3N7CA

Crystal structure of the ran binding domain from the nuclear pore complex component nup2 from ashbya gossypii
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
113
structure length
109
Chain Sequence
EEVLFCEKAKLLIFDSGYTSRGVGELKLLRKKDDKGKVRVLCRSGMGHVLLNTSVVKSFKYQPIDADNENLIKWPIITDGKLETFIIKVKQKADGRRLVGAVADAQQAM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of the RAN binding domain from the nuclear pore complex component NUP2 from Ashbya gossypii
rcsb
source organism Ashbya gossypii
molecule tags Protein transport
molecule keywords ABR034Wp
total genus 20
structure length 109
sequence length 113
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-05-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 3n7cA00
2LULA 1XKEA 1WVHA 3KZ1A 4IOYX 2IYBA 1ZM0A 2VSZA 2Y7BA 2Y8FA 1W1DA 5GOWB 3KRWA 1IRSA 2I5FA 3DXDA 4A6FB 1BTNA 1UNRA 2IFSA 1MIZB 3ZDTA 2YVCA 5HE2A 2K00A 1MPHA 1V5MA 1KZGA 2CAYA 1ZVRA 3D8FA 2H7EA 3DXEA 3TFMA 3FM8C 4L6EA 4HAZB 2GS0A 1FHOA 2YF0A 2XQNM 1U27A 4P7IA 1I7AA 1X05A 5D3YA 1XD4A 4C0AA 4EMOA 4NY0A 2DYQA 1Q67A 4B6HA 4A6HA 1V5UA 2RNRB 4IFSA 4KVGB 1OMWA 2OTXA 2RSGA 5HE0A 2CY5A 4ZRKA 3VIAA 1XODA 2ELAA 1NTVA 1V61A 3BINA 1P6SA 3ULCA 4F7UP 3TW1A 2W2WA 3TCAA 2LKOA 4DBBA 3GYOA 4F7GA 1X11A 3SO6A 1UNPA 2BCJA 4CHMA 2RVBB 1FHWA 1P5TA 3X23A 4YONA 1EVHA 1XX0A 4EJNA 4HB2B 2DA0A 1P3RA 2I1KA 5C5BA 4HDQA 1UEFA 1U5DA 2KCJA 4Z2NA 1MK9B 1NI2A 4MY6A 2R0DA 5J3QA 5EFXA 2P0FA 3ULBA 3NSUA 2LOXA 2DKPA 3PSCA 5J3TA 2D9WA 1FGZA 2MKRA 3U8ZA 1NU2A 1X1GA 5DH9B 3A8QA 1DDVA 2EMTA 3QWMA 5J3YA 2Z0PA 4A5KA 3HK0A 1M7EA 5L81A 5CLQB 2CRFA 4H8SA 2COAA 3M1IB 2DLWA 2UZRA 3AU4A 5KCVA 2GCJA 2D11A 3FEHA 2VRWB 2MWNB 3QIJA 1MAIA 3PVUA 4KHOA 2COFA 1X1FA 2AEHA 2CY4A 2M38A 4DX8A 2V76A 3ODWA 4GXBA 2DFKA 2R09A 1GC6A 4HHVA 1QC6A 4K81A 1GG3A 1H10A 5HE3A 4Z2MB 3PZDA 2J0JA 2RUKB 2KGXB 1E5WA 2D9YA 1WI1A 3F0WA 1PMSA 3N7CA 4GMVA 3G9WA 1SGHA 2ELBA 3SYXA 1RJ2A 1TXDA 3A8PA 4MT7A 3SV1A 2RLOA 3MDBC 3P7ZA 5C5BB 2D9ZA 3PVLA 2D9XA 1FB8A 1RRPB 2I1JA 2W2XD 2E2XA 1U5GA 5JHGA 4TYZA 3ODXA 2DTCA 1TQZA 1EF1A 1FHXA 1EGXA 4WJ7A 1AWEA 2MDXA 3PG7A 4EKUA 2DX1A 2L2IA 1KI1B 3DXCA 4HAXB 1FOEA 4XWXA 4K2OA 2YS1A 5LOPB 1XCGA 5DHFB 5FI1A 2DHKA 2YSZA 1WJMA 1V89A 2HTHB 2YT0A 2LYDA 1BTKA 1U29A 2Q13A 2K2UA 2COCA 3QBVB 1V88A 1J19A 2M14A 4D0NB 2X18A 2Z0QA 2LOZA 3TVVA 1BAKA 1GC7A 2EJ8A 3CXBB 4HB0B 1WJ1A 2OQBA 1QQGA 3V5WA 1LB1A 1AQCA 2NMBA 3D8EA 2RGNB 1U5FA 4HAWB 3PVWA 5HE1A 2P8VA 1PLSA 4HATB 1U5EA 4ZRIA 3CIKA 1OY2A 2JP2A 5CLLB 1WGUA 4DXAB 2DN6A 3HW2B 3O96A 3KY9A 1ZSQA 4GMXB 1UPRA 4ZRJA 4A6KA 1XR0B 4KHAA 2D9VA 1PFJA 1B55A 2EC1A 4Y94A 4HB4B 1DROA 1W1GA 3KRXA 3ZVRA 5JHHA 2DKQA 2YT1A 3P6AA 3IVFA 5LONB 2FJLA 1I2HA 1ZC3B 1W1HA 2W2XC 2EMSA 3A98B 2MFQA 4GZUA 3LJUX 4WVFB 2ZPYA 1DDMA 1Z87A 4BBKA 1MIXA 1DBHA 2DYNA 2HE7A 4NSWA 2P0HA 1FGYA 4GPTB 3VOQA 1UNQA 3RCPA 4HAUB 3MPXA 5D3WA 5D27A 3TO1A 2GJYA 1LW3A 1WG7A 2QKLA 5FI0A 5JLJB 5C6RA 1X86A 4KAXB 4HDOA 3BJIA 2ROZB 2P0DA 3T06A 2PZ1A 3WYFB 2DHIA 3GYPA 1KZ7A 4DX90 1MKEA 1OQNA 2QKMA 5KQ4A 2VKIA 4A6FA 3AU5A 2J0MA 3OANA 1ZC4B 1DYNA 3FSSA 2DHJA 2J0KA 2LG1A 3U7DA 1Y19B 1M7RA 4KHBB 4IAPA 2L1CA 2G35A 1V5PA 3PP2A 1TJ6A 5D3VA 2ADZA 1K5GB 2UZSA 5D3XA 1SHCA 1K5DB 4K17A 1ISNA 1MK7B 2YRYA 4HAYB 1Y5OA 2AL6A 2N23A 2GCLA 5DIFB 2D4QA 5DHAB 1DDWA 4HB3B 3ODOA 2KUPA 4YL8A 2D2QA 1BWNA 3F5RA 3SNHA 2YS5A 3ML4A 2ROVA 2H7DA 4K2PA 1UPQA 1N3HA 2NZ8B 5C79A 5C16A 2D10A 1EAZA 4GN1A 2I5CA 3SUZA 2YS3A 4WSFA 4CHJA 4CYEA 5JP4A 2DX5A 5DI9B 5KQ1A 3WA0A 2J59M 1NTYA 2K2JA 2N0YA 3D8DA 2CODA 3AJ4A 4F7HA 4HAVB 4TKNA 4PNKA 3HQCA 3UZTA 1WGQA 1H4RA 1J0WA 2Y8GA 3KSYA 2UVMA 4PQ0A 1U2BA 1FAOA 2Z0OA 4MK0A 3PEGA
chains in the Genus database with same CATH superfamily
2LULA 4QJ5B 1XKEA 1WVHA 3KZ1A 4IOYX 2IYBA 1ZM0A 2VSZA 2Y7BA 2Y8FA 1W1DA 5GOWB 1ZYIA 3KRWA 1IRSA 2I5FA 3NWFA 3DXDA 4A6FB 1BTNA 1UNRA 2IFSA 1MIZB 3ZDTA 2YVCA 2KIGA 5HE2A 2K00A 1MPHA 1V5MA 1KZGA 2CAYA 1ZVRA 3D8FA 2H7EA 3DXEA 3TFMA 3FM8C 2NBVA 4HAZB 4L6EA 2GS0A 1FHOA 2YF0A 2XQNM 1U27A 4P7IA 1I7AA 1X05A 5D3YA 1XD4A 4C0AA 4EMOA 4NY0A 2DYQA 1Q67A 4B6HA 4A6HA 1V5UA 2RNRB 4IFSA 4KVGB 1OMWA 2OTXA 2RSGA 5HE0A 2CY5A 2Z14A 4ZRKA 3VIAA 1XODA 2ELAA 1NTVA 1V61A 3BINA 1P6SA 3ULCA 4F7UP 3TW1A 2W2WA 3TCAA 2LKOA 4DBBA 3GYOA 4F7GA 1X11A 3SO6A 1UNPA 2BCJA 4CHMA 2RVBB 1FHWA 1P5TA 3X23A 4YONA 1EVHA 1XX0A 4EJNA 4HB2B 2ZKMX 2DA0A 1P3RA 2I1KA 5C5BA 4HDQA 1UEFA 1U5DA 4QJ3B 2KCJA 4Z2NA 1MK9B 1NI2A 4MY6A 2R0DA 5J3QA 5EFXA 2P0FA 3ULBA 4CSQA 3NSUA 2LOXA 2DKPA 3PSCA 5J3TA 2D9WA 1FGZA 2MKRA 2YT2A 3U8ZA 1NU2A 1X1GA 5DH9B 3A8QA 1DDVA 2EMTA 3QWMA 5J3YA 2Z0PA 4A5KA 3HK0A 1M7EA 5L81A 5CLQB 2CRFA 4H8SA 2COAA 3M1IB 2DLWA 2UZRA 3AU4A 5KCVA 3U12A 5I2SA 2GCJA 2D11A 4D6WA 3FEHA 2VRWB 2MWNB 3QIJA 1MAIA 3PVUA 4KHOA 2COFA 1X1FA 2AEHA 2CY4A 2M38A 4DX8A 2V76A 3ODWA 4GXBA 2DFKA 2R09A 1GC6A 4HHVA 2GUMA 1QC6A 4K81A 1GG3A 1H10A 5HE3A 4Z2MB 3PZDA 2J0JA 2RUKB 2KGXB 1E5WA 2D9YA 1WI1A 3F0WA 1PMSA 3N7CA 4GMVA 2K8EA 3G9WA 1SGHA 2ELBA 3SYXA 1RJ2A 1TXDA 3A8PA 4MT7A 3SV1A 2RLOA 3MDBC 3P7ZA 5C5BB 2D9ZA 3PVLA 2D9XA 1FB8A 1RRPB 2I1JA 2W2XD 2E2XA 1U5GA 4GNKB 5JHGA 4TYZA 3ODXA 2DTCA 1TQZA 1EF1A 1FHXA 3NWAA 5LG4B 1EGXA 4WJ7A 1AWEA 2MDXA 3PG7A 4EKUA 2DX1A 5I2MA 2L2IA 1KI1B 3DXCA 4HAXB 1FOEA 4XWXA 4K2OA 2YS1A 5LOPB 1XCGA 4GOUA 5DHFB 5FI1A 2DHKA 2YSZA 1WJMA 1V89A 2HTHB 2YT0A 2LYDA 1BTKA 2KIEA 1U29A 2Q13A 2K2UA 2COCA 3QBVB 1V88A 2KR0A 1J19A 2M14A 4D0NB 2X18A 2Z0QA 2LOZA 3TVVA 1BAKA 4OSNA 1GC7A 2EJ8A 3CXBB 4HB0B 1WJ1A 2OQBA 1QQGA 3B77A 3V5WA 1LB1A 1AQCA 2NMBA 3D8EA 2RGNB 1U5FA 4HAWB 3PVWA 5HE1A 3NW8A 2P8VA 2R2YA 1PLSA 4HATB 1U5EA 4ZRIA 3CIKA 1OY2A 2JP2A 5CLLB 1WGUA 4DXAB 2DN6A 3HW2B 3O96A 3KY9A 1ZSQA 3FVCA 4GMXB 1UPRA 4ZRJA 4A6KA 1XR0B 5IRSA 4KHAA 2D9VA 1PFJA 1B55A 2EC1A 4Y94A 4HB4B 1DROA 1W1GA 3KRXA 3ZVRA 4QXAB 5JHHA 2DKQA 2YT1A 3P6AA 1T77A 3IVFA 5LONB 1MI1A 2FJLA 1I2HA 3HSAA 1ZC3B 1W1HA 2W2XC 2EMSA 3A98B 2MFQA 4GZUA 3LJUX 4WVFB 2ZPYA 5M4YB 1DDMA 1Z87A 4BBKA 1MIXA 1DBHA 2DYNA 2HE7A 4NSWA 2P0HA 1FGYA 4GPTB 4KHBA 3NWDA 3VOQA 1UNQA 3RCPA 2Z4DA 4HAUB 3MPXA 3A58A 2K49A 5D3WA 5D27A 3TO1A 2GJYA 1LW3A 1WG7A 2QKLA 5FI0A 5JLJB 5C6RA 1X86A 4KAXB 4HDOA 3BJIA 2ROZB 2P0DA 3T06A 2PZ1A 3WYFB 2DHIA 3GYPA 1KZ7A 4DX90 1MKEA 1OQNA 2QKMA 5KQ4A 3HIEA 2VKIA 4A6FA 3AU5A 2J0MA 3OANA 1ZC4B 1DYNA 3DCXA 3FSSA 2DHJA 2J0KA 2LG1A 3U7DA 4HSIA 1Y19B 1M7RA 4KHBB 4IAPA 2L1CA 2Z59A 2G35A 1V5PA 3PP2A 4QJ4B 1TJ6A 5D3VA 2ADZA 1K5GB 2UZSA 3OHMB 5D3XA 1SHCA 1K5DB 4K17A 1ISNA 1MK7B 2YRYA 4L1RA 4HAYB 1Y5OA 2AL6A 2N23A 2GCLA 5DIFB 2D4QA 5DHAB 1DDWA 4HB3B 3ODOA 2KUPA 4YL8A 2D2QA 1BWNA 3F5RA 3SNHA 2YS5A 2KUQA 3ML4A 2ROVA 2H7DA 4K2PA 1UPQA 1N3HA 2NZ8B 5C79A 5C16A 2D10A 1EAZA 4GN1A 2I5CA 3SUZA 2YS3A 4WSFA 4CHJA 4CYEA 5JP4A 2DX5A 5DI9B 5KQ1A 3WA0A 2J59M 2FJUB 4OT1A 1NTYA 2K2JA 2N0YA 3D8DA 2CODA 3AJ4A 4F7HA 4HAVB 4TKNA 4PNKA 3HQCA 3UZTA 1WGQA 1H4RA 2RRFA 1J0WA 2Y8GA 3KSYA 2Z13A 2UVMA 4PQ0A 1U2BA 4DIXA 1FAOA 2Z0OA 4MK0A 3PEGA
chains in the Genus database with same CATH topology
2LULA 1XKEA 1WVHA 3KZ1A 4IOYX 2IYBA 1ZM0A 2VSZA 2Y7BA 2Y8FA 1W1DA 5GOWB 3KRWA 1IRSA 2I5FA 3DXDA 4A6FB 1BTNA 1UNRA 2IFSA 1MIZB 3ZDTA 2YVCA 5HE2A 2K00A 1MPHA 1V5MA 1KZGA 2CAYA 1ZVRA 3D8FA 2H7EA 3DXEA 3TFMA 3FM8C 4L6EA 4HAZB 2GS0A 1FHOA 2YF0A 2XQNM 1U27A 4P7IA 1I7AA 1X05A 5D3YA 1XD4A 4C0AA 4EMOA 4NY0A 2DYQA 1Q67A 4B6HA 4A6HA 1V5UA 2RNRB 4IFSA 4KVGB 1OMWA 2OTXA 2RSGA 5HE0A 2CY5A 4ZRKA 3VIAA 1XODA 2ELAA 1NTVA 1V61A 3BINA 1P6SA 3ULCA 4F7UP 3TW1A 2W2WA 3TCAA 2LKOA 4DBBA 3GYOA 4F7GA 1X11A 3SO6A 1UNPA 2BCJA 4CHMA 2RVBB 1FHWA 1P5TA 3X23A 4YONA 1EVHA 1XX0A 4EJNA 4HB2B 2DA0A 1P3RA 2I1KA 5C5BA 4HDQA 1UEFA 1U5DA 2KCJA 4Z2NA 1MK9B 1NI2A 4MY6A 2R0DA 5J3QA 5EFXA 2P0FA 3ULBA 3NSUA 2LOXA 2DKPA 3PSCA 5J3TA 2D9WA 1FGZA 2MKRA 3U8ZA 1NU2A 1X1GA 5DH9B 3A8QA 1DDVA 2EMTA 3QWMA 5J3YA 2Z0PA 4A5KA 3HK0A 1M7EA 5L81A 5CLQB 2CRFA 4H8SA 2COAA 3M1IB 2DLWA 2UZRA 3AU4A 5KCVA 2GCJA 2D11A 3FEHA 2VRWB 2MWNB 3QIJA 1MAIA 3PVUA 4KHOA 2COFA 1X1FA 2AEHA 2CY4A 2M38A 4DX8A 2V76A 3ODWA 4GXBA 2DFKA 2R09A 1GC6A 4HHVA 1QC6A 4K81A 1GG3A 1H10A 5HE3A 4Z2MB 3PZDA 2J0JA 2RUKB 2KGXB 1E5WA 2D9YA 1WI1A 3F0WA 1PMSA 3N7CA 4GMVA 3G9WA 1SGHA 2ELBA 3SYXA 1RJ2A 1TXDA 3A8PA 4MT7A 3SV1A 2RLOA 3MDBC 3P7ZA 5C5BB 2D9ZA 3PVLA 2D9XA 1FB8A 1RRPB 2I1JA 2W2XD 2E2XA 1U5GA 5JHGA 4TYZA 3ODXA 2DTCA 1TQZA 1EF1A 1FHXA 1EGXA 4WJ7A 1AWEA 2MDXA 3PG7A 4EKUA 2DX1A 2L2IA 1KI1B 3DXCA 4HAXB 1FOEA 4XWXA 4K2OA 2YS1A 5LOPB 1XCGA 5DHFB 5FI1A 2DHKA 2YSZA 1WJMA 1V89A 2HTHB 2YT0A 2LYDA 1BTKA 1U29A 2Q13A 2K2UA 2COCA 3QBVB 1V88A 1J19A 2M14A 4D0NB 2X18A 2Z0QA 2LOZA 3TVVA 1BAKA 1GC7A 2EJ8A 3CXBB 4HB0B 1WJ1A 2OQBA 1QQGA 3V5WA 1LB1A 1AQCA 2NMBA 3D8EA 2RGNB 1U5FA 4HAWB 3PVWA 5HE1A 2P8VA 1PLSA 4HATB 1U5EA 4ZRIA 3CIKA 1OY2A 2JP2A 5CLLB 1WGUA 4DXAB 2DN6A 3HW2B 3O96A 3KY9A 1ZSQA 4GMXB 1UPRA 4ZRJA 4A6KA 1XR0B 4KHAA 2D9VA 1PFJA 1B55A 2EC1A 4Y94A 4HB4B 1DROA 1W1GA 3KRXA 3ZVRA 5JHHA 2DKQA 2YT1A 3P6AA 3IVFA 5LONB 2FJLA 1I2HA 1ZC3B 1W1HA 2W2XC 2EMSA 3A98B 2MFQA 4GZUA 3LJUX 4WVFB 2ZPYA 1DDMA 1Z87A 4BBKA 1MIXA 1DBHA 2DYNA 2HE7A 4NSWA 2P0HA 1FGYA 4GPTB 3VOQA 1UNQA 3RCPA 4HAUB 3MPXA 5D3WA 5D27A 3TO1A 2GJYA 1LW3A 1WG7A 2QKLA 5FI0A 5JLJB 5C6RA 1X86A 4KAXB 4HDOA 3BJIA 2ROZB 2P0DA 3T06A 2PZ1A 3WYFB 2DHIA 3GYPA 1KZ7A 4DX90 1MKEA 1OQNA 2QKMA 5KQ4A 2VKIA 4A6FA 3AU5A 2J0MA 3OANA 1ZC4B 1DYNA 3FSSA 2DHJA 2J0KA 2LG1A 3U7DA 1Y19B 1M7RA 4KHBB 4IAPA 2L1CA 2G35A 1V5PA 3PP2A 1TJ6A 5D3VA 2ADZA 1K5GB 2UZSA 5D3XA 1SHCA 1K5DB 4K17A 1ISNA 1MK7B 2YRYA 4HAYB 1Y5OA 2AL6A 2N23A 2GCLA 5DIFB 2D4QA 5DHAB 1DDWA 4HB3B 3ODOA 2KUPA 4YL8A 2D2QA 1BWNA 3F5RA 3SNHA 2YS5A 3ML4A 2ROVA 2H7DA 4K2PA 1UPQA 1N3HA 2NZ8B 5C79A 5C16A 2D10A 1EAZA 4GN1A 2I5CA 3SUZA 2YS3A 4WSFA 4CHJA 4CYEA 5JP4A 2DX5A 5DI9B 5KQ1A 3WA0A 2J59M 1NTYA 2K2JA 2N0YA 3D8DA 2CODA 3AJ4A 4F7HA 4HAVB 4TKNA 4PNKA 3HQCA 3UZTA 1WGQA 1H4RA 1J0WA 2Y8GA 3KSYA 2UVMA 4PQ0A 1U2BA 1FAOA 2Z0OA 4MK0A 3PEGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LUL A;  1XKE A;  1WVH A;  3KZ1 A;  4IOY X;  2IYB A;  1ZM0 A;  2VSZ A;  2Y7B A;  2Y8F A;  1W1D A;  5GOW B;  3KRW A;  1IRS A;  2I5F A;  3DXD A;  4A6F B;  1BTN A;  1UNR A;  2IFS A;  1MIZ B;  3ZDT A;  2YVC A;  5HE2 A;  2K00 A;  1MPH A;  1V5M A;  1KZG A;  2CAY A;  1ZVR A;  3D8F A;  2H7E A;  3DXE A;  3TFM A;  3FM8 C;  4L6E A;  4HAZ B;  2GS0 A;  1FHO A;  2YF0 A;  2XQN M;  1U27 A;  4P7I A;  1I7A A;  1X05 A;  5D3Y A;  1XD4 A;  4C0A A;  4EMO A;  4NY0 A;  2DYQ A;  1Q67 A;  4B6H A;  4A6H A;  1V5U A;  2RNR B;  4IFS A;  4KVG B;  1OMW A;  2OTX A;  2RSG A;  5HE0 A;  2CY5 A;  4ZRK A;  3VIA A;  1XOD A;  2ELA A;  1NTV A;  1V61 A;  3BIN A;  1P6S A;  3ULC A;  4F7U P;  3TW1 A;  2W2W A;  3TCA A;  2LKO A;  4DBB A;  3GYO A;  4F7G A;  1X11 A;  3SO6 A;  1UNP A;  2BCJ A;  4CHM A;  2RVB B;  1FHW A;  1P5T A;  3X23 A;  4YON A;  1EVH A;  1XX0 A;  4EJN A;  4HB2 B;  2DA0 A;  1P3R A;  2I1K A;  5C5B A;  4HDQ A;  1UEF A;  1U5D A;  2KCJ A;  4Z2N A;  1MK9 B;  1NI2 A;  4MY6 A;  2R0D A;  5J3Q A;  5EFX A;  2P0F A;  3ULB A;  3NSU A;  2LOX A;  2DKP A;  3PSC A;  5J3T A;  2D9W A;  1FGZ A;  2MKR A;  3U8Z A;  1NU2 A;  1X1G A;  5DH9 B;  3A8Q A;  1DDV A;  2EMT A;  3QWM A;  5J3Y A;  2Z0P A;  4A5K A;  3HK0 A;  1M7E A;  5L81 A;  5CLQ B;  2CRF A;  4H8S A;  2COA A;  3M1I B;  2DLW A;  2UZR A;  3AU4 A;  5KCV A;  2GCJ A;  2D11 A;  3FEH A;  2VRW B;  2MWN B;  3QIJ A;  1MAI A;  3PVU A;  4KHO A;  2COF A;  1X1F A;  2AEH A;  2CY4 A;  2M38 A;  4DX8 A;  2V76 A;  3ODW A;  4GXB A;  2DFK A;  2R09 A;  1GC6 A;  4HHV A;  1QC6 A;  4K81 A;  1GG3 A;  1H10 A;  5HE3 A;  4Z2M B;  3PZD A;  2J0J A;  2RUK B;  2KGX B;  1E5W A;  2D9Y A;  1WI1 A;  3F0W A;  1PMS A;  3N7C A;  4GMV A;  3G9W A;  1SGH A;  2ELB A;  3SYX A;  1RJ2 A;  1TXD A;  3A8P A;  4MT7 A;  3SV1 A;  2RLO A;  3MDB C;  3P7Z A;  5C5B B;  2D9Z A;  3PVL A;  2D9X A;  1FB8 A;  1RRP B;  2I1J A;  2W2X D;  2E2X A;  1U5G A;  5JHG A;  4TYZ A;  3ODX A;  2DTC A;  1TQZ A;  1EF1 A;  1FHX A;  1EGX A;  4WJ7 A;  1AWE A;  2MDX A;  3PG7 A;  4EKU A;  2DX1 A;  2L2I A;  1KI1 B;  3DXC A;  4HAX B;  1FOE A;  4XWX A;  4K2O A;  2YS1 A;  5LOP B;  1XCG A;  5DHF B;  5FI1 A;  2DHK A;  2YSZ A;  1WJM A;  1V89 A;  2HTH B;  2YT0 A;  2LYD A;  1BTK A;  1U29 A;  2Q13 A;  2K2U A;  2COC A;  3QBV B;  1V88 A;  1J19 A;  2M14 A;  4D0N B;  2X18 A;  2Z0Q A;  2LOZ A;  3TVV A;  1BAK A;  1GC7 A;  2EJ8 A;  3CXB B;  4HB0 B;  1WJ1 A;  2OQB A;  1QQG A;  3V5W A;  1LB1 A;  1AQC A;  2NMB A;  3D8E A;  2RGN B;  1U5F A;  4HAW B;  3PVW A;  5HE1 A;  2P8V A;  1PLS A;  4HAT B;  1U5E A;  4ZRI A;  3CIK A;  1OY2 A;  2JP2 A;  5CLL B;  1WGU A;  4DXA B;  2DN6 A;  3HW2 B;  3O96 A;  3KY9 A;  1ZSQ A;  4GMX B;  1UPR A;  4ZRJ A;  4A6K A;  1XR0 B;  4KHA A;  2D9V A;  1PFJ A;  1B55 A;  2EC1 A;  4Y94 A;  4HB4 B;  1DRO A;  1W1G A;  3KRX A;  3ZVR A;  5JHH A;  2DKQ A;  2YT1 A;  3P6A A;  3IVF A;  5LON B;  2FJL A;  1I2H A;  1ZC3 B;  1W1H A;  2W2X C;  2EMS A;  3A98 B;  2MFQ A;  4GZU A;  3LJU X;  4WVF B;  2ZPY A;  1DDM A;  1Z87 A;  4BBK A;  1MIX A;  1DBH A;  2DYN A;  2HE7 A;  4NSW A;  2P0H A;  1FGY A;  4GPT B;  3VOQ A;  1UNQ A;  3RCP A;  4HAU B;  3MPX A;  5D3W A;  5D27 A;  3TO1 A;  2GJY A;  1LW3 A;  1WG7 A;  2QKL A;  5FI0 A;  5JLJ B;  5C6R A;  1X86 A;  4KAX B;  4HDO A;  3BJI A;  2ROZ B;  2P0D A;  3T06 A;  2PZ1 A;  3WYF B;  2DHI A;  3GYP A;  1KZ7 A;  4DX9 0;  1MKE A;  1OQN A;  2QKM A;  5KQ4 A;  2VKI A;  4A6F A;  3AU5 A;  2J0M A;  3OAN A;  1ZC4 B;  1DYN A;  3FSS A;  2DHJ A;  2J0K A;  2LG1 A;  3U7D A;  1Y19 B;  1M7R A;  4KHB B;  4IAP A;  2L1C A;  2G35 A;  1V5P A;  3PP2 A;  1TJ6 A;  5D3V A;  2ADZ A;  1K5G B;  2UZS A;  5D3X A;  1SHC A;  1K5D B;  4K17 A;  1ISN A;  1MK7 B;  2YRY A;  4HAY B;  1Y5O A;  2AL6 A;  2N23 A;  2GCL A;  5DIF B;  2D4Q A;  5DHA B;  1DDW A;  4HB3 B;  3ODO A;  2KUP A;  4YL8 A;  2D2Q A;  1BWN A;  3F5R A;  3SNH A;  2YS5 A;  3ML4 A;  2ROV A;  2H7D A;  4K2P A;  1UPQ A;  1N3H A;  2NZ8 B;  5C79 A;  5C16 A;  2D10 A;  1EAZ A;  4GN1 A;  2I5C A;  3SUZ A;  2YS3 A;  4WSF A;  4CHJ A;  4CYE A;  5JP4 A;  2DX5 A;  5DI9 B;  5KQ1 A;  3WA0 A;  2J59 M;  1NTY A;  2K2J A;  2N0Y A;  3D8D A;  2COD A;  3AJ4 A;  4F7H A;  4HAV B;  4TKN A;  4PNK A;  3HQC A;  3UZT A;  1WGQ A;  1H4R A;  1J0W A;  2Y8G A;  3KSY A;  2UVM A;  4PQ0 A;  1U2B A;  1FAO A;  2Z0O A;  4MK0 A;  3PEG A; 
#chains in the Genus database with same CATH topology
 2LUL A;  4QJ5 B;  1XKE A;  1WVH A;  3KZ1 A;  4IOY X;  2IYB A;  1ZM0 A;  2VSZ A;  2Y7B A;  2Y8F A;  1W1D A;  5GOW B;  1ZYI A;  3KRW A;  1IRS A;  2I5F A;  3NWF A;  3DXD A;  4A6F B;  1BTN A;  1UNR A;  2IFS A;  1MIZ B;  3ZDT A;  2YVC A;  2KIG A;  5HE2 A;  2K00 A;  1MPH A;  1V5M A;  1KZG A;  2CAY A;  1ZVR A;  3D8F A;  2H7E A;  3DXE A;  3TFM A;  3FM8 C;  2NBV A;  4HAZ B;  4L6E A;  2GS0 A;  1FHO A;  2YF0 A;  2XQN M;  1U27 A;  4P7I A;  1I7A A;  1X05 A;  5D3Y A;  1XD4 A;  4C0A A;  4EMO A;  4NY0 A;  2DYQ A;  1Q67 A;  4B6H A;  4A6H A;  1V5U A;  2RNR B;  4IFS A;  4KVG B;  1OMW A;  2OTX A;  2RSG A;  5HE0 A;  2CY5 A;  2Z14 A;  4ZRK A;  3VIA A;  1XOD A;  2ELA A;  1NTV A;  1V61 A;  3BIN A;  1P6S A;  3ULC A;  4F7U P;  3TW1 A;  2W2W A;  3TCA A;  2LKO A;  4DBB A;  3GYO A;  4F7G A;  1X11 A;  3SO6 A;  1UNP A;  2BCJ A;  4CHM A;  2RVB B;  1FHW A;  1P5T A;  3X23 A;  4YON A;  1EVH A;  1XX0 A;  4EJN A;  4HB2 B;  2ZKM X;  2DA0 A;  1P3R A;  2I1K A;  5C5B A;  4HDQ A;  1UEF A;  1U5D A;  4QJ3 B;  2KCJ A;  4Z2N A;  1MK9 B;  1NI2 A;  4MY6 A;  2R0D A;  5J3Q A;  5EFX A;  2P0F A;  3ULB A;  4CSQ A;  3NSU A;  2LOX A;  2DKP A;  3PSC A;  5J3T A;  2D9W A;  1FGZ A;  2MKR A;  2YT2 A;  3U8Z A;  1NU2 A;  1X1G A;  5DH9 B;  3A8Q A;  1DDV A;  2EMT A;  3QWM A;  5J3Y A;  2Z0P A;  4A5K A;  3HK0 A;  1M7E A;  5L81 A;  5CLQ B;  2CRF A;  4H8S A;  2COA A;  3M1I B;  2DLW A;  2UZR A;  3AU4 A;  5KCV A;  3U12 A;  5I2S A;  2GCJ A;  2D11 A;  4D6W A;  3FEH A;  2VRW B;  2MWN B;  3QIJ A;  1MAI A;  3PVU A;  4KHO A;  2COF A;  1X1F A;  2AEH A;  2CY4 A;  2M38 A;  4DX8 A;  2V76 A;  3ODW A;  4GXB A;  2DFK A;  2R09 A;  1GC6 A;  4HHV A;  2GUM A;  1QC6 A;  4K81 A;  1GG3 A;  1H10 A;  5HE3 A;  4Z2M B;  3PZD A;  2J0J A;  2RUK B;  2KGX B;  1E5W A;  2D9Y A;  1WI1 A;  3F0W A;  1PMS A;  3N7C A;  4GMV A;  2K8E A;  3G9W A;  1SGH A;  2ELB A;  3SYX A;  1RJ2 A;  1TXD A;  3A8P A;  4MT7 A;  3SV1 A;  2RLO A;  3MDB C;  3P7Z A;  5C5B B;  2D9Z A;  3PVL A;  2D9X A;  1FB8 A;  1RRP B;  2I1J A;  2W2X D;  2E2X A;  1U5G A;  4GNK B;  5JHG A;  4TYZ A;  3ODX A;  2DTC A;  1TQZ A;  1EF1 A;  1FHX A;  3NWA A;  5LG4 B;  1EGX A;  4WJ7 A;  1AWE A;  2MDX A;  3PG7 A;  4EKU A;  2DX1 A;  5I2M A;  2L2I A;  1KI1 B;  3DXC A;  4HAX B;  1FOE A;  4XWX A;  4K2O A;  2YS1 A;  5LOP B;  1XCG A;  4GOU A;  5DHF B;  5FI1 A;  2DHK A;  2YSZ A;  1WJM A;  1V89 A;  2HTH B;  2YT0 A;  2LYD A;  1BTK A;  2KIE A;  1U29 A;  2Q13 A;  2K2U A;  2COC A;  3QBV B;  1V88 A;  2KR0 A;  1J19 A;  2M14 A;  4D0N B;  2X18 A;  2Z0Q A;  2LOZ A;  3TVV A;  1BAK A;  4OSN A;  1GC7 A;  2EJ8 A;  3CXB B;  4HB0 B;  1WJ1 A;  2OQB A;  1QQG A;  3B77 A;  3V5W A;  1LB1 A;  1AQC A;  2NMB A;  3D8E A;  2RGN B;  1U5F A;  4HAW B;  3PVW A;  5HE1 A;  3NW8 A;  2P8V A;  2R2Y A;  1PLS A;  4HAT B;  1U5E A;  4ZRI A;  3CIK A;  1OY2 A;  2JP2 A;  5CLL B;  1WGU A;  4DXA B;  2DN6 A;  3HW2 B;  3O96 A;  3KY9 A;  1ZSQ A;  3FVC A;  4GMX B;  1UPR A;  4ZRJ A;  4A6K A;  1XR0 B;  5IRS A;  4KHA A;  2D9V A;  1PFJ A;  1B55 A;  2EC1 A;  4Y94 A;  4HB4 B;  1DRO A;  1W1G A;  3KRX A;  3ZVR A;  4QXA B;  5JHH A;  2DKQ A;  2YT1 A;  3P6A A;  1T77 A;  3IVF A;  5LON B;  1MI1 A;  2FJL A;  1I2H A;  3HSA A;  1ZC3 B;  1W1H A;  2W2X C;  2EMS A;  3A98 B;  2MFQ A;  4GZU A;  3LJU X;  4WVF B;  2ZPY A;  5M4Y B;  1DDM A;  1Z87 A;  4BBK A;  1MIX A;  1DBH A;  2DYN A;  2HE7 A;  4NSW A;  2P0H A;  1FGY A;  4GPT B;  4KHB A;  3NWD A;  3VOQ A;  1UNQ A;  3RCP A;  2Z4D A;  4HAU B;  3MPX A;  3A58 A;  2K49 A;  5D3W A;  5D27 A;  3TO1 A;  2GJY A;  1LW3 A;  1WG7 A;  2QKL A;  5FI0 A;  5JLJ B;  5C6R A;  1X86 A;  4KAX B;  4HDO A;  3BJI A;  2ROZ B;  2P0D A;  3T06 A;  2PZ1 A;  3WYF B;  2DHI A;  3GYP A;  1KZ7 A;  4DX9 0;  1MKE A;  1OQN A;  2QKM A;  5KQ4 A;  3HIE A;  2VKI A;  4A6F A;  3AU5 A;  2J0M A;  3OAN A;  1ZC4 B;  1DYN A;  3DCX A;  3FSS A;  2DHJ A;  2J0K A;  2LG1 A;  3U7D A;  4HSI A;  1Y19 B;  1M7R A;  4KHB B;  4IAP A;  2L1C A;  2Z59 A;  2G35 A;  1V5P A;  3PP2 A;  4QJ4 B;  1TJ6 A;  5D3V A;  2ADZ A;  1K5G B;  2UZS A;  3OHM B;  5D3X A;  1SHC A;  1K5D B;  4K17 A;  1ISN A;  1MK7 B;  2YRY A;  4L1R A;  4HAY B;  1Y5O A;  2AL6 A;  2N23 A;  2GCL A;  5DIF B;  2D4Q A;  5DHA B;  1DDW A;  4HB3 B;  3ODO A;  2KUP A;  4YL8 A;  2D2Q A;  1BWN A;  3F5R A;  3SNH A;  2YS5 A;  2KUQ A;  3ML4 A;  2ROV A;  2H7D A;  4K2P A;  1UPQ A;  1N3H A;  2NZ8 B;  5C79 A;  5C16 A;  2D10 A;  1EAZ A;  4GN1 A;  2I5C A;  3SUZ A;  2YS3 A;  4WSF A;  4CHJ A;  4CYE A;  5JP4 A;  2DX5 A;  5DI9 B;  5KQ1 A;  3WA0 A;  2J59 M;  2FJU B;  4OT1 A;  1NTY A;  2K2J A;  2N0Y A;  3D8D A;  2COD A;  3AJ4 A;  4F7H A;  4HAV B;  4TKN A;  4PNK A;  3HQC A;  3UZT A;  1WGQ A;  1H4R A;  2RRF A;  1J0W A;  2Y8G A;  3KSY A;  2Z13 A;  2UVM A;  4PQ0 A;  1U2B A;  4DIX A;  1FAO A;  2Z0O A;  4MK0 A;  3PEG A; 
#chains in the Genus database with same CATH homology
 2LUL A;  1XKE A;  1WVH A;  3KZ1 A;  4IOY X;  2IYB A;  1ZM0 A;  2VSZ A;  2Y7B A;  2Y8F A;  1W1D A;  5GOW B;  3KRW A;  1IRS A;  2I5F A;  3DXD A;  4A6F B;  1BTN A;  1UNR A;  2IFS A;  1MIZ B;  3ZDT A;  2YVC A;  5HE2 A;  2K00 A;  1MPH A;  1V5M A;  1KZG A;  2CAY A;  1ZVR A;  3D8F A;  2H7E A;  3DXE A;  3TFM A;  3FM8 C;  4L6E A;  4HAZ B;  2GS0 A;  1FHO A;  2YF0 A;  2XQN M;  1U27 A;  4P7I A;  1I7A A;  1X05 A;  5D3Y A;  1XD4 A;  4C0A A;  4EMO A;  4NY0 A;  2DYQ A;  1Q67 A;  4B6H A;  4A6H A;  1V5U A;  2RNR B;  4IFS A;  4KVG B;  1OMW A;  2OTX A;  2RSG A;  5HE0 A;  2CY5 A;  4ZRK A;  3VIA A;  1XOD A;  2ELA A;  1NTV A;  1V61 A;  3BIN A;  1P6S A;  3ULC A;  4F7U P;  3TW1 A;  2W2W A;  3TCA A;  2LKO A;  4DBB A;  3GYO A;  4F7G A;  1X11 A;  3SO6 A;  1UNP A;  2BCJ A;  4CHM A;  2RVB B;  1FHW A;  1P5T A;  3X23 A;  4YON A;  1EVH A;  1XX0 A;  4EJN A;  4HB2 B;  2DA0 A;  1P3R A;  2I1K A;  5C5B A;  4HDQ A;  1UEF A;  1U5D A;  2KCJ A;  4Z2N A;  1MK9 B;  1NI2 A;  4MY6 A;  2R0D A;  5J3Q A;  5EFX A;  2P0F A;  3ULB A;  3NSU A;  2LOX A;  2DKP A;  3PSC A;  5J3T A;  2D9W A;  1FGZ A;  2MKR A;  3U8Z A;  1NU2 A;  1X1G A;  5DH9 B;  3A8Q A;  1DDV A;  2EMT A;  3QWM A;  5J3Y A;  2Z0P A;  4A5K A;  3HK0 A;  1M7E A;  5L81 A;  5CLQ B;  2CRF A;  4H8S A;  2COA A;  3M1I B;  2DLW A;  2UZR A;  3AU4 A;  5KCV A;  2GCJ A;  2D11 A;  3FEH A;  2VRW B;  2MWN B;  3QIJ A;  1MAI A;  3PVU A;  4KHO A;  2COF A;  1X1F A;  2AEH A;  2CY4 A;  2M38 A;  4DX8 A;  2V76 A;  3ODW A;  4GXB A;  2DFK A;  2R09 A;  1GC6 A;  4HHV A;  1QC6 A;  4K81 A;  1GG3 A;  1H10 A;  5HE3 A;  4Z2M B;  3PZD A;  2J0J A;  2RUK B;  2KGX B;  1E5W A;  2D9Y A;  1WI1 A;  3F0W A;  1PMS A;  3N7C A;  4GMV A;  3G9W A;  1SGH A;  2ELB A;  3SYX A;  1RJ2 A;  1TXD A;  3A8P A;  4MT7 A;  3SV1 A;  2RLO A;  3MDB C;  3P7Z A;  5C5B B;  2D9Z A;  3PVL A;  2D9X A;  1FB8 A;  1RRP B;  2I1J A;  2W2X D;  2E2X A;  1U5G A;  5JHG A;  4TYZ A;  3ODX A;  2DTC A;  1TQZ A;  1EF1 A;  1FHX A;  1EGX A;  4WJ7 A;  1AWE A;  2MDX A;  3PG7 A;  4EKU A;  2DX1 A;  2L2I A;  1KI1 B;  3DXC A;  4HAX B;  1FOE A;  4XWX A;  4K2O A;  2YS1 A;  5LOP B;  1XCG A;  5DHF B;  5FI1 A;  2DHK A;  2YSZ A;  1WJM A;  1V89 A;  2HTH B;  2YT0 A;  2LYD A;  1BTK A;  1U29 A;  2Q13 A;  2K2U A;  2COC A;  3QBV B;  1V88 A;  1J19 A;  2M14 A;  4D0N B;  2X18 A;  2Z0Q A;  2LOZ A;  3TVV A;  1BAK A;  1GC7 A;  2EJ8 A;  3CXB B;  4HB0 B;  1WJ1 A;  2OQB A;  1QQG A;  3V5W A;  1LB1 A;  1AQC A;  2NMB A;  3D8E A;  2RGN B;  1U5F A;  4HAW B;  3PVW A;  5HE1 A;  2P8V A;  1PLS A;  4HAT B;  1U5E A;  4ZRI A;  3CIK A;  1OY2 A;  2JP2 A;  5CLL B;  1WGU A;  4DXA B;  2DN6 A;  3HW2 B;  3O96 A;  3KY9 A;  1ZSQ A;  4GMX B;  1UPR A;  4ZRJ A;  4A6K A;  1XR0 B;  4KHA A;  2D9V A;  1PFJ A;  1B55 A;  2EC1 A;  4Y94 A;  4HB4 B;  1DRO A;  1W1G A;  3KRX A;  3ZVR A;  5JHH A;  2DKQ A;  2YT1 A;  3P6A A;  3IVF A;  5LON B;  2FJL A;  1I2H A;  1ZC3 B;  1W1H A;  2W2X C;  2EMS A;  3A98 B;  2MFQ A;  4GZU A;  3LJU X;  4WVF B;  2ZPY A;  1DDM A;  1Z87 A;  4BBK A;  1MIX A;  1DBH A;  2DYN A;  2HE7 A;  4NSW A;  2P0H A;  1FGY A;  4GPT B;  3VOQ A;  1UNQ A;  3RCP A;  4HAU B;  3MPX A;  5D3W A;  5D27 A;  3TO1 A;  2GJY A;  1LW3 A;  1WG7 A;  2QKL A;  5FI0 A;  5JLJ B;  5C6R A;  1X86 A;  4KAX B;  4HDO A;  3BJI A;  2ROZ B;  2P0D A;  3T06 A;  2PZ1 A;  3WYF B;  2DHI A;  3GYP A;  1KZ7 A;  4DX9 0;  1MKE A;  1OQN A;  2QKM A;  5KQ4 A;  2VKI A;  4A6F A;  3AU5 A;  2J0M A;  3OAN A;  1ZC4 B;  1DYN A;  3FSS A;  2DHJ A;  2J0K A;  2LG1 A;  3U7D A;  1Y19 B;  1M7R A;  4KHB B;  4IAP A;  2L1C A;  2G35 A;  1V5P A;  3PP2 A;  1TJ6 A;  5D3V A;  2ADZ A;  1K5G B;  2UZS A;  5D3X A;  1SHC A;  1K5D B;  4K17 A;  1ISN A;  1MK7 B;  2YRY A;  4HAY B;  1Y5O A;  2AL6 A;  2N23 A;  2GCL A;  5DIF B;  2D4Q A;  5DHA B;  1DDW A;  4HB3 B;  3ODO A;  2KUP A;  4YL8 A;  2D2Q A;  1BWN A;  3F5R A;  3SNH A;  2YS5 A;  3ML4 A;  2ROV A;  2H7D A;  4K2P A;  1UPQ A;  1N3H A;  2NZ8 B;  5C79 A;  5C16 A;  2D10 A;  1EAZ A;  4GN1 A;  2I5C A;  3SUZ A;  2YS3 A;  4WSF A;  4CHJ A;  4CYE A;  5JP4 A;  2DX5 A;  5DI9 B;  5KQ1 A;  3WA0 A;  2J59 M;  1NTY A;  2K2J A;  2N0Y A;  3D8D A;  2COD A;  3AJ4 A;  4F7H A;  4HAV B;  4TKN A;  4PNK A;  3HQC A;  3UZT A;  1WGQ A;  1H4R A;  1J0W A;  2Y8G A;  3KSY A;  2UVM A;  4PQ0 A;  1U2B A;  1FAO A;  2Z0O A;  4MK0 A;  3PEG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...