2LKOA

Structural basis of phosphoinositide binding to kindlin-2 pleckstrin homology domain in regulating integrin activation
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
138
structure length
138
Chain Sequence
GSHMGDITSIPELADYIKVFKPKKLTLKGYKQYWCTFKDTSISCYKSKEESSGTPAHQMNLRGCEVTPDVNISGQKFNIKLLIPVAEGMNEIWLRCDNEKQYAHWMAACRLASKGKTMADSSYNLEVQNILSFLKMQH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Fermitin family homolog 2
publication title Structural basis of phosphoinositide binding to kindlin-2 protein pleckstrin homology domain in regulating integrin activation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion
total genus 15
structure length 138
sequence length 138
ec nomenclature
pdb deposition date 2011-10-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00169 PH PH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2lkoA00
2OQBA 1XCGA 2I1KA 2P8VA 3BJIA 4A6HA 5J3QA 4HB0B 4CHMA 2D4QA 5C6RA 1DDMA 4MY6A 2EC1A 4CYEA 2ADZA 2D2QA 2I1JA 1XD4A 3P6AA 2KGXB 4HB2B 4B6HA 2CRFA 4EJNA 2RNRB 5LONB 1LW3A 3A8QA 1U5EA 3OANA 3SYXA 2FJLA 1K5DB 1MIXA 1EGXA 2YS3A 4KHOA 3SNHA 1X11A 2GJYA 4DBBA 1H10A 3D8EA 2EJ8A 3RCPA 2CAYA 4EMOA 4WSFA 2CY5A 2R09A 3LJUX 1J19A 1Y19B 5LOPB 2QKLA 1UNRA 1KZ7A 2UZRA 4TYZA 3A98B 3IVFA 1ZC4B 4HAWB 3BINA 2D9WA 5JHGA 2YS5A 5EFXA 2ELAA 4F7UP 3PP2A 1X86A 3SUZA 5JLJB 3ULBA 5GOWB 1U27A 3ZVRA 2D9VA 3MPXA 2D11A 1FHOA 1XR0B 1FOEA 1J0WA 2LULA 4HAVB 4K2PA 1V89A 2DKQA 2W2WA 1ZM0A 1WI1A 3ODOA 2CODA 1FB8A 4K2OA 5KQ4A 2XQNM 1ISNA 2GCLA 4BBKA 1X1FA 2I5CA 3UZTA 1W1GA 2HE7A 3T06A 3KZ1A 2MFQA 2Z0OA 4IFSA 2GCJA 3G9WA 1Y5OA 4KHAA 2CY4A 2DYNA 4P7IA 5HE1A 5D3VA 4TKNA 3CIKA 3PG7A 1UEFA 2VKIA 2LOZA 3ODWA 3A8PA 1TXDA 1XX0A 4NSWA 4WJ7A 1PMSA 4H8SA 4KVGB 1WG7A 1W1DA 3TO1A 1P5TA 3KRXA 4Y94A 1E5WA 1TJ6A 3D8DA 1WGUA 5D3YA 4GMVA 2E2XA 1MAIA 4Z2NA 2K2UA 3HW2B 1AWEA 1FHXA 3VOQA 5C16A 1EAZA 2MDXA 4IOYX 1QC6A 2LKOA 5CLQB 1GC6A 1P6SA 2KCJA 3DXDA 2UZSA 2DHJA 2I5FA 2ROVA 5JHHA 3NSUA 1SGHA 3WA0A 2GS0A 2ZPYA 4GMXB 1V5PA 1N3HA 2P0FA 2D9ZA 1RRPB 2DHKA 4K17A 2DA0A 2DKPA 1NI2A 2VRWB 2W2XD 2ROZB 3QBVB 1DDVA 2DHIA 2P0DA 2M14A 1FGYA 2D9YA 2J0MA 1AQCA 1BWNA 3FEHA 5FI0A 5HE3A 2H7EA 5FI1A 4F7GA 5C79A 1U5GA 4HDOA 1UNQA 1KZGA 1U5DA 1ZSQA 2V76A 3M1IB 1U29A 1Q67A 2LG1A 5HE0A 2NZ8B 3QIJA 4IAPA 5HE2A 1MPHA 2H7DA 2RLOA 1BAKA 3U7DA 2LOXA 1H4RA 2OTXA 3U8ZA 4KHBB 2D10A 4MK0A 3X23A 5D27A 2COCA 4PNKA 1V61A 4HAYB 1PLSA 2DX1A 2J59M 1U5FA 4HAUB 2K2JA 4EKUA 1M7RA 2Y7BA 3KY9A 2K00A 4F7HA 3HK0A 4DX90 2PZ1A 1MKEA 2P0HA 4GZUA 5KCVA 2N0YA 5D3XA 1RJ2A 5DHFB 4ZRKA 4A6FA 4ZRJA 3WYFB 2QKMA 2DYQA 3VIAA 5J3YA 4A5KA 3ZDTA 2EMTA 2L2IA 2BCJA 4XWXA 2Z0PA 1Z87A 2DFKA 1K5GB 1GG3A 4A6FB 2RSGA 2X18A 4YONA 3MDBC 3ML4A 1NU2A 5KQ1A 2N23A 2HTHB 2YRYA 3PSCA 5J3TA 1I2HA 2RVBB 1X1GA 3PEGA 2DLWA 1V5MA 4K81A 2LYDA 1V88A 2W2XC 1ZVRA 3FSSA 4GN1A 2ELBA 4KAXB 4L6EA 4C0AA 4MT7A 2MKRA 3TW1A 5L81A 3PVWA 4CHJA 1V5UA 1UPRA 5DIFB 4HB4B 3TCAA 1MIZB 2JP2A 5JP4A 2RGNB 3PVLA 1P3RA 3FM8C 1UNPA 4DXAB 1MK9B 3F5RA 4Z2MB 2KUPA 2R0DA 1MK7B 4GPTB 1FGZA 1XKEA 4PQ0A 1XODA 1SHCA 2MWNB 3ULCA 2L1CA 2D9XA 3KRWA 2Q13A 4D0NB 2RUKB 3O96A 1TQZA 1WJMA 2COFA 2AL6A 1WJ1A 1FHWA 2YSZA 1NTYA 1LB1A 2AEHA 1M7EA 2M38A 2IFSA 3GYOA 1KI1B 1W1HA 1WGQA 1NTVA 1EVHA 1IRSA 2YS1A 3DXEA 1FAOA 4HAZB 3PZDA 3CXBB 2EMSA 1ZC3B 4WVFB 4NY0A 2NMBA 3AU4A 2G35A 4HDQA 1I7AA 1U2BA 5DH9B 1BTNA 2COAA 1BTKA 3ODXA 3PVUA 3TVVA 4HAXB 2Y8GA 1OY2A 2UVMA 1DBHA 3DXCA 4ZRIA 5C5BA 3AJ4A 3F0WA 1X05A 4HATB 1OMWA 3SV1A 1DDWA 2DN6A 5CLLB 3HQCA 2YF0A 1B55A 4YL8A 1GC7A 3D8FA 2DTCA 4HB3B 5DI9B 5DHAB 5C5BB 2J0JA 3TFMA 1EF1A 2YT0A 1QQGA 3AU5A 3QWMA 4GXBA 2DX5A 5D3WA 4A6KA 1DROA 2IYBA 3GYPA 3KSYA 2VSZA 2YVCA 3N7CA 1WVHA 2Y8FA 3SO6A 4DX8A 1UPQA 3P7ZA 1PFJA 1DYNA 3V5WA 2YT1A 2J0KA 2Z0QA 1OQNA 4HHVA
chains in the Genus database with same CATH superfamily
2OQBA 3A58A 1XCGA 2I1KA 2P8VA 3BJIA 4A6HA 5J3QA 4HB0B 4CHMA 5I2MA 2D4QA 5C6RA 3NWAA 1DDMA 4MY6A 2EC1A 4CYEA 2ADZA 2D2QA 2I1JA 1XD4A 3P6AA 2KGXB 5IRSA 4HB2B 4B6HA 4HSIA 2CRFA 4EJNA 2RNRB 5LONB 1LW3A 3A8QA 1U5EA 3OANA 4D6WA 3SYXA 2FJLA 1K5DB 1MIXA 1EGXA 2YS3A 4QJ4B 2KR0A 4KHOA 4QJ3B 3SNHA 1X11A 2GJYA 4DBBA 1H10A 3D8EA 2EJ8A 3RCPA 2CAYA 4EMOA 4WSFA 2CY5A 2R09A 3LJUX 1J19A 1Y19B 5LOPB 2QKLA 1UNRA 1KZ7A 2UZRA 4TYZA 3A98B 3IVFA 1ZC4B 4HAWB 3BINA 2D9WA 5JHGA 2YS5A 5EFXA 2ELAA 4F7UP 3PP2A 1X86A 3SUZA 5JLJB 3ULBA 5GOWB 1U27A 4KHBA 3ZVRA 2D9VA 3MPXA 2D11A 1FHOA 1XR0B 2Z13A 1FOEA 1J0WA 3NWDA 2LULA 4HAVB 4DIXA 4K2PA 1V89A 2DKQA 2W2WA 1ZM0A 1WI1A 3ODOA 4CSQA 2CODA 1FB8A 4K2OA 5KQ4A 2XQNM 1ISNA 2GCLA 4BBKA 2YT2A 1X1FA 2I5CA 3UZTA 1W1GA 5LG4B 2HE7A 3T06A 3KZ1A 2MFQA 2Z0OA 4IFSA 2GCJA 3G9WA 1Y5OA 4KHAA 2CY4A 2DYNA 2NBVA 4P7IA 5HE1A 5D3VA 4TKNA 3CIKA 2R2YA 3PG7A 1UEFA 2VKIA 2RRFA 2LOZA 3ODWA 3A8PA 1TXDA 1XX0A 4NSWA 4WJ7A 1PMSA 4H8SA 4GNKB 4KVGB 1WG7A 1W1DA 3TO1A 1P5TA 3KRXA 4Y94A 1E5WA 1TJ6A 3D8DA 1WGUA 5D3YA 4GMVA 2E2XA 4OT1A 1MAIA 2K49A 2K2UA 3HW2B 4Z2NA 1AWEA 1FHXA 3VOQA 3OHMB 5C16A 1EAZA 2MDXA 4IOYX 1QC6A 2LKOA 5CLQB 1GC6A 1P6SA 2KCJA 3DXDA 2UZSA 2DHJA 2I5FA 2ROVA 5JHHA 3NSUA 1SGHA 3WA0A 2GS0A 2ZPYA 4GMXB 1V5PA 1N3HA 3U12A 2P0FA 2D9ZA 1RRPB 2DHKA 4K17A 2DA0A 2DKPA 1NI2A 2VRWB 2W2XD 2ROZB 3QBVB 1DDVA 2DHIA 2P0DA 2M14A 1FGYA 2D9YA 2J0MA 1AQCA 1BWNA 3FEHA 5FI0A 5HE3A 2H7EA 5FI1A 3B77A 4F7GA 5C79A 1U5GA 4QXAB 4HDOA 1UNQA 1KZGA 1U5DA 1ZSQA 2V76A 3M1IB 1U29A 2Z4DA 1Q67A 2LG1A 5HE0A 2NZ8B 3QIJA 4IAPA 5HE2A 1MPHA 2H7DA 2RLOA 1BAKA 3U7DA 2LOXA 1H4RA 2GUMA 1ZYIA 2OTXA 3U8ZA 4KHBB 2D10A 4MK0A 2ZKMX 3X23A 5D27A 2COCA 4PNKA 1V61A 1T77A 4HAYB 1PLSA 2DX1A 2J59M 1U5FA 4HAUB 2K8EA 2K2JA 2Z59A 4EKUA 1M7RA 3NWFA 2Y7BA 3KY9A 2K00A 3FVCA 4F7HA 3HK0A 4DX90 2PZ1A 1MKEA 2P0HA 4GZUA 5KCVA 2N0YA 5D3XA 1RJ2A 5DHFB 4ZRKA 4A6FA 4ZRJA 3WYFB 2QKMA 2DYQA 3VIAA 3HIEA 5J3YA 4A5KA 3ZDTA 2EMTA 2L2IA 2BCJA 4XWXA 2Z0PA 1Z87A 2DFKA 2FJUB 1K5GB 1GG3A 4A6FB 2RSGA 4L1RA 2X18A 4YONA 3MDBC 3ML4A 1NU2A 5KQ1A 2N23A 1MI1A 2HTHB 2YRYA 3NW8A 3PSCA 5J3TA 1I2HA 2RVBB 1X1GA 3PEGA 2DLWA 1V5MA 4K81A 2LYDA 1V88A 2W2XC 1ZVRA 3FSSA 4GN1A 2ELBA 4KAXB 4L6EA 2KIEA 4C0AA 5M4YB 4MT7A 2MKRA 3TW1A 5L81A 3PVWA 4CHJA 1V5UA 1UPRA 5DIFB 4HB4B 5I2SA 3TCAA 1MIZB 2JP2A 5JP4A 2RGNB 3PVLA 1P3RA 3FM8C 1UNPA 4DXAB 1MK9B 3F5RA 4Z2MB 2KUPA 2R0DA 1MK7B 4GPTB 1FGZA 1XKEA 4PQ0A 4QJ5B 1XODA 1SHCA 2MWNB 3ULCA 2KIGA 2L1CA 2D9XA 3HSAA 3KRWA 2Q13A 4D0NB 2RUKB 3O96A 1TQZA 1WJMA 2COFA 2AL6A 1WJ1A 1FHWA 2YSZA 1NTYA 1LB1A 2AEHA 1M7EA 2M38A 2IFSA 3GYOA 1KI1B 1W1HA 1WGQA 1NTVA 1EVHA 1IRSA 2YS1A 3DXEA 1FAOA 4HAZB 3PZDA 3CXBB 2EMSA 1ZC3B 2Z14A 4WVFB 4NY0A 2NMBA 3AU4A 2G35A 4HDQA 1I7AA 4OSNA 1U2BA 5DH9B 1BTNA 2COAA 1BTKA 3ODXA 3PVUA 3TVVA 4HAXB 2Y8GA 1OY2A 2UVMA 1DBHA 3DXCA 4ZRIA 5C5BA 3AJ4A 3F0WA 1X05A 4HATB 1OMWA 3SV1A 1DDWA 2DN6A 5CLLB 3HQCA 2YF0A 1B55A 4YL8A 4GOUA 1GC7A 3D8FA 2DTCA 4HB3B 5DI9B 5DHAB 5C5BB 2J0JA 3TFMA 1EF1A 2YT0A 1QQGA 3AU5A 3QWMA 4GXBA 2DX5A 5D3WA 4A6KA 1DROA 2IYBA 2KUQA 3GYPA 3KSYA 2VSZA 2YVCA 3N7CA 1WVHA 2Y8FA 3SO6A 4DX8A 3DCXA 1UPQA 3P7ZA 1PFJA 1DYNA 3V5WA 2YT1A 2J0KA 2Z0QA 1OQNA 4HHVA
chains in the Genus database with same CATH topology
2OQBA 1XCGA 2I1KA 2P8VA 3BJIA 4A6HA 5J3QA 4HB0B 4CHMA 2D4QA 5C6RA 1DDMA 4MY6A 2EC1A 4CYEA 2ADZA 2D2QA 2I1JA 1XD4A 3P6AA 2KGXB 4HB2B 4B6HA 2CRFA 4EJNA 2RNRB 5LONB 1LW3A 3A8QA 1U5EA 3OANA 3SYXA 2FJLA 1K5DB 1MIXA 1EGXA 2YS3A 4KHOA 3SNHA 1X11A 2GJYA 4DBBA 1H10A 3D8EA 2EJ8A 3RCPA 2CAYA 4EMOA 4WSFA 2CY5A 2R09A 3LJUX 1J19A 1Y19B 5LOPB 2QKLA 1UNRA 1KZ7A 2UZRA 4TYZA 3A98B 3IVFA 1ZC4B 4HAWB 3BINA 2D9WA 5JHGA 2YS5A 5EFXA 2ELAA 4F7UP 3PP2A 1X86A 3SUZA 5JLJB 3ULBA 5GOWB 1U27A 3ZVRA 2D9VA 3MPXA 2D11A 1FHOA 1XR0B 1FOEA 1J0WA 2LULA 4HAVB 4K2PA 1V89A 2DKQA 2W2WA 1ZM0A 1WI1A 3ODOA 2CODA 1FB8A 4K2OA 5KQ4A 2XQNM 1ISNA 2GCLA 4BBKA 1X1FA 2I5CA 3UZTA 1W1GA 2HE7A 3T06A 3KZ1A 2MFQA 2Z0OA 4IFSA 2GCJA 3G9WA 1Y5OA 4KHAA 2CY4A 2DYNA 4P7IA 5HE1A 5D3VA 4TKNA 3CIKA 3PG7A 1UEFA 2VKIA 2LOZA 3ODWA 3A8PA 1TXDA 1XX0A 4NSWA 4WJ7A 1PMSA 4H8SA 4KVGB 1WG7A 1W1DA 3TO1A 1P5TA 3KRXA 4Y94A 1E5WA 1TJ6A 3D8DA 1WGUA 5D3YA 4GMVA 2E2XA 1MAIA 4Z2NA 2K2UA 3HW2B 1AWEA 1FHXA 3VOQA 5C16A 1EAZA 2MDXA 4IOYX 1QC6A 2LKOA 5CLQB 1GC6A 1P6SA 2KCJA 3DXDA 2UZSA 2DHJA 2I5FA 2ROVA 5JHHA 3NSUA 1SGHA 3WA0A 2GS0A 2ZPYA 4GMXB 1V5PA 1N3HA 2P0FA 2D9ZA 1RRPB 2DHKA 4K17A 2DA0A 2DKPA 1NI2A 2VRWB 2W2XD 2ROZB 3QBVB 1DDVA 2DHIA 2P0DA 2M14A 1FGYA 2D9YA 2J0MA 1AQCA 1BWNA 3FEHA 5FI0A 5HE3A 2H7EA 5FI1A 4F7GA 5C79A 1U5GA 4HDOA 1UNQA 1KZGA 1U5DA 1ZSQA 2V76A 3M1IB 1U29A 1Q67A 2LG1A 5HE0A 2NZ8B 3QIJA 4IAPA 5HE2A 1MPHA 2H7DA 2RLOA 1BAKA 3U7DA 2LOXA 1H4RA 2OTXA 3U8ZA 4KHBB 2D10A 4MK0A 3X23A 5D27A 2COCA 4PNKA 1V61A 4HAYB 1PLSA 2DX1A 2J59M 1U5FA 4HAUB 2K2JA 4EKUA 1M7RA 2Y7BA 3KY9A 2K00A 4F7HA 3HK0A 4DX90 2PZ1A 1MKEA 2P0HA 4GZUA 5KCVA 2N0YA 5D3XA 1RJ2A 5DHFB 4ZRKA 4A6FA 4ZRJA 3WYFB 2QKMA 2DYQA 3VIAA 5J3YA 4A5KA 3ZDTA 2EMTA 2L2IA 2BCJA 4XWXA 2Z0PA 1Z87A 2DFKA 1K5GB 1GG3A 4A6FB 2RSGA 2X18A 4YONA 3MDBC 3ML4A 1NU2A 5KQ1A 2N23A 2HTHB 2YRYA 3PSCA 5J3TA 1I2HA 2RVBB 1X1GA 3PEGA 2DLWA 1V5MA 4K81A 2LYDA 1V88A 2W2XC 1ZVRA 3FSSA 4GN1A 2ELBA 4KAXB 4L6EA 4C0AA 4MT7A 2MKRA 3TW1A 5L81A 3PVWA 4CHJA 1V5UA 1UPRA 5DIFB 4HB4B 3TCAA 1MIZB 2JP2A 5JP4A 2RGNB 3PVLA 1P3RA 3FM8C 1UNPA 4DXAB 1MK9B 3F5RA 4Z2MB 2KUPA 2R0DA 1MK7B 4GPTB 1FGZA 1XKEA 4PQ0A 1XODA 1SHCA 2MWNB 3ULCA 2L1CA 2D9XA 3KRWA 2Q13A 4D0NB 2RUKB 3O96A 1TQZA 1WJMA 2COFA 2AL6A 1WJ1A 1FHWA 2YSZA 1NTYA 1LB1A 2AEHA 1M7EA 2M38A 2IFSA 3GYOA 1KI1B 1W1HA 1WGQA 1NTVA 1EVHA 1IRSA 2YS1A 3DXEA 1FAOA 4HAZB 3PZDA 3CXBB 2EMSA 1ZC3B 4WVFB 4NY0A 2NMBA 3AU4A 2G35A 4HDQA 1I7AA 1U2BA 5DH9B 1BTNA 2COAA 1BTKA 3ODXA 3PVUA 3TVVA 4HAXB 2Y8GA 1OY2A 2UVMA 1DBHA 3DXCA 4ZRIA 5C5BA 3AJ4A 3F0WA 1X05A 4HATB 1OMWA 3SV1A 1DDWA 2DN6A 5CLLB 3HQCA 2YF0A 1B55A 4YL8A 1GC7A 3D8FA 2DTCA 4HB3B 5DI9B 5DHAB 5C5BB 2J0JA 3TFMA 1EF1A 2YT0A 1QQGA 3AU5A 3QWMA 4GXBA 2DX5A 5D3WA 4A6KA 1DROA 2IYBA 3GYPA 3KSYA 2VSZA 2YVCA 3N7CA 1WVHA 2Y8FA 3SO6A 4DX8A 1UPQA 3P7ZA 1PFJA 1DYNA 3V5WA 2YT1A 2J0KA 2Z0QA 1OQNA 4HHVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OQB A;  1XCG A;  2I1K A;  2P8V A;  3BJI A;  4A6H A;  5J3Q A;  4HB0 B;  4CHM A;  2D4Q A;  5C6R A;  1DDM A;  4MY6 A;  2EC1 A;  4CYE A;  2ADZ A;  2D2Q A;  2I1J A;  1XD4 A;  3P6A A;  2KGX B;  4HB2 B;  4B6H A;  2CRF A;  4EJN A;  2RNR B;  5LON B;  1LW3 A;  3A8Q A;  1U5E A;  3OAN A;  3SYX A;  2FJL A;  1K5D B;  1MIX A;  1EGX A;  2YS3 A;  4KHO A;  3SNH A;  1X11 A;  2GJY A;  4DBB A;  1H10 A;  3D8E A;  2EJ8 A;  3RCP A;  2CAY A;  4EMO A;  4WSF A;  2CY5 A;  2R09 A;  3LJU X;  1J19 A;  1Y19 B;  5LOP B;  2QKL A;  1UNR A;  1KZ7 A;  2UZR A;  4TYZ A;  3A98 B;  3IVF A;  1ZC4 B;  4HAW B;  3BIN A;  2D9W A;  5JHG A;  2YS5 A;  5EFX A;  2ELA A;  4F7U P;  3PP2 A;  1X86 A;  3SUZ A;  5JLJ B;  3ULB A;  5GOW B;  1U27 A;  3ZVR A;  2D9V A;  3MPX A;  2D11 A;  1FHO A;  1XR0 B;  1FOE A;  1J0W A;  2LUL A;  4HAV B;  4K2P A;  1V89 A;  2DKQ A;  2W2W A;  1ZM0 A;  1WI1 A;  3ODO A;  2COD A;  1FB8 A;  4K2O A;  5KQ4 A;  2XQN M;  1ISN A;  2GCL A;  4BBK A;  1X1F A;  2I5C A;  3UZT A;  1W1G A;  2HE7 A;  3T06 A;  3KZ1 A;  2MFQ A;  2Z0O A;  4IFS A;  2GCJ A;  3G9W A;  1Y5O A;  4KHA A;  2CY4 A;  2DYN A;  4P7I A;  5HE1 A;  5D3V A;  4TKN A;  3CIK A;  3PG7 A;  1UEF A;  2VKI A;  2LOZ A;  3ODW A;  3A8P A;  1TXD A;  1XX0 A;  4NSW A;  4WJ7 A;  1PMS A;  4H8S A;  4KVG B;  1WG7 A;  1W1D A;  3TO1 A;  1P5T A;  3KRX A;  4Y94 A;  1E5W A;  1TJ6 A;  3D8D A;  1WGU A;  5D3Y A;  4GMV A;  2E2X A;  1MAI A;  4Z2N A;  2K2U A;  3HW2 B;  1AWE A;  1FHX A;  3VOQ A;  5C16 A;  1EAZ A;  2MDX A;  4IOY X;  1QC6 A;  2LKO A;  5CLQ B;  1GC6 A;  1P6S A;  2KCJ A;  3DXD A;  2UZS A;  2DHJ A;  2I5F A;  2ROV A;  5JHH A;  3NSU A;  1SGH A;  3WA0 A;  2GS0 A;  2ZPY A;  4GMX B;  1V5P A;  1N3H A;  2P0F A;  2D9Z A;  1RRP B;  2DHK A;  4K17 A;  2DA0 A;  2DKP A;  1NI2 A;  2VRW B;  2W2X D;  2ROZ B;  3QBV B;  1DDV A;  2DHI A;  2P0D A;  2M14 A;  1FGY A;  2D9Y A;  2J0M A;  1AQC A;  1BWN A;  3FEH A;  5FI0 A;  5HE3 A;  2H7E A;  5FI1 A;  4F7G A;  5C79 A;  1U5G A;  4HDO A;  1UNQ A;  1KZG A;  1U5D A;  1ZSQ A;  2V76 A;  3M1I B;  1U29 A;  1Q67 A;  2LG1 A;  5HE0 A;  2NZ8 B;  3QIJ A;  4IAP A;  5HE2 A;  1MPH A;  2H7D A;  2RLO A;  1BAK A;  3U7D A;  2LOX A;  1H4R A;  2OTX A;  3U8Z A;  4KHB B;  2D10 A;  4MK0 A;  3X23 A;  5D27 A;  2COC A;  4PNK A;  1V61 A;  4HAY B;  1PLS A;  2DX1 A;  2J59 M;  1U5F A;  4HAU B;  2K2J A;  4EKU A;  1M7R A;  2Y7B A;  3KY9 A;  2K00 A;  4F7H A;  3HK0 A;  4DX9 0;  2PZ1 A;  1MKE A;  2P0H A;  4GZU A;  5KCV A;  2N0Y A;  5D3X A;  1RJ2 A;  5DHF B;  4ZRK A;  4A6F A;  4ZRJ A;  3WYF B;  2QKM A;  2DYQ A;  3VIA A;  5J3Y A;  4A5K A;  3ZDT A;  2EMT A;  2L2I A;  2BCJ A;  4XWX A;  2Z0P A;  1Z87 A;  2DFK A;  1K5G B;  1GG3 A;  4A6F B;  2RSG A;  2X18 A;  4YON A;  3MDB C;  3ML4 A;  1NU2 A;  5KQ1 A;  2N23 A;  2HTH B;  2YRY A;  3PSC A;  5J3T A;  1I2H A;  2RVB B;  1X1G A;  3PEG A;  2DLW A;  1V5M A;  4K81 A;  2LYD A;  1V88 A;  2W2X C;  1ZVR A;  3FSS A;  4GN1 A;  2ELB A;  4KAX B;  4L6E A;  4C0A A;  4MT7 A;  2MKR A;  3TW1 A;  5L81 A;  3PVW A;  4CHJ A;  1V5U A;  1UPR A;  5DIF B;  4HB4 B;  3TCA A;  1MIZ B;  2JP2 A;  5JP4 A;  2RGN B;  3PVL A;  1P3R A;  3FM8 C;  1UNP A;  4DXA B;  1MK9 B;  3F5R A;  4Z2M B;  2KUP A;  2R0D A;  1MK7 B;  4GPT B;  1FGZ A;  1XKE A;  4PQ0 A;  1XOD A;  1SHC A;  2MWN B;  3ULC A;  2L1C A;  2D9X A;  3KRW A;  2Q13 A;  4D0N B;  2RUK B;  3O96 A;  1TQZ A;  1WJM A;  2COF A;  2AL6 A;  1WJ1 A;  1FHW A;  2YSZ A;  1NTY A;  1LB1 A;  2AEH A;  1M7E A;  2M38 A;  2IFS A;  3GYO A;  1KI1 B;  1W1H A;  1WGQ A;  1NTV A;  1EVH A;  1IRS A;  2YS1 A;  3DXE A;  1FAO A;  4HAZ B;  3PZD A;  3CXB B;  2EMS A;  1ZC3 B;  4WVF B;  4NY0 A;  2NMB A;  3AU4 A;  2G35 A;  4HDQ A;  1I7A A;  1U2B A;  5DH9 B;  1BTN A;  2COA A;  1BTK A;  3ODX A;  3PVU A;  3TVV A;  4HAX B;  2Y8G A;  1OY2 A;  2UVM A;  1DBH A;  3DXC A;  4ZRI A;  5C5B A;  3AJ4 A;  3F0W A;  1X05 A;  4HAT B;  1OMW A;  3SV1 A;  1DDW A;  2DN6 A;  5CLL B;  3HQC A;  2YF0 A;  1B55 A;  4YL8 A;  1GC7 A;  3D8F A;  2DTC A;  4HB3 B;  5DI9 B;  5DHA B;  5C5B B;  2J0J A;  3TFM A;  1EF1 A;  2YT0 A;  1QQG A;  3AU5 A;  3QWM A;  4GXB A;  2DX5 A;  5D3W A;  4A6K A;  1DRO A;  2IYB A;  3GYP A;  3KSY A;  2VSZ A;  2YVC A;  3N7C A;  1WVH A;  2Y8F A;  3SO6 A;  4DX8 A;  1UPQ A;  3P7Z A;  1PFJ A;  1DYN A;  3V5W A;  2YT1 A;  2J0K A;  2Z0Q A;  1OQN A;  4HHV A; 
#chains in the Genus database with same CATH topology
 2OQB A;  3A58 A;  1XCG A;  2I1K A;  2P8V A;  3BJI A;  4A6H A;  5J3Q A;  4HB0 B;  4CHM A;  5I2M A;  2D4Q A;  5C6R A;  3NWA A;  1DDM A;  4MY6 A;  2EC1 A;  4CYE A;  2ADZ A;  2D2Q A;  2I1J A;  1XD4 A;  3P6A A;  2KGX B;  5IRS A;  4HB2 B;  4B6H A;  4HSI A;  2CRF A;  4EJN A;  2RNR B;  5LON B;  1LW3 A;  3A8Q A;  1U5E A;  3OAN A;  4D6W A;  3SYX A;  2FJL A;  1K5D B;  1MIX A;  1EGX A;  2YS3 A;  4QJ4 B;  2KR0 A;  4KHO A;  4QJ3 B;  3SNH A;  1X11 A;  2GJY A;  4DBB A;  1H10 A;  3D8E A;  2EJ8 A;  3RCP A;  2CAY A;  4EMO A;  4WSF A;  2CY5 A;  2R09 A;  3LJU X;  1J19 A;  1Y19 B;  5LOP B;  2QKL A;  1UNR A;  1KZ7 A;  2UZR A;  4TYZ A;  3A98 B;  3IVF A;  1ZC4 B;  4HAW B;  3BIN A;  2D9W A;  5JHG A;  2YS5 A;  5EFX A;  2ELA A;  4F7U P;  3PP2 A;  1X86 A;  3SUZ A;  5JLJ B;  3ULB A;  5GOW B;  1U27 A;  4KHB A;  3ZVR A;  2D9V A;  3MPX A;  2D11 A;  1FHO A;  1XR0 B;  2Z13 A;  1FOE A;  1J0W A;  3NWD A;  2LUL A;  4HAV B;  4DIX A;  4K2P A;  1V89 A;  2DKQ A;  2W2W A;  1ZM0 A;  1WI1 A;  3ODO A;  4CSQ A;  2COD A;  1FB8 A;  4K2O A;  5KQ4 A;  2XQN M;  1ISN A;  2GCL A;  4BBK A;  2YT2 A;  1X1F A;  2I5C A;  3UZT A;  1W1G A;  5LG4 B;  2HE7 A;  3T06 A;  3KZ1 A;  2MFQ A;  2Z0O A;  4IFS A;  2GCJ A;  3G9W A;  1Y5O A;  4KHA A;  2CY4 A;  2DYN A;  2NBV A;  4P7I A;  5HE1 A;  5D3V A;  4TKN A;  3CIK A;  2R2Y A;  3PG7 A;  1UEF A;  2VKI A;  2RRF A;  2LOZ A;  3ODW A;  3A8P A;  1TXD A;  1XX0 A;  4NSW A;  4WJ7 A;  1PMS A;  4H8S A;  4GNK B;  4KVG B;  1WG7 A;  1W1D A;  3TO1 A;  1P5T A;  3KRX A;  4Y94 A;  1E5W A;  1TJ6 A;  3D8D A;  1WGU A;  5D3Y A;  4GMV A;  2E2X A;  4OT1 A;  1MAI A;  2K49 A;  2K2U A;  3HW2 B;  4Z2N A;  1AWE A;  1FHX A;  3VOQ A;  3OHM B;  5C16 A;  1EAZ A;  2MDX A;  4IOY X;  1QC6 A;  2LKO A;  5CLQ B;  1GC6 A;  1P6S A;  2KCJ A;  3DXD A;  2UZS A;  2DHJ A;  2I5F A;  2ROV A;  5JHH A;  3NSU A;  1SGH A;  3WA0 A;  2GS0 A;  2ZPY A;  4GMX B;  1V5P A;  1N3H A;  3U12 A;  2P0F A;  2D9Z A;  1RRP B;  2DHK A;  4K17 A;  2DA0 A;  2DKP A;  1NI2 A;  2VRW B;  2W2X D;  2ROZ B;  3QBV B;  1DDV A;  2DHI A;  2P0D A;  2M14 A;  1FGY A;  2D9Y A;  2J0M A;  1AQC A;  1BWN A;  3FEH A;  5FI0 A;  5HE3 A;  2H7E A;  5FI1 A;  3B77 A;  4F7G A;  5C79 A;  1U5G A;  4QXA B;  4HDO A;  1UNQ A;  1KZG A;  1U5D A;  1ZSQ A;  2V76 A;  3M1I B;  1U29 A;  2Z4D A;  1Q67 A;  2LG1 A;  5HE0 A;  2NZ8 B;  3QIJ A;  4IAP A;  5HE2 A;  1MPH A;  2H7D A;  2RLO A;  1BAK A;  3U7D A;  2LOX A;  1H4R A;  2GUM A;  1ZYI A;  2OTX A;  3U8Z A;  4KHB B;  2D10 A;  4MK0 A;  2ZKM X;  3X23 A;  5D27 A;  2COC A;  4PNK A;  1V61 A;  1T77 A;  4HAY B;  1PLS A;  2DX1 A;  2J59 M;  1U5F A;  4HAU B;  2K8E A;  2K2J A;  2Z59 A;  4EKU A;  1M7R A;  3NWF A;  2Y7B A;  3KY9 A;  2K00 A;  3FVC A;  4F7H A;  3HK0 A;  4DX9 0;  2PZ1 A;  1MKE A;  2P0H A;  4GZU A;  5KCV A;  2N0Y A;  5D3X A;  1RJ2 A;  5DHF B;  4ZRK A;  4A6F A;  4ZRJ A;  3WYF B;  2QKM A;  2DYQ A;  3VIA A;  3HIE A;  5J3Y A;  4A5K A;  3ZDT A;  2EMT A;  2L2I A;  2BCJ A;  4XWX A;  2Z0P A;  1Z87 A;  2DFK A;  2FJU B;  1K5G B;  1GG3 A;  4A6F B;  2RSG A;  4L1R A;  2X18 A;  4YON A;  3MDB C;  3ML4 A;  1NU2 A;  5KQ1 A;  2N23 A;  1MI1 A;  2HTH B;  2YRY A;  3NW8 A;  3PSC A;  5J3T A;  1I2H A;  2RVB B;  1X1G A;  3PEG A;  2DLW A;  1V5M A;  4K81 A;  2LYD A;  1V88 A;  2W2X C;  1ZVR A;  3FSS A;  4GN1 A;  2ELB A;  4KAX B;  4L6E A;  2KIE A;  4C0A A;  5M4Y B;  4MT7 A;  2MKR A;  3TW1 A;  5L81 A;  3PVW A;  4CHJ A;  1V5U A;  1UPR A;  5DIF B;  4HB4 B;  5I2S A;  3TCA A;  1MIZ B;  2JP2 A;  5JP4 A;  2RGN B;  3PVL A;  1P3R A;  3FM8 C;  1UNP A;  4DXA B;  1MK9 B;  3F5R A;  4Z2M B;  2KUP A;  2R0D A;  1MK7 B;  4GPT B;  1FGZ A;  1XKE A;  4PQ0 A;  4QJ5 B;  1XOD A;  1SHC A;  2MWN B;  3ULC A;  2KIG A;  2L1C A;  2D9X A;  3HSA A;  3KRW A;  2Q13 A;  4D0N B;  2RUK B;  3O96 A;  1TQZ A;  1WJM A;  2COF A;  2AL6 A;  1WJ1 A;  1FHW A;  2YSZ A;  1NTY A;  1LB1 A;  2AEH A;  1M7E A;  2M38 A;  2IFS A;  3GYO A;  1KI1 B;  1W1H A;  1WGQ A;  1NTV A;  1EVH A;  1IRS A;  2YS1 A;  3DXE A;  1FAO A;  4HAZ B;  3PZD A;  3CXB B;  2EMS A;  1ZC3 B;  2Z14 A;  4WVF B;  4NY0 A;  2NMB A;  3AU4 A;  2G35 A;  4HDQ A;  1I7A A;  4OSN A;  1U2B A;  5DH9 B;  1BTN A;  2COA A;  1BTK A;  3ODX A;  3PVU A;  3TVV A;  4HAX B;  2Y8G A;  1OY2 A;  2UVM A;  1DBH A;  3DXC A;  4ZRI A;  5C5B A;  3AJ4 A;  3F0W A;  1X05 A;  4HAT B;  1OMW A;  3SV1 A;  1DDW A;  2DN6 A;  5CLL B;  3HQC A;  2YF0 A;  1B55 A;  4YL8 A;  4GOU A;  1GC7 A;  3D8F A;  2DTC A;  4HB3 B;  5DI9 B;  5DHA B;  5C5B B;  2J0J A;  3TFM A;  1EF1 A;  2YT0 A;  1QQG A;  3AU5 A;  3QWM A;  4GXB A;  2DX5 A;  5D3W A;  4A6K A;  1DRO A;  2IYB A;  2KUQ A;  3GYP A;  3KSY A;  2VSZ A;  2YVC A;  3N7C A;  1WVH A;  2Y8F A;  3SO6 A;  4DX8 A;  3DCX A;  1UPQ A;  3P7Z A;  1PFJ A;  1DYN A;  3V5W A;  2YT1 A;  2J0K A;  2Z0Q A;  1OQN A;  4HHV A; 
#chains in the Genus database with same CATH homology
 2OQB A;  1XCG A;  2I1K A;  2P8V A;  3BJI A;  4A6H A;  5J3Q A;  4HB0 B;  4CHM A;  2D4Q A;  5C6R A;  1DDM A;  4MY6 A;  2EC1 A;  4CYE A;  2ADZ A;  2D2Q A;  2I1J A;  1XD4 A;  3P6A A;  2KGX B;  4HB2 B;  4B6H A;  2CRF A;  4EJN A;  2RNR B;  5LON B;  1LW3 A;  3A8Q A;  1U5E A;  3OAN A;  3SYX A;  2FJL A;  1K5D B;  1MIX A;  1EGX A;  2YS3 A;  4KHO A;  3SNH A;  1X11 A;  2GJY A;  4DBB A;  1H10 A;  3D8E A;  2EJ8 A;  3RCP A;  2CAY A;  4EMO A;  4WSF A;  2CY5 A;  2R09 A;  3LJU X;  1J19 A;  1Y19 B;  5LOP B;  2QKL A;  1UNR A;  1KZ7 A;  2UZR A;  4TYZ A;  3A98 B;  3IVF A;  1ZC4 B;  4HAW B;  3BIN A;  2D9W A;  5JHG A;  2YS5 A;  5EFX A;  2ELA A;  4F7U P;  3PP2 A;  1X86 A;  3SUZ A;  5JLJ B;  3ULB A;  5GOW B;  1U27 A;  3ZVR A;  2D9V A;  3MPX A;  2D11 A;  1FHO A;  1XR0 B;  1FOE A;  1J0W A;  2LUL A;  4HAV B;  4K2P A;  1V89 A;  2DKQ A;  2W2W A;  1ZM0 A;  1WI1 A;  3ODO A;  2COD A;  1FB8 A;  4K2O A;  5KQ4 A;  2XQN M;  1ISN A;  2GCL A;  4BBK A;  1X1F A;  2I5C A;  3UZT A;  1W1G A;  2HE7 A;  3T06 A;  3KZ1 A;  2MFQ A;  2Z0O A;  4IFS A;  2GCJ A;  3G9W A;  1Y5O A;  4KHA A;  2CY4 A;  2DYN A;  4P7I A;  5HE1 A;  5D3V A;  4TKN A;  3CIK A;  3PG7 A;  1UEF A;  2VKI A;  2LOZ A;  3ODW A;  3A8P A;  1TXD A;  1XX0 A;  4NSW A;  4WJ7 A;  1PMS A;  4H8S A;  4KVG B;  1WG7 A;  1W1D A;  3TO1 A;  1P5T A;  3KRX A;  4Y94 A;  1E5W A;  1TJ6 A;  3D8D A;  1WGU A;  5D3Y A;  4GMV A;  2E2X A;  1MAI A;  4Z2N A;  2K2U A;  3HW2 B;  1AWE A;  1FHX A;  3VOQ A;  5C16 A;  1EAZ A;  2MDX A;  4IOY X;  1QC6 A;  2LKO A;  5CLQ B;  1GC6 A;  1P6S A;  2KCJ A;  3DXD A;  2UZS A;  2DHJ A;  2I5F A;  2ROV A;  5JHH A;  3NSU A;  1SGH A;  3WA0 A;  2GS0 A;  2ZPY A;  4GMX B;  1V5P A;  1N3H A;  2P0F A;  2D9Z A;  1RRP B;  2DHK A;  4K17 A;  2DA0 A;  2DKP A;  1NI2 A;  2VRW B;  2W2X D;  2ROZ B;  3QBV B;  1DDV A;  2DHI A;  2P0D A;  2M14 A;  1FGY A;  2D9Y A;  2J0M A;  1AQC A;  1BWN A;  3FEH A;  5FI0 A;  5HE3 A;  2H7E A;  5FI1 A;  4F7G A;  5C79 A;  1U5G A;  4HDO A;  1UNQ A;  1KZG A;  1U5D A;  1ZSQ A;  2V76 A;  3M1I B;  1U29 A;  1Q67 A;  2LG1 A;  5HE0 A;  2NZ8 B;  3QIJ A;  4IAP A;  5HE2 A;  1MPH A;  2H7D A;  2RLO A;  1BAK A;  3U7D A;  2LOX A;  1H4R A;  2OTX A;  3U8Z A;  4KHB B;  2D10 A;  4MK0 A;  3X23 A;  5D27 A;  2COC A;  4PNK A;  1V61 A;  4HAY B;  1PLS A;  2DX1 A;  2J59 M;  1U5F A;  4HAU B;  2K2J A;  4EKU A;  1M7R A;  2Y7B A;  3KY9 A;  2K00 A;  4F7H A;  3HK0 A;  4DX9 0;  2PZ1 A;  1MKE A;  2P0H A;  4GZU A;  5KCV A;  2N0Y A;  5D3X A;  1RJ2 A;  5DHF B;  4ZRK A;  4A6F A;  4ZRJ A;  3WYF B;  2QKM A;  2DYQ A;  3VIA A;  5J3Y A;  4A5K A;  3ZDT A;  2EMT A;  2L2I A;  2BCJ A;  4XWX A;  2Z0P A;  1Z87 A;  2DFK A;  1K5G B;  1GG3 A;  4A6F B;  2RSG A;  2X18 A;  4YON A;  3MDB C;  3ML4 A;  1NU2 A;  5KQ1 A;  2N23 A;  2HTH B;  2YRY A;  3PSC A;  5J3T A;  1I2H A;  2RVB B;  1X1G A;  3PEG A;  2DLW A;  1V5M A;  4K81 A;  2LYD A;  1V88 A;  2W2X C;  1ZVR A;  3FSS A;  4GN1 A;  2ELB A;  4KAX B;  4L6E A;  4C0A A;  4MT7 A;  2MKR A;  3TW1 A;  5L81 A;  3PVW A;  4CHJ A;  1V5U A;  1UPR A;  5DIF B;  4HB4 B;  3TCA A;  1MIZ B;  2JP2 A;  5JP4 A;  2RGN B;  3PVL A;  1P3R A;  3FM8 C;  1UNP A;  4DXA B;  1MK9 B;  3F5R A;  4Z2M B;  2KUP A;  2R0D A;  1MK7 B;  4GPT B;  1FGZ A;  1XKE A;  4PQ0 A;  1XOD A;  1SHC A;  2MWN B;  3ULC A;  2L1C A;  2D9X A;  3KRW A;  2Q13 A;  4D0N B;  2RUK B;  3O96 A;  1TQZ A;  1WJM A;  2COF A;  2AL6 A;  1WJ1 A;  1FHW A;  2YSZ A;  1NTY A;  1LB1 A;  2AEH A;  1M7E A;  2M38 A;  2IFS A;  3GYO A;  1KI1 B;  1W1H A;  1WGQ A;  1NTV A;  1EVH A;  1IRS A;  2YS1 A;  3DXE A;  1FAO A;  4HAZ B;  3PZD A;  3CXB B;  2EMS A;  1ZC3 B;  4WVF B;  4NY0 A;  2NMB A;  3AU4 A;  2G35 A;  4HDQ A;  1I7A A;  1U2B A;  5DH9 B;  1BTN A;  2COA A;  1BTK A;  3ODX A;  3PVU A;  3TVV A;  4HAX B;  2Y8G A;  1OY2 A;  2UVM A;  1DBH A;  3DXC A;  4ZRI A;  5C5B A;  3AJ4 A;  3F0W A;  1X05 A;  4HAT B;  1OMW A;  3SV1 A;  1DDW A;  2DN6 A;  5CLL B;  3HQC A;  2YF0 A;  1B55 A;  4YL8 A;  1GC7 A;  3D8F A;  2DTC A;  4HB3 B;  5DI9 B;  5DHA B;  5C5B B;  2J0J A;  3TFM A;  1EF1 A;  2YT0 A;  1QQG A;  3AU5 A;  3QWM A;  4GXB A;  2DX5 A;  5D3W A;  4A6K A;  1DRO A;  2IYB A;  3GYP A;  3KSY A;  2VSZ A;  2YVC A;  3N7C A;  1WVH A;  2Y8F A;  3SO6 A;  4DX8 A;  1UPQ A;  3P7Z A;  1PFJ A;  1DYN A;  3V5W A;  2YT1 A;  2J0K A;  2Z0Q A;  1OQN A;  4HHV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...