4MY6A

Enah-evh1 in complex with peptidomimetic low-molecular weight inhibitor ac-[2-cl-f]-[prom-2]-[prom-1]-oh
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
110
structure length
110
Chain Sequence
b'SEQSICQARAAVMVYDDANKKWVPAGGSTGFSRVHIYHHTGNNTFRVVGRKIQDHQVVINCAIPKGLKYNQATQTFHQWRDARQVYGLNFGSKEDANVFASAMMHALEVL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein enabled homolog
publication title A modular toolkit to inhibit proline-rich motif-mediated protein-protein interactions.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion/inhibitor
total genus 26
structure length 110
sequence length 110
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-09-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00568 WH1 WH1 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 4my6A00
4HDOA 1P6SA 4HAUB 2DHIA 2LG1A 2M14A 4ZRKA 2COFA 4A6HA 1U27A 1X05A 4KAXB 3ZVRA 4HB2B 1FGYA 1FOEA 1PLSA 1H10A 2DHKA 2HTHB 4GMVA 2W2XD 3WA0A 1V5UA 2AL6A 4KVGB 1WGUA 4HB4B 4K81A 2LOZA 5HE2A 1UPQA 2DFKA 3AU5A 3X23A 4A6KA 4ZRIA 1OY2A 1WG7A 2J0KA 1EF1A 1BTNA 3U7DA 3N7CA 5DH9B 2D9ZA 4HB0B 1X1GA 4F7UP 4Z2MB 5KQ1A 4HAWB 3KZ1A 3P6AA 2LKOA 5D3WA 4K2OA 4PNKA 3GYOA 3UZTA 4MT7A 2YVCA 3D8FA 1EGXA 5C5BB 5DI9B 4CYEA 3FEHA 3PVLA 1ZC4B 4GXBA 3TFMA 2R09A 4A5KA 5L81A 2EC1A 2DHJA 4DX8A 1EVHA 2YSZA 4GPTB 2CODA 3LJUX 3A8PA 2Y8GA 1U5DA 5DIFB 1H4RA 3AU4A 3KY9A 4EKUA 2COCA 3SO6A 1SHCA 4DBBA 2QKLA 3NSUA 1K5GB 1XCGA 2P8VA 2RGNB 1QC6A 2DLWA 5JP4A 2RSGA 1GC6A 1WGQA 3ULBA 1J0WA 5JLJB 1RJ2A 1TQZA 4EMOA 1NU2A 3TVVA 1GG3A 4ZRJA 2VSZA 2ADZA 3AJ4A 4HAVB 3ODXA 2DN6A 2K00A 3ZDTA 4HAYB 1OQNA 1LW3A 3QIJA 1Q67A 2QKMA 3ML4A 1FHXA 1V89A 1DDVA 4KHOA 2N23A 4KHBB 2RNRB 3KRXA 1ZM0A 5JHGA 1P3RA 5FI1A 2VRWB 1X11A 1V88A 1XD4A 2KGXB 4MK0A 2COAA 4Z2NA 1PFJA 2YS3A 3ODOA 2N0YA 3BJIA 3F5RA 2GJYA 4IOYX 1ZSQA 5C16A 1MKEA 4TKNA 4GZUA 4HHVA 1UNPA 2D9VA 1IRSA 2AEHA 1QQGA 1V5PA 2ROVA 2IYBA 1U2BA 2J0MA 1Y5OA 2MWNB 3F0WA 4XWXA 1KZGA 4HB3B 2RVBB 2PZ1A 4L6EA 5D3VA 3IVFA 2G35A 4CHMA 1I2HA 2HE7A 4C0AA 3KRWA 4WJ7A 2P0DA 4EJNA 2CAYA 1U5EA 5KQ4A 1FHWA 1OMWA 1GC7A 1FAOA 1XODA 2YS5A 3SUZA 1X1FA 1XX0A 2ZPYA 2I1JA 4WVFB 4Y94A 5DHAB 5LOPB 2ELAA 1M7EA 3HW2B 3VOQA 2YT1A 2W2WA 1U5GA 3MDBC 4MY6A 1W1DA 5C5BA 2JP2A 3OANA 1FGZA 1P5TA 1TJ6A 1N3HA 2H7EA 1UNRA 5J3QA 1WI1A 1EAZA 1DDMA 1UEFA 4GMXB 3D8DA 1U29A 4K17A 5HE1A 2DKQA 3U8ZA 2MDXA 1SGHA 1UPRA 2D9XA 2Q13A 1B55A 4F7GA 4WSFA 2UZSA 2GCJA 1KZ7A 4A6FB 3WYFB 1V5MA 3O96A 5D3YA 5C79A 5JHHA 4HAXB 5FI0A 1U5FA 2W2XC 3FSSA 3FM8C 3CIKA 2Y7BA 4KHAA 1NI2A 1WJ1A 5HE3A 1FHOA 2KCJA 1E5WA 2M38A 1DROA 3D8EA 2DTCA 1MK9B 2YS1A 1AQCA 2ROZB 3M1IB 3ODWA 3HQCA 1BTKA 5EFXA 2DYQA 2EMSA 4HDQA 1ISNA 3T06A 5J3YA 1RRPB 2D2QA 3BINA 2D4QA 3TO1A 2Z0OA 3MPXA 3PZDA 2BCJA 2Z0QA 4IAPA 5KCVA 4IFSA 1NTYA 4B6HA 4D0NB 3V5WA 2FJLA 1Z87A 2K2JA 2RLOA 1K5DB 2K2UA 2DX1A 5LONB 2R0DA 1V61A 2CY4A 1MAIA 2YT0A 3DXCA 2J0JA 1TXDA 1XKEA 5DHFB 1XR0B 1W1GA 1J19A 4NY0A 1MPHA 1DDWA 2LOXA 5D3XA 1NTVA 3ULCA 3DXEA 3QBVB 2L2IA 1DBHA 1AWEA 2NZ8B 3SYXA 3PVWA 4HAZB 1PMSA 2VKIA 2P0HA 2YF0A 3GYPA 5D27A 1KI1B 2DA0A 4H8SA 1DYNA 2IFSA 2D11A 2Z0PA 1I7AA 3PG7A 1WVHA 2ELBA 2LYDA 5J3TA 1FB8A 1MIZB 2I5FA 3HK0A 3P7ZA 3TCAA 3CXBB 2CRFA 4TYZA 4P7IA 1BWNA 3PP2A 2D9WA 2KUPA 3G9WA 2E2XA 1MIXA 2RUKB 1WJMA 5HE0A 2I5CA 2I1KA 3QWMA 2DYNA 4F7HA 3TW1A 5C6RA 2J59M 3SV1A 2MFQA 2D9YA 2H7DA 2UVMA 3PEGA 2EJ8A 3PSCA 5GOWB 2CY5A 3A8QA 4PQ0A 4K2PA 2DX5A 3A98B 4CHJA 1M7RA 2YRYA 2DKPA 2XQNM 4A6FA 2Y8FA 2OTXA 5CLQB 3VIAA 3KSYA 2MKRA 4DXAB 2NMBA 4DX90 1X86A 3DXDA 5CLLB 3RCPA 1Y19B 4BBKA 2OQBA 1UNQA 4HATB 4YL8A 2D10A 3SNHA 2L1CA 2GCLA 1W1HA 2X18A 2UZRA 2P0FA 1ZC3B 4NSWA 1MK7B 2EMTA 1LB1A 1BAKA 3PVUA 1ZVRA 4YONA 2LULA 2V76A 4GN1A 2GS0A
chains in the Genus database with same CATH superfamily
4HDOA 3A58A 1P6SA 4HAUB 2DHIA 2LG1A 2M14A 4ZRKA 2COFA 4A6HA 2KUQA 1U27A 1X05A 3B77A 4KAXB 3ZVRA 4HB2B 1FGYA 1FOEA 4QJ3B 1PLSA 1H10A 2DHKA 2HTHB 4GMVA 2W2XD 3WA0A 1V5UA 2AL6A 4KVGB 1WGUA 4HB4B 4K81A 2LOZA 5HE2A 1UPQA 2DFKA 3AU5A 3X23A 3OHMB 4A6KA 4ZRIA 1OY2A 1WG7A 2J0KA 1EF1A 1BTNA 3U7DA 4HSIA 3N7CA 5DH9B 2D9ZA 4HB0B 1X1GA 4F7UP 4Z2MB 5KQ1A 4HAWB 3KZ1A 3P6AA 2LKOA 5D3WA 4K2OA 4PNKA 3GYOA 3UZTA 4MT7A 2YVCA 3D8FA 1EGXA 5C5BB 5DI9B 4CYEA 3FEHA 3PVLA 1ZC4B 4GXBA 3TFMA 2KR0A 2R09A 4A5KA 5L81A 2EC1A 2DHJA 1ZYIA 4DX8A 4GNKB 4QJ5B 2Z14A 2Z4DA 1EVHA 2YSZA 4GPTB 2CODA 3LJUX 3A8PA 2Y8GA 1U5DA 5DIFB 1H4RA 3AU4A 3KY9A 3HIEA 4EKUA 2COCA 3SO6A 1SHCA 4DBBA 2QKLA 2RRFA 3NSUA 1K5GB 1XCGA 4OSNA 2P8VA 2RGNB 1QC6A 2DLWA 5JP4A 2RSGA 1GC6A 1WGQA 3ULBA 1J0WA 5JLJB 1RJ2A 1TQZA 4EMOA 1NU2A 3TVVA 1GG3A 4ZRJA 2VSZA 2ADZA 3AJ4A 4HAVB 2R2YA 3ODXA 2DN6A 2K00A 3NWDA 3ZDTA 4HAYB 1OQNA 1LW3A 3QIJA 1Q67A 2QKMA 3ML4A 1FHXA 1V89A 1DDVA 4KHOA 2N23A 4KHBB 2RNRB 2NBVA 3KRXA 1ZM0A 5JHGA 1P3RA 5FI1A 2VRWB 1X11A 1V88A 1XD4A 2KGXB 4MK0A 2COAA 4Z2NA 4OT1A 1PFJA 2YS3A 3ODOA 2N0YA 3BJIA 3F5RA 2GJYA 4IOYX 1ZSQA 5C16A 1MKEA 4TKNA 4GZUA 4HHVA 1UNPA 2D9VA 1IRSA 2AEHA 1QQGA 1V5PA 2ROVA 2IYBA 1U2BA 2J0MA 1Y5OA 2MWNB 3F0WA 3FVCA 4XWXA 1KZGA 4HB3B 2RVBB 3NW8A 2PZ1A 4L6EA 5D3VA 3IVFA 2G35A 4CHMA 1I2HA 2HE7A 4C0AA 3KRWA 4WJ7A 2P0DA 3HSAA 4EJNA 2CAYA 1U5EA 5KQ4A 1FHWA 1OMWA 1GC7A 2KIGA 1FAOA 1XODA 2YS5A 3SUZA 1X1FA 1XX0A 2ZPYA 2I1JA 2K8EA 4WVFB 4Y94A 5DHAB 5LOPB 2ELAA 1M7EA 3HW2B 3VOQA 2YT1A 2W2WA 1U5GA 3MDBC 4MY6A 1T77A 1W1DA 5C5BA 2JP2A 3OANA 1FGZA 1P5TA 1TJ6A 1N3HA 2H7EA 1UNRA 5J3QA 1WI1A 1EAZA 2KIEA 1DDMA 1UEFA 4GMXB 3D8DA 1U29A 4K17A 5HE1A 3NWAA 2DKQA 3U8ZA 2MDXA 1SGHA 1UPRA 2D9XA 4GOUA 2Q13A 1B55A 4F7GA 4WSFA 2ZKMX 2UZSA 2GCJA 1KZ7A 4A6FB 3WYFB 1V5MA 3NWFA 3O96A 5D3YA 5C79A 5JHHA 4HAXB 5FI0A 1U5FA 2W2XC 3FSSA 3FM8C 3CIKA 2Y7BA 3U12A 4KHAA 1NI2A 1WJ1A 5HE3A 1FHOA 2KCJA 1E5WA 2M38A 1DROA 3D8EA 2DTCA 1MK9B 2YS1A 1AQCA 1MI1A 2ROZB 3M1IB 3ODWA 3HQCA 1BTKA 5EFXA 2DYQA 2EMSA 4HDQA 1ISNA 3T06A 5J3YA 1RRPB 2D2QA 3BINA 2D4QA 3TO1A 2Z0OA 3MPXA 3PZDA 2BCJA 2Z0QA 4IAPA 5KCVA 4IFSA 5IRSA 1NTYA 4B6HA 4D0NB 4KHBA 3V5WA 2FJLA 1Z87A 4QXAB 2K2JA 2RLOA 1K5DB 2K2UA 2DX1A 5LONB 2R0DA 1V61A 2CY4A 1MAIA 4QJ4B 2YT0A 3DXCA 2J0JA 3DCXA 1TXDA 1XKEA 5DHFB 1XR0B 1W1GA 1J19A 4NY0A 1MPHA 4CSQA 1DDWA 2LOXA 5D3XA 1NTVA 3ULCA 3DXEA 3QBVB 2L2IA 1DBHA 1AWEA 2FJUB 2NZ8B 5I2MA 3SYXA 3PVWA 2Z13A 2GUMA 4HAZB 1PMSA 2VKIA 2P0HA 2YF0A 3GYPA 5D27A 1KI1B 2DA0A 4H8SA 1DYNA 2IFSA 2D11A 4DIXA 2Z0PA 1I7AA 3PG7A 1WVHA 2ELBA 2LYDA 5J3TA 1FB8A 1MIZB 2I5FA 3HK0A 3P7ZA 3TCAA 3CXBB 2CRFA 4TYZA 4P7IA 5LG4B 1BWNA 3PP2A 2D9WA 5I2SA 2KUPA 4L1RA 2YT2A 3G9WA 2E2XA 1MIXA 2RUKB 1WJMA 5HE0A 2I5CA 2I1KA 3QWMA 5M4YB 4D6WA 2DYNA 4F7HA 3TW1A 5C6RA 2J59M 3SV1A 2MFQA 2D9YA 2H7DA 2UVMA 3PEGA 2EJ8A 3PSCA 5GOWB 2Z59A 2CY5A 3A8QA 4PQ0A 4K2PA 2DX5A 3A98B 4CHJA 1M7RA 2YRYA 2DKPA 2XQNM 4A6FA 2Y8FA 2OTXA 5CLQB 3VIAA 3KSYA 2MKRA 4DXAB 2NMBA 4DX90 1X86A 3DXDA 5CLLB 3RCPA 2K49A 1Y19B 4BBKA 2OQBA 1UNQA 4HATB 4YL8A 2D10A 3SNHA 2L1CA 2GCLA 1W1HA 2X18A 2UZRA 2P0FA 1ZC3B 4NSWA 1MK7B 2EMTA 1LB1A 1BAKA 3PVUA 1ZVRA 4YONA 2LULA 2V76A 4GN1A 2GS0A
chains in the Genus database with same CATH topology
4HDOA 1P6SA 4HAUB 2DHIA 2LG1A 2M14A 4ZRKA 2COFA 4A6HA 1U27A 1X05A 4KAXB 3ZVRA 4HB2B 1FGYA 1FOEA 1PLSA 1H10A 2DHKA 2HTHB 4GMVA 2W2XD 3WA0A 1V5UA 2AL6A 4KVGB 1WGUA 4HB4B 4K81A 2LOZA 5HE2A 1UPQA 2DFKA 3AU5A 3X23A 4A6KA 4ZRIA 1OY2A 1WG7A 2J0KA 1EF1A 1BTNA 3U7DA 3N7CA 5DH9B 2D9ZA 4HB0B 1X1GA 4F7UP 4Z2MB 5KQ1A 4HAWB 3KZ1A 3P6AA 2LKOA 5D3WA 4K2OA 4PNKA 3GYOA 3UZTA 4MT7A 2YVCA 3D8FA 1EGXA 5C5BB 5DI9B 4CYEA 3FEHA 3PVLA 1ZC4B 4GXBA 3TFMA 2R09A 4A5KA 5L81A 2EC1A 2DHJA 4DX8A 1EVHA 2YSZA 4GPTB 2CODA 3LJUX 3A8PA 2Y8GA 1U5DA 5DIFB 1H4RA 3AU4A 3KY9A 4EKUA 2COCA 3SO6A 1SHCA 4DBBA 2QKLA 3NSUA 1K5GB 1XCGA 2P8VA 2RGNB 1QC6A 2DLWA 5JP4A 2RSGA 1GC6A 1WGQA 3ULBA 1J0WA 5JLJB 1RJ2A 1TQZA 4EMOA 1NU2A 3TVVA 1GG3A 4ZRJA 2VSZA 2ADZA 3AJ4A 4HAVB 3ODXA 2DN6A 2K00A 3ZDTA 4HAYB 1OQNA 1LW3A 3QIJA 1Q67A 2QKMA 3ML4A 1FHXA 1V89A 1DDVA 4KHOA 2N23A 4KHBB 2RNRB 3KRXA 1ZM0A 5JHGA 1P3RA 5FI1A 2VRWB 1X11A 1V88A 1XD4A 2KGXB 4MK0A 2COAA 4Z2NA 1PFJA 2YS3A 3ODOA 2N0YA 3BJIA 3F5RA 2GJYA 4IOYX 1ZSQA 5C16A 1MKEA 4TKNA 4GZUA 4HHVA 1UNPA 2D9VA 1IRSA 2AEHA 1QQGA 1V5PA 2ROVA 2IYBA 1U2BA 2J0MA 1Y5OA 2MWNB 3F0WA 4XWXA 1KZGA 4HB3B 2RVBB 2PZ1A 4L6EA 5D3VA 3IVFA 2G35A 4CHMA 1I2HA 2HE7A 4C0AA 3KRWA 4WJ7A 2P0DA 4EJNA 2CAYA 1U5EA 5KQ4A 1FHWA 1OMWA 1GC7A 1FAOA 1XODA 2YS5A 3SUZA 1X1FA 1XX0A 2ZPYA 2I1JA 4WVFB 4Y94A 5DHAB 5LOPB 2ELAA 1M7EA 3HW2B 3VOQA 2YT1A 2W2WA 1U5GA 3MDBC 4MY6A 1W1DA 5C5BA 2JP2A 3OANA 1FGZA 1P5TA 1TJ6A 1N3HA 2H7EA 1UNRA 5J3QA 1WI1A 1EAZA 1DDMA 1UEFA 4GMXB 3D8DA 1U29A 4K17A 5HE1A 2DKQA 3U8ZA 2MDXA 1SGHA 1UPRA 2D9XA 2Q13A 1B55A 4F7GA 4WSFA 2UZSA 2GCJA 1KZ7A 4A6FB 3WYFB 1V5MA 3O96A 5D3YA 5C79A 5JHHA 4HAXB 5FI0A 1U5FA 2W2XC 3FSSA 3FM8C 3CIKA 2Y7BA 4KHAA 1NI2A 1WJ1A 5HE3A 1FHOA 2KCJA 1E5WA 2M38A 1DROA 3D8EA 2DTCA 1MK9B 2YS1A 1AQCA 2ROZB 3M1IB 3ODWA 3HQCA 1BTKA 5EFXA 2DYQA 2EMSA 4HDQA 1ISNA 3T06A 5J3YA 1RRPB 2D2QA 3BINA 2D4QA 3TO1A 2Z0OA 3MPXA 3PZDA 2BCJA 2Z0QA 4IAPA 5KCVA 4IFSA 1NTYA 4B6HA 4D0NB 3V5WA 2FJLA 1Z87A 2K2JA 2RLOA 1K5DB 2K2UA 2DX1A 5LONB 2R0DA 1V61A 2CY4A 1MAIA 2YT0A 3DXCA 2J0JA 1TXDA 1XKEA 5DHFB 1XR0B 1W1GA 1J19A 4NY0A 1MPHA 1DDWA 2LOXA 5D3XA 1NTVA 3ULCA 3DXEA 3QBVB 2L2IA 1DBHA 1AWEA 2NZ8B 3SYXA 3PVWA 4HAZB 1PMSA 2VKIA 2P0HA 2YF0A 3GYPA 5D27A 1KI1B 2DA0A 4H8SA 1DYNA 2IFSA 2D11A 2Z0PA 1I7AA 3PG7A 1WVHA 2ELBA 2LYDA 5J3TA 1FB8A 1MIZB 2I5FA 3HK0A 3P7ZA 3TCAA 3CXBB 2CRFA 4TYZA 4P7IA 1BWNA 3PP2A 2D9WA 2KUPA 3G9WA 2E2XA 1MIXA 2RUKB 1WJMA 5HE0A 2I5CA 2I1KA 3QWMA 2DYNA 4F7HA 3TW1A 5C6RA 2J59M 3SV1A 2MFQA 2D9YA 2H7DA 2UVMA 3PEGA 2EJ8A 3PSCA 5GOWB 2CY5A 3A8QA 4PQ0A 4K2PA 2DX5A 3A98B 4CHJA 1M7RA 2YRYA 2DKPA 2XQNM 4A6FA 2Y8FA 2OTXA 5CLQB 3VIAA 3KSYA 2MKRA 4DXAB 2NMBA 4DX90 1X86A 3DXDA 5CLLB 3RCPA 1Y19B 4BBKA 2OQBA 1UNQA 4HATB 4YL8A 2D10A 3SNHA 2L1CA 2GCLA 1W1HA 2X18A 2UZRA 2P0FA 1ZC3B 4NSWA 1MK7B 2EMTA 1LB1A 1BAKA 3PVUA 1ZVRA 4YONA 2LULA 2V76A 4GN1A 2GS0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HDO A;  1P6S A;  4HAU B;  2DHI A;  2LG1 A;  2M14 A;  4ZRK A;  2COF A;  4A6H A;  1U27 A;  1X05 A;  4KAX B;  3ZVR A;  4HB2 B;  1FGY A;  1FOE A;  1PLS A;  1H10 A;  2DHK A;  2HTH B;  4GMV A;  2W2X D;  3WA0 A;  1V5U A;  2AL6 A;  4KVG B;  1WGU A;  4HB4 B;  4K81 A;  2LOZ A;  5HE2 A;  1UPQ A;  2DFK A;  3AU5 A;  3X23 A;  4A6K A;  4ZRI A;  1OY2 A;  1WG7 A;  2J0K A;  1EF1 A;  1BTN A;  3U7D A;  3N7C A;  5DH9 B;  2D9Z A;  4HB0 B;  1X1G A;  4F7U P;  4Z2M B;  5KQ1 A;  4HAW B;  3KZ1 A;  3P6A A;  2LKO A;  5D3W A;  4K2O A;  4PNK A;  3GYO A;  3UZT A;  4MT7 A;  2YVC A;  3D8F A;  1EGX A;  5C5B B;  5DI9 B;  4CYE A;  3FEH A;  3PVL A;  1ZC4 B;  4GXB A;  3TFM A;  2R09 A;  4A5K A;  5L81 A;  2EC1 A;  2DHJ A;  4DX8 A;  1EVH A;  2YSZ A;  4GPT B;  2COD A;  3LJU X;  3A8P A;  2Y8G A;  1U5D A;  5DIF B;  1H4R A;  3AU4 A;  3KY9 A;  4EKU A;  2COC A;  3SO6 A;  1SHC A;  4DBB A;  2QKL A;  3NSU A;  1K5G B;  1XCG A;  2P8V A;  2RGN B;  1QC6 A;  2DLW A;  5JP4 A;  2RSG A;  1GC6 A;  1WGQ A;  3ULB A;  1J0W A;  5JLJ B;  1RJ2 A;  1TQZ A;  4EMO A;  1NU2 A;  3TVV A;  1GG3 A;  4ZRJ A;  2VSZ A;  2ADZ A;  3AJ4 A;  4HAV B;  3ODX A;  2DN6 A;  2K00 A;  3ZDT A;  4HAY B;  1OQN A;  1LW3 A;  3QIJ A;  1Q67 A;  2QKM A;  3ML4 A;  1FHX A;  1V89 A;  1DDV A;  4KHO A;  2N23 A;  4KHB B;  2RNR B;  3KRX A;  1ZM0 A;  5JHG A;  1P3R A;  5FI1 A;  2VRW B;  1X11 A;  1V88 A;  1XD4 A;  2KGX B;  4MK0 A;  2COA A;  4Z2N A;  1PFJ A;  2YS3 A;  3ODO A;  2N0Y A;  3BJI A;  3F5R A;  2GJY A;  4IOY X;  1ZSQ A;  5C16 A;  1MKE A;  4TKN A;  4GZU A;  4HHV A;  1UNP A;  2D9V A;  1IRS A;  2AEH A;  1QQG A;  1V5P A;  2ROV A;  2IYB A;  1U2B A;  2J0M A;  1Y5O A;  2MWN B;  3F0W A;  4XWX A;  1KZG A;  4HB3 B;  2RVB B;  2PZ1 A;  4L6E A;  5D3V A;  3IVF A;  2G35 A;  4CHM A;  1I2H A;  2HE7 A;  4C0A A;  3KRW A;  4WJ7 A;  2P0D A;  4EJN A;  2CAY A;  1U5E A;  5KQ4 A;  1FHW A;  1OMW A;  1GC7 A;  1FAO A;  1XOD A;  2YS5 A;  3SUZ A;  1X1F A;  1XX0 A;  2ZPY A;  2I1J A;  4WVF B;  4Y94 A;  5DHA B;  5LOP B;  2ELA A;  1M7E A;  3HW2 B;  3VOQ A;  2YT1 A;  2W2W A;  1U5G A;  3MDB C;  4MY6 A;  1W1D A;  5C5B A;  2JP2 A;  3OAN A;  1FGZ A;  1P5T A;  1TJ6 A;  1N3H A;  2H7E A;  1UNR A;  5J3Q A;  1WI1 A;  1EAZ A;  1DDM A;  1UEF A;  4GMX B;  3D8D A;  1U29 A;  4K17 A;  5HE1 A;  2DKQ A;  3U8Z A;  2MDX A;  1SGH A;  1UPR A;  2D9X A;  2Q13 A;  1B55 A;  4F7G A;  4WSF A;  2UZS A;  2GCJ A;  1KZ7 A;  4A6F B;  3WYF B;  1V5M A;  3O96 A;  5D3Y A;  5C79 A;  5JHH A;  4HAX B;  5FI0 A;  1U5F A;  2W2X C;  3FSS A;  3FM8 C;  3CIK A;  2Y7B A;  4KHA A;  1NI2 A;  1WJ1 A;  5HE3 A;  1FHO A;  2KCJ A;  1E5W A;  2M38 A;  1DRO A;  3D8E A;  2DTC A;  1MK9 B;  2YS1 A;  1AQC A;  2ROZ B;  3M1I B;  3ODW A;  3HQC A;  1BTK A;  5EFX A;  2DYQ A;  2EMS A;  4HDQ A;  1ISN A;  3T06 A;  5J3Y A;  1RRP B;  2D2Q A;  3BIN A;  2D4Q A;  3TO1 A;  2Z0O A;  3MPX A;  3PZD A;  2BCJ A;  2Z0Q A;  4IAP A;  5KCV A;  4IFS A;  1NTY A;  4B6H A;  4D0N B;  3V5W A;  2FJL A;  1Z87 A;  2K2J A;  2RLO A;  1K5D B;  2K2U A;  2DX1 A;  5LON B;  2R0D A;  1V61 A;  2CY4 A;  1MAI A;  2YT0 A;  3DXC A;  2J0J A;  1TXD A;  1XKE A;  5DHF B;  1XR0 B;  1W1G A;  1J19 A;  4NY0 A;  1MPH A;  1DDW A;  2LOX A;  5D3X A;  1NTV A;  3ULC A;  3DXE A;  3QBV B;  2L2I A;  1DBH A;  1AWE A;  2NZ8 B;  3SYX A;  3PVW A;  4HAZ B;  1PMS A;  2VKI A;  2P0H A;  2YF0 A;  3GYP A;  5D27 A;  1KI1 B;  2DA0 A;  4H8S A;  1DYN A;  2IFS A;  2D11 A;  2Z0P A;  1I7A A;  3PG7 A;  1WVH A;  2ELB A;  2LYD A;  5J3T A;  1FB8 A;  1MIZ B;  2I5F A;  3HK0 A;  3P7Z A;  3TCA A;  3CXB B;  2CRF A;  4TYZ A;  4P7I A;  1BWN A;  3PP2 A;  2D9W A;  2KUP A;  3G9W A;  2E2X A;  1MIX A;  2RUK B;  1WJM A;  5HE0 A;  2I5C A;  2I1K A;  3QWM A;  2DYN A;  4F7H A;  3TW1 A;  5C6R A;  2J59 M;  3SV1 A;  2MFQ A;  2D9Y A;  2H7D A;  2UVM A;  3PEG A;  2EJ8 A;  3PSC A;  5GOW B;  2CY5 A;  3A8Q A;  4PQ0 A;  4K2P A;  2DX5 A;  3A98 B;  4CHJ A;  1M7R A;  2YRY A;  2DKP A;  2XQN M;  4A6F A;  2Y8F A;  2OTX A;  5CLQ B;  3VIA A;  3KSY A;  2MKR A;  4DXA B;  2NMB A;  4DX9 0;  1X86 A;  3DXD A;  5CLL B;  3RCP A;  1Y19 B;  4BBK A;  2OQB A;  1UNQ A;  4HAT B;  4YL8 A;  2D10 A;  3SNH A;  2L1C A;  2GCL A;  1W1H A;  2X18 A;  2UZR A;  2P0F A;  1ZC3 B;  4NSW A;  1MK7 B;  2EMT A;  1LB1 A;  1BAK A;  3PVU A;  1ZVR A;  4YON A;  2LUL A;  2V76 A;  4GN1 A;  2GS0 A; 
#chains in the Genus database with same CATH topology
 4HDO A;  3A58 A;  1P6S A;  4HAU B;  2DHI A;  2LG1 A;  2M14 A;  4ZRK A;  2COF A;  4A6H A;  2KUQ A;  1U27 A;  1X05 A;  3B77 A;  4KAX B;  3ZVR A;  4HB2 B;  1FGY A;  1FOE A;  4QJ3 B;  1PLS A;  1H10 A;  2DHK A;  2HTH B;  4GMV A;  2W2X D;  3WA0 A;  1V5U A;  2AL6 A;  4KVG B;  1WGU A;  4HB4 B;  4K81 A;  2LOZ A;  5HE2 A;  1UPQ A;  2DFK A;  3AU5 A;  3X23 A;  3OHM B;  4A6K A;  4ZRI A;  1OY2 A;  1WG7 A;  2J0K A;  1EF1 A;  1BTN A;  3U7D A;  4HSI A;  3N7C A;  5DH9 B;  2D9Z A;  4HB0 B;  1X1G A;  4F7U P;  4Z2M B;  5KQ1 A;  4HAW B;  3KZ1 A;  3P6A A;  2LKO A;  5D3W A;  4K2O A;  4PNK A;  3GYO A;  3UZT A;  4MT7 A;  2YVC A;  3D8F A;  1EGX A;  5C5B B;  5DI9 B;  4CYE A;  3FEH A;  3PVL A;  1ZC4 B;  4GXB A;  3TFM A;  2KR0 A;  2R09 A;  4A5K A;  5L81 A;  2EC1 A;  2DHJ A;  1ZYI A;  4DX8 A;  4GNK B;  4QJ5 B;  2Z14 A;  2Z4D A;  1EVH A;  2YSZ A;  4GPT B;  2COD A;  3LJU X;  3A8P A;  2Y8G A;  1U5D A;  5DIF B;  1H4R A;  3AU4 A;  3KY9 A;  3HIE A;  4EKU A;  2COC A;  3SO6 A;  1SHC A;  4DBB A;  2QKL A;  2RRF A;  3NSU A;  1K5G B;  1XCG A;  4OSN A;  2P8V A;  2RGN B;  1QC6 A;  2DLW A;  5JP4 A;  2RSG A;  1GC6 A;  1WGQ A;  3ULB A;  1J0W A;  5JLJ B;  1RJ2 A;  1TQZ A;  4EMO A;  1NU2 A;  3TVV A;  1GG3 A;  4ZRJ A;  2VSZ A;  2ADZ A;  3AJ4 A;  4HAV B;  2R2Y A;  3ODX A;  2DN6 A;  2K00 A;  3NWD A;  3ZDT A;  4HAY B;  1OQN A;  1LW3 A;  3QIJ A;  1Q67 A;  2QKM A;  3ML4 A;  1FHX A;  1V89 A;  1DDV A;  4KHO A;  2N23 A;  4KHB B;  2RNR B;  2NBV A;  3KRX A;  1ZM0 A;  5JHG A;  1P3R A;  5FI1 A;  2VRW B;  1X11 A;  1V88 A;  1XD4 A;  2KGX B;  4MK0 A;  2COA A;  4Z2N A;  4OT1 A;  1PFJ A;  2YS3 A;  3ODO A;  2N0Y A;  3BJI A;  3F5R A;  2GJY A;  4IOY X;  1ZSQ A;  5C16 A;  1MKE A;  4TKN A;  4GZU A;  4HHV A;  1UNP A;  2D9V A;  1IRS A;  2AEH A;  1QQG A;  1V5P A;  2ROV A;  2IYB A;  1U2B A;  2J0M A;  1Y5O A;  2MWN B;  3F0W A;  3FVC A;  4XWX A;  1KZG A;  4HB3 B;  2RVB B;  3NW8 A;  2PZ1 A;  4L6E A;  5D3V A;  3IVF A;  2G35 A;  4CHM A;  1I2H A;  2HE7 A;  4C0A A;  3KRW A;  4WJ7 A;  2P0D A;  3HSA A;  4EJN A;  2CAY A;  1U5E A;  5KQ4 A;  1FHW A;  1OMW A;  1GC7 A;  2KIG A;  1FAO A;  1XOD A;  2YS5 A;  3SUZ A;  1X1F A;  1XX0 A;  2ZPY A;  2I1J A;  2K8E A;  4WVF B;  4Y94 A;  5DHA B;  5LOP B;  2ELA A;  1M7E A;  3HW2 B;  3VOQ A;  2YT1 A;  2W2W A;  1U5G A;  3MDB C;  4MY6 A;  1T77 A;  1W1D A;  5C5B A;  2JP2 A;  3OAN A;  1FGZ A;  1P5T A;  1TJ6 A;  1N3H A;  2H7E A;  1UNR A;  5J3Q A;  1WI1 A;  1EAZ A;  2KIE A;  1DDM A;  1UEF A;  4GMX B;  3D8D A;  1U29 A;  4K17 A;  5HE1 A;  3NWA A;  2DKQ A;  3U8Z A;  2MDX A;  1SGH A;  1UPR A;  2D9X A;  4GOU A;  2Q13 A;  1B55 A;  4F7G A;  4WSF A;  2ZKM X;  2UZS A;  2GCJ A;  1KZ7 A;  4A6F B;  3WYF B;  1V5M A;  3NWF A;  3O96 A;  5D3Y A;  5C79 A;  5JHH A;  4HAX B;  5FI0 A;  1U5F A;  2W2X C;  3FSS A;  3FM8 C;  3CIK A;  2Y7B A;  3U12 A;  4KHA A;  1NI2 A;  1WJ1 A;  5HE3 A;  1FHO A;  2KCJ A;  1E5W A;  2M38 A;  1DRO A;  3D8E A;  2DTC A;  1MK9 B;  2YS1 A;  1AQC A;  1MI1 A;  2ROZ B;  3M1I B;  3ODW A;  3HQC A;  1BTK A;  5EFX A;  2DYQ A;  2EMS A;  4HDQ A;  1ISN A;  3T06 A;  5J3Y A;  1RRP B;  2D2Q A;  3BIN A;  2D4Q A;  3TO1 A;  2Z0O A;  3MPX A;  3PZD A;  2BCJ A;  2Z0Q A;  4IAP A;  5KCV A;  4IFS A;  5IRS A;  1NTY A;  4B6H A;  4D0N B;  4KHB A;  3V5W A;  2FJL A;  1Z87 A;  4QXA B;  2K2J A;  2RLO A;  1K5D B;  2K2U A;  2DX1 A;  5LON B;  2R0D A;  1V61 A;  2CY4 A;  1MAI A;  4QJ4 B;  2YT0 A;  3DXC A;  2J0J A;  3DCX A;  1TXD A;  1XKE A;  5DHF B;  1XR0 B;  1W1G A;  1J19 A;  4NY0 A;  1MPH A;  4CSQ A;  1DDW A;  2LOX A;  5D3X A;  1NTV A;  3ULC A;  3DXE A;  3QBV B;  2L2I A;  1DBH A;  1AWE A;  2FJU B;  2NZ8 B;  5I2M A;  3SYX A;  3PVW A;  2Z13 A;  2GUM A;  4HAZ B;  1PMS A;  2VKI A;  2P0H A;  2YF0 A;  3GYP A;  5D27 A;  1KI1 B;  2DA0 A;  4H8S A;  1DYN A;  2IFS A;  2D11 A;  4DIX A;  2Z0P A;  1I7A A;  3PG7 A;  1WVH A;  2ELB A;  2LYD A;  5J3T A;  1FB8 A;  1MIZ B;  2I5F A;  3HK0 A;  3P7Z A;  3TCA A;  3CXB B;  2CRF A;  4TYZ A;  4P7I A;  5LG4 B;  1BWN A;  3PP2 A;  2D9W A;  5I2S A;  2KUP A;  4L1R A;  2YT2 A;  3G9W A;  2E2X A;  1MIX A;  2RUK B;  1WJM A;  5HE0 A;  2I5C A;  2I1K A;  3QWM A;  5M4Y B;  4D6W A;  2DYN A;  4F7H A;  3TW1 A;  5C6R A;  2J59 M;  3SV1 A;  2MFQ A;  2D9Y A;  2H7D A;  2UVM A;  3PEG A;  2EJ8 A;  3PSC A;  5GOW B;  2Z59 A;  2CY5 A;  3A8Q A;  4PQ0 A;  4K2P A;  2DX5 A;  3A98 B;  4CHJ A;  1M7R A;  2YRY A;  2DKP A;  2XQN M;  4A6F A;  2Y8F A;  2OTX A;  5CLQ B;  3VIA A;  3KSY A;  2MKR A;  4DXA B;  2NMB A;  4DX9 0;  1X86 A;  3DXD A;  5CLL B;  3RCP A;  2K49 A;  1Y19 B;  4BBK A;  2OQB A;  1UNQ A;  4HAT B;  4YL8 A;  2D10 A;  3SNH A;  2L1C A;  2GCL A;  1W1H A;  2X18 A;  2UZR A;  2P0F A;  1ZC3 B;  4NSW A;  1MK7 B;  2EMT A;  1LB1 A;  1BAK A;  3PVU A;  1ZVR A;  4YON A;  2LUL A;  2V76 A;  4GN1 A;  2GS0 A; 
#chains in the Genus database with same CATH homology
 4HDO A;  1P6S A;  4HAU B;  2DHI A;  2LG1 A;  2M14 A;  4ZRK A;  2COF A;  4A6H A;  1U27 A;  1X05 A;  4KAX B;  3ZVR A;  4HB2 B;  1FGY A;  1FOE A;  1PLS A;  1H10 A;  2DHK A;  2HTH B;  4GMV A;  2W2X D;  3WA0 A;  1V5U A;  2AL6 A;  4KVG B;  1WGU A;  4HB4 B;  4K81 A;  2LOZ A;  5HE2 A;  1UPQ A;  2DFK A;  3AU5 A;  3X23 A;  4A6K A;  4ZRI A;  1OY2 A;  1WG7 A;  2J0K A;  1EF1 A;  1BTN A;  3U7D A;  3N7C A;  5DH9 B;  2D9Z A;  4HB0 B;  1X1G A;  4F7U P;  4Z2M B;  5KQ1 A;  4HAW B;  3KZ1 A;  3P6A A;  2LKO A;  5D3W A;  4K2O A;  4PNK A;  3GYO A;  3UZT A;  4MT7 A;  2YVC A;  3D8F A;  1EGX A;  5C5B B;  5DI9 B;  4CYE A;  3FEH A;  3PVL A;  1ZC4 B;  4GXB A;  3TFM A;  2R09 A;  4A5K A;  5L81 A;  2EC1 A;  2DHJ A;  4DX8 A;  1EVH A;  2YSZ A;  4GPT B;  2COD A;  3LJU X;  3A8P A;  2Y8G A;  1U5D A;  5DIF B;  1H4R A;  3AU4 A;  3KY9 A;  4EKU A;  2COC A;  3SO6 A;  1SHC A;  4DBB A;  2QKL A;  3NSU A;  1K5G B;  1XCG A;  2P8V A;  2RGN B;  1QC6 A;  2DLW A;  5JP4 A;  2RSG A;  1GC6 A;  1WGQ A;  3ULB A;  1J0W A;  5JLJ B;  1RJ2 A;  1TQZ A;  4EMO A;  1NU2 A;  3TVV A;  1GG3 A;  4ZRJ A;  2VSZ A;  2ADZ A;  3AJ4 A;  4HAV B;  3ODX A;  2DN6 A;  2K00 A;  3ZDT A;  4HAY B;  1OQN A;  1LW3 A;  3QIJ A;  1Q67 A;  2QKM A;  3ML4 A;  1FHX A;  1V89 A;  1DDV A;  4KHO A;  2N23 A;  4KHB B;  2RNR B;  3KRX A;  1ZM0 A;  5JHG A;  1P3R A;  5FI1 A;  2VRW B;  1X11 A;  1V88 A;  1XD4 A;  2KGX B;  4MK0 A;  2COA A;  4Z2N A;  1PFJ A;  2YS3 A;  3ODO A;  2N0Y A;  3BJI A;  3F5R A;  2GJY A;  4IOY X;  1ZSQ A;  5C16 A;  1MKE A;  4TKN A;  4GZU A;  4HHV A;  1UNP A;  2D9V A;  1IRS A;  2AEH A;  1QQG A;  1V5P A;  2ROV A;  2IYB A;  1U2B A;  2J0M A;  1Y5O A;  2MWN B;  3F0W A;  4XWX A;  1KZG A;  4HB3 B;  2RVB B;  2PZ1 A;  4L6E A;  5D3V A;  3IVF A;  2G35 A;  4CHM A;  1I2H A;  2HE7 A;  4C0A A;  3KRW A;  4WJ7 A;  2P0D A;  4EJN A;  2CAY A;  1U5E A;  5KQ4 A;  1FHW A;  1OMW A;  1GC7 A;  1FAO A;  1XOD A;  2YS5 A;  3SUZ A;  1X1F A;  1XX0 A;  2ZPY A;  2I1J A;  4WVF B;  4Y94 A;  5DHA B;  5LOP B;  2ELA A;  1M7E A;  3HW2 B;  3VOQ A;  2YT1 A;  2W2W A;  1U5G A;  3MDB C;  4MY6 A;  1W1D A;  5C5B A;  2JP2 A;  3OAN A;  1FGZ A;  1P5T A;  1TJ6 A;  1N3H A;  2H7E A;  1UNR A;  5J3Q A;  1WI1 A;  1EAZ A;  1DDM A;  1UEF A;  4GMX B;  3D8D A;  1U29 A;  4K17 A;  5HE1 A;  2DKQ A;  3U8Z A;  2MDX A;  1SGH A;  1UPR A;  2D9X A;  2Q13 A;  1B55 A;  4F7G A;  4WSF A;  2UZS A;  2GCJ A;  1KZ7 A;  4A6F B;  3WYF B;  1V5M A;  3O96 A;  5D3Y A;  5C79 A;  5JHH A;  4HAX B;  5FI0 A;  1U5F A;  2W2X C;  3FSS A;  3FM8 C;  3CIK A;  2Y7B A;  4KHA A;  1NI2 A;  1WJ1 A;  5HE3 A;  1FHO A;  2KCJ A;  1E5W A;  2M38 A;  1DRO A;  3D8E A;  2DTC A;  1MK9 B;  2YS1 A;  1AQC A;  2ROZ B;  3M1I B;  3ODW A;  3HQC A;  1BTK A;  5EFX A;  2DYQ A;  2EMS A;  4HDQ A;  1ISN A;  3T06 A;  5J3Y A;  1RRP B;  2D2Q A;  3BIN A;  2D4Q A;  3TO1 A;  2Z0O A;  3MPX A;  3PZD A;  2BCJ A;  2Z0Q A;  4IAP A;  5KCV A;  4IFS A;  1NTY A;  4B6H A;  4D0N B;  3V5W A;  2FJL A;  1Z87 A;  2K2J A;  2RLO A;  1K5D B;  2K2U A;  2DX1 A;  5LON B;  2R0D A;  1V61 A;  2CY4 A;  1MAI A;  2YT0 A;  3DXC A;  2J0J A;  1TXD A;  1XKE A;  5DHF B;  1XR0 B;  1W1G A;  1J19 A;  4NY0 A;  1MPH A;  1DDW A;  2LOX A;  5D3X A;  1NTV A;  3ULC A;  3DXE A;  3QBV B;  2L2I A;  1DBH A;  1AWE A;  2NZ8 B;  3SYX A;  3PVW A;  4HAZ B;  1PMS A;  2VKI A;  2P0H A;  2YF0 A;  3GYP A;  5D27 A;  1KI1 B;  2DA0 A;  4H8S A;  1DYN A;  2IFS A;  2D11 A;  2Z0P A;  1I7A A;  3PG7 A;  1WVH A;  2ELB A;  2LYD A;  5J3T A;  1FB8 A;  1MIZ B;  2I5F A;  3HK0 A;  3P7Z A;  3TCA A;  3CXB B;  2CRF A;  4TYZ A;  4P7I A;  1BWN A;  3PP2 A;  2D9W A;  2KUP A;  3G9W A;  2E2X A;  1MIX A;  2RUK B;  1WJM A;  5HE0 A;  2I5C A;  2I1K A;  3QWM A;  2DYN A;  4F7H A;  3TW1 A;  5C6R A;  2J59 M;  3SV1 A;  2MFQ A;  2D9Y A;  2H7D A;  2UVM A;  3PEG A;  2EJ8 A;  3PSC A;  5GOW B;  2CY5 A;  3A8Q A;  4PQ0 A;  4K2P A;  2DX5 A;  3A98 B;  4CHJ A;  1M7R A;  2YRY A;  2DKP A;  2XQN M;  4A6F A;  2Y8F A;  2OTX A;  5CLQ B;  3VIA A;  3KSY A;  2MKR A;  4DXA B;  2NMB A;  4DX9 0;  1X86 A;  3DXD A;  5CLL B;  3RCP A;  1Y19 B;  4BBK A;  2OQB A;  1UNQ A;  4HAT B;  4YL8 A;  2D10 A;  3SNH A;  2L1C A;  2GCL A;  1W1H A;  2X18 A;  2UZR A;  2P0F A;  1ZC3 B;  4NSW A;  1MK7 B;  2EMT A;  1LB1 A;  1BAK A;  3PVU A;  1ZVR A;  4YON A;  2LUL A;  2V76 A;  4GN1 A;  2GS0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...