  5KCV A;  4ZRI A;  2K2J A;  3NW8 A;  2OQB A;  2EJ8 A;  1WJM A;  4P7I A;  2ROV A;  5I2S A;  4PQ0 A;  1XR0 B;  2VKI A;  3ULB A;  2CY4 A;  1DYN A;  2M38 A;  3PG7 A;  2D9X A;  4DX9 0;  1ISN A;  4HAW B;  4DBB A;  4TYZ A;  3PZD A;  1UNQ A;  4GXB A;  4A5K A;  4F7G A;  1Q67 A;  5JLJ B;  5LON B;  3D8F A;  4D0N B;  1T77 A;  2KIE A;  4GZU A;  1P3R A;  4MK0 A;  1WI1 A;  4BBK A;  3P7Z A;  4KVG B;  3SNH A;  5HE0 A;  1DDW A;  2R09 A;  4IAP A;  2Z0P A;  2KCJ A;  5M4Y B;  1BAK A;  5HE2 A;  5J3Q A;  5J3Y A;  2MWN B;  4PNK A;  2RLO A;  1EGX A;  1GG3 A;  3ZDT A;  2D9Y A;  5KQ4 A;  2LOX A;  1OY2 A;  5FI1 A;  1NTV A;  5FI0 A;  3CXB B;  1U5D A;  3A8Q A;  3KRX A;  2DLW A;  5HE1 A;  2RSG A;  2V76 A;  3TW1 A;  2DYN A;  1KZG A;  1PLS A;  3FSS A;  2D11 A;  2COD A;  1U29 A;  1BTN A;  1W1D A;  4HAU B;  3FM8 C;  3OHM B;  4K17 A;  2D9Z A;  1MIX A;  5GOW B;  2H7D A;  1U5E A;  1XX0 A;  4XWX A;  3LJU X;  5DH9 B;  1DRO A;  4Z2M B;  3P6A A;  1XOD A;  1GC6 A;  2LOZ A;  2FJL A;  4F7U P;  3WA0 A;  2GCJ A;  4GOU A;  5IRS A;  2J0J A;  2X18 A;  2ADZ A;  4HAT B;  1V61 A;  2I5F A;  1RRP B;  1E5W A;  1U2B A;  2YSZ A;  5C5B A;  3UZT A;  1UNP A;  2DHJ A;  4C0A A;  1I7A A;  3O96 A;  3NWF A;  3A58 A;  2E2X A;  3U8Z A;  3HK0 A;  1U5G A;  1MIZ B;  2Y8G A;  4HAZ B;  4KAX B;  2YS1 A;  3PVU A;  2Z0O A;  1KZ7 A;  1Y19 B;  3SO6 A;  4WJ7 A;  1P6S A;  1TXD A;  5D27 A;  2HTH B;  2P0D A;  1DDM A;  2KGX B;  2UZR A;  4F7H A;  4EMO A;  4KHA A;  2I5C A;  3ML4 A;  3X23 A;  2G35 A;  2GJY A;  3TVV A;  3DCX A;  2Z59 A;  1DDV A;  2JP2 A;  4HAY B;  2I1J A;  1ZYI A;  4K2O A;  3B77 A;  4HDQ A;  4Y94 A;  4L6E A;  2OTX A;  3QBV B;  1LB1 A;  3M1I B;  1FGY A;  3IVF A;  1EVH A;  4ZRK A;  2W2X C;  4GMX B;  2DKP A;  5JHG A;  2PZ1 A;  1MAI A;  2COF A;  4ZRJ A;  3A98 B;  3OAN A;  1QC6 A;  3NSU A;  2UZS A;  2DX5 A;  3MDB C;  2MDX A;  2Z14 A;  3VIA A;  1XCG A;  1H4R A;  2COC A;  3KRW A; 
#chains in the Genus database with same CATH homology
 3D8D A;  1FHW A;  1TJ6 A;  4B6H A;  4DXA B;  3KY9 A;  5C5B B;  2NZ8 B;  5L81 A;  4H8S A;  5EFX A;  5D3W A;  2LUL A;  2P8V A;  1PMS A;  2IFS A;  1WVH A;  3AU4 A;  2J0M A;  1X1G A;  2W2X D;  3HW2 B;  1W1G A;  1ZSQ A;  2HE7 A;  2LKO A;  1MKE A;  1NU2 A;  3SUZ A;  2MKR A;  2R0D A;  1X86 A;  2YS3 A;  1PFJ A;  3ODW A;  3GYO A;  4HDO A;  1V5M A;  1X11 A;  4DX8 A;  3PP2 A;  4TKN A;  2ELA A;  2D4Q A;  1TQZ A;  3ZVR A;  1OMW A;  1AQC A;  4CHM A;  2DKQ A;  4HB2 B;  1EF1 A;  1RJ2 A;  1Z87 A;  1J19 A;  5DHA B;  1SHC A;  1M7E A;  2CAY A;  2CRF A;  1WG7 A;  1MPH A;  2AL6 A;  5LOP B;  1N3H A;  1IRS A;  2DN6 A;  2DYQ A;  1ZVR A;  2XQN M;  2LG1 A;  3VOQ A;  2J59 M;  2W2W A;  2RNR B;  1U5F A;  4GMV A;  1NTY A;  2Q13 A;  4KHO A;  2M14 A;  2K00 A;  4HB0 B;  5D3X A;  1V5P A;  3ULC A;  2EMS A;  5JP4 A;  1NI2 A;  4MY6 A;  2CY5 A;  3PSC A;  2H7E A;  2P0H A;  1FGZ A;  1V88 A;  2EMT A;  3FEH A;  2ROZ B;  2KUP A;  2GCL A;  3F5R A;  3PVW A;  2Y8F A;  2LYD A;  3A8P A;  5C79 A;  2YRY A;  1H10 A;  2L2I A;  2EC1 A;  4HAX B;  4KHB B;  4EKU A;  4A6F A;  1GC7 A;  5DIF B;  1ZM0 A;  3BIN A;  4K2P A;  1J0W A;  2J0K A;  2Z0Q A;  2UVM A;  3V5W A;  1MK7 B;  2COA A;  1FOE A;  2DTC A;  2RUK B;  4A6H A;  2AEH A;  1M7R A;  1DBH A;  4IFS A;  5D3V A;  4GN1 A;  4HHV A;  1ZC3 B;  2YT0 A;  3T06 A;  3RCP A;  4A6K A;  2ELB A;  4NY0 A;  2YT1 A;  4K81 A;  5C6R A;  4YL8 A;  1UEF A;  2GS0 A;  2L1C A;  3ODO A;  4YON A;  2BCJ A;  1X05 A;  1EAZ A;  1LW3 A;  1XKE A;  1BTK A;  1Y5O A;  3ODX A;  3AJ4 A;  1FAO A;  3CIK A;  2DA0 A;  1UPR A;  2D9V A;  4HAV B;  3PVL A;  3D8E A;  4GPT B;  1WGU A;  3AU5 A;  2NMB A;  1U27 A;  2YF0 A;  2N0Y A;  2YVC A;  3DXE A;  4NSW A;  3SYX A;  5DI9 B;  5J3T A;  5DHF B;  5CLL B;  2RGN B;  1KI1 B;  5C16 A;  2DHI A;  3MPX A;  3DXD A;  2D2Q A;  2DHK A;  3QWM A;  1K5G B;  5CLQ B;  4A6F B;  3TFM A;  2ZPY A;  1WGQ A;  4HB4 B;  2P0F A;  1OQN A;  3QIJ A;  2D10 A;  1BWN A;  1FB8 A;  1X1F A;  5D3Y A;  1P5T A;  1B55 A;  4IOY X;  1V89 A;  4CYE A;  2D9W A;  3KZ1 A;  1UPQ A;  1V5U A;  1QQG A;  3PEG A;  2YS5 A;  3GYP A;  2IYB A;  1K5D B;  3G9W A;  4WVF B;  5KQ1 A;  1AWE A;  2N23 A;  1I2H A;  4Z2N A;  1WJ1 A;  2VRW B;  2I1K A;  3WYF B;  3TCA A;  1MK9 B;  4HB3 B;  2RVB B;  2K2U A;  1ZC4 B;  4MT7 A;  3HQC A;  3F0W A;  3U7D A;  3BJI A;  1XD4 A;  1UNR A;  5JHH A;  2DX1 A;  4CHJ A;  1FHO A;  3KSY A;  2MFQ A;  4EJN A;  3N7C A;  3DXC A;  3SV1 A;  1W1H A;  5HE3 A;  2Y7B A;  2QKL A;  2DFK A;  4WSF A;  1SGH A;  2VSZ A;  1FHX A;  3TO1 A;  2QKM A;  5KCV A;  4ZRI A;  2K2J A;  2OQB A;  2EJ8 A;  1WJM A;  4P7I A;  2ROV A;  4PQ0 A;  1XR0 B;  2VKI A;  3ULB A;  2CY4 A;  1DYN A;  2M38 A;  3PG7 A;  2D9X A;  4DX9 0;  1ISN A;  4HAW B;  4DBB A;  4TYZ A;  3PZD A;  1UNQ A;  4GXB A;  4A5K A;  4F7G A;  1Q67 A;  5JLJ B;  5LON B;  3D8F A;  4D0N B;  4GZU A;  1P3R A;  4MK0 A;  1WI1 A;  4BBK A;  3P7Z A;  4KVG B;  3SNH A;  5HE0 A;  1DDW A;  2R09 A;  4IAP A;  2Z0P A;  2KCJ A;  1BAK A;  5HE2 A;  5J3Q A;  5J3Y A;  2MWN B;  4PNK A;  2RLO A;  1EGX A;  1GG3 A;  3ZDT A;  2D9Y A;  5KQ4 A;  2LOX A;  1OY2 A;  5FI1 A;  1NTV A;  5FI0 A;  3CXB B;  1U5D A;  3A8Q A;  3KRX A;  2DLW A;  5HE1 A;  2RSG A;  2V76 A;  3TW1 A;  2DYN A;  1KZG A;  1PLS A;  3FSS A;  2D11 A;  2COD A;  1U29 A;  1BTN A;  1W1D A;  4HAU B;  3FM8 C;  4K17 A;  2D9Z A;  1MIX A;  5GOW B;  2H7D A;  1U5E A;  1XX0 A;  4XWX A;  3LJU X;  5DH9 B;  1DRO A;  4Z2M B;  3P6A A;  1XOD A;  1GC6 A;  2LOZ A;  2FJL A;  4F7U P;  3WA0 A;  2GCJ A;  2J0J A;  2X18 A;  2ADZ A;  4HAT B;  1V61 A;  2I5F A;  1RRP B;  1E5W A;  1U2B A;  2YSZ A;  5C5B A;  3UZT A;  1UNP A;  2DHJ A;  4C0A A;  1I7A A;  3O96 A;  2E2X A;  3U8Z A;  3HK0 A;  1U5G A;  1MIZ B;  2Y8G A;  4HAZ B;  4KAX B;  2YS1 A;  3PVU A;  2Z0O A;  1KZ7 A;  1Y19 B;  3SO6 A;  4WJ7 A;  1P6S A;  1TXD A;  5D27 A;  2HTH B;  2P0D A;  1DDM A;  2KGX B;  2UZR A;  4F7H A;  4EMO A;  4KHA A;  2I5C A;  3ML4 A;  3X23 A;  2G35 A;  2GJY A;  3TVV A;  1DDV A;  2JP2 A;  4HAY B;  2I1J A;  4K2O A;  4HDQ A;  4Y94 A;  4L6E A;  2OTX A;  3QBV B;  1LB1 A;  3M1I B;  1FGY A;  3IVF A;  1EVH A;  4ZRK A;  2W2X C;  4GMX B;  2DKP A;  5JHG A;  2PZ1 A;  1MAI A;  2COF A;  4ZRJ A;  3A98 B;  3OAN A;  1QC6 A;  3NSU A;  2UZS A;  2DX5 A;  3MDB C;  2MDX A;  3VIA A;  1XCG A;  1H4R A;  2COC A;  3KRW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...