3N7CA

Crystal structure of the ran binding domain from the nuclear pore complex component nup2 from ashbya gossypii
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
113
structure length
109
Chain Sequence
EEVLFCEKAKLLIFDSGYTSRGVGELKLLRKKDDKGKVRVLCRSGMGHVLLNTSVVKSFKYQPIDADNENLIKWPIITDGKLETFIIKVKQKADGRRLVGAVADAQQAM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords ABR034Wp
publication title Crystal structure of the RAN binding domain from the nuclear pore complex component NUP2 from Ashbya gossypii
rcsb
source organism Ashbya gossypii
molecule tags Protein transport
total genus 20
structure length 109
sequence length 113
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-05-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 3n7cA00
2YS5A 1Y5OA 1ZSQA 2N23A 2RUKB 5C79A 2UZSA 4KAXB 2L2IA 3AU5A 4PQ0A 5JP4A 3D8FA 2J59M 2YT0A 4TYZA 2DN6A 1J19A 4GPTB 3F0WA 3ODWA 2J0MA 3TCAA 1I7AA 1OY2A 1WGQA 3VIAA 3P6AA 2I5CA 1EF1A 4HAUB 2K2UA 2N0YA 3G9WA 1TXDA 1WVHA 1WI1A 2M38A 2Y8GA 2DFKA 1U29A 4GN1A 1EVHA 2YT1A 2JP2A 3ML4A 3FEHA 1X05A 2GCLA 1UNPA 5D3WA 4KHAA 3SUZA 5C5BA 1PFJA 1X86A 2D9YA 1P3RA 1DDWA 4ZRKA 1AWEA 4KHOA 3AU4A 2YS3A 5LONB 2IFSA 1V5PA 2P0DA 1XODA 1MKEA 4GMVA 2X18A 5GOWB 4EKUA 3X23A 1W1DA 3M1IB 2D2QA 2Z0OA 1H4RA 2L1CA 5DHAB 2D9VA 2GCJA 2KGXB 3SO6A 1ISNA 3KY9A 4HB0B 1K5DB 2DX1A 3D8EA 3ODOA 4GMXB 1DDVA 1U5DA 2BCJA 1UPQA 4KVGB 2OTXA 4HDQA 4DXAB 1AQCA 2YSZA 4CHJA 1PMSA 3SV1A 4F7HA 3DXDA 1X1FA 1EAZA 4YONA 1MK7B 3MPXA 3O96A 2KUPA 1GC7A 3ZDTA 1M7EA 1LW3A 2D9WA 4H8SA 2ROVA 3GYPA 2HTHB 1B55A 4WSFA 4MY6A 2AL6A 1X1GA 4A6FB 3ODXA 3SNHA 2COFA 4Z2MB 3HQCA 1KZ7A 5J3TA 3AJ4A 1DROA 4YL8A 2H7DA 2J0JA 4EMOA 3WYFB 1U5EA 3U7DA 2VKIA 3DXEA 4ZRJA 5HE3A 4HATB 4HHVA 1FGYA 1FOEA 1RJ2A 2ZPYA 4K2OA 4B6HA 2I1KA 2RGNB 3PSCA 2XQNM 1RRPB 2I5FA 1ZC3B 2G35A 1UNQA 4ZRIA 2MDXA 4EJNA 3F5RA 2LYDA 5JLJB 4IFSA 1SHCA 1TJ6A 1SGHA 1XX0A 1FHWA 2YS1A 4HAWB 3TFMA 1W1GA 2CY4A 2H7EA 2GS0A 4TKNA 3LJUX 2VSZA 2QKMA 2QKLA 1FAOA 3OANA 1MAIA 3CXBB 2Z0PA 1QC6A 1BWNA 2LULA 3TO1A 5J3YA 1M7RA 4GZUA 1ZC4B 5FI0A 2DTCA 3PVLA 4MK0A 4A6FA 2DYQA 2OQBA 2Q13A 3KRXA 2NZ8B 4HAVB 4NSWA 4HAYB 4XWXA 3T06A 5FI1A 5CLQB 1V89A 4K17A 1X11A 2NMBA 3U8ZA 2EMSA 1NTVA 4K81A 2EMTA 5JHHA 4GXBA 1H10A 3KRWA 1V88A 2Y8FA 1KI1B 2D4QA 3VOQA 2CRFA 2ELAA 2P8VA 1WGUA 5D3VA 3D8DA 3KZ1A 1N3HA 2DHIA 2J0KA 1UEFA 1K5GB 4CYEA 1BTKA 2ADZA 2CODA 2R0DA 3ZVRA 2MKRA 3PVUA 5C6RA 4WVFB 3A8PA 2KCJA 1IRSA 2RSGA 2D11A 1UPRA 5CLLB 5C16A 1MIZB 1NI2A 4F7GA 2CY5A 4P7IA 5DH9B 3A98B 1BAKA 2R09A 4HB3B 4PNKA 3ULBA 2MWNB 2VRWB 4DBBA 2D9XA 1DBHA 3QBVB 4WJ7A 4D0NB 1GC6A 2RLOA 3QIJA 3V5WA 2DHKA 2ROZB 5LOPB 4A5KA 5DI9B 2M14A 2Z0QA 2DA0A 1ZVRA 2AEHA 1Y19B 1W1HA 2LOXA 5D3XA 3TVVA 2K2JA 4IAPA 1TQZA 1NU2A 2DYNA 4Y94A 1U5FA 3N7CA 1QQGA 5DIFB 1XKEA 1PLSA 3RCPA 2IYBA 3IVFA 1WJMA 1UNRA 2EC1A 1XCGA 4NY0A 4Z2NA 3UZTA 4MT7A 1WG7A 3KSYA 1GG3A 5L81A 4F7UP 5JHGA 5DHFB 4DX8A 3CIKA 1EGXA 5EFXA 3FSSA 4DX90 2W2XD 4KHBB 5HE0A 3QWMA 1MIXA 1J0WA 3DXCA 2DKPA 3WA0A 1KZGA 2PZ1A 1V61A 2EJ8A 2K00A 4HB2B 2MFQA 1OMWA 1XD4A 1LB1A 1Q67A 2D9ZA 2DX5A 2HE7A 1FB8A 1I2HA 5KCVA 2P0HA 4A6HA 1BTNA 1FGZA 2E2XA 2GJYA 3BJIA 3HW2B 1E5WA 3P7ZA 1MK9B 2Y7BA 3PZDA 2DKQA 1P6SA 2W2WA 4HDOA 3PEGA 2DHJA 3MDBC 1ZM0A 3PP2A 1Z87A 1V5UA 2UVMA 3PVWA 1U2BA 2W2XC 2D10A 5D3YA 3GYOA 5KQ1A 3BINA 2YF0A 1XR0B 1MPHA 2ELBA 2V76A 1U27A 1NTYA 5J3QA 3SYXA 3A8QA 2LG1A 4K2PA 4HAXB 5D27A 2CAYA 2COCA 4CHMA 3ULCA 4IOYX 2LKOA 4A6KA 5KQ4A 5HE2A 3NSUA 4L6EA 1P5TA 2YRYA 1V5MA 2RVBB 4HB4B 5HE1A 1DYNA 4C0AA 4BBKA 1WJ1A 5C5BB 2RNRB 2YVCA 2FJLA 1OQNA 1DDMA 2P0FA 3FM8C 2COAA 1U5GA 2LOZA 2I1JA 4HAZB 3PG7A 3HK0A 2DLWA 1FHOA 1FHXA 3TW1A 2UZRA
chains in the Genus database with same CATH superfamily
2YS5A 1Y5OA 1ZSQA 2N23A 2RUKB 5C79A 2UZSA 4KAXB 2L2IA 3AU5A 4PQ0A 5JP4A 3D8FA 4OSNA 2J59M 2YT0A 4TYZA 2DN6A 1J19A 4GPTB 4DIXA 3F0WA 3ODWA 2J0MA 3TCAA 1I7AA 2K49A 1OY2A 4L1RA 1WGQA 3VIAA 3P6AA 2I5CA 1EF1A 4HAUB 2K2UA 2N0YA 3G9WA 1TXDA 1WVHA 1WI1A 2M38A 2Y8GA 2DFKA 1U29A 4GN1A 1EVHA 2YT1A 2JP2A 2KR0A 3FEHA 3ML4A 1X05A 2GCLA 3NWAA 1UNPA 5D3WA 4KHAA 3SUZA 3NWFA 5C5BA 1PFJA 1X86A 2D9YA 1P3RA 1DDWA 4ZRKA 1AWEA 4KHOA 3AU4A 5M4YB 2YS3A 5LONB 2IFSA 1V5PA 2P0DA 1XODA 1MKEA 4GMVA 2X18A 5GOWB 4EKUA 3X23A 1W1DA 3M1IB 5IRSA 2D2QA 2R2YA 2Z0OA 1H4RA 2L1CA 4OT1A 5DHAB 2D9VA 2GCJA 2KGXB 3SO6A 1ISNA 1ZYIA 3KY9A 4HB0B 1K5DB 2DX1A 3D8EA 3ODOA 4GMXB 1DDVA 1U5DA 2BCJA 1UPQA 4KVGB 5I2MA 2OTXA 4HDQA 4DXAB 1AQCA 2KIGA 2YSZA 4CHJA 1PMSA 3SV1A 4F7HA 2GUMA 3DXDA 1X1FA 1EAZA 4YONA 1MK7B 3MPXA 3O96A 2KUPA 1GC7A 3ZDTA 1M7EA 2KUQA 1LW3A 2D9WA 4H8SA 2ROVA 3GYPA 2HTHB 1B55A 4WSFA 4MY6A 3NW8A 4QJ3B 2AL6A 1X1GA 4A6FB 3ODXA 3SNHA 2COFA 4Z2MB 3HQCA 1KZ7A 5J3TA 3AJ4A 3FVCA 1DROA 4YL8A 2H7DA 2J0JA 4EMOA 3WYFB 1U5EA 3U7DA 2VKIA 4HSIA 4QJ5B 3DXEA 4ZRJA 5HE3A 4HATB 4HHVA 1FGYA 1FOEA 1RJ2A 3NWDA 2ZPYA 4K2OA 4B6HA 2I1KA 2RGNB 3PSCA 2XQNM 1RRPB 3A58A 2I5FA 1ZC3B 2G35A 1UNQA 4ZRIA 2MDXA 4EJNA 3F5RA 2LYDA 5JLJB 4IFSA 1SHCA 1TJ6A 1SGHA 1XX0A 1FHWA 2YS1A 4HAWB 3TFMA 1W1GA 2CY4A 2H7EA 2GS0A 4TKNA 3LJUX 2VSZA 2QKMA 2QKLA 1FAOA 3OANA 1MAIA 3CXBB 2Z0PA 1QC6A 1BWNA 2LULA 3TO1A 5J3YA 1M7RA 4GZUA 1ZC4B 5FI0A 2DTCA 3PVLA 4MK0A 4A6FA 2DYQA 2FJUB 2OQBA 2Q13A 3KRXA 2NZ8B 4HAVB 4NSWA 4HAYB 4XWXA 3T06A 5FI1A 5CLQB 1V89A 4K17A 1X11A 1MI1A 2NMBA 3U8ZA 3HIEA 2Z59A 2EMSA 1NTVA 4K81A 2EMTA 5JHHA 4GXBA 1H10A 3KRWA 1V88A 2Y8FA 1KI1B 2D4QA 3VOQA 2CRFA 2ELAA 2P8VA 1WGUA 5D3VA 3D8DA 3KZ1A 1N3HA 2DHIA 2J0KA 1UEFA 1K5GB 2Z4DA 4CYEA 1BTKA 2ADZA 2CODA 2R0DA 3ZVRA 2MKRA 3PVUA 5C6RA 4WVFB 3A8PA 2KCJA 1IRSA 2RSGA 2D11A 1UPRA 5CLLB 5C16A 5I2SA 1MIZB 1NI2A 4F7GA 2Z14A 2CY5A 4P7IA 5DH9B 3A98B 1BAKA 2R09A 4HB3B 4PNKA 3ULBA 2MWNB 2VRWB 4KHBA 4DBBA 2D9XA 1DBHA 3QBVB 4WJ7A 4D0NB 5LG4B 1GC6A 2Z13A 2RLOA 4QXAB 3QIJA 3V5WA 2DHKA 2ROZB 5LOPB 4A5KA 5DI9B 2M14A 2Z0QA 2DA0A 1ZVRA 2NBVA 2AEHA 1Y19B 2K8EA 1W1HA 1T77A 2LOXA 5D3XA 4GNKB 4GOUA 3TVVA 2K2JA 4IAPA 1TQZA 1NU2A 2DYNA 4Y94A 3HSAA 1U5FA 3N7CA 3B77A 1QQGA 5DIFB 1XKEA 1PLSA 3RCPA 2IYBA 3IVFA 1WJMA 1UNRA 2EC1A 4D6WA 1XCGA 3DCXA 4NY0A 4Z2NA 3UZTA 4MT7A 1WG7A 3KSYA 1GG3A 5L81A 4F7UP 5JHGA 5DHFB 4DX8A 3CIKA 1EGXA 5EFXA 3FSSA 4DX90 2W2XD 4KHBB 5HE0A 3QWMA 1MIXA 1J0WA 3DXCA 2DKPA 3WA0A 1KZGA 2PZ1A 2YT2A 1V61A 3U12A 2EJ8A 2K00A 2RRFA 4HB2B 2MFQA 1OMWA 1XD4A 1LB1A 1Q67A 2D9ZA 2DX5A 2HE7A 1FB8A 4CSQA 1I2HA 5KCVA 2P0HA 4A6HA 1BTNA 1FGZA 2E2XA 2GJYA 3BJIA 3HW2B 1E5WA 3P7ZA 1MK9B 2KIEA 2Y7BA 3PZDA 2DKQA 1P6SA 2W2WA 4HDOA 3PEGA 2DHJA 3MDBC 1ZM0A 3PP2A 1Z87A 1V5UA 2UVMA 3PVWA 1U2BA 2W2XC 2D10A 5D3YA 3GYOA 5KQ1A 3BINA 2YF0A 1XR0B 1MPHA 2ELBA 2V76A 1U27A 1NTYA 5J3QA 3SYXA 3A8QA 2LG1A 4K2PA 4HAXB 5D27A 2CAYA 2COCA 4CHMA 3OHMB 3ULCA 4QJ4B 4IOYX 2LKOA 4A6KA 5KQ4A 5HE2A 3NSUA 4L6EA 1P5TA 2YRYA 1V5MA 2RVBB 4HB4B 5HE1A 2ZKMX 1DYNA 4C0AA 4BBKA 1WJ1A 5C5BB 2RNRB 2YVCA 2FJLA 1OQNA 1DDMA 2P0FA 3FM8C 2COAA 1U5GA 2LOZA 2I1JA 4HAZB 3PG7A 3HK0A 2DLWA 1FHOA 1FHXA 3TW1A 2UZRA
chains in the Genus database with same CATH topology
2YS5A 1Y5OA 1ZSQA 2N23A 2RUKB 5C79A 2UZSA 4KAXB 2L2IA 3AU5A 4PQ0A 5JP4A 3D8FA 2J59M 2YT0A 4TYZA 2DN6A 1J19A 4GPTB 3F0WA 3ODWA 2J0MA 3TCAA 1I7AA 1OY2A 1WGQA 3VIAA 3P6AA 2I5CA 1EF1A 4HAUB 2K2UA 2N0YA 3G9WA 1TXDA 1WVHA 1WI1A 2M38A 2Y8GA 2DFKA 1U29A 4GN1A 1EVHA 2YT1A 2JP2A 3ML4A 3FEHA 1X05A 2GCLA 1UNPA 5D3WA 4KHAA 3SUZA 5C5BA 1PFJA 1X86A 2D9YA 1P3RA 1DDWA 4ZRKA 1AWEA 4KHOA 3AU4A 2YS3A 5LONB 2IFSA 1V5PA 2P0DA 1XODA 1MKEA 4GMVA 2X18A 5GOWB 4EKUA 3X23A 1W1DA 3M1IB 2D2QA 2Z0OA 1H4RA 2L1CA 5DHAB 2D9VA 2GCJA 2KGXB 3SO6A 1ISNA 3KY9A 4HB0B 1K5DB 2DX1A 3D8EA 3ODOA 4GMXB 1DDVA 1U5DA 2BCJA 1UPQA 4KVGB 2OTXA 4HDQA 4DXAB 1AQCA 2YSZA 4CHJA 1PMSA 3SV1A 4F7HA 3DXDA 1X1FA 1EAZA 4YONA 1MK7B 3MPXA 3O96A 2KUPA 1GC7A 3ZDTA 1M7EA 1LW3A 2D9WA 4H8SA 2ROVA 3GYPA 2HTHB 1B55A 4WSFA 4MY6A 2AL6A 1X1GA 4A6FB 3ODXA 3SNHA 2COFA 4Z2MB 3HQCA 1KZ7A 5J3TA 3AJ4A 1DROA 4YL8A 2H7DA 2J0JA 4EMOA 3WYFB 1U5EA 3U7DA 2VKIA 3DXEA 4ZRJA 5HE3A 4HATB 4HHVA 1FGYA 1FOEA 1RJ2A 2ZPYA 4K2OA 4B6HA 2I1KA 2RGNB 3PSCA 2XQNM 1RRPB 2I5FA 1ZC3B 2G35A 1UNQA 4ZRIA 2MDXA 4EJNA 3F5RA 2LYDA 5JLJB 4IFSA 1SHCA 1TJ6A 1SGHA 1XX0A 1FHWA 2YS1A 4HAWB 3TFMA 1W1GA 2CY4A 2H7EA 2GS0A 4TKNA 3LJUX 2VSZA 2QKMA 2QKLA 1FAOA 3OANA 1MAIA 3CXBB 2Z0PA 1QC6A 1BWNA 2LULA 3TO1A 5J3YA 1M7RA 4GZUA 1ZC4B 5FI0A 2DTCA 3PVLA 4MK0A 4A6FA 2DYQA 2OQBA 2Q13A 3KRXA 2NZ8B 4HAVB 4NSWA 4HAYB 4XWXA 3T06A 5FI1A 5CLQB 1V89A 4K17A 1X11A 2NMBA 3U8ZA 2EMSA 1NTVA 4K81A 2EMTA 5JHHA 4GXBA 1H10A 3KRWA 1V88A 2Y8FA 1KI1B 2D4QA 3VOQA 2CRFA 2ELAA 2P8VA 1WGUA 5D3VA 3D8DA 3KZ1A 1N3HA 2DHIA 2J0KA 1UEFA 1K5GB 4CYEA 1BTKA 2ADZA 2CODA 2R0DA 3ZVRA 2MKRA 3PVUA 5C6RA 4WVFB 3A8PA 2KCJA 1IRSA 2RSGA 2D11A 1UPRA 5CLLB 5C16A 1MIZB 1NI2A 4F7GA 2CY5A 4P7IA 5DH9B 3A98B 1BAKA 2R09A 4HB3B 4PNKA 3ULBA 2MWNB 2VRWB 4DBBA 2D9XA 1DBHA 3QBVB 4WJ7A 4D0NB 1GC6A 2RLOA 3QIJA 3V5WA 2DHKA 2ROZB 5LOPB 4A5KA 5DI9B 2M14A 2Z0QA 2DA0A 1ZVRA 2AEHA 1Y19B 1W1HA 2LOXA 5D3XA 3TVVA 2K2JA 4IAPA 1TQZA 1NU2A 2DYNA 4Y94A 1U5FA 3N7CA 1QQGA 5DIFB 1XKEA 1PLSA 3RCPA 2IYBA 3IVFA 1WJMA 1UNRA 2EC1A 1XCGA 4NY0A 4Z2NA 3UZTA 4MT7A 1WG7A 3KSYA 1GG3A 5L81A 4F7UP 5JHGA 5DHFB 4DX8A 3CIKA 1EGXA 5EFXA 3FSSA 4DX90 2W2XD 4KHBB 5HE0A 3QWMA 1MIXA 1J0WA 3DXCA 2DKPA 3WA0A 1KZGA 2PZ1A 1V61A 2EJ8A 2K00A 4HB2B 2MFQA 1OMWA 1XD4A 1LB1A 1Q67A 2D9ZA 2DX5A 2HE7A 1FB8A 1I2HA 5KCVA 2P0HA 4A6HA 1BTNA 1FGZA 2E2XA 2GJYA 3BJIA 3HW2B 1E5WA 3P7ZA 1MK9B 2Y7BA 3PZDA 2DKQA 1P6SA 2W2WA 4HDOA 3PEGA 2DHJA 3MDBC 1ZM0A 3PP2A 1Z87A 1V5UA 2UVMA 3PVWA 1U2BA 2W2XC 2D10A 5D3YA 3GYOA 5KQ1A 3BINA 2YF0A 1XR0B 1MPHA 2ELBA 2V76A 1U27A 1NTYA 5J3QA 3SYXA 3A8QA 2LG1A 4K2PA 4HAXB 5D27A 2CAYA 2COCA 4CHMA 3ULCA 4IOYX 2LKOA 4A6KA 5KQ4A 5HE2A 3NSUA 4L6EA 1P5TA 2YRYA 1V5MA 2RVBB 4HB4B 5HE1A 1DYNA 4C0AA 4BBKA 1WJ1A 5C5BB 2RNRB 2YVCA 2FJLA 1OQNA 1DDMA 2P0FA 3FM8C 2COAA 1U5GA 2LOZA 2I1JA 4HAZB 3PG7A 3HK0A 2DLWA 1FHOA 1FHXA 3TW1A 2UZRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YS5 A;  1Y5O A;  1ZSQ A;  2N23 A;  2RUK B;  5C79 A;  2UZS A;  4KAX B;  2L2I A;  3AU5 A;  4PQ0 A;  5JP4 A;  3D8F A;  2J59 M;  2YT0 A;  4TYZ A;  2DN6 A;  1J19 A;  4GPT B;  3F0W A;  3ODW A;  2J0M A;  3TCA A;  1I7A A;  1OY2 A;  1WGQ A;  3VIA A;  3P6A A;  2I5C A;  1EF1 A;  4HAU B;  2K2U A;  2N0Y A;  3G9W A;  1TXD A;  1WVH A;  1WI1 A;  2M38 A;  2Y8G A;  2DFK A;  1U29 A;  4GN1 A;  1EVH A;  2YT1 A;  2JP2 A;  3ML4 A;  3FEH A;  1X05 A;  2GCL A;  1UNP A;  5D3W A;  4KHA A;  3SUZ A;  5C5B A;  1PFJ A;  1X86 A;  2D9Y A;  1P3R A;  1DDW A;  4ZRK A;  1AWE A;  4KHO A;  3AU4 A;  2YS3 A;  5LON B;  2IFS A;  1V5P A;  2P0D A;  1XOD A;  1MKE A;  4GMV A;  2X18 A;  5GOW B;  4EKU A;  3X23 A;  1W1D A;  3M1I B;  2D2Q A;  2Z0O A;  1H4R A;  2L1C A;  5DHA B;  2D9V A;  2GCJ A;  2KGX B;  3SO6 A;  1ISN A;  3KY9 A;  4HB0 B;  1K5D B;  2DX1 A;  3D8E A;  3ODO A;  4GMX B;  1DDV A;  1U5D A;  2BCJ A;  1UPQ A;  4KVG B;  2OTX A;  4HDQ A;  4DXA B;  1AQC A;  2YSZ A;  4CHJ A;  1PMS A;  3SV1 A;  4F7H A;  3DXD A;  1X1F A;  1EAZ A;  4YON A;  1MK7 B;  3MPX A;  3O96 A;  2KUP A;  1GC7 A;  3ZDT A;  1M7E A;  1LW3 A;  2D9W A;  4H8S A;  2ROV A;  3GYP A;  2HTH B;  1B55 A;  4WSF A;  4MY6 A;  2AL6 A;  1X1G A;  4A6F B;  3ODX A;  3SNH A;  2COF A;  4Z2M B;  3HQC A;  1KZ7 A;  5J3T A;  3AJ4 A;  1DRO A;  4YL8 A;  2H7D A;  2J0J A;  4EMO A;  3WYF B;  1U5E A;  3U7D A;  2VKI A;  3DXE A;  4ZRJ A;  5HE3 A;  4HAT B;  4HHV A;  1FGY A;  1FOE A;  1RJ2 A;  2ZPY A;  4K2O A;  4B6H A;  2I1K A;  2RGN B;  3PSC A;  2XQN M;  1RRP B;  2I5F A;  1ZC3 B;  2G35 A;  1UNQ A;  4ZRI A;  2MDX A;  4EJN A;  3F5R A;  2LYD A;  5JLJ B;  4IFS A;  1SHC A;  1TJ6 A;  1SGH A;  1XX0 A;  1FHW A;  2YS1 A;  4HAW B;  3TFM A;  1W1G A;  2CY4 A;  2H7E A;  2GS0 A;  4TKN A;  3LJU X;  2VSZ A;  2QKM A;  2QKL A;  1FAO A;  3OAN A;  1MAI A;  3CXB B;  2Z0P A;  1QC6 A;  1BWN A;  2LUL A;  3TO1 A;  5J3Y A;  1M7R A;  4GZU A;  1ZC4 B;  5FI0 A;  2DTC A;  3PVL A;  4MK0 A;  4A6F A;  2DYQ A;  2OQB A;  2Q13 A;  3KRX A;  2NZ8 B;  4HAV B;  4NSW A;  4HAY B;  4XWX A;  3T06 A;  5FI1 A;  5CLQ B;  1V89 A;  4K17 A;  1X11 A;  2NMB A;  3U8Z A;  2EMS A;  1NTV A;  4K81 A;  2EMT A;  5JHH A;  4GXB A;  1H10 A;  3KRW A;  1V88 A;  2Y8F A;  1KI1 B;  2D4Q A;  3VOQ A;  2CRF A;  2ELA A;  2P8V A;  1WGU A;  5D3V A;  3D8D A;  3KZ1 A;  1N3H A;  2DHI A;  2J0K A;  1UEF A;  1K5G B;  4CYE A;  1BTK A;  2ADZ A;  2COD A;  2R0D A;  3ZVR A;  2MKR A;  3PVU A;  5C6R A;  4WVF B;  3A8P A;  2KCJ A;  1IRS A;  2RSG A;  2D11 A;  1UPR A;  5CLL B;  5C16 A;  1MIZ B;  1NI2 A;  4F7G A;  2CY5 A;  4P7I A;  5DH9 B;  3A98 B;  1BAK A;  2R09 A;  4HB3 B;  4PNK A;  3ULB A;  2MWN B;  2VRW B;  4DBB A;  2D9X A;  1DBH A;  3QBV B;  4WJ7 A;  4D0N B;  1GC6 A;  2RLO A;  3QIJ A;  3V5W A;  2DHK A;  2ROZ B;  5LOP B;  4A5K A;  5DI9 B;  2M14 A;  2Z0Q A;  2DA0 A;  1ZVR A;  2AEH A;  1Y19 B;  1W1H A;  2LOX A;  5D3X A;  3TVV A;  2K2J A;  4IAP A;  1TQZ A;  1NU2 A;  2DYN A;  4Y94 A;  1U5F A;  3N7C A;  1QQG A;  5DIF B;  1XKE A;  1PLS A;  3RCP A;  2IYB A;  3IVF A;  1WJM A;  1UNR A;  2EC1 A;  1XCG A;  4NY0 A;  4Z2N A;  3UZT A;  4MT7 A;  1WG7 A;  3KSY A;  1GG3 A;  5L81 A;  4F7U P;  5JHG A;  5DHF B;  4DX8 A;  3CIK A;  1EGX A;  5EFX A;  3FSS A;  4DX9 0;  2W2X D;  4KHB B;  5HE0 A;  3QWM A;  1MIX A;  1J0W A;  3DXC A;  2DKP A;  3WA0 A;  1KZG A;  2PZ1 A;  1V61 A;  2EJ8 A;  2K00 A;  4HB2 B;  2MFQ A;  1OMW A;  1XD4 A;  1LB1 A;  1Q67 A;  2D9Z A;  2DX5 A;  2HE7 A;  1FB8 A;  1I2H A;  5KCV A;  2P0H A;  4A6H A;  1BTN A;  1FGZ A;  2E2X A;  2GJY A;  3BJI A;  3HW2 B;  1E5W A;  3P7Z A;  1MK9 B;  2Y7B A;  3PZD A;  2DKQ A;  1P6S A;  2W2W A;  4HDO A;  3PEG A;  2DHJ A;  3MDB C;  1ZM0 A;  3PP2 A;  1Z87 A;  1V5U A;  2UVM A;  3PVW A;  1U2B A;  2W2X C;  2D10 A;  5D3Y A;  3GYO A;  5KQ1 A;  3BIN A;  2YF0 A;  1XR0 B;  1MPH A;  2ELB A;  2V76 A;  1U27 A;  1NTY A;  5J3Q A;  3SYX A;  3A8Q A;  2LG1 A;  4K2P A;  4HAX B;  5D27 A;  2CAY A;  2COC A;  4CHM A;  3ULC A;  4IOY X;  2LKO A;  4A6K A;  5KQ4 A;  5HE2 A;  3NSU A;  4L6E A;  1P5T A;  2YRY A;  1V5M A;  2RVB B;  4HB4 B;  5HE1 A;  1DYN A;  4C0A A;  4BBK A;  1WJ1 A;  5C5B B;  2RNR B;  2YVC A;  2FJL A;  1OQN A;  1DDM A;  2P0F A;  3FM8 C;  2COA A;  1U5G A;  2LOZ A;  2I1J A;  4HAZ B;  3PG7 A;  3HK0 A;  2DLW A;  1FHO A;  1FHX A;  3TW1 A;  2UZR A; 
#chains in the Genus database with same CATH topology
 2YS5 A;  1Y5O A;  1ZSQ A;  2N23 A;  2RUK B;  5C79 A;  2UZS A;  4KAX B;  2L2I A;  3AU5 A;  4PQ0 A;  5JP4 A;  3D8F A;  4OSN A;  2J59 M;  2YT0 A;  4TYZ A;  2DN6 A;  1J19 A;  4GPT B;  4DIX A;  3F0W A;  3ODW A;  2J0M A;  3TCA A;  1I7A A;  2K49 A;  1OY2 A;  4L1R A;  1WGQ A;  3VIA A;  3P6A A;  2I5C A;  1EF1 A;  4HAU B;  2K2U A;  2N0Y A;  3G9W A;  1TXD A;  1WVH A;  1WI1 A;  2M38 A;  2Y8G A;  2DFK A;  1U29 A;  4GN1 A;  1EVH A;  2YT1 A;  2JP2 A;  2KR0 A;  3FEH A;  3ML4 A;  1X05 A;  2GCL A;  3NWA A;  1UNP A;  5D3W A;  4KHA A;  3SUZ A;  3NWF A;  5C5B A;  1PFJ A;  1X86 A;  2D9Y A;  1P3R A;  1DDW A;  4ZRK A;  1AWE A;  4KHO A;  3AU4 A;  5M4Y B;  2YS3 A;  5LON B;  2IFS A;  1V5P A;  2P0D A;  1XOD A;  1MKE A;  4GMV A;  2X18 A;  5GOW B;  4EKU A;  3X23 A;  1W1D A;  3M1I B;  5IRS A;  2D2Q A;  2R2Y A;  2Z0O A;  1H4R A;  2L1C A;  4OT1 A;  5DHA B;  2D9V A;  2GCJ A;  2KGX B;  3SO6 A;  1ISN A;  1ZYI A;  3KY9 A;  4HB0 B;  1K5D B;  2DX1 A;  3D8E A;  3ODO A;  4GMX B;  1DDV A;  1U5D A;  2BCJ A;  1UPQ A;  4KVG B;  5I2M A;  2OTX A;  4HDQ A;  4DXA B;  1AQC A;  2KIG A;  2YSZ A;  4CHJ A;  1PMS A;  3SV1 A;  4F7H A;  2GUM A;  3DXD A;  1X1F A;  1EAZ A;  4YON A;  1MK7 B;  3MPX A;  3O96 A;  2KUP A;  1GC7 A;  3ZDT A;  1M7E A;  2KUQ A;  1LW3 A;  2D9W A;  4H8S A;  2ROV A;  3GYP A;  2HTH B;  1B55 A;  4WSF A;  4MY6 A;  3NW8 A;  4QJ3 B;  2AL6 A;  1X1G A;  4A6F B;  3ODX A;  3SNH A;  2COF A;  4Z2M B;  3HQC A;  1KZ7 A;  5J3T A;  3AJ4 A;  3FVC A;  1DRO A;  4YL8 A;  2H7D A;  2J0J A;  4EMO A;  3WYF B;  1U5E A;  3U7D A;  2VKI A;  4HSI A;  4QJ5 B;  3DXE A;  4ZRJ A;  5HE3 A;  4HAT B;  4HHV A;  1FGY A;  1FOE A;  1RJ2 A;  3NWD A;  2ZPY A;  4K2O A;  4B6H A;  2I1K A;  2RGN B;  3PSC A;  2XQN M;  1RRP B;  3A58 A;  2I5F A;  1ZC3 B;  2G35 A;  1UNQ A;  4ZRI A;  2MDX A;  4EJN A;  3F5R A;  2LYD A;  5JLJ B;  4IFS A;  1SHC A;  1TJ6 A;  1SGH A;  1XX0 A;  1FHW A;  2YS1 A;  4HAW B;  3TFM A;  1W1G A;  2CY4 A;  2H7E A;  2GS0 A;  4TKN A;  3LJU X;  2VSZ A;  2QKM A;  2QKL A;  1FAO A;  3OAN A;  1MAI A;  3CXB B;  2Z0P A;  1QC6 A;  1BWN A;  2LUL A;  3TO1 A;  5J3Y A;  1M7R A;  4GZU A;  1ZC4 B;  5FI0 A;  2DTC A;  3PVL A;  4MK0 A;  4A6F A;  2DYQ A;  2FJU B;  2OQB A;  2Q13 A;  3KRX A;  2NZ8 B;  4HAV B;  4NSW A;  4HAY B;  4XWX A;  3T06 A;  5FI1 A;  5CLQ B;  1V89 A;  4K17 A;  1X11 A;  1MI1 A;  2NMB A;  3U8Z A;  3HIE A;  2Z59 A;  2EMS A;  1NTV A;  4K81 A;  2EMT A;  5JHH A;  4GXB A;  1H10 A;  3KRW A;  1V88 A;  2Y8F A;  1KI1 B;  2D4Q A;  3VOQ A;  2CRF A;  2ELA A;  2P8V A;  1WGU A;  5D3V A;  3D8D A;  3KZ1 A;  1N3H A;  2DHI A;  2J0K A;  1UEF A;  1K5G B;  2Z4D A;  4CYE A;  1BTK A;  2ADZ A;  2COD A;  2R0D A;  3ZVR A;  2MKR A;  3PVU A;  5C6R A;  4WVF B;  3A8P A;  2KCJ A;  1IRS A;  2RSG A;  2D11 A;  1UPR A;  5CLL B;  5C16 A;  5I2S A;  1MIZ B;  1NI2 A;  4F7G A;  2Z14 A;  2CY5 A;  4P7I A;  5DH9 B;  3A98 B;  1BAK A;  2R09 A;  4HB3 B;  4PNK A;  3ULB A;  2MWN B;  2VRW B;  4KHB A;  4DBB A;  2D9X A;  1DBH A;  3QBV B;  4WJ7 A;  4D0N B;  5LG4 B;  1GC6 A;  2Z13 A;  2RLO A;  4QXA B;  3QIJ A;  3V5W A;  2DHK A;  2ROZ B;  5LOP B;  4A5K A;  5DI9 B;  2M14 A;  2Z0Q A;  2DA0 A;  1ZVR A;  2NBV A;  2AEH A;  1Y19 B;  2K8E A;  1W1H A;  1T77 A;  2LOX A;  5D3X A;  4GNK B;  4GOU A;  3TVV A;  2K2J A;  4IAP A;  1TQZ A;  1NU2 A;  2DYN A;  4Y94 A;  3HSA A;  1U5F A;  3N7C A;  3B77 A;  1QQG A;  5DIF B;  1XKE A;  1PLS A;  3RCP A;  2IYB A;  3IVF A;  1WJM A;  1UNR A;  2EC1 A;  4D6W A;  1XCG A;  3DCX A;  4NY0 A;  4Z2N A;  3UZT A;  4MT7 A;  1WG7 A;  3KSY A;  1GG3 A;  5L81 A;  4F7U P;  5JHG A;  5DHF B;  4DX8 A;  3CIK A;  1EGX A;  5EFX A;  3FSS A;  4DX9 0;  2W2X D;  4KHB B;  5HE0 A;  3QWM A;  1MIX A;  1J0W A;  3DXC A;  2DKP A;  3WA0 A;  1KZG A;  2PZ1 A;  2YT2 A;  1V61 A;  3U12 A;  2EJ8 A;  2K00 A;  2RRF A;  4HB2 B;  2MFQ A;  1OMW A;  1XD4 A;  1LB1 A;  1Q67 A;  2D9Z A;  2DX5 A;  2HE7 A;  1FB8 A;  4CSQ A;  1I2H A;  5KCV A;  2P0H A;  4A6H A;  1BTN A;  1FGZ A;  2E2X A;  2GJY A;  3BJI A;  3HW2 B;  1E5W A;  3P7Z A;  1MK9 B;  2KIE A;  2Y7B A;  3PZD A;  2DKQ A;  1P6S A;  2W2W A;  4HDO A;  3PEG A;  2DHJ A;  3MDB C;  1ZM0 A;  3PP2 A;  1Z87 A;  1V5U A;  2UVM A;  3PVW A;  1U2B A;  2W2X C;  2D10 A;  5D3Y A;  3GYO A;  5KQ1 A;  3BIN A;  2YF0 A;  1XR0 B;  1MPH A;  2ELB A;  2V76 A;  1U27 A;  1NTY A;  5J3Q A;  3SYX A;  3A8Q A;  2LG1 A;  4K2P A;  4HAX B;  5D27 A;  2CAY A;  2COC A;  4CHM A;  3OHM B;  3ULC A;  4QJ4 B;  4IOY X;  2LKO A;  4A6K A;  5KQ4 A;  5HE2 A;  3NSU A;  4L6E A;  1P5T A;  2YRY A;  1V5M A;  2RVB B;  4HB4 B;  5HE1 A;  2ZKM X;  1DYN A;  4C0A A;  4BBK A;  1WJ1 A;  5C5B B;  2RNR B;  2YVC A;  2FJL A;  1OQN A;  1DDM A;  2P0F A;  3FM8 C;  2COA A;  1U5G A;  2LOZ A;  2I1J A;  4HAZ B;  3PG7 A;  3HK0 A;  2DLW A;  1FHO A;  1FHX A;  3TW1 A;  2UZR A; 
#chains in the Genus database with same CATH homology
 2YS5 A;  1Y5O A;  1ZSQ A;  2N23 A;  2RUK B;  5C79 A;  2UZS A;  4KAX B;  2L2I A;  3AU5 A;  4PQ0 A;  5JP4 A;  3D8F A;  2J59 M;  2YT0 A;  4TYZ A;  2DN6 A;  1J19 A;  4GPT B;  3F0W A;  3ODW A;  2J0M A;  3TCA A;  1I7A A;  1OY2 A;  1WGQ A;  3VIA A;  3P6A A;  2I5C A;  1EF1 A;  4HAU B;  2K2U A;  2N0Y A;  3G9W A;  1TXD A;  1WVH A;  1WI1 A;  2M38 A;  2Y8G A;  2DFK A;  1U29 A;  4GN1 A;  1EVH A;  2YT1 A;  2JP2 A;  3ML4 A;  3FEH A;  1X05 A;  2GCL A;  1UNP A;  5D3W A;  4KHA A;  3SUZ A;  5C5B A;  1PFJ A;  1X86 A;  2D9Y A;  1P3R A;  1DDW A;  4ZRK A;  1AWE A;  4KHO A;  3AU4 A;  2YS3 A;  5LON B;  2IFS A;  1V5P A;  2P0D A;  1XOD A;  1MKE A;  4GMV A;  2X18 A;  5GOW B;  4EKU A;  3X23 A;  1W1D A;  3M1I B;  2D2Q A;  2Z0O A;  1H4R A;  2L1C A;  5DHA B;  2D9V A;  2GCJ A;  2KGX B;  3SO6 A;  1ISN A;  3KY9 A;  4HB0 B;  1K5D B;  2DX1 A;  3D8E A;  3ODO A;  4GMX B;  1DDV A;  1U5D A;  2BCJ A;  1UPQ A;  4KVG B;  2OTX A;  4HDQ A;  4DXA B;  1AQC A;  2YSZ A;  4CHJ A;  1PMS A;  3SV1 A;  4F7H A;  3DXD A;  1X1F A;  1EAZ A;  4YON A;  1MK7 B;  3MPX A;  3O96 A;  2KUP A;  1GC7 A;  3ZDT A;  1M7E A;  1LW3 A;  2D9W A;  4H8S A;  2ROV A;  3GYP A;  2HTH B;  1B55 A;  4WSF A;  4MY6 A;  2AL6 A;  1X1G A;  4A6F B;  3ODX A;  3SNH A;  2COF A;  4Z2M B;  3HQC A;  1KZ7 A;  5J3T A;  3AJ4 A;  1DRO A;  4YL8 A;  2H7D A;  2J0J A;  4EMO A;  3WYF B;  1U5E A;  3U7D A;  2VKI A;  3DXE A;  4ZRJ A;  5HE3 A;  4HAT B;  4HHV A;  1FGY A;  1FOE A;  1RJ2 A;  2ZPY A;  4K2O A;  4B6H A;  2I1K A;  2RGN B;  3PSC A;  2XQN M;  1RRP B;  2I5F A;  1ZC3 B;  2G35 A;  1UNQ A;  4ZRI A;  2MDX A;  4EJN A;  3F5R A;  2LYD A;  5JLJ B;  4IFS A;  1SHC A;  1TJ6 A;  1SGH A;  1XX0 A;  1FHW A;  2YS1 A;  4HAW B;  3TFM A;  1W1G A;  2CY4 A;  2H7E A;  2GS0 A;  4TKN A;  3LJU X;  2VSZ A;  2QKM A;  2QKL A;  1FAO A;  3OAN A;  1MAI A;  3CXB B;  2Z0P A;  1QC6 A;  1BWN A;  2LUL A;  3TO1 A;  5J3Y A;  1M7R A;  4GZU A;  1ZC4 B;  5FI0 A;  2DTC A;  3PVL A;  4MK0 A;  4A6F A;  2DYQ A;  2OQB A;  2Q13 A;  3KRX A;  2NZ8 B;  4HAV B;  4NSW A;  4HAY B;  4XWX A;  3T06 A;  5FI1 A;  5CLQ B;  1V89 A;  4K17 A;  1X11 A;  2NMB A;  3U8Z A;  2EMS A;  1NTV A;  4K81 A;  2EMT A;  5JHH A;  4GXB A;  1H10 A;  3KRW A;  1V88 A;  2Y8F A;  1KI1 B;  2D4Q A;  3VOQ A;  2CRF A;  2ELA A;  2P8V A;  1WGU A;  5D3V A;  3D8D A;  3KZ1 A;  1N3H A;  2DHI A;  2J0K A;  1UEF A;  1K5G B;  4CYE A;  1BTK A;  2ADZ A;  2COD A;  2R0D A;  3ZVR A;  2MKR A;  3PVU A;  5C6R A;  4WVF B;  3A8P A;  2KCJ A;  1IRS A;  2RSG A;  2D11 A;  1UPR A;  5CLL B;  5C16 A;  1MIZ B;  1NI2 A;  4F7G A;  2CY5 A;  4P7I A;  5DH9 B;  3A98 B;  1BAK A;  2R09 A;  4HB3 B;  4PNK A;  3ULB A;  2MWN B;  2VRW B;  4DBB A;  2D9X A;  1DBH A;  3QBV B;  4WJ7 A;  4D0N B;  1GC6 A;  2RLO A;  3QIJ A;  3V5W A;  2DHK A;  2ROZ B;  5LOP B;  4A5K A;  5DI9 B;  2M14 A;  2Z0Q A;  2DA0 A;  1ZVR A;  2AEH A;  1Y19 B;  1W1H A;  2LOX A;  5D3X A;  3TVV A;  2K2J A;  4IAP A;  1TQZ A;  1NU2 A;  2DYN A;  4Y94 A;  1U5F A;  3N7C A;  1QQG A;  5DIF B;  1XKE A;  1PLS A;  3RCP A;  2IYB A;  3IVF A;  1WJM A;  1UNR A;  2EC1 A;  1XCG A;  4NY0 A;  4Z2N A;  3UZT A;  4MT7 A;  1WG7 A;  3KSY A;  1GG3 A;  5L81 A;  4F7U P;  5JHG A;  5DHF B;  4DX8 A;  3CIK A;  1EGX A;  5EFX A;  3FSS A;  4DX9 0;  2W2X D;  4KHB B;  5HE0 A;  3QWM A;  1MIX A;  1J0W A;  3DXC A;  2DKP A;  3WA0 A;  1KZG A;  2PZ1 A;  1V61 A;  2EJ8 A;  2K00 A;  4HB2 B;  2MFQ A;  1OMW A;  1XD4 A;  1LB1 A;  1Q67 A;  2D9Z A;  2DX5 A;  2HE7 A;  1FB8 A;  1I2H A;  5KCV A;  2P0H A;  4A6H A;  1BTN A;  1FGZ A;  2E2X A;  2GJY A;  3BJI A;  3HW2 B;  1E5W A;  3P7Z A;  1MK9 B;  2Y7B A;  3PZD A;  2DKQ A;  1P6S A;  2W2W A;  4HDO A;  3PEG A;  2DHJ A;  3MDB C;  1ZM0 A;  3PP2 A;  1Z87 A;  1V5U A;  2UVM A;  3PVW A;  1U2B A;  2W2X C;  2D10 A;  5D3Y A;  3GYO A;  5KQ1 A;  3BIN A;  2YF0 A;  1XR0 B;  1MPH A;  2ELB A;  2V76 A;  1U27 A;  1NTY A;  5J3Q A;  3SYX A;  3A8Q A;  2LG1 A;  4K2P A;  4HAX B;  5D27 A;  2CAY A;  2COC A;  4CHM A;  3ULC A;  4IOY X;  2LKO A;  4A6K A;  5KQ4 A;  5HE2 A;  3NSU A;  4L6E A;  1P5T A;  2YRY A;  1V5M A;  2RVB B;  4HB4 B;  5HE1 A;  1DYN A;  4C0A A;  4BBK A;  1WJ1 A;  5C5B B;  2RNR B;  2YVC A;  2FJL A;  1OQN A;  1DDM A;  2P0F A;  3FM8 C;  2COA A;  1U5G A;  2LOZ A;  2I1J A;  4HAZ B;  3PG7 A;  3HK0 A;  2DLW A;  1FHO A;  1FHX A;  3TW1 A;  2UZR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...