2LKOA

Structural basis of phosphoinositide binding to kindlin-2 pleckstrin homology domain in regulating integrin activation
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
138
structure length
138
Chain Sequence
GSHMGDITSIPELADYIKVFKPKKLTLKGYKQYWCTFKDTSISCYKSKEESSGTPAHQMNLRGCEVTPDVNISGQKFNIKLLIPVAEGMNEIWLRCDNEKQYAHWMAACRLASKGKTMADSSYNLEVQNILSFLKMQH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural basis of phosphoinositide binding to kindlin-2 protein pleckstrin homology domain in regulating integrin activation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion
molecule keywords Fermitin family homolog 2
total genus 15
structure length 138
sequence length 138
ec nomenclature
pdb deposition date 2011-10-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00169 PH PH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2lkoA00
1XR0B 1J0WA 3AJ4A 1UNPA 2YT1A 2VKIA 2MFQA 2LYDA 3DXCA 3PSCA 3TFMA 1U2BA 1H10A 2M38A 4WVFB 1ZC4B 2LKOA 1P6SA 2YS3A 1X1FA 1EAZA 5KQ1A 3TCAA 1RJ2A 4YONA 3F0WA 3ULBA 2DHKA 1KZ7A 2L2IA 1GC6A 4TYZA 5C5BB 1ISNA 1P3RA 3SO6A 4K2OA 2OTXA 2K00A 1GG3A 5JP4A 1V5PA 1H4RA 4HHVA 2V76A 1TQZA 4ZRIA 3P6AA 3ULCA 2PZ1A 2YSZA 4KHAA 1FGYA 1OMWA 2ADZA 3PP2A 2D10A 1MAIA 3KY9A 3A8QA 2LG1A 1XX0A 2EMSA 3PZDA 2DHJA 1MKEA 2DX1A 3KRWA 1UPQA 1BTNA 2Z0QA 5D27A 1V61A 3FEHA 3D8EA 3PVUA 3SNHA 5C79A 4HAVB 2MWNB 4HB2B 3BINA 3DXDA 1X11A 1QQGA 5HE2A 4HAUB 2J0MA 4DX8A 2G35A 3IVFA 2DKQA 1ZC3B 1Y5OA 3D8FA 1W1DA 3UZTA 1TXDA 1V5MA 4GXBA 2D9WA 1KI1B 5DH9B 5EFXA 4GMVA 2QKLA 2VSZA 3TO1A 5C5BA 2W2XD 1U29A 4XWXA 3AU4A 3V5WA 2D9VA 4EKUA 2I5CA 3ODOA 4GN1A 5LONB 4HB4B 4KHOA 1EGXA 3KZ1A 4H8SA 4NY0A 2DN6A 3SUZA 1ZSQA 2LULA 2D2QA 4K81A 2QKMA 3SV1A 3WA0A 1W1HA 1UPRA 2L1CA 4NSWA 2MKRA 1FHWA 4D0NB 4B6HA 2RNRB 4TKNA 4Z2NA 2ROZB 4GZUA 5LOPB 4Z2MB 2AL6A 3OANA 4Y94A 3KSYA 4MK0A 4A6KA 1DYNA 5JLJB 2DLWA 2YS5A 2NZ8B 1WGUA 2GJYA 2Z0PA 1WVHA 5DIFB 1M7RA 1LW3A 2EC1A 2IFSA 4WJ7A 5DI9B 1BTKA 2BCJA 2RLOA 3PVLA 3T06A 1K5GB 5J3YA 2COCA 1NTYA 3F5RA 5HE0A 1W1GA 3U7DA 2IYBA 2W2XC 5CLLB 4L6EA 1UNQA 3QBVB 1MK7B 2AEHA 1XODA 2D9YA 5DHFB 5D3XA 1XD4A 1WG7A 1DDVA 2P0FA 2M14A 4IOYX 1U5DA 1ZVRA 1J19A 1MIXA 3G9WA 2DA0A 4HB0B 1QC6A 5D3YA 3GYOA 4F7HA 4EJNA 5KQ4A 5J3QA 5KCVA 1MK9B 4K17A 3X23A 3P7ZA 2H7EA 2CY4A 2CODA 5HE3A 3MDBC 4A5KA 2DFKA 4P7IA 1NTVA 1NU2A 5J3TA 2EMTA 2OQBA 1Z87A 5JHHA 3ML4A 2ZPYA 1PFJA 2YS1A 3GYPA 2COFA 5CLQB 3ZVRA 2XQNM 2VRWB 1DBHA 4HDOA 2ELAA 2RVBB 1U5GA 1P5TA 1XCGA 2Q13A 2D9ZA 2Y8GA 3NSUA 1IRSA 1B55A 2R0DA 3CXBB 2DKPA 4HATB 2Z0OA 4HB3B 3QWMA 4ZRJA 1EF1A 4CHJA 2P8VA 1Y19B 2K2UA 4CHMA 3FM8C 2JP2A 2Y8FA 1SHCA 1RRPB 2UVMA 2YVCA 4DXAB 3M1IB 2DX5A 2W2WA 3KRXA 2H7DA 3VIAA 1K5DB 2X18A 1LB1A 2GCJA 2ROVA 1WJMA 3DXEA 4F7UP 2I1KA 2Y7BA 4DBBA 1X86A 1BWNA 3SYXA 2YF0A 1V5UA 2COAA 2FJLA 4A6HA 5DHAB 4DX90 1V89A 3FSSA 1UEFA 3TVVA 1KZGA 2GS0A 3PEGA 2EJ8A 3HQCA 2DHIA 3N7CA 5L81A 4IFSA 2RUKB 1WI1A 1OQNA 4PNKA 1EVHA 3O96A 4MT7A 2YT0A 4HAYB 1X05A 1PMSA 2I1JA 4GPTB 3HK0A 1V88A 1UNRA 3D8DA 4HAZB 4HAXB 1FB8A 2LOXA 5C16A 4HDQA 1BAKA 1M7EA 3ODXA 3VOQA 2K2JA 5JHGA 1OY2A 2DYNA 3TW1A 3CIKA 1TJ6A 4A6FB 2RGNB 1NI2A 2KCJA 2N23A 1E5WA 2D11A 4PQ0A 1WGQA 3ODWA 1FGZA 3A98B 5GOWB 5C6RA 3U8ZA 2I5FA 1U27A 2J0JA 1Q67A 1I2HA 2E2XA 2R09A 4KHBB 5FI1A 2DYQA 2J59M 3PG7A 4GMXB 1AQCA 2J0KA 4F7GA 5D3WA 2LOZA 2GCLA 5D3VA 3AU5A 1DROA 1PLSA 2YRYA 2NMBA 1DDWA 4C0AA 2P0HA 3RCPA 3ZDTA 2CRFA 2P0DA 2N0YA 3PVWA 1FOEA 1GC7A 4HAWB 1FHXA 1ZM0A 2D9XA 1WJ1A 2KGXB 1SGHA 2HTHB 4WSFA 1FAOA 2RSGA 4BBKA 1FHOA 3BJIA 3HW2B 1U5FA 1XKEA 4ZRKA 2DTCA 4MY6A 1I7AA 4CYEA 1X1GA 1MIZB 2D4QA 2ELBA 1N3HA 4IAPA 2CAYA 1MPHA 2KUPA 4A6FA 2UZRA 4YL8A 4EMOA 3LJUX 4KVGB 3QIJA 5FI0A 3A8PA 3WYFB 3MPXA 1DDMA 1U5EA 4K2PA 2UZSA 2CY5A 5HE1A 1AWEA 4KAXB 2MDXA 2HE7A
chains in the Genus database with same CATH superfamily
1XR0B 1J0WA 3AJ4A 1UNPA 2YT1A 2VKIA 2MFQA 2LYDA 3DXCA 3PSCA 3TFMA 1U2BA 1H10A 2M38A 4WVFB 1ZC4B 2LKOA 1P6SA 2YS3A 1X1FA 1EAZA 5KQ1A 3TCAA 1RJ2A 4YONA 3F0WA 3ULBA 2Z4DA 2DHKA 1KZ7A 2L2IA 1GC6A 4QJ5B 4TYZA 5C5BB 1ISNA 1P3RA 3SO6A 3NWFA 4K2OA 2OTXA 2K00A 1GG3A 5JP4A 1V5PA 1H4RA 4HHVA 2V76A 2RRFA 1TQZA 4ZRIA 3NW8A 2Z59A 3P6AA 3ULCA 2ZKMX 2PZ1A 2YSZA 4KHAA 1FGYA 1OMWA 2ADZA 3PP2A 2D10A 1MAIA 3KY9A 3A8QA 2LG1A 1XX0A 2EMSA 3PZDA 2KIEA 2DHJA 1MKEA 3KRWA 2DX1A 1UPQA 1BTNA 2Z0QA 5D27A 1V61A 3FEHA 5LG4B 3D8EA 3PVUA 3SNHA 5C79A 4HAVB 2MWNB 4HB2B 3BINA 3DXDA 1X11A 1T77A 1QQGA 5HE2A 4HAUB 2J0MA 4DX8A 2G35A 3IVFA 2DKQA 1ZC3B 4GOUA 1Y5OA 3D8FA 1W1DA 3UZTA 1TXDA 1V5MA 4GXBA 2D9WA 1KI1B 5DH9B 5EFXA 4GMVA 2QKLA 2GUMA 2VSZA 3TO1A 5C5BA 2W2XD 1U29A 4XWXA 3AU4A 3V5WA 2D9VA 2K49A 4EKUA 2I5CA 1ZYIA 3ODOA 4GN1A 5LONB 4HB4B 4KHOA 1EGXA 3KZ1A 4H8SA 4NY0A 2DN6A 3SUZA 4DIXA 1ZSQA 2LULA 2D2QA 4K81A 2QKMA 3SV1A 3WA0A 1W1HA 1UPRA 2L1CA 4NSWA 2MKRA 1FHWA 4D0NB 4B6HA 2RNRB 4TKNA 4Z2NA 2KUQA 2ROZB 4GZUA 3U12A 5LOPB 4Z2MB 2AL6A 3OANA 4Y94A 3KSYA 4MK0A 4A6KA 1DYNA 5JLJB 2DLWA 2YS5A 2NZ8B 3HSAA 1WGUA 2GJYA 2Z0PA 5M4YB 1WVHA 5DIFB 1M7RA 1LW3A 2EC1A 2IFSA 4WJ7A 5DI9B 1BTKA 2BCJA 2RLOA 3PVLA 3T06A 1K5GB 5J3YA 2COCA 1NTYA 3F5RA 5HE0A 2Z13A 1W1GA 3U7DA 2IYBA 2W2XC 5CLLB 4L6EA 1UNQA 3QBVB 1MK7B 4D6WA 2AEHA 1XODA 2D9YA 5DHFB 5D3XA 1XD4A 4CSQA 1WG7A 1DDVA 2P0FA 5I2SA 2M14A 4IOYX 1U5DA 2Z14A 1ZVRA 1J19A 1MIXA 3G9WA 2DA0A 4HB0B 1QC6A 5D3YA 3GYOA 4F7HA 2K8EA 4EJNA 5KQ4A 5J3QA 5KCVA 1MK9B 4K17A 3X23A 2YT2A 3P7ZA 2H7EA 2CY4A 2CODA 5HE3A 3MDBC 4A5KA 2DFKA 4P7IA 1NTVA 1NU2A 5J3TA 2EMTA 2OQBA 1Z87A 5JHHA 3ML4A 2ZPYA 1PFJA 2YS1A 3GYPA 4OSNA 2COFA 4HSIA 5CLQB 3ZVRA 2XQNM 2VRWB 1DBHA 3FVCA 4HDOA 2ELAA 2RVBB 1U5GA 1P5TA 1XCGA 2Q13A 2D9ZA 2Y8GA 3NSUA 1IRSA 1B55A 2R0DA 3CXBB 2DKPA 4HATB 2Z0OA 4HB3B 3QWMA 4ZRJA 1EF1A 4CHJA 2P8VA 1Y19B 2K2UA 4CHMA 3FM8C 2JP2A 2Y8FA 1SHCA 1RRPB 2UVMA 2YVCA 4DXAB 3M1IB 2DX5A 2W2WA 4GNKB 2KIGA 3KRXA 2H7DA 3VIAA 3A58A 2KR0A 1K5DB 2X18A 1LB1A 2GCJA 2ROVA 3HIEA 1WJMA 3DXEA 4F7UP 2I1KA 2Y7BA 4DBBA 1X86A 1BWNA 3SYXA 2YF0A 4QJ4B 1V5UA 2COAA 2FJLA 4A6HA 5DHAB 4DX90 1V89A 4QJ3B 3FSSA 1UEFA 3TVVA 1KZGA 2GS0A 3PEGA 2EJ8A 3HQCA 2DHIA 3N7CA 5L81A 4IFSA 2RUKB 1WI1A 1MI1A 1OQNA 4PNKA 1EVHA 3O96A 4MT7A 2YT0A 4HAYB 3NWAA 1X05A 1PMSA 2I1JA 4GPTB 3HK0A 1V88A 1UNRA 3D8DA 4HAZB 4HAXB 1FB8A 2LOXA 5C16A 4HDQA 1BAKA 3B77A 1M7EA 3ODXA 3VOQA 2K2JA 5JHGA 1OY2A 2DYNA 3TW1A 3CIKA 1TJ6A 4A6FB 2RGNB 5IRSA 1NI2A 2KCJA 2R2YA 3NWDA 2N23A 1E5WA 2D11A 4PQ0A 1WGQA 3DCXA 3ODWA 1FGZA 3A98B 5GOWB 4KHBA 5C6RA 2FJUB 3U8ZA 2I5FA 1U27A 2J0JA 1Q67A 1I2HA 2E2XA 2R09A 4KHBB 5FI1A 2DYQA 2J59M 3PG7A 4GMXB 1AQCA 2J0KA 4F7GA 5D3WA 2LOZA 2GCLA 5D3VA 3AU5A 1DROA 1PLSA 2YRYA 2NMBA 1DDWA 4C0AA 2P0HA 3RCPA 3ZDTA 2CRFA 2P0DA 2N0YA 3PVWA 1FOEA 1GC7A 1FHXA 1ZM0A 2D9XA 4HAWB 1WJ1A 2KGXB 1SGHA 2HTHB 4WSFA 1FAOA 2RSGA 5I2MA 4BBKA 1FHOA 3BJIA 3HW2B 1U5FA 1XKEA 4QXAB 4ZRKA 2DTCA 4MY6A 1I7AA 4CYEA 1X1GA 1MIZB 2D4QA 2ELBA 1N3HA 2CAYA 2KUPA 1MPHA 4IAPA 4OT1A 4A6FA 2UZRA 3OHMB 4YL8A 4EMOA 2NBVA 3LJUX 4KVGB 3QIJA 5FI0A 3A8PA 3WYFB 4L1RA 3MPXA 1DDMA 1U5EA 4K2PA 2UZSA 2CY5A 5HE1A 1AWEA 4KAXB 2MDXA 2HE7A
chains in the Genus database with same CATH topology
1XR0B 1J0WA 3AJ4A 1UNPA 2YT1A 2VKIA 2MFQA 2LYDA 3DXCA 3PSCA 3TFMA 1U2BA 1H10A 2M38A 4WVFB 1ZC4B 2LKOA 1P6SA 2YS3A 1X1FA 1EAZA 5KQ1A 3TCAA 1RJ2A 4YONA 3F0WA 3ULBA 2DHKA 1KZ7A 2L2IA 1GC6A 4TYZA 5C5BB 1ISNA 1P3RA 3SO6A 4K2OA 2OTXA 2K00A 1GG3A 5JP4A 1V5PA 1H4RA 4HHVA 2V76A 1TQZA 4ZRIA 3P6AA 3ULCA 2PZ1A 2YSZA 4KHAA 1FGYA 1OMWA 2ADZA 3PP2A 2D10A 1MAIA 3KY9A 3A8QA 2LG1A 1XX0A 2EMSA 3PZDA 2DHJA 1MKEA 2DX1A 3KRWA 1UPQA 1BTNA 2Z0QA 5D27A 1V61A 3FEHA 3D8EA 3PVUA 3SNHA 5C79A 4HAVB 2MWNB 4HB2B 3BINA 3DXDA 1X11A 1QQGA 5HE2A 4HAUB 2J0MA 4DX8A 2G35A 3IVFA 2DKQA 1ZC3B 1Y5OA 3D8FA 1W1DA 3UZTA 1TXDA 1V5MA 4GXBA 2D9WA 1KI1B 5DH9B 5EFXA 4GMVA 2QKLA 2VSZA 3TO1A 5C5BA 2W2XD 1U29A 4XWXA 3AU4A 3V5WA 2D9VA 4EKUA 2I5CA 3ODOA 4GN1A 5LONB 4HB4B 4KHOA 1EGXA 3KZ1A 4H8SA 4NY0A 2DN6A 3SUZA 1ZSQA 2LULA 2D2QA 4K81A 2QKMA 3SV1A 3WA0A 1W1HA 1UPRA 2L1CA 4NSWA 2MKRA 1FHWA 4D0NB 4B6HA 2RNRB 4TKNA 4Z2NA 2ROZB 4GZUA 5LOPB 4Z2MB 2AL6A 3OANA 4Y94A 3KSYA 4MK0A 4A6KA 1DYNA 5JLJB 2DLWA 2YS5A 2NZ8B 1WGUA 2GJYA 2Z0PA 1WVHA 5DIFB 1M7RA 1LW3A 2EC1A 2IFSA 4WJ7A 5DI9B 1BTKA 2BCJA 2RLOA 3PVLA 3T06A 1K5GB 5J3YA 2COCA 1NTYA 3F5RA 5HE0A 1W1GA 3U7DA 2IYBA 2W2XC 5CLLB 4L6EA 1UNQA 3QBVB 1MK7B 2AEHA 1XODA 2D9YA 5DHFB 5D3XA 1XD4A 1WG7A 1DDVA 2P0FA 2M14A 4IOYX 1U5DA 1ZVRA 1J19A 1MIXA 3G9WA 2DA0A 4HB0B 1QC6A 5D3YA 3GYOA 4F7HA 4EJNA 5KQ4A 5J3QA 5KCVA 1MK9B 4K17A 3X23A 3P7ZA 2H7EA 2CY4A 2CODA 5HE3A 3MDBC 4A5KA 2DFKA 4P7IA 1NTVA 1NU2A 5J3TA 2EMTA 2OQBA 1Z87A 5JHHA 3ML4A 2ZPYA 1PFJA 2YS1A 3GYPA 2COFA 5CLQB 3ZVRA 2XQNM 2VRWB 1DBHA 4HDOA 2ELAA 2RVBB 1U5GA 1P5TA 1XCGA 2Q13A 2D9ZA 2Y8GA 3NSUA 1IRSA 1B55A 2R0DA 3CXBB 2DKPA 4HATB 2Z0OA 4HB3B 3QWMA 4ZRJA 1EF1A 4CHJA 2P8VA 1Y19B 2K2UA 4CHMA 3FM8C 2JP2A 2Y8FA 1SHCA 1RRPB 2UVMA 2YVCA 4DXAB 3M1IB 2DX5A 2W2WA 3KRXA 2H7DA 3VIAA 1K5DB 2X18A 1LB1A 2GCJA 2ROVA 1WJMA 3DXEA 4F7UP 2I1KA 2Y7BA 4DBBA 1X86A 1BWNA 3SYXA 2YF0A 1V5UA 2COAA 2FJLA 4A6HA 5DHAB 4DX90 1V89A 3FSSA 1UEFA 3TVVA 1KZGA 2GS0A 3PEGA 2EJ8A 3HQCA 2DHIA 3N7CA 5L81A 4IFSA 2RUKB 1WI1A 1OQNA 4PNKA 1EVHA 3O96A 4MT7A 2YT0A 4HAYB 1X05A 1PMSA 2I1JA 4GPTB 3HK0A 1V88A 1UNRA 3D8DA 4HAZB 4HAXB 1FB8A 2LOXA 5C16A 4HDQA 1BAKA 1M7EA 3ODXA 3VOQA 2K2JA 5JHGA 1OY2A 2DYNA 3TW1A 3CIKA 1TJ6A 4A6FB 2RGNB 1NI2A 2KCJA 2N23A 1E5WA 2D11A 4PQ0A 1WGQA 3ODWA 1FGZA 3A98B 5GOWB 5C6RA 3U8ZA 2I5FA 1U27A 2J0JA 1Q67A 1I2HA 2E2XA 2R09A 4KHBB 5FI1A 2DYQA 2J59M 3PG7A 4GMXB 1AQCA 2J0KA 4F7GA 5D3WA 2LOZA 2GCLA 5D3VA 3AU5A 1DROA 1PLSA 2YRYA 2NMBA 1DDWA 4C0AA 2P0HA 3RCPA 3ZDTA 2CRFA 2P0DA 2N0YA 3PVWA 1FOEA 1GC7A 4HAWB 1FHXA 1ZM0A 2D9XA 1WJ1A 2KGXB 1SGHA 2HTHB 4WSFA 1FAOA 2RSGA 4BBKA 1FHOA 3BJIA 3HW2B 1U5FA 1XKEA 4ZRKA 2DTCA 4MY6A 1I7AA 4CYEA 1X1GA 1MIZB 2D4QA 2ELBA 1N3HA 4IAPA 2CAYA 1MPHA 2KUPA 4A6FA 2UZRA 4YL8A 4EMOA 3LJUX 4KVGB 3QIJA 5FI0A 3A8PA 3WYFB 3MPXA 1DDMA 1U5EA 4K2PA 2UZSA 2CY5A 5HE1A 1AWEA 4KAXB 2MDXA 2HE7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XR0 B;  1J0W A;  3AJ4 A;  1UNP A;  2YT1 A;  2VKI A;  2MFQ A;  2LYD A;  3DXC A;  3PSC A;  3TFM A;  1U2B A;  1H10 A;  2M38 A;  4WVF B;  1ZC4 B;  2LKO A;  1P6S A;  2YS3 A;  1X1F A;  1EAZ A;  5KQ1 A;  3TCA A;  1RJ2 A;  4YON A;  3F0W A;  3ULB A;  2DHK A;  1KZ7 A;  2L2I A;  1GC6 A;  4TYZ A;  5C5B B;  1ISN A;  1P3R A;  3SO6 A;  4K2O A;  2OTX A;  2K00 A;  1GG3 A;  5JP4 A;  1V5P A;  1H4R A;  4HHV A;  2V76 A;  1TQZ A;  4ZRI A;  3P6A A;  3ULC A;  2PZ1 A;  2YSZ A;  4KHA A;  1FGY A;  1OMW A;  2ADZ A;  3PP2 A;  2D10 A;  1MAI A;  3KY9 A;  3A8Q A;  2LG1 A;  1XX0 A;  2EMS A;  3PZD A;  2DHJ A;  1MKE A;  2DX1 A;  3KRW A;  1UPQ A;  1BTN A;  2Z0Q A;  5D27 A;  1V61 A;  3FEH A;  3D8E A;  3PVU A;  3SNH A;  5C79 A;  4HAV B;  2MWN B;  4HB2 B;  3BIN A;  3DXD A;  1X11 A;  1QQG A;  5HE2 A;  4HAU B;  2J0M A;  4DX8 A;  2G35 A;  3IVF A;  2DKQ A;  1ZC3 B;  1Y5O A;  3D8F A;  1W1D A;  3UZT A;  1TXD A;  1V5M A;  4GXB A;  2D9W A;  1KI1 B;  5DH9 B;  5EFX A;  4GMV A;  2QKL A;  2VSZ A;  3TO1 A;  5C5B A;  2W2X D;  1U29 A;  4XWX A;  3AU4 A;  3V5W A;  2D9V A;  4EKU A;  2I5C A;  3ODO A;  4GN1 A;  5LON B;  4HB4 B;  4KHO A;  1EGX A;  3KZ1 A;  4H8S A;  4NY0 A;  2DN6 A;  3SUZ A;  1ZSQ A;  2LUL A;  2D2Q A;  4K81 A;  2QKM A;  3SV1 A;  3WA0 A;  1W1H A;  1UPR A;  2L1C A;  4NSW A;  2MKR A;  1FHW A;  4D0N B;  4B6H A;  2RNR B;  4TKN A;  4Z2N A;  2ROZ B;  4GZU A;  5LOP B;  4Z2M B;  2AL6 A;  3OAN A;  4Y94 A;  3KSY A;  4MK0 A;  4A6K A;  1DYN A;  5JLJ B;  2DLW A;  2YS5 A;  2NZ8 B;  1WGU A;  2GJY A;  2Z0P A;  1WVH A;  5DIF B;  1M7R A;  1LW3 A;  2EC1 A;  2IFS A;  4WJ7 A;  5DI9 B;  1BTK A;  2BCJ A;  2RLO A;  3PVL A;  3T06 A;  1K5G B;  5J3Y A;  2COC A;  1NTY A;  3F5R A;  5HE0 A;  1W1G A;  3U7D A;  2IYB A;  2W2X C;  5CLL B;  4L6E A;  1UNQ A;  3QBV B;  1MK7 B;  2AEH A;  1XOD A;  2D9Y A;  5DHF B;  5D3X A;  1XD4 A;  1WG7 A;  1DDV A;  2P0F A;  2M14 A;  4IOY X;  1U5D A;  1ZVR A;  1J19 A;  1MIX A;  3G9W A;  2DA0 A;  4HB0 B;  1QC6 A;  5D3Y A;  3GYO A;  4F7H A;  4EJN A;  5KQ4 A;  5J3Q A;  5KCV A;  1MK9 B;  4K17 A;  3X23 A;  3P7Z A;  2H7E A;  2CY4 A;  2COD A;  5HE3 A;  3MDB C;  4A5K A;  2DFK A;  4P7I A;  1NTV A;  1NU2 A;  5J3T A;  2EMT A;  2OQB A;  1Z87 A;  5JHH A;  3ML4 A;  2ZPY A;  1PFJ A;  2YS1 A;  3GYP A;  2COF A;  5CLQ B;  3ZVR A;  2XQN M;  2VRW B;  1DBH A;  4HDO A;  2ELA A;  2RVB B;  1U5G A;  1P5T A;  1XCG A;  2Q13 A;  2D9Z A;  2Y8G A;  3NSU A;  1IRS A;  1B55 A;  2R0D A;  3CXB B;  2DKP A;  4HAT B;  2Z0O A;  4HB3 B;  3QWM A;  4ZRJ A;  1EF1 A;  4CHJ A;  2P8V A;  1Y19 B;  2K2U A;  4CHM A;  3FM8 C;  2JP2 A;  2Y8F A;  1SHC A;  1RRP B;  2UVM A;  2YVC A;  4DXA B;  3M1I B;  2DX5 A;  2W2W A;  3KRX A;  2H7D A;  3VIA A;  1K5D B;  2X18 A;  1LB1 A;  2GCJ A;  2ROV A;  1WJM A;  3DXE A;  4F7U P;  2I1K A;  2Y7B A;  4DBB A;  1X86 A;  1BWN A;  3SYX A;  2YF0 A;  1V5U A;  2COA A;  2FJL A;  4A6H A;  5DHA B;  4DX9 0;  1V89 A;  3FSS A;  1UEF A;  3TVV A;  1KZG A;  2GS0 A;  3PEG A;  2EJ8 A;  3HQC A;  2DHI A;  3N7C A;  5L81 A;  4IFS A;  2RUK B;  1WI1 A;  1OQN A;  4PNK A;  1EVH A;  3O96 A;  4MT7 A;  2YT0 A;  4HAY B;  1X05 A;  1PMS A;  2I1J A;  4GPT B;  3HK0 A;  1V88 A;  1UNR A;  3D8D A;  4HAZ B;  4HAX B;  1FB8 A;  2LOX A;  5C16 A;  4HDQ A;  1BAK A;  1M7E A;  3ODX A;  3VOQ A;  2K2J A;  5JHG A;  1OY2 A;  2DYN A;  3TW1 A;  3CIK A;  1TJ6 A;  4A6F B;  2RGN B;  1NI2 A;  2KCJ A;  2N23 A;  1E5W A;  2D11 A;  4PQ0 A;  1WGQ A;  3ODW A;  1FGZ A;  3A98 B;  5GOW B;  5C6R A;  3U8Z A;  2I5F A;  1U27 A;  2J0J A;  1Q67 A;  1I2H A;  2E2X A;  2R09 A;  4KHB B;  5FI1 A;  2DYQ A;  2J59 M;  3PG7 A;  4GMX B;  1AQC A;  2J0K A;  4F7G A;  5D3W A;  2LOZ A;  2GCL A;  5D3V A;  3AU5 A;  1DRO A;  1PLS A;  2YRY A;  2NMB A;  1DDW A;  4C0A A;  2P0H A;  3RCP A;  3ZDT A;  2CRF A;  2P0D A;  2N0Y A;  3PVW A;  1FOE A;  1GC7 A;  4HAW B;  1FHX A;  1ZM0 A;  2D9X A;  1WJ1 A;  2KGX B;  1SGH A;  2HTH B;  4WSF A;  1FAO A;  2RSG A;  4BBK A;  1FHO A;  3BJI A;  3HW2 B;  1U5F A;  1XKE A;  4ZRK A;  2DTC A;  4MY6 A;  1I7A A;  4CYE A;  1X1G A;  1MIZ B;  2D4Q A;  2ELB A;  1N3H A;  4IAP A;  2CAY A;  1MPH A;  2KUP A;  4A6F A;  2UZR A;  4YL8 A;  4EMO A;  3LJU X;  4KVG B;  3QIJ A;  5FI0 A;  3A8P A;  3WYF B;  3MPX A;  1DDM A;  1U5E A;  4K2P A;  2UZS A;  2CY5 A;  5HE1 A;  1AWE A;  4KAX B;  2MDX A;  2HE7 A; 
#chains in the Genus database with same CATH topology
 1XR0 B;  1J0W A;  3AJ4 A;  1UNP A;  2YT1 A;  2VKI A;  2MFQ A;  2LYD A;  3DXC A;  3PSC A;  3TFM A;  1U2B A;  1H10 A;  2M38 A;  4WVF B;  1ZC4 B;  2LKO A;  1P6S A;  2YS3 A;  1X1F A;  1EAZ A;  5KQ1 A;  3TCA A;  1RJ2 A;  4YON A;  3F0W A;  3ULB A;  2Z4D A;  2DHK A;  1KZ7 A;  2L2I A;  1GC6 A;  4QJ5 B;  4TYZ A;  5C5B B;  1ISN A;  1P3R A;  3SO6 A;  3NWF A;  4K2O A;  2OTX A;  2K00 A;  1GG3 A;  5JP4 A;  1V5P A;  1H4R A;  4HHV A;  2V76 A;  2RRF A;  1TQZ A;  4ZRI A;  3NW8 A;  2Z59 A;  3P6A A;  3ULC A;  2ZKM X;  2PZ1 A;  2YSZ A;  4KHA A;  1FGY A;  1OMW A;  2ADZ A;  3PP2 A;  2D10 A;  1MAI A;  3KY9 A;  3A8Q A;  2LG1 A;  1XX0 A;  2EMS A;  3PZD A;  2KIE A;  2DHJ A;  1MKE A;  3KRW A;  2DX1 A;  1UPQ A;  1BTN A;  2Z0Q A;  5D27 A;  1V61 A;  3FEH A;  5LG4 B;  3D8E A;  3PVU A;  3SNH A;  5C79 A;  4HAV B;  2MWN B;  4HB2 B;  3BIN A;  3DXD A;  1X11 A;  1T77 A;  1QQG A;  5HE2 A;  4HAU B;  2J0M A;  4DX8 A;  2G35 A;  3IVF A;  2DKQ A;  1ZC3 B;  4GOU A;  1Y5O A;  3D8F A;  1W1D A;  3UZT A;  1TXD A;  1V5M A;  4GXB A;  2D9W A;  1KI1 B;  5DH9 B;  5EFX A;  4GMV A;  2QKL A;  2GUM A;  2VSZ A;  3TO1 A;  5C5B A;  2W2X D;  1U29 A;  4XWX A;  3AU4 A;  3V5W A;  2D9V A;  2K49 A;  4EKU A;  2I5C A;  1ZYI A;  3ODO A;  4GN1 A;  5LON B;  4HB4 B;  4KHO A;  1EGX A;  3KZ1 A;  4H8S A;  4NY0 A;  2DN6 A;  3SUZ A;  4DIX A;  1ZSQ A;  2LUL A;  2D2Q A;  4K81 A;  2QKM A;  3SV1 A;  3WA0 A;  1W1H A;  1UPR A;  2L1C A;  4NSW A;  2MKR A;  1FHW A;  4D0N B;  4B6H A;  2RNR B;  4TKN A;  4Z2N A;  2KUQ A;  2ROZ B;  4GZU A;  3U12 A;  5LOP B;  4Z2M B;  2AL6 A;  3OAN A;  4Y94 A;  3KSY A;  4MK0 A;  4A6K A;  1DYN A;  5JLJ B;  2DLW A;  2YS5 A;  2NZ8 B;  3HSA A;  1WGU A;  2GJY A;  2Z0P A;  5M4Y B;  1WVH A;  5DIF B;  1M7R A;  1LW3 A;  2EC1 A;  2IFS A;  4WJ7 A;  5DI9 B;  1BTK A;  2BCJ A;  2RLO A;  3PVL A;  3T06 A;  1K5G B;  5J3Y A;  2COC A;  1NTY A;  3F5R A;  5HE0 A;  2Z13 A;  1W1G A;  3U7D A;  2IYB A;  2W2X C;  5CLL B;  4L6E A;  1UNQ A;  3QBV B;  1MK7 B;  4D6W A;  2AEH A;  1XOD A;  2D9Y A;  5DHF B;  5D3X A;  1XD4 A;  4CSQ A;  1WG7 A;  1DDV A;  2P0F A;  5I2S A;  2M14 A;  4IOY X;  1U5D A;  2Z14 A;  1ZVR A;  1J19 A;  1MIX A;  3G9W A;  2DA0 A;  4HB0 B;  1QC6 A;  5D3Y A;  3GYO A;  4F7H A;  2K8E A;  4EJN A;  5KQ4 A;  5J3Q A;  5KCV A;  1MK9 B;  4K17 A;  3X23 A;  2YT2 A;  3P7Z A;  2H7E A;  2CY4 A;  2COD A;  5HE3 A;  3MDB C;  4A5K A;  2DFK A;  4P7I A;  1NTV A;  1NU2 A;  5J3T A;  2EMT A;  2OQB A;  1Z87 A;  5JHH A;  3ML4 A;  2ZPY A;  1PFJ A;  2YS1 A;  3GYP A;  4OSN A;  2COF A;  4HSI A;  5CLQ B;  3ZVR A;  2XQN M;  2VRW B;  1DBH A;  3FVC A;  4HDO A;  2ELA A;  2RVB B;  1U5G A;  1P5T A;  1XCG A;  2Q13 A;  2D9Z A;  2Y8G A;  3NSU A;  1IRS A;  1B55 A;  2R0D A;  3CXB B;  2DKP A;  4HAT B;  2Z0O A;  4HB3 B;  3QWM A;  4ZRJ A;  1EF1 A;  4CHJ A;  2P8V A;  1Y19 B;  2K2U A;  4CHM A;  3FM8 C;  2JP2 A;  2Y8F A;  1SHC A;  1RRP B;  2UVM A;  2YVC A;  4DXA B;  3M1I B;  2DX5 A;  2W2W A;  4GNK B;  2KIG A;  3KRX A;  2H7D A;  3VIA A;  3A58 A;  2KR0 A;  1K5D B;  2X18 A;  1LB1 A;  2GCJ A;  2ROV A;  3HIE A;  1WJM A;  3DXE A;  4F7U P;  2I1K A;  2Y7B A;  4DBB A;  1X86 A;  1BWN A;  3SYX A;  2YF0 A;  4QJ4 B;  1V5U A;  2COA A;  2FJL A;  4A6H A;  5DHA B;  4DX9 0;  1V89 A;  4QJ3 B;  3FSS A;  1UEF A;  3TVV A;  1KZG A;  2GS0 A;  3PEG A;  2EJ8 A;  3HQC A;  2DHI A;  3N7C A;  5L81 A;  4IFS A;  2RUK B;  1WI1 A;  1MI1 A;  1OQN A;  4PNK A;  1EVH A;  3O96 A;  4MT7 A;  2YT0 A;  4HAY B;  3NWA A;  1X05 A;  1PMS A;  2I1J A;  4GPT B;  3HK0 A;  1V88 A;  1UNR A;  3D8D A;  4HAZ B;  4HAX B;  1FB8 A;  2LOX A;  5C16 A;  4HDQ A;  1BAK A;  3B77 A;  1M7E A;  3ODX A;  3VOQ A;  2K2J A;  5JHG A;  1OY2 A;  2DYN A;  3TW1 A;  3CIK A;  1TJ6 A;  4A6F B;  2RGN B;  5IRS A;  1NI2 A;  2KCJ A;  2R2Y A;  3NWD A;  2N23 A;  1E5W A;  2D11 A;  4PQ0 A;  1WGQ A;  3DCX A;  3ODW A;  1FGZ A;  3A98 B;  5GOW B;  4KHB A;  5C6R A;  2FJU B;  3U8Z A;  2I5F A;  1U27 A;  2J0J A;  1Q67 A;  1I2H A;  2E2X A;  2R09 A;  4KHB B;  5FI1 A;  2DYQ A;  2J59 M;  3PG7 A;  4GMX B;  1AQC A;  2J0K A;  4F7G A;  5D3W A;  2LOZ A;  2GCL A;  5D3V A;  3AU5 A;  1DRO A;  1PLS A;  2YRY A;  2NMB A;  1DDW A;  4C0A A;  2P0H A;  3RCP A;  3ZDT A;  2CRF A;  2P0D A;  2N0Y A;  3PVW A;  1FOE A;  1GC7 A;  1FHX A;  1ZM0 A;  2D9X A;  4HAW B;  1WJ1 A;  2KGX B;  1SGH A;  2HTH B;  4WSF A;  1FAO A;  2RSG A;  5I2M A;  4BBK A;  1FHO A;  3BJI A;  3HW2 B;  1U5F A;  1XKE A;  4QXA B;  4ZRK A;  2DTC A;  4MY6 A;  1I7A A;  4CYE A;  1X1G A;  1MIZ B;  2D4Q A;  2ELB A;  1N3H A;  2CAY A;  2KUP A;  1MPH A;  4IAP A;  4OT1 A;  4A6F A;  2UZR A;  3OHM B;  4YL8 A;  4EMO A;  2NBV A;  3LJU X;  4KVG B;  3QIJ A;  5FI0 A;  3A8P A;  3WYF B;  4L1R A;  3MPX A;  1DDM A;  1U5E A;  4K2P A;  2UZS A;  2CY5 A;  5HE1 A;  1AWE A;  4KAX B;  2MDX A;  2HE7 A; 
#chains in the Genus database with same CATH homology
 1XR0 B;  1J0W A;  3AJ4 A;  1UNP A;  2YT1 A;  2VKI A;  2MFQ A;  2LYD A;  3DXC A;  3PSC A;  3TFM A;  1U2B A;  1H10 A;  2M38 A;  4WVF B;  1ZC4 B;  2LKO A;  1P6S A;  2YS3 A;  1X1F A;  1EAZ A;  5KQ1 A;  3TCA A;  1RJ2 A;  4YON A;  3F0W A;  3ULB A;  2DHK A;  1KZ7 A;  2L2I A;  1GC6 A;  4TYZ A;  5C5B B;  1ISN A;  1P3R A;  3SO6 A;  4K2O A;  2OTX A;  2K00 A;  1GG3 A;  5JP4 A;  1V5P A;  1H4R A;  4HHV A;  2V76 A;  1TQZ A;  4ZRI A;  3P6A A;  3ULC A;  2PZ1 A;  2YSZ A;  4KHA A;  1FGY A;  1OMW A;  2ADZ A;  3PP2 A;  2D10 A;  1MAI A;  3KY9 A;  3A8Q A;  2LG1 A;  1XX0 A;  2EMS A;  3PZD A;  2DHJ A;  1MKE A;  2DX1 A;  3KRW A;  1UPQ A;  1BTN A;  2Z0Q A;  5D27 A;  1V61 A;  3FEH A;  3D8E A;  3PVU A;  3SNH A;  5C79 A;  4HAV B;  2MWN B;  4HB2 B;  3BIN A;  3DXD A;  1X11 A;  1QQG A;  5HE2 A;  4HAU B;  2J0M A;  4DX8 A;  2G35 A;  3IVF A;  2DKQ A;  1ZC3 B;  1Y5O A;  3D8F A;  1W1D A;  3UZT A;  1TXD A;  1V5M A;  4GXB A;  2D9W A;  1KI1 B;  5DH9 B;  5EFX A;  4GMV A;  2QKL A;  2VSZ A;  3TO1 A;  5C5B A;  2W2X D;  1U29 A;  4XWX A;  3AU4 A;  3V5W A;  2D9V A;  4EKU A;  2I5C A;  3ODO A;  4GN1 A;  5LON B;  4HB4 B;  4KHO A;  1EGX A;  3KZ1 A;  4H8S A;  4NY0 A;  2DN6 A;  3SUZ A;  1ZSQ A;  2LUL A;  2D2Q A;  4K81 A;  2QKM A;  3SV1 A;  3WA0 A;  1W1H A;  1UPR A;  2L1C A;  4NSW A;  2MKR A;  1FHW A;  4D0N B;  4B6H A;  2RNR B;  4TKN A;  4Z2N A;  2ROZ B;  4GZU A;  5LOP B;  4Z2M B;  2AL6 A;  3OAN A;  4Y94 A;  3KSY A;  4MK0 A;  4A6K A;  1DYN A;  5JLJ B;  2DLW A;  2YS5 A;  2NZ8 B;  1WGU A;  2GJY A;  2Z0P A;  1WVH A;  5DIF B;  1M7R A;  1LW3 A;  2EC1 A;  2IFS A;  4WJ7 A;  5DI9 B;  1BTK A;  2BCJ A;  2RLO A;  3PVL A;  3T06 A;  1K5G B;  5J3Y A;  2COC A;  1NTY A;  3F5R A;  5HE0 A;  1W1G A;  3U7D A;  2IYB A;  2W2X C;  5CLL B;  4L6E A;  1UNQ A;  3QBV B;  1MK7 B;  2AEH A;  1XOD A;  2D9Y A;  5DHF B;  5D3X A;  1XD4 A;  1WG7 A;  1DDV A;  2P0F A;  2M14 A;  4IOY X;  1U5D A;  1ZVR A;  1J19 A;  1MIX A;  3G9W A;  2DA0 A;  4HB0 B;  1QC6 A;  5D3Y A;  3GYO A;  4F7H A;  4EJN A;  5KQ4 A;  5J3Q A;  5KCV A;  1MK9 B;  4K17 A;  3X23 A;  3P7Z A;  2H7E A;  2CY4 A;  2COD A;  5HE3 A;  3MDB C;  4A5K A;  2DFK A;  4P7I A;  1NTV A;  1NU2 A;  5J3T A;  2EMT A;  2OQB A;  1Z87 A;  5JHH A;  3ML4 A;  2ZPY A;  1PFJ A;  2YS1 A;  3GYP A;  2COF A;  5CLQ B;  3ZVR A;  2XQN M;  2VRW B;  1DBH A;  4HDO A;  2ELA A;  2RVB B;  1U5G A;  1P5T A;  1XCG A;  2Q13 A;  2D9Z A;  2Y8G A;  3NSU A;  1IRS A;  1B55 A;  2R0D A;  3CXB B;  2DKP A;  4HAT B;  2Z0O A;  4HB3 B;  3QWM A;  4ZRJ A;  1EF1 A;  4CHJ A;  2P8V A;  1Y19 B;  2K2U A;  4CHM A;  3FM8 C;  2JP2 A;  2Y8F A;  1SHC A;  1RRP B;  2UVM A;  2YVC A;  4DXA B;  3M1I B;  2DX5 A;  2W2W A;  3KRX A;  2H7D A;  3VIA A;  1K5D B;  2X18 A;  1LB1 A;  2GCJ A;  2ROV A;  1WJM A;  3DXE A;  4F7U P;  2I1K A;  2Y7B A;  4DBB A;  1X86 A;  1BWN A;  3SYX A;  2YF0 A;  1V5U A;  2COA A;  2FJL A;  4A6H A;  5DHA B;  4DX9 0;  1V89 A;  3FSS A;  1UEF A;  3TVV A;  1KZG A;  2GS0 A;  3PEG A;  2EJ8 A;  3HQC A;  2DHI A;  3N7C A;  5L81 A;  4IFS A;  2RUK B;  1WI1 A;  1OQN A;  4PNK A;  1EVH A;  3O96 A;  4MT7 A;  2YT0 A;  4HAY B;  1X05 A;  1PMS A;  2I1J A;  4GPT B;  3HK0 A;  1V88 A;  1UNR A;  3D8D A;  4HAZ B;  4HAX B;  1FB8 A;  2LOX A;  5C16 A;  4HDQ A;  1BAK A;  1M7E A;  3ODX A;  3VOQ A;  2K2J A;  5JHG A;  1OY2 A;  2DYN A;  3TW1 A;  3CIK A;  1TJ6 A;  4A6F B;  2RGN B;  1NI2 A;  2KCJ A;  2N23 A;  1E5W A;  2D11 A;  4PQ0 A;  1WGQ A;  3ODW A;  1FGZ A;  3A98 B;  5GOW B;  5C6R A;  3U8Z A;  2I5F A;  1U27 A;  2J0J A;  1Q67 A;  1I2H A;  2E2X A;  2R09 A;  4KHB B;  5FI1 A;  2DYQ A;  2J59 M;  3PG7 A;  4GMX B;  1AQC A;  2J0K A;  4F7G A;  5D3W A;  2LOZ A;  2GCL A;  5D3V A;  3AU5 A;  1DRO A;  1PLS A;  2YRY A;  2NMB A;  1DDW A;  4C0A A;  2P0H A;  3RCP A;  3ZDT A;  2CRF A;  2P0D A;  2N0Y A;  3PVW A;  1FOE A;  1GC7 A;  4HAW B;  1FHX A;  1ZM0 A;  2D9X A;  1WJ1 A;  2KGX B;  1SGH A;  2HTH B;  4WSF A;  1FAO A;  2RSG A;  4BBK A;  1FHO A;  3BJI A;  3HW2 B;  1U5F A;  1XKE A;  4ZRK A;  2DTC A;  4MY6 A;  1I7A A;  4CYE A;  1X1G A;  1MIZ B;  2D4Q A;  2ELB A;  1N3H A;  4IAP A;  2CAY A;  1MPH A;  2KUP A;  4A6F A;  2UZR A;  4YL8 A;  4EMO A;  3LJU X;  4KVG B;  3QIJ A;  5FI0 A;  3A8P A;  3WYF B;  3MPX A;  1DDM A;  1U5E A;  4K2P A;  2UZS A;  2CY5 A;  5HE1 A;  1AWE A;  4KAX B;  2MDX A;  2HE7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...