4MY6A

Enah-evh1 in complex with peptidomimetic low-molecular weight inhibitor ac-[2-cl-f]-[prom-2]-[prom-1]-oh
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
110
structure length
110
Chain Sequence
SEQSICQARAAVMVYDDANKKWVPAGGSTGFSRVHIYHHTGNNTFRVVGRKIQDHQVVINCAIPKGLKYNQATQTFHQWRDARQVYGLNFGSKEDANVFASAMMHALEVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein enabled homolog
publication title A modular toolkit to inhibit proline-rich motif-mediated protein-protein interactions.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion/inhibitor
total genus 26
structure length 110
sequence length 110
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-09-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00568 WH1 WH1 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 4my6A00
3TVVA 3D8EA 3CXBB 2HTHB 1OY2A 5CLLB 1DDWA 5DI9B 3QWMA 4EJNA 1XX0A 2AEHA 3ODOA 1OMWA 2YF0A 1PLSA 1DROA 3DXDA 3RCPA 2LULA 2W2XD 4HAXB 1MPHA 2ELBA 1U5GA 2Y8FA 4NSWA 1W1DA 4GPTB 2CY5A 3PVLA 2QKLA 2CODA 1WJ1A 1V5PA 1RJ2A 2GS0A 3UZTA 2ROVA 3HW2B 1FHOA 2RLOA 3PVUA 4MK0A 4D0NB 2P0DA 1EAZA 4IOYX 2D9YA 1GC7A 2I5CA 5D3VA 3IVFA 1U2BA 5DH9B 1K5GB 1IRSA 2H7EA 1WI1A 1J0WA 3SNHA 2COCA 5DHFB 2YVCA 1BTKA 2MWNB 5LONB 1NI2A 2DHIA 1U5FA 2D9XA 1MKEA 2DKQA 2OQBA 1ZC3B 1V61A 3KY9A 5D27A 1X11A 4CYEA 1UPQA 2J0KA 1XODA 4HHVA 2DYNA 3TCAA 4CHJA 1V88A 1U27A 1GG3A 1WGQA 3ODXA 1V5MA 1PFJA 2CY4A 2LG1A 1LB1A 4BBKA 1EGXA 3LJUX 4ZRIA 2L1CA 5JHHA 2EC1A 1X05A 5JHGA 1NTYA 1XD4A 1KZ7A 3SO6A 4F7HA 3VIAA 1FHWA 2IYBA 4MT7A 3VOQA 1XCGA 2GCJA 3FM8C 1NU2A 1UNRA 4GN1A 3MPXA 1V89A 2D10A 3X23A 3DXCA 4HATB 3BINA 1TQZA 2I5FA 5C79A 2D4QA 3WYFB 3ULBA 2R0DA 2W2XC 4Z2NA 1DDMA 4WVFB 1I2HA 1XKEA 4PNKA 3P6AA 4K81A 2KGXB 2RSGA 2Y7BA 2X18A 3P7ZA 4A6KA 4K2PA 2AL6A 5HE1A 1WVHA 3G9WA 2Q13A 2M38A 1K5DB 2QKMA 2D2QA 1Y19B 2RGNB 4HAWB 3PZDA 1N3HA 3PP2A 2W2WA 5KQ1A 2G35A 2KUPA 1ZVRA 2I1JA 1J19A 3CIKA 5HE0A 4HAYB 3NSUA 3F5RA 2I1KA 1XR0B 2J0JA 3TFMA 3V5WA 4DBBA 2HE7A 1DDVA 3ULCA 5D3XA 4MY6A 2DKPA 2KCJA 2UVMA 2V76A 1MIZB 2EMSA 3FSSA 3QBVB 2LKOA 3HK0A 1WJMA 1RRPB 4L6EA 4KHBB 3M1IB 4C0AA 1FHXA 1MK9B 4K2OA 4TYZA 4HB3B 4Y94A 3TW1A 1GC6A 2FJLA 2D9ZA 1UNPA 1DBHA 5D3YA 1BAKA 2R09A 1TXDA 2ROZB 3AU5A 5FI0A 4DX8A 2YS3A 5J3TA 1QQGA 1UEFA 1FGYA 5JLJB 3OANA 4F7UP 1TJ6A 2OTXA 3ZVRA 1KZGA 2ELAA 2RVBB 2YS5A 4KVGB 2RNRB 3N7CA 1EVHA 4EMOA 4WJ7A 2DTCA 4Z2MB 3GYPA 4NY0A 4GXBA 3A98B 4HB4B 5FI1A 2COFA 2K2UA 2DX5A 3ODWA 2LOXA 5D3WA 2P8VA 3AJ4A 4ZRJA 3F0WA 5L81A 2CAYA 1WGUA 5KQ4A 3FEHA 1P5TA 2P0HA 1AWEA 2DYQA 4TKNA 4HAZB 4K17A 2ADZA 2VRWB 5C5BB 3HQCA 3TO1A 2GJYA 3SUZA 2MFQA 4HB2B 2EJ8A 1QC6A 1AQCA 2NZ8B 1ZM0A 2Z0PA 3PVWA 4KHOA 2YSZA 2DX1A 2D11A 2GCLA 1E5WA 3AU4A 2J0MA 2N23A 3U7DA 5C5BA 4GMXB 3ML4A 2LOZA 1PMSA 5J3YA 3SYXA 4IAPA 2NMBA 1UNQA 1U5DA 2MDXA 3A8PA 1UPRA 2EMTA 5CLQB 1ZC4B 1I7AA 5DHAB 5C16A 3D8FA 1EF1A 2IFSA 3SV1A 1DYNA 1MIXA 2K00A 2DHKA 3PEGA 3DXEA 1SHCA 2RUKB 3KSYA 1ISNA 1KI1B 1OQNA 1Q67A 2DA0A 1U5EA 4EKUA 4CHMA 5LOPB 1M7EA 3KRWA 5J3QA 1H10A 2DFKA 4HB0B 4GMVA 1ZSQA 3WA0A 5GOWB 2DN6A 2H7DA 4DX90 5DIFB 2P0FA 4HDQA 1U29A 1X1GA 4ZRKA 1Z87A 4WSFA 1X86A 2ZPYA 2M14A 3KRXA 3O96A 1FAOA 3ZDTA 2BCJA 3BJIA 5C6RA 3MDBC 2YT1A 1WG7A 5HE2A 1MAIA 2YRYA 2Z0OA 3T06A 4KHAA 2PZ1A 5HE3A 1NTVA 2UZRA 1FGZA 5JP4A 4YONA 4HDOA 1LW3A 4KAXB 4H8SA 2Y8GA 2D9WA 4A6FB 4B6HA 2VKIA 1FOEA 2K2JA 2MKRA 1M7RA 4P7IA 4XWXA 2UZSA 1X1FA 1P3RA 4A6HA 1Y5OA 2DHJA 3PSCA 4YL8A 2LYDA 3U8ZA 2JP2A 1V5UA 3PG7A 2L2IA 4A6FA 1B55A 4DXAB 3KZ1A 1H4RA 2Z0QA 2D9VA 3A8QA 2N0YA 2YS1A 1MK7B 2YT0A 2E2XA 1BWNA 3GYOA 1W1GA 4GZUA 3D8DA 3QIJA 2VSZA 2XQNM 2COAA 1P6SA 1FB8A 2CRFA 4F7GA 5EFXA 2J59M 4PQ0A 1BTNA 4IFSA 4A5KA 4HAUB 2DLWA 4HAVB 1W1HA 1SGHA 5KCVA
chains in the Genus database with same CATH superfamily
2KIEA 3TVVA 3D8EA 3CXBB 2HTHB 1OY2A 5CLLB 1DDWA 5DI9B 3QWMA 4EJNA 1XX0A 3NW8A 4DIXA 2AEHA 3ODOA 1OMWA 2YF0A 1PLSA 1DROA 3DXDA 3RCPA 2LULA 2W2XD 4HAXB 1MPHA 2ELBA 1U5GA 2Y8FA 4NSWA 1W1DA 4GPTB 2CY5A 3PVLA 2QKLA 2CODA 1WJ1A 1V5PA 1RJ2A 2GS0A 3UZTA 2ROVA 3HW2B 1FHOA 2RLOA 3PVUA 4MK0A 4D0NB 2P0DA 1EAZA 4IOYX 2D9YA 1GC7A 2I5CA 5D3VA 3IVFA 1U2BA 5DH9B 1K5GB 1IRSA 2H7EA 1WI1A 1J0WA 3SNHA 2COCA 5DHFB 2K49A 2YVCA 2K8EA 2Z4DA 3U12A 1BTKA 2MWNB 5LONB 1NI2A 2DHIA 1U5FA 2D9XA 1MKEA 2DKQA 2OQBA 1ZC3B 1V61A 3KY9A 5D27A 1ZYIA 1X11A 4CYEA 2FJUB 2KUQA 1UPQA 5M4YB 4HSIA 2J0KA 1XODA 4HHVA 2DYNA 3B77A 3TCAA 4CHJA 1V88A 1U27A 1GG3A 1WGQA 3ODXA 2YT2A 1V5MA 1PFJA 2CY4A 2LG1A 1LB1A 4BBKA 1EGXA 3LJUX 4ZRIA 2L1CA 5JHHA 2EC1A 1X05A 5JHGA 1NTYA 1XD4A 1KZ7A 3SO6A 4F7HA 3VIAA 1FHWA 2IYBA 4MT7A 2ZKMX 3VOQA 1XCGA 2GCJA 3FM8C 1NU2A 1UNRA 4GN1A 3MPXA 1V89A 2D10A 3X23A 3DXCA 4HATB 3BINA 1TQZA 2I5FA 5C79A 2D4QA 3WYFB 3ULBA 2R0DA 2W2XC 4Z2NA 1DDMA 4WVFB 1I2HA 1XKEA 4PNKA 3P6AA 4K81A 2KGXB 2RSGA 2Y7BA 2X18A 3P7ZA 4A6KA 4K2PA 2AL6A 5HE1A 1WVHA 3G9WA 2Q13A 2M38A 1K5DB 2QKMA 2D2QA 1Y19B 2RGNB 4HAWB 3PZDA 1N3HA 3PP2A 2W2WA 5KQ1A 2G35A 2KUPA 1ZVRA 3NWAA 2I1JA 1J19A 3CIKA 5HE0A 4HAYB 3NSUA 3F5RA 2I1KA 1XR0B 2J0JA 3TFMA 3V5WA 2Z59A 4DBBA 2HE7A 1DDVA 3ULCA 4GOUA 5D3XA 4MY6A 2DKPA 2KCJA 2UVMA 2V76A 3A58A 1MIZB 2EMSA 3FSSA 2NBVA 3QBVB 2LKOA 3HK0A 1WJMA 1RRPB 4L6EA 4KHBB 3M1IB 4OSNA 3OHMB 3HIEA 4C0AA 1FHXA 1MK9B 4K2OA 4TYZA 4HB3B 4Y94A 3TW1A 1GC6A 2FJLA 2D9ZA 1UNPA 5I2SA 1MI1A 1DBHA 4QXAB 5D3YA 1BAKA 2R09A 3DCXA 1TXDA 2ROZB 3AU5A 4KHBA 5FI0A 4DX8A 2YS3A 5J3TA 1QQGA 1UEFA 1FGYA 5JLJB 3OANA 4F7UP 1TJ6A 2OTXA 3ZVRA 1KZGA 1T77A 2ELAA 2RVBB 2KIGA 2YS5A 4KVGB 2RNRB 3N7CA 1EVHA 4EMOA 4WJ7A 2GUMA 2DTCA 4Z2MB 3GYPA 4L1RA 4NY0A 4GXBA 3A98B 4HB4B 5FI1A 2COFA 2K2UA 5LG4B 2DX5A 3ODWA 2LOXA 5D3WA 2P8VA 3AJ4A 4ZRJA 3F0WA 5L81A 2CAYA 1WGUA 5KQ4A 3FEHA 1P5TA 2P0HA 2KR0A 3NWFA 1AWEA 2DYQA 4GNKB 3FVCA 4TKNA 4QJ5B 4HAZB 4K17A 3NWDA 2R2YA 2ADZA 2VRWB 5C5BB 3HQCA 3TO1A 2GJYA 3SUZA 2MFQA 4HB2B 2EJ8A 4OT1A 1QC6A 1AQCA 2NZ8B 1ZM0A 2Z0PA 3PVWA 4KHOA 2YSZA 2DX1A 2D11A 2Z13A 2GCLA 1E5WA 3AU4A 2J0MA 2N23A 3U7DA 5C5BA 3HSAA 4GMXB 3ML4A 2LOZA 1PMSA 5J3YA 3SYXA 4IAPA 2NMBA 1UNQA 1U5DA 2MDXA 3A8PA 1UPRA 2EMTA 5CLQB 1ZC4B 1I7AA 5DHAB 5C16A 3D8FA 1EF1A 2IFSA 3SV1A 5IRSA 1DYNA 1MIXA 2K00A 2DHKA 3PEGA 3DXEA 1SHCA 2RUKB 3KSYA 1ISNA 1KI1B 1OQNA 1Q67A 2DA0A 1U5EA 4EKUA 4CHMA 5LOPB 1M7EA 3KRWA 5J3QA 1H10A 2DFKA 4HB0B 4GMVA 1ZSQA 3WA0A 5GOWB 2DN6A 2H7DA 4DX90 5DIFB 2P0FA 4HDQA 1U29A 1X1GA 4ZRKA 1Z87A 4WSFA 1X86A 2ZPYA 2M14A 3KRXA 3O96A 1FAOA 3ZDTA 2BCJA 3BJIA 5C6RA 3MDBC 2YT1A 1WG7A 5HE2A 1MAIA 4QJ4B 2YRYA 2Z0OA 2RRFA 3T06A 4KHAA 2PZ1A 5HE3A 1NTVA 2UZRA 1FGZA 5JP4A 4YONA 4HDOA 1LW3A 4KAXB 4H8SA 2Y8GA 2D9WA 4A6FB 4B6HA 2VKIA 4CSQA 1FOEA 2K2JA 2MKRA 2Z14A 1M7RA 4P7IA 4XWXA 2UZSA 1X1FA 1P3RA 4A6HA 5I2MA 1Y5OA 2DHJA 3PSCA 4YL8A 2LYDA 3U8ZA 2JP2A 1V5UA 3PG7A 2L2IA 4A6FA 1B55A 4DXAB 3KZ1A 1H4RA 2Z0QA 2D9VA 3A8QA 2N0YA 2YS1A 1MK7B 2YT0A 2E2XA 1BWNA 3GYOA 1W1GA 4GZUA 3D8DA 3QIJA 2VSZA 2XQNM 2COAA 1P6SA 1FB8A 2CRFA 4QJ3B 4F7GA 5EFXA 2J59M 4PQ0A 1BTNA 4D6WA 4IFSA 4A5KA 4HAUB 2DLWA 4HAVB 1W1HA 1SGHA 5KCVA
chains in the Genus database with same CATH topology
3TVVA 3D8EA 3CXBB 2HTHB 1OY2A 5CLLB 1DDWA 5DI9B 3QWMA 4EJNA 1XX0A 2AEHA 3ODOA 1OMWA 2YF0A 1PLSA 1DROA 3DXDA 3RCPA 2LULA 2W2XD 4HAXB 1MPHA 2ELBA 1U5GA 2Y8FA 4NSWA 1W1DA 4GPTB 2CY5A 3PVLA 2QKLA 2CODA 1WJ1A 1V5PA 1RJ2A 2GS0A 3UZTA 2ROVA 3HW2B 1FHOA 2RLOA 3PVUA 4MK0A 4D0NB 2P0DA 1EAZA 4IOYX 2D9YA 1GC7A 2I5CA 5D3VA 3IVFA 1U2BA 5DH9B 1K5GB 1IRSA 2H7EA 1WI1A 1J0WA 3SNHA 2COCA 5DHFB 2YVCA 1BTKA 2MWNB 5LONB 1NI2A 2DHIA 1U5FA 2D9XA 1MKEA 2DKQA 2OQBA 1ZC3B 1V61A 3KY9A 5D27A 1X11A 4CYEA 1UPQA 2J0KA 1XODA 4HHVA 2DYNA 3TCAA 4CHJA 1V88A 1U27A 1GG3A 1WGQA 3ODXA 1V5MA 1PFJA 2CY4A 2LG1A 1LB1A 4BBKA 1EGXA 3LJUX 4ZRIA 2L1CA 5JHHA 2EC1A 1X05A 5JHGA 1NTYA 1XD4A 1KZ7A 3SO6A 4F7HA 3VIAA 1FHWA 2IYBA 4MT7A 3VOQA 1XCGA 2GCJA 3FM8C 1NU2A 1UNRA 4GN1A 3MPXA 1V89A 2D10A 3X23A 3DXCA 4HATB 3BINA 1TQZA 2I5FA 5C79A 2D4QA 3WYFB 3ULBA 2R0DA 2W2XC 4Z2NA 1DDMA 4WVFB 1I2HA 1XKEA 4PNKA 3P6AA 4K81A 2KGXB 2RSGA 2Y7BA 2X18A 3P7ZA 4A6KA 4K2PA 2AL6A 5HE1A 1WVHA 3G9WA 2Q13A 2M38A 1K5DB 2QKMA 2D2QA 1Y19B 2RGNB 4HAWB 3PZDA 1N3HA 3PP2A 2W2WA 5KQ1A 2G35A 2KUPA 1ZVRA 2I1JA 1J19A 3CIKA 5HE0A 4HAYB 3NSUA 3F5RA 2I1KA 1XR0B 2J0JA 3TFMA 3V5WA 4DBBA 2HE7A 1DDVA 3ULCA 5D3XA 4MY6A 2DKPA 2KCJA 2UVMA 2V76A 1MIZB 2EMSA 3FSSA 3QBVB 2LKOA 3HK0A 1WJMA 1RRPB 4L6EA 4KHBB 3M1IB 4C0AA 1FHXA 1MK9B 4K2OA 4TYZA 4HB3B 4Y94A 3TW1A 1GC6A 2FJLA 2D9ZA 1UNPA 1DBHA 5D3YA 1BAKA 2R09A 1TXDA 2ROZB 3AU5A 5FI0A 4DX8A 2YS3A 5J3TA 1QQGA 1UEFA 1FGYA 5JLJB 3OANA 4F7UP 1TJ6A 2OTXA 3ZVRA 1KZGA 2ELAA 2RVBB 2YS5A 4KVGB 2RNRB 3N7CA 1EVHA 4EMOA 4WJ7A 2DTCA 4Z2MB 3GYPA 4NY0A 4GXBA 3A98B 4HB4B 5FI1A 2COFA 2K2UA 2DX5A 3ODWA 2LOXA 5D3WA 2P8VA 3AJ4A 4ZRJA 3F0WA 5L81A 2CAYA 1WGUA 5KQ4A 3FEHA 1P5TA 2P0HA 1AWEA 2DYQA 4TKNA 4HAZB 4K17A 2ADZA 2VRWB 5C5BB 3HQCA 3TO1A 2GJYA 3SUZA 2MFQA 4HB2B 2EJ8A 1QC6A 1AQCA 2NZ8B 1ZM0A 2Z0PA 3PVWA 4KHOA 2YSZA 2DX1A 2D11A 2GCLA 1E5WA 3AU4A 2J0MA 2N23A 3U7DA 5C5BA 4GMXB 3ML4A 2LOZA 1PMSA 5J3YA 3SYXA 4IAPA 2NMBA 1UNQA 1U5DA 2MDXA 3A8PA 1UPRA 2EMTA 5CLQB 1ZC4B 1I7AA 5DHAB 5C16A 3D8FA 1EF1A 2IFSA 3SV1A 1DYNA 1MIXA 2K00A 2DHKA 3PEGA 3DXEA 1SHCA 2RUKB 3KSYA 1ISNA 1KI1B 1OQNA 1Q67A 2DA0A 1U5EA 4EKUA 4CHMA 5LOPB 1M7EA 3KRWA 5J3QA 1H10A 2DFKA 4HB0B 4GMVA 1ZSQA 3WA0A 5GOWB 2DN6A 2H7DA 4DX90 5DIFB 2P0FA 4HDQA 1U29A 1X1GA 4ZRKA 1Z87A 4WSFA 1X86A 2ZPYA 2M14A 3KRXA 3O96A 1FAOA 3ZDTA 2BCJA 3BJIA 5C6RA 3MDBC 2YT1A 1WG7A 5HE2A 1MAIA 2YRYA 2Z0OA 3T06A 4KHAA 2PZ1A 5HE3A 1NTVA 2UZRA 1FGZA 5JP4A 4YONA 4HDOA 1LW3A 4KAXB 4H8SA 2Y8GA 2D9WA 4A6FB 4B6HA 2VKIA 1FOEA 2K2JA 2MKRA 1M7RA 4P7IA 4XWXA 2UZSA 1X1FA 1P3RA 4A6HA 1Y5OA 2DHJA 3PSCA 4YL8A 2LYDA 3U8ZA 2JP2A 1V5UA 3PG7A 2L2IA 4A6FA 1B55A 4DXAB 3KZ1A 1H4RA 2Z0QA 2D9VA 3A8QA 2N0YA 2YS1A 1MK7B 2YT0A 2E2XA 1BWNA 3GYOA 1W1GA 4GZUA 3D8DA 3QIJA 2VSZA 2XQNM 2COAA 1P6SA 1FB8A 2CRFA 4F7GA 5EFXA 2J59M 4PQ0A 1BTNA 4IFSA 4A5KA 4HAUB 2DLWA 4HAVB 1W1HA 1SGHA 5KCVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TVV A;  3D8E A;  3CXB B;  2HTH B;  1OY2 A;  5CLL B;  1DDW A;  5DI9 B;  3QWM A;  4EJN A;  1XX0 A;  2AEH A;  3ODO A;  1OMW A;  2YF0 A;  1PLS A;  1DRO A;  3DXD A;  3RCP A;  2LUL A;  2W2X D;  4HAX B;  1MPH A;  2ELB A;  1U5G A;  2Y8F A;  4NSW A;  1W1D A;  4GPT B;  2CY5 A;  3PVL A;  2QKL A;  2COD A;  1WJ1 A;  1V5P A;  1RJ2 A;  2GS0 A;  3UZT A;  2ROV A;  3HW2 B;  1FHO A;  2RLO A;  3PVU A;  4MK0 A;  4D0N B;  2P0D A;  1EAZ A;  4IOY X;  2D9Y A;  1GC7 A;  2I5C A;  5D3V A;  3IVF A;  1U2B A;  5DH9 B;  1K5G B;  1IRS A;  2H7E A;  1WI1 A;  1J0W A;  3SNH A;  2COC A;  5DHF B;  2YVC A;  1BTK A;  2MWN B;  5LON B;  1NI2 A;  2DHI A;  1U5F A;  2D9X A;  1MKE A;  2DKQ A;  2OQB A;  1ZC3 B;  1V61 A;  3KY9 A;  5D27 A;  1X11 A;  4CYE A;  1UPQ A;  2J0K A;  1XOD A;  4HHV A;  2DYN A;  3TCA A;  4CHJ A;  1V88 A;  1U27 A;  1GG3 A;  1WGQ A;  3ODX A;  1V5M A;  1PFJ A;  2CY4 A;  2LG1 A;  1LB1 A;  4BBK A;  1EGX A;  3LJU X;  4ZRI A;  2L1C A;  5JHH A;  2EC1 A;  1X05 A;  5JHG A;  1NTY A;  1XD4 A;  1KZ7 A;  3SO6 A;  4F7H A;  3VIA A;  1FHW A;  2IYB A;  4MT7 A;  3VOQ A;  1XCG A;  2GCJ A;  3FM8 C;  1NU2 A;  1UNR A;  4GN1 A;  3MPX A;  1V89 A;  2D10 A;  3X23 A;  3DXC A;  4HAT B;  3BIN A;  1TQZ A;  2I5F A;  5C79 A;  2D4Q A;  3WYF B;  3ULB A;  2R0D A;  2W2X C;  4Z2N A;  1DDM A;  4WVF B;  1I2H A;  1XKE A;  4PNK A;  3P6A A;  4K81 A;  2KGX B;  2RSG A;  2Y7B A;  2X18 A;  3P7Z A;  4A6K A;  4K2P A;  2AL6 A;  5HE1 A;  1WVH A;  3G9W A;  2Q13 A;  2M38 A;  1K5D B;  2QKM A;  2D2Q A;  1Y19 B;  2RGN B;  4HAW B;  3PZD A;  1N3H A;  3PP2 A;  2W2W A;  5KQ1 A;  2G35 A;  2KUP A;  1ZVR A;  2I1J A;  1J19 A;  3CIK A;  5HE0 A;  4HAY B;  3NSU A;  3F5R A;  2I1K A;  1XR0 B;  2J0J A;  3TFM A;  3V5W A;  4DBB A;  2HE7 A;  1DDV A;  3ULC A;  5D3X A;  4MY6 A;  2DKP A;  2KCJ A;  2UVM A;  2V76 A;  1MIZ B;  2EMS A;  3FSS A;  3QBV B;  2LKO A;  3HK0 A;  1WJM A;  1RRP B;  4L6E A;  4KHB B;  3M1I B;  4C0A A;  1FHX A;  1MK9 B;  4K2O A;  4TYZ A;  4HB3 B;  4Y94 A;  3TW1 A;  1GC6 A;  2FJL A;  2D9Z A;  1UNP A;  1DBH A;  5D3Y A;  1BAK A;  2R09 A;  1TXD A;  2ROZ B;  3AU5 A;  5FI0 A;  4DX8 A;  2YS3 A;  5J3T A;  1QQG A;  1UEF A;  1FGY A;  5JLJ B;  3OAN A;  4F7U P;  1TJ6 A;  2OTX A;  3ZVR A;  1KZG A;  2ELA A;  2RVB B;  2YS5 A;  4KVG B;  2RNR B;  3N7C A;  1EVH A;  4EMO A;  4WJ7 A;  2DTC A;  4Z2M B;  3GYP A;  4NY0 A;  4GXB A;  3A98 B;  4HB4 B;  5FI1 A;  2COF A;  2K2U A;  2DX5 A;  3ODW A;  2LOX A;  5D3W A;  2P8V A;  3AJ4 A;  4ZRJ A;  3F0W A;  5L81 A;  2CAY A;  1WGU A;  5KQ4 A;  3FEH A;  1P5T A;  2P0H A;  1AWE A;  2DYQ A;  4TKN A;  4HAZ B;  4K17 A;  2ADZ A;  2VRW B;  5C5B B;  3HQC A;  3TO1 A;  2GJY A;  3SUZ A;  2MFQ A;  4HB2 B;  2EJ8 A;  1QC6 A;  1AQC A;  2NZ8 B;  1ZM0 A;  2Z0P A;  3PVW A;  4KHO A;  2YSZ A;  2DX1 A;  2D11 A;  2GCL A;  1E5W A;  3AU4 A;  2J0M A;  2N23 A;  3U7D A;  5C5B A;  4GMX B;  3ML4 A;  2LOZ A;  1PMS A;  5J3Y A;  3SYX A;  4IAP A;  2NMB A;  1UNQ A;  1U5D A;  2MDX A;  3A8P A;  1UPR A;  2EMT A;  5CLQ B;  1ZC4 B;  1I7A A;  5DHA B;  5C16 A;  3D8F A;  1EF1 A;  2IFS A;  3SV1 A;  1DYN A;  1MIX A;  2K00 A;  2DHK A;  3PEG A;  3DXE A;  1SHC A;  2RUK B;  3KSY A;  1ISN A;  1KI1 B;  1OQN A;  1Q67 A;  2DA0 A;  1U5E A;  4EKU A;  4CHM A;  5LOP B;  1M7E A;  3KRW A;  5J3Q A;  1H10 A;  2DFK A;  4HB0 B;  4GMV A;  1ZSQ A;  3WA0 A;  5GOW B;  2DN6 A;  2H7D A;  4DX9 0;  5DIF B;  2P0F A;  4HDQ A;  1U29 A;  1X1G A;  4ZRK A;  1Z87 A;  4WSF A;  1X86 A;  2ZPY A;  2M14 A;  3KRX A;  3O96 A;  1FAO A;  3ZDT A;  2BCJ A;  3BJI A;  5C6R A;  3MDB C;  2YT1 A;  1WG7 A;  5HE2 A;  1MAI A;  2YRY A;  2Z0O A;  3T06 A;  4KHA A;  2PZ1 A;  5HE3 A;  1NTV A;  2UZR A;  1FGZ A;  5JP4 A;  4YON A;  4HDO A;  1LW3 A;  4KAX B;  4H8S A;  2Y8G A;  2D9W A;  4A6F B;  4B6H A;  2VKI A;  1FOE A;  2K2J A;  2MKR A;  1M7R A;  4P7I A;  4XWX A;  2UZS A;  1X1F A;  1P3R A;  4A6H A;  1Y5O A;  2DHJ A;  3PSC A;  4YL8 A;  2LYD A;  3U8Z A;  2JP2 A;  1V5U A;  3PG7 A;  2L2I A;  4A6F A;  1B55 A;  4DXA B;  3KZ1 A;  1H4R A;  2Z0Q A;  2D9V A;  3A8Q A;  2N0Y A;  2YS1 A;  1MK7 B;  2YT0 A;  2E2X A;  1BWN A;  3GYO A;  1W1G A;  4GZU A;  3D8D A;  3QIJ A;  2VSZ A;  2XQN M;  2COA A;  1P6S A;  1FB8 A;  2CRF A;  4F7G A;  5EFX A;  2J59 M;  4PQ0 A;  1BTN A;  4IFS A;  4A5K A;  4HAU B;  2DLW A;  4HAV B;  1W1H A;  1SGH A;  5KCV A; 
#chains in the Genus database with same CATH topology
 2KIE A;  3TVV A;  3D8E A;  3CXB B;  2HTH B;  1OY2 A;  5CLL B;  1DDW A;  5DI9 B;  3QWM A;  4EJN A;  1XX0 A;  3NW8 A;  4DIX A;  2AEH A;  3ODO A;  1OMW A;  2YF0 A;  1PLS A;  1DRO A;  3DXD A;  3RCP A;  2LUL A;  2W2X D;  4HAX B;  1MPH A;  2ELB A;  1U5G A;  2Y8F A;  4NSW A;  1W1D A;  4GPT B;  2CY5 A;  3PVL A;  2QKL A;  2COD A;  1WJ1 A;  1V5P A;  1RJ2 A;  2GS0 A;  3UZT A;  2ROV A;  3HW2 B;  1FHO A;  2RLO A;  3PVU A;  4MK0 A;  4D0N B;  2P0D A;  1EAZ A;  4IOY X;  2D9Y A;  1GC7 A;  2I5C A;  5D3V A;  3IVF A;  1U2B A;  5DH9 B;  1K5G B;  1IRS A;  2H7E A;  1WI1 A;  1J0W A;  3SNH A;  2COC A;  5DHF B;  2K49 A;  2YVC A;  2K8E A;  2Z4D A;  3U12 A;  1BTK A;  2MWN B;  5LON B;  1NI2 A;  2DHI A;  1U5F A;  2D9X A;  1MKE A;  2DKQ A;  2OQB A;  1ZC3 B;  1V61 A;  3KY9 A;  5D27 A;  1ZYI A;  1X11 A;  4CYE A;  2FJU B;  2KUQ A;  1UPQ A;  5M4Y B;  4HSI A;  2J0K A;  1XOD A;  4HHV A;  2DYN A;  3B77 A;  3TCA A;  4CHJ A;  1V88 A;  1U27 A;  1GG3 A;  1WGQ A;  3ODX A;  2YT2 A;  1V5M A;  1PFJ A;  2CY4 A;  2LG1 A;  1LB1 A;  4BBK A;  1EGX A;  3LJU X;  4ZRI A;  2L1C A;  5JHH A;  2EC1 A;  1X05 A;  5JHG A;  1NTY A;  1XD4 A;  1KZ7 A;  3SO6 A;  4F7H A;  3VIA A;  1FHW A;  2IYB A;  4MT7 A;  2ZKM X;  3VOQ A;  1XCG A;  2GCJ A;  3FM8 C;  1NU2 A;  1UNR A;  4GN1 A;  3MPX A;  1V89 A;  2D10 A;  3X23 A;  3DXC A;  4HAT B;  3BIN A;  1TQZ A;  2I5F A;  5C79 A;  2D4Q A;  3WYF B;  3ULB A;  2R0D A;  2W2X C;  4Z2N A;  1DDM A;  4WVF B;  1I2H A;  1XKE A;  4PNK A;  3P6A A;  4K81 A;  2KGX B;  2RSG A;  2Y7B A;  2X18 A;  3P7Z A;  4A6K A;  4K2P A;  2AL6 A;  5HE1 A;  1WVH A;  3G9W A;  2Q13 A;  2M38 A;  1K5D B;  2QKM A;  2D2Q A;  1Y19 B;  2RGN B;  4HAW B;  3PZD A;  1N3H A;  3PP2 A;  2W2W A;  5KQ1 A;  2G35 A;  2KUP A;  1ZVR A;  3NWA A;  2I1J A;  1J19 A;  3CIK A;  5HE0 A;  4HAY B;  3NSU A;  3F5R A;  2I1K A;  1XR0 B;  2J0J A;  3TFM A;  3V5W A;  2Z59 A;  4DBB A;  2HE7 A;  1DDV A;  3ULC A;  4GOU A;  5D3X A;  4MY6 A;  2DKP A;  2KCJ A;  2UVM A;  2V76 A;  3A58 A;  1MIZ B;  2EMS A;  3FSS A;  2NBV A;  3QBV B;  2LKO A;  3HK0 A;  1WJM A;  1RRP B;  4L6E A;  4KHB B;  3M1I B;  4OSN A;  3OHM B;  3HIE A;  4C0A A;  1FHX A;  1MK9 B;  4K2O A;  4TYZ A;  4HB3 B;  4Y94 A;  3TW1 A;  1GC6 A;  2FJL A;  2D9Z A;  1UNP A;  5I2S A;  1MI1 A;  1DBH A;  4QXA B;  5D3Y A;  1BAK A;  2R09 A;  3DCX A;  1TXD A;  2ROZ B;  3AU5 A;  4KHB A;  5FI0 A;  4DX8 A;  2YS3 A;  5J3T A;  1QQG A;  1UEF A;  1FGY A;  5JLJ B;  3OAN A;  4F7U P;  1TJ6 A;  2OTX A;  3ZVR A;  1KZG A;  1T77 A;  2ELA A;  2RVB B;  2KIG A;  2YS5 A;  4KVG B;  2RNR B;  3N7C A;  1EVH A;  4EMO A;  4WJ7 A;  2GUM A;  2DTC A;  4Z2M B;  3GYP A;  4L1R A;  4NY0 A;  4GXB A;  3A98 B;  4HB4 B;  5FI1 A;  2COF A;  2K2U A;  5LG4 B;  2DX5 A;  3ODW A;  2LOX A;  5D3W A;  2P8V A;  3AJ4 A;  4ZRJ A;  3F0W A;  5L81 A;  2CAY A;  1WGU A;  5KQ4 A;  3FEH A;  1P5T A;  2P0H A;  2KR0 A;  3NWF A;  1AWE A;  2DYQ A;  4GNK B;  3FVC A;  4TKN A;  4QJ5 B;  4HAZ B;  4K17 A;  3NWD A;  2R2Y A;  2ADZ A;  2VRW B;  5C5B B;  3HQC A;  3TO1 A;  2GJY A;  3SUZ A;  2MFQ A;  4HB2 B;  2EJ8 A;  4OT1 A;  1QC6 A;  1AQC A;  2NZ8 B;  1ZM0 A;  2Z0P A;  3PVW A;  4KHO A;  2YSZ A;  2DX1 A;  2D11 A;  2Z13 A;  2GCL A;  1E5W A;  3AU4 A;  2J0M A;  2N23 A;  3U7D A;  5C5B A;  3HSA A;  4GMX B;  3ML4 A;  2LOZ A;  1PMS A;  5J3Y A;  3SYX A;  4IAP A;  2NMB A;  1UNQ A;  1U5D A;  2MDX A;  3A8P A;  1UPR A;  2EMT A;  5CLQ B;  1ZC4 B;  1I7A A;  5DHA B;  5C16 A;  3D8F A;  1EF1 A;  2IFS A;  3SV1 A;  5IRS A;  1DYN A;  1MIX A;  2K00 A;  2DHK A;  3PEG A;  3DXE A;  1SHC A;  2RUK B;  3KSY A;  1ISN A;  1KI1 B;  1OQN A;  1Q67 A;  2DA0 A;  1U5E A;  4EKU A;  4CHM A;  5LOP B;  1M7E A;  3KRW A;  5J3Q A;  1H10 A;  2DFK A;  4HB0 B;  4GMV A;  1ZSQ A;  3WA0 A;  5GOW B;  2DN6 A;  2H7D A;  4DX9 0;  5DIF B;  2P0F A;  4HDQ A;  1U29 A;  1X1G A;  4ZRK A;  1Z87 A;  4WSF A;  1X86 A;  2ZPY A;  2M14 A;  3KRX A;  3O96 A;  1FAO A;  3ZDT A;  2BCJ A;  3BJI A;  5C6R A;  3MDB C;  2YT1 A;  1WG7 A;  5HE2 A;  1MAI A;  4QJ4 B;  2YRY A;  2Z0O A;  2RRF A;  3T06 A;  4KHA A;  2PZ1 A;  5HE3 A;  1NTV A;  2UZR A;  1FGZ A;  5JP4 A;  4YON A;  4HDO A;  1LW3 A;  4KAX B;  4H8S A;  2Y8G A;  2D9W A;  4A6F B;  4B6H A;  2VKI A;  4CSQ A;  1FOE A;  2K2J A;  2MKR A;  2Z14 A;  1M7R A;  4P7I A;  4XWX A;  2UZS A;  1X1F A;  1P3R A;  4A6H A;  5I2M A;  1Y5O A;  2DHJ A;  3PSC A;  4YL8 A;  2LYD A;  3U8Z A;  2JP2 A;  1V5U A;  3PG7 A;  2L2I A;  4A6F A;  1B55 A;  4DXA B;  3KZ1 A;  1H4R A;  2Z0Q A;  2D9V A;  3A8Q A;  2N0Y A;  2YS1 A;  1MK7 B;  2YT0 A;  2E2X A;  1BWN A;  3GYO A;  1W1G A;  4GZU A;  3D8D A;  3QIJ A;  2VSZ A;  2XQN M;  2COA A;  1P6S A;  1FB8 A;  2CRF A;  4QJ3 B;  4F7G A;  5EFX A;  2J59 M;  4PQ0 A;  1BTN A;  4D6W A;  4IFS A;  4A5K A;  4HAU B;  2DLW A;  4HAV B;  1W1H A;  1SGH A;  5KCV A; 
#chains in the Genus database with same CATH homology
 3TVV A;  3D8E A;  3CXB B;  2HTH B;  1OY2 A;  5CLL B;  1DDW A;  5DI9 B;  3QWM A;  4EJN A;  1XX0 A;  2AEH A;  3ODO A;  1OMW A;  2YF0 A;  1PLS A;  1DRO A;  3DXD A;  3RCP A;  2LUL A;  2W2X D;  4HAX B;  1MPH A;  2ELB A;  1U5G A;  2Y8F A;  4NSW A;  1W1D A;  4GPT B;  2CY5 A;  3PVL A;  2QKL A;  2COD A;  1WJ1 A;  1V5P A;  1RJ2 A;  2GS0 A;  3UZT A;  2ROV A;  3HW2 B;  1FHO A;  2RLO A;  3PVU A;  4MK0 A;  4D0N B;  2P0D A;  1EAZ A;  4IOY X;  2D9Y A;  1GC7 A;  2I5C A;  5D3V A;  3IVF A;  1U2B A;  5DH9 B;  1K5G B;  1IRS A;  2H7E A;  1WI1 A;  1J0W A;  3SNH A;  2COC A;  5DHF B;  2YVC A;  1BTK A;  2MWN B;  5LON B;  1NI2 A;  2DHI A;  1U5F A;  2D9X A;  1MKE A;  2DKQ A;  2OQB A;  1ZC3 B;  1V61 A;  3KY9 A;  5D27 A;  1X11 A;  4CYE A;  1UPQ A;  2J0K A;  1XOD A;  4HHV A;  2DYN A;  3TCA A;  4CHJ A;  1V88 A;  1U27 A;  1GG3 A;  1WGQ A;  3ODX A;  1V5M A;  1PFJ A;  2CY4 A;  2LG1 A;  1LB1 A;  4BBK A;  1EGX A;  3LJU X;  4ZRI A;  2L1C A;  5JHH A;  2EC1 A;  1X05 A;  5JHG A;  1NTY A;  1XD4 A;  1KZ7 A;  3SO6 A;  4F7H A;  3VIA A;  1FHW A;  2IYB A;  4MT7 A;  3VOQ A;  1XCG A;  2GCJ A;  3FM8 C;  1NU2 A;  1UNR A;  4GN1 A;  3MPX A;  1V89 A;  2D10 A;  3X23 A;  3DXC A;  4HAT B;  3BIN A;  1TQZ A;  2I5F A;  5C79 A;  2D4Q A;  3WYF B;  3ULB A;  2R0D A;  2W2X C;  4Z2N A;  1DDM A;  4WVF B;  1I2H A;  1XKE A;  4PNK A;  3P6A A;  4K81 A;  2KGX B;  2RSG A;  2Y7B A;  2X18 A;  3P7Z A;  4A6K A;  4K2P A;  2AL6 A;  5HE1 A;  1WVH A;  3G9W A;  2Q13 A;  2M38 A;  1K5D B;  2QKM A;  2D2Q A;  1Y19 B;  2RGN B;  4HAW B;  3PZD A;  1N3H A;  3PP2 A;  2W2W A;  5KQ1 A;  2G35 A;  2KUP A;  1ZVR A;  2I1J A;  1J19 A;  3CIK A;  5HE0 A;  4HAY B;  3NSU A;  3F5R A;  2I1K A;  1XR0 B;  2J0J A;  3TFM A;  3V5W A;  4DBB A;  2HE7 A;  1DDV A;  3ULC A;  5D3X A;  4MY6 A;  2DKP A;  2KCJ A;  2UVM A;  2V76 A;  1MIZ B;  2EMS A;  3FSS A;  3QBV B;  2LKO A;  3HK0 A;  1WJM A;  1RRP B;  4L6E A;  4KHB B;  3M1I B;  4C0A A;  1FHX A;  1MK9 B;  4K2O A;  4TYZ A;  4HB3 B;  4Y94 A;  3TW1 A;  1GC6 A;  2FJL A;  2D9Z A;  1UNP A;  1DBH A;  5D3Y A;  1BAK A;  2R09 A;  1TXD A;  2ROZ B;  3AU5 A;  5FI0 A;  4DX8 A;  2YS3 A;  5J3T A;  1QQG A;  1UEF A;  1FGY A;  5JLJ B;  3OAN A;  4F7U P;  1TJ6 A;  2OTX A;  3ZVR A;  1KZG A;  2ELA A;  2RVB B;  2YS5 A;  4KVG B;  2RNR B;  3N7C A;  1EVH A;  4EMO A;  4WJ7 A;  2DTC A;  4Z2M B;  3GYP A;  4NY0 A;  4GXB A;  3A98 B;  4HB4 B;  5FI1 A;  2COF A;  2K2U A;  2DX5 A;  3ODW A;  2LOX A;  5D3W A;  2P8V A;  3AJ4 A;  4ZRJ A;  3F0W A;  5L81 A;  2CAY A;  1WGU A;  5KQ4 A;  3FEH A;  1P5T A;  2P0H A;  1AWE A;  2DYQ A;  4TKN A;  4HAZ B;  4K17 A;  2ADZ A;  2VRW B;  5C5B B;  3HQC A;  3TO1 A;  2GJY A;  3SUZ A;  2MFQ A;  4HB2 B;  2EJ8 A;  1QC6 A;  1AQC A;  2NZ8 B;  1ZM0 A;  2Z0P A;  3PVW A;  4KHO A;  2YSZ A;  2DX1 A;  2D11 A;  2GCL A;  1E5W A;  3AU4 A;  2J0M A;  2N23 A;  3U7D A;  5C5B A;  4GMX B;  3ML4 A;  2LOZ A;  1PMS A;  5J3Y A;  3SYX A;  4IAP A;  2NMB A;  1UNQ A;  1U5D A;  2MDX A;  3A8P A;  1UPR A;  2EMT A;  5CLQ B;  1ZC4 B;  1I7A A;  5DHA B;  5C16 A;  3D8F A;  1EF1 A;  2IFS A;  3SV1 A;  1DYN A;  1MIX A;  2K00 A;  2DHK A;  3PEG A;  3DXE A;  1SHC A;  2RUK B;  3KSY A;  1ISN A;  1KI1 B;  1OQN A;  1Q67 A;  2DA0 A;  1U5E A;  4EKU A;  4CHM A;  5LOP B;  1M7E A;  3KRW A;  5J3Q A;  1H10 A;  2DFK A;  4HB0 B;  4GMV A;  1ZSQ A;  3WA0 A;  5GOW B;  2DN6 A;  2H7D A;  4DX9 0;  5DIF B;  2P0F A;  4HDQ A;  1U29 A;  1X1G A;  4ZRK A;  1Z87 A;  4WSF A;  1X86 A;  2ZPY A;  2M14 A;  3KRX A;  3O96 A;  1FAO A;  3ZDT A;  2BCJ A;  3BJI A;  5C6R A;  3MDB C;  2YT1 A;  1WG7 A;  5HE2 A;  1MAI A;  2YRY A;  2Z0O A;  3T06 A;  4KHA A;  2PZ1 A;  5HE3 A;  1NTV A;  2UZR A;  1FGZ A;  5JP4 A;  4YON A;  4HDO A;  1LW3 A;  4KAX B;  4H8S A;  2Y8G A;  2D9W A;  4A6F B;  4B6H A;  2VKI A;  1FOE A;  2K2J A;  2MKR A;  1M7R A;  4P7I A;  4XWX A;  2UZS A;  1X1F A;  1P3R A;  4A6H A;  1Y5O A;  2DHJ A;  3PSC A;  4YL8 A;  2LYD A;  3U8Z A;  2JP2 A;  1V5U A;  3PG7 A;  2L2I A;  4A6F A;  1B55 A;  4DXA B;  3KZ1 A;  1H4R A;  2Z0Q A;  2D9V A;  3A8Q A;  2N0Y A;  2YS1 A;  1MK7 B;  2YT0 A;  2E2X A;  1BWN A;  3GYO A;  1W1G A;  4GZU A;  3D8D A;  3QIJ A;  2VSZ A;  2XQN M;  2COA A;  1P6S A;  1FB8 A;  2CRF A;  4F7G A;  5EFX A;  2J59 M;  4PQ0 A;  1BTN A;  4IFS A;  4A5K A;  4HAU B;  2DLW A;  4HAV B;  1W1H A;  1SGH A;  5KCV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...