2LKOA

Structural basis of phosphoinositide binding to kindlin-2 pleckstrin homology domain in regulating integrin activation
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
138
structure length
138
Chain Sequence
GSHMGDITSIPELADYIKVFKPKKLTLKGYKQYWCTFKDTSISCYKSKEESSGTPAHQMNLRGCEVTPDVNISGQKFNIKLLIPVAEGMNEIWLRCDNEKQYAHWMAACRLASKGKTMADSSYNLEVQNILSFLKMQH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Cell adhesion
molecule keywords Fermitin family homolog 2
publication title Structural basis of phosphoinositide binding to kindlin-2 protein pleckstrin homology domain in regulating integrin activation.
pubmed doi rcsb
source organism Homo sapiens
total genus 15
structure length 138
sequence length 138
ec nomenclature
pdb deposition date 2011-10-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00169 PH PH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2lkoA00
2Q13A 5D3YA 3V5WA 4HATB 1WGUA 4GXBA 3MPXA 3CXBB 4GPTB 4HAWB 3D8DA 4KHOA 1MPHA 3KRWA 4EKUA 4IAPA 1DROA 1UEFA 3MDBC 2L1CA 1E5WA 4F7HA 2VKIA 1W1DA 2I1JA 5HE0A 3RCPA 1P3RA 2Z0OA 1DDWA 3VOQA 1NU2A 1BAKA 3T06A 2QKLA 4HAZB 4A6FA 4YL8A 4EJNA 2RLOA 2KUPA 2D9WA 5D27A 2J0KA 3A8QA 1QC6A 1B55A 3TCAA 1UNRA 1M7RA 4YONA 2J0JA 2YF0A 1J0WA 4K17A 5C79A 3AU4A 3PEGA 1Q67A 2G35A 1KZGA 2Y7BA 1LW3A 1U5EA 3A8PA 1EAZA 1I2HA 2W2XC 2K2JA 1M7EA 4ZRIA 5D3VA 4L6EA 2J0MA 5J3TA 3GYOA 2KGXB 5DHFB 4BBKA 4HAYB 1BTKA 2LOZA 1XODA 2EMSA 4F7GA 4HDOA 5DH9B 3ML4A 2RSGA 1X1GA 2YT0A 3TW1A 2W2XD 3AJ4A 3VIAA 4C0AA 1GG3A 3PP2A 1FB8A 1DDMA 3PZDA 1PLSA 2AEHA 1WGQA 3ODOA 3U8ZA 1WI1A 4WVFB 2L2IA 1U2BA 2YS3A 2JP2A 4ZRKA 2PZ1A 1RJ2A 2D11A 4ZRJA 3SNHA 3O96A 1H10A 2RVBB 1GC6A 4PQ0A 4A5KA 1V61A 2MWNB 4HAVB 4NY0A 2RNRB 2DX5A 1RRPB 1UPQA 1MKEA 2CAYA 1FAOA 2LKOA 1W1GA 3DXEA 2IYBA 3P6AA 1ZM0A 2EMTA 4KHAA 2QKMA 2H7EA 4A6HA 2Z0PA 1MK9B 2ZPYA 1DDVA 3PVUA 2DTCA 1X05A 3ZDTA 1NI2A 3FSSA 1AQCA 4DXAB 4HB0B 4A6FB 1PFJA 5HE1A 1U29A 3ODWA 2ELBA 2LOXA 2RUKB 3DXCA 5EFXA 4H8SA 3U7DA 2GS0A 5C6RA 2N23A 2R0DA 1QQGA 1V89A 5JP4A 2D9VA 1OQNA 1WVHA 2Z0QA 3P7ZA 3PVLA 2DN6A 4EMOA 1U5GA 5JHGA 3QBVB 1MIZB 2HE7A 4GMXB 2FJLA 3LJUX 5DHAB 2V76A 5CLLB 4A6KA 5JLJB 2BCJA 2LYDA 2OQBA 1LB1A 1NTYA 2D4QA 1GC7A 1FHXA 5C5BA 2HTHB 2P0DA 2M38A 5JHHA 1SGHA 2I1KA 3IVFA 2EC1A 2R09A 1OY2A 1V88A 1IRSA 1EF1A 3AU5A 2I5FA 1WJMA 1ZVRA 5C16A 2KCJA 1K5DB 4CYEA 4WSFA 2DHIA 2IFSA 1X11A 2COAA 1P6SA 5KQ1A 2H7DA 1DBHA 3M1IB 1X86A 3A98B 3PG7A 2J59M 1Y5OA 2LG1A 4HAXB 4CHJA 4KAXB 1DYNA 2P0FA 2NZ8B 5KCVA 3OANA 3ODXA 1SHCA 2LULA 1MK7B 5LOPB 1V5UA 4HB2B 4K2PA 3G9WA 4HAUB 2AL6A 4P7IA 1Y19B 4DX90 4WJ7A 3BINA 1WG7A 3ULCA 2DHKA 4KHBB 2CY5A 2GCJA 1V5MA 2DX1A 3HQCA 1PMSA 2DFKA 1I7AA 1WJ1A 4Y94A 4CHMA 3X23A 5KQ4A 5L81A 1FHWA 2P8VA 4MY6A 4TKNA 2K2UA 3D8FA 1UPRA 3WA0A 3PSCA 3UZTA 2NMBA 1ZC4B 2GCLA 4PNKA 3ULBA 4Z2NA 1OMWA 3D8EA 1XCGA 1MAIA 2P0HA 3KSYA 2DKQA 2RGNB 3ZVRA 4HHVA 3DXDA 4D0NB 2COFA 4F7UP 2M14A 1KZ7A 2D9XA 5FI0A 4HDQA 3HW2B 1K5GB 1TQZA 3KRXA 3SO6A 5J3QA 5HE2A 2CRFA 3KY9A 2OTXA 3FM8C 1EVHA 2Y8FA 2D9YA 3F5RA 2ROVA 4B6HA 2D9ZA 1FOEA 1EGXA 2ADZA 2VSZA 2CODA 1TXDA 1UNPA 5FI1A 2UZRA 4XWXA 4GN1A 2YVCA 1Z87A 2DYNA 3BJIA 2DLWA 3QIJA 5C5BB 4NSWA 5CLQB 1W1HA 5D3XA 3SV1A 4GZUA 1FGZA 1TJ6A 3FEHA 5J3YA 2YS5A 4MT7A 1BTNA 5D3WA 1V5PA 2E2XA 1ISNA 2ROZB 3TFMA 1ZC3B 2I5CA 3CIKA 1XX0A 3HK0A 2DYQA 3N7CA 2MDXA 2XQNM 2YT1A 3F0WA 3GYPA 4MK0A 2D2QA 1MIXA 3WYFB 3TO1A 1UNQA 2MKRA 1J19A 2CY4A 2DA0A 4K2OA 1XD4A 2DKPA 2N0YA 1U27A 2COCA 4K81A 2Y8GA 5HE3A 1KI1B 1BWNA 2YS1A 3KZ1A 5LONB 3QWMA 2EJ8A 1FHOA 3PVWA 4KVGB 2D10A 1P5TA 1ZSQA 1U5FA 2YRYA 1NTVA 1U5DA 5DIFB 2UVMA 4HB4B 5GOWB 4GMVA 2ELAA 2YSZA 2X18A 3SYXA 2VRWB 4HB3B 1AWEA 1X1FA 4Z2MB 1H4RA 2K00A 2MFQA 3SUZA 4IFSA 4IOYX 1XKEA 2GJYA 5DI9B 1XR0B 4TYZA 4DX8A 1FGYA 3NSUA 4DBBA 2W2WA 1N3HA 2DHJA 3TVVA 2UZSA
chains in the Genus database with same CATH superfamily
2Q13A 5D3YA 3V5WA 4HATB 1WGUA 4GXBA 4QJ3B 3MPXA 3CXBB 4GPTB 4HAWB 3D8DA 4KHOA 1MPHA 3KRWA 4EKUA 4IAPA 1DROA 1UEFA 3MDBC 2L1CA 1E5WA 4F7HA 2VKIA 1W1DA 2I1JA 2NBVA 5HE0A 3RCPA 1P3RA 2Z0OA 1DDWA 3VOQA 1NU2A 1BAKA 3T06A 2QKLA 4HAZB 4A6FA 4YL8A 4EJNA 2RLOA 2KUPA 4OSNA 2D9WA 5D27A 2J0KA 3A8QA 1QC6A 1B55A 4HSIA 4OT1A 3TCAA 3NWFA 1UNRA 1M7RA 4YONA 2Z14A 2J0JA 2YF0A 1J0WA 4K17A 5C79A 3AU4A 3PEGA 4D6WA 1Q67A 2G35A 1KZGA 2Y7BA 1LW3A 1U5EA 3A8PA 1EAZA 1I2HA 2W2XC 2K2JA 1M7EA 4ZRIA 5D3VA 4L6EA 2J0MA 5J3TA 3GYOA 2KGXB 2KIGA 5DHFB 4BBKA 4HAYB 1BTKA 2KIEA 2LOZA 1XODA 2EMSA 4F7GA 4HDOA 5DH9B 3ML4A 2Z13A 2RSGA 1X1GA 2Z4DA 2YT0A 3TW1A 2W2XD 3AJ4A 3VIAA 4C0AA 1GG3A 3PP2A 1FB8A 1DDMA 3PZDA 1PLSA 2AEHA 1WGQA 3ODOA 3U8ZA 1WI1A 1MI1A 4WVFB 2L2IA 1U2BA 2YS3A 2JP2A 4ZRKA 2PZ1A 1RJ2A 2D11A 4ZRJA 3SNHA 3O96A 1H10A 2RVBB 4KHBA 1GC6A 4PQ0A 4A5KA 1V61A 2MWNB 4HAVB 4NY0A 4QJ5B 2RNRB 2DX5A 1RRPB 1UPQA 1MKEA 3U12A 2CAYA 1FAOA 2LKOA 1W1GA 2KR0A 3DXEA 2IYBA 3P6AA 1ZM0A 2EMTA 4KHAA 2QKMA 2H7EA 4A6HA 2Z0PA 1MK9B 2ZPYA 1DDVA 3PVUA 2DTCA 1X05A 3OHMB 3ZDTA 1NI2A 3FSSA 1AQCA 4DXAB 4HB0B 4A6FB 1PFJA 5HE1A 1U29A 2ELBA 2LOXA 2RUKB 3ODWA 3DXCA 3NWDA 5EFXA 4H8SA 3U7DA 2GS0A 5C6RA 2N23A 2R0DA 1QQGA 4CSQA 1V89A 5JP4A 2D9VA 1OQNA 1WVHA 2R2YA 3DCXA 2Z0QA 3P7ZA 3PVLA 2DN6A 4EMOA 1U5GA 5JHGA 5M4YB 3QBVB 1MIZB 2HE7A 4GMXB 2FJLA 3LJUX 5DHAB 2V76A 5CLLB 4A6KA 5JLJB 2BCJA 2LYDA 2OQBA 1LB1A 1NTYA 2D4QA 1GC7A 1FHXA 5C5BA 2HTHB 2P0DA 2M38A 5JHHA 1SGHA 2I1KA 2GUMA 3IVFA 2EC1A 2R09A 1OY2A 1V88A 3HIEA 1IRSA 1EF1A 3AU5A 2I5FA 4GNKB 1WJMA 1ZVRA 5C16A 2KCJA 1K5DB 4CYEA 4WSFA 2DHIA 2IFSA 1X11A 2COAA 1P6SA 5KQ1A 2H7DA 1DBHA 3M1IB 1X86A 3A98B 5I2SA 3PG7A 2J59M 1Y5OA 2Z59A 2LG1A 4HAXB 2YT2A 4CHJA 4KAXB 3B77A 1DYNA 2P0FA 2NZ8B 5KCVA 3OANA 3ODXA 1SHCA 2LULA 1MK7B 2ZKMX 5LOPB 1V5UA 4HB2B 4K2PA 3G9WA 4HAUB 2AL6A 4P7IA 1Y19B 4DX90 4WJ7A 3BINA 1WG7A 3ULCA 2FJUB 2DHKA 5LG4B 4KHBB 2CY5A 2GCJA 1V5MA 2DX1A 3HQCA 1PMSA 2DFKA 1I7AA 1WJ1A 4Y94A 4CHMA 3NW8A 3X23A 5KQ4A 5L81A 1FHWA 2P8VA 4QXAB 4MY6A 4TKNA 2K2UA 3D8FA 1UPRA 3WA0A 3PSCA 3UZTA 2NMBA 3FVCA 1ZC4B 2GCLA 4PNKA 3ULBA 4Z2NA 1OMWA 3D8EA 1XCGA 1MAIA 2P0HA 3KSYA 2DKQA 3NWAA 2RGNB 3ZVRA 4HHVA 3DXDA 4D0NB 2COFA 4F7UP 2M14A 1KZ7A 2D9XA 5FI0A 4HDQA 3HW2B 1K5GB 1TQZA 3KRXA 3SO6A 2K8EA 5J3QA 5HE2A 2CRFA 3KY9A 2OTXA 3FM8C 1EVHA 2Y8FA 2D9YA 3F5RA 2ROVA 4B6HA 2D9ZA 1FOEA 1EGXA 2ADZA 2VSZA 2CODA 1TXDA 1UNPA 4DIXA 4GOUA 5FI1A 2UZRA 4XWXA 4GN1A 2YVCA 1Z87A 2DYNA 3BJIA 2DLWA 3QIJA 5C5BB 4NSWA 5CLQB 1W1HA 3HSAA 5D3XA 3SV1A 4L1RA 4GZUA 1FGZA 1TJ6A 3FEHA 5J3YA 2YS5A 4MT7A 1BTNA 5D3WA 1V5PA 2E2XA 1ISNA 2K49A 2ROZB 3TFMA 1ZC3B 2I5CA 3CIKA 1XX0A 3HK0A 2DYQA 3A58A 1ZYIA 3N7CA 2MDXA 2XQNM 2YT1A 3F0WA 3GYPA 4MK0A 2D2QA 1MIXA 3WYFB 3TO1A 1UNQA 2MKRA 1J19A 2CY4A 2DA0A 4K2OA 4QJ4B 1XD4A 2DKPA 2N0YA 1U27A 2COCA 5I2MA 4K81A 2Y8GA 5HE3A 1KI1B 1BWNA 2YS1A 3KZ1A 5LONB 3QWMA 2EJ8A 1FHOA 3PVWA 4KVGB 2D10A 1P5TA 1ZSQA 1U5FA 2YRYA 1NTVA 1U5DA 5DIFB 2UVMA 4HB4B 5GOWB 2KUQA 4GMVA 5IRSA 2ELAA 2YSZA 2X18A 2RRFA 3SYXA 2VRWB 4HB3B 1AWEA 1X1FA 4Z2MB 1H4RA 2K00A 2MFQA 3SUZA 4IFSA 4IOYX 1XKEA 2GJYA 5DI9B 1XR0B 4TYZA 4DX8A 1FGYA 3NSUA 4DBBA 2W2WA 1N3HA 2DHJA 3TVVA 1T77A 2UZSA
chains in the Genus database with same CATH topology
2Q13A 5D3YA 3V5WA 4HATB 1WGUA 4GXBA 3MPXA 3CXBB 4GPTB 4HAWB 3D8DA 4KHOA 1MPHA 3KRWA 4EKUA 4IAPA 1DROA 1UEFA 3MDBC 2L1CA 1E5WA 4F7HA 2VKIA 1W1DA 2I1JA 5HE0A 3RCPA 1P3RA 2Z0OA 1DDWA 3VOQA 1NU2A 1BAKA 3T06A 2QKLA 4HAZB 4A6FA 4YL8A 4EJNA 2RLOA 2KUPA 2D9WA 5D27A 2J0KA 3A8QA 1QC6A 1B55A 3TCAA 1UNRA 1M7RA 4YONA 2J0JA 2YF0A 1J0WA 4K17A 5C79A 3AU4A 3PEGA 1Q67A 2G35A 1KZGA 2Y7BA 1LW3A 1U5EA 3A8PA 1EAZA 1I2HA 2W2XC 2K2JA 1M7EA 4ZRIA 5D3VA 4L6EA 2J0MA 5J3TA 3GYOA 2KGXB 5DHFB 4BBKA 4HAYB 1BTKA 2LOZA 1XODA 2EMSA 4F7GA 4HDOA 5DH9B 3ML4A 2RSGA 1X1GA 2YT0A 3TW1A 2W2XD 3AJ4A 3VIAA 4C0AA 1GG3A 3PP2A 1FB8A 1DDMA 3PZDA 1PLSA 2AEHA 1WGQA 3ODOA 3U8ZA 1WI1A 4WVFB 2L2IA 1U2BA 2YS3A 2JP2A 4ZRKA 2PZ1A 1RJ2A 2D11A 4ZRJA 3SNHA 3O96A 1H10A 2RVBB 1GC6A 4PQ0A 4A5KA 1V61A 2MWNB 4HAVB 4NY0A 2RNRB 2DX5A 1RRPB 1UPQA 1MKEA 2CAYA 1FAOA 2LKOA 1W1GA 3DXEA 2IYBA 3P6AA 1ZM0A 2EMTA 4KHAA 2QKMA 2H7EA 4A6HA 2Z0PA 1MK9B 2ZPYA 1DDVA 3PVUA 2DTCA 1X05A 3ZDTA 1NI2A 3FSSA 1AQCA 4DXAB 4HB0B 4A6FB 1PFJA 5HE1A 1U29A 3ODWA 2ELBA 2LOXA 2RUKB 3DXCA 5EFXA 4H8SA 3U7DA 2GS0A 5C6RA 2N23A 2R0DA 1QQGA 1V89A 5JP4A 2D9VA 1OQNA 1WVHA 2Z0QA 3P7ZA 3PVLA 2DN6A 4EMOA 1U5GA 5JHGA 3QBVB 1MIZB 2HE7A 4GMXB 2FJLA 3LJUX 5DHAB 2V76A 5CLLB 4A6KA 5JLJB 2BCJA 2LYDA 2OQBA 1LB1A 1NTYA 2D4QA 1GC7A 1FHXA 5C5BA 2HTHB 2P0DA 2M38A 5JHHA 1SGHA 2I1KA 3IVFA 2EC1A 2R09A 1OY2A 1V88A 1IRSA 1EF1A 3AU5A 2I5FA 1WJMA 1ZVRA 5C16A 2KCJA 1K5DB 4CYEA 4WSFA 2DHIA 2IFSA 1X11A 2COAA 1P6SA 5KQ1A 2H7DA 1DBHA 3M1IB 1X86A 3A98B 3PG7A 2J59M 1Y5OA 2LG1A 4HAXB 4CHJA 4KAXB 1DYNA 2P0FA 2NZ8B 5KCVA 3OANA 3ODXA 1SHCA 2LULA 1MK7B 5LOPB 1V5UA 4HB2B 4K2PA 3G9WA 4HAUB 2AL6A 4P7IA 1Y19B 4DX90 4WJ7A 3BINA 1WG7A 3ULCA 2DHKA 4KHBB 2CY5A 2GCJA 1V5MA 2DX1A 3HQCA 1PMSA 2DFKA 1I7AA 1WJ1A 4Y94A 4CHMA 3X23A 5KQ4A 5L81A 1FHWA 2P8VA 4MY6A 4TKNA 2K2UA 3D8FA 1UPRA 3WA0A 3PSCA 3UZTA 2NMBA 1ZC4B 2GCLA 4PNKA 3ULBA 4Z2NA 1OMWA 3D8EA 1XCGA 1MAIA 2P0HA 3KSYA 2DKQA 2RGNB 3ZVRA 4HHVA 3DXDA 4D0NB 2COFA 4F7UP 2M14A 1KZ7A 2D9XA 5FI0A 4HDQA 3HW2B 1K5GB 1TQZA 3KRXA 3SO6A 5J3QA 5HE2A 2CRFA 3KY9A 2OTXA 3FM8C 1EVHA 2Y8FA 2D9YA 3F5RA 2ROVA 4B6HA 2D9ZA 1FOEA 1EGXA 2ADZA 2VSZA 2CODA 1TXDA 1UNPA 5FI1A 2UZRA 4XWXA 4GN1A 2YVCA 1Z87A 2DYNA 3BJIA 2DLWA 3QIJA 5C5BB 4NSWA 5CLQB 1W1HA 5D3XA 3SV1A 4GZUA 1FGZA 1TJ6A 3FEHA 5J3YA 2YS5A 4MT7A 1BTNA 5D3WA 1V5PA 2E2XA 1ISNA 2ROZB 3TFMA 1ZC3B 2I5CA 3CIKA 1XX0A 3HK0A 2DYQA 3N7CA 2MDXA 2XQNM 2YT1A 3F0WA 3GYPA 4MK0A 2D2QA 1MIXA 3WYFB 3TO1A 1UNQA 2MKRA 1J19A 2CY4A 2DA0A 4K2OA 1XD4A 2DKPA 2N0YA 1U27A 2COCA 4K81A 2Y8GA 5HE3A 1KI1B 1BWNA 2YS1A 3KZ1A 5LONB 3QWMA 2EJ8A 1FHOA 3PVWA 4KVGB 2D10A 1P5TA 1ZSQA 1U5FA 2YRYA 1NTVA 1U5DA 5DIFB 2UVMA 4HB4B 5GOWB 4GMVA 2ELAA 2YSZA 2X18A 3SYXA 2VRWB 4HB3B 1AWEA 1X1FA 4Z2MB 1H4RA 2K00A 2MFQA 3SUZA 4IFSA 4IOYX 1XKEA 2GJYA 5DI9B 1XR0B 4TYZA 4DX8A 1FGYA 3NSUA 4DBBA 2W2WA 1N3HA 2DHJA 3TVVA 2UZSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Q13 A;  5D3Y A;  3V5W A;  4HAT B;  1WGU A;  4GXB A;  3MPX A;  3CXB B;  4GPT B;  4HAW B;  3D8D A;  4KHO A;  1MPH A;  3KRW A;  4EKU A;  4IAP A;  1DRO A;  1UEF A;  3MDB C;  2L1C A;  1E5W A;  4F7H A;  2VKI A;  1W1D A;  2I1J A;  5HE0 A;  3RCP A;  1P3R A;  2Z0O A;  1DDW A;  3VOQ A;  1NU2 A;  1BAK A;  3T06 A;  2QKL A;  4HAZ B;  4A6F A;  4YL8 A;  4EJN A;  2RLO A;  2KUP A;  2D9W A;  5D27 A;  2J0K A;  3A8Q A;  1QC6 A;  1B55 A;  3TCA A;  1UNR A;  1M7R A;  4YON A;  2J0J A;  2YF0 A;  1J0W A;  4K17 A;  5C79 A;  3AU4 A;  3PEG A;  1Q67 A;  2G35 A;  1KZG A;  2Y7B A;  1LW3 A;  1U5E A;  3A8P A;  1EAZ A;  1I2H A;  2W2X C;  2K2J A;  1M7E A;  4ZRI A;  5D3V A;  4L6E A;  2J0M A;  5J3T A;  3GYO A;  2KGX B;  5DHF B;  4BBK A;  4HAY B;  1BTK A;  2LOZ A;  1XOD A;  2EMS A;  4F7G A;  4HDO A;  5DH9 B;  3ML4 A;  2RSG A;  1X1G A;  2YT0 A;  3TW1 A;  2W2X D;  3AJ4 A;  3VIA A;  4C0A A;  1GG3 A;  3PP2 A;  1FB8 A;  1DDM A;  3PZD A;  1PLS A;  2AEH A;  1WGQ A;  3ODO A;  3U8Z A;  1WI1 A;  4WVF B;  2L2I A;  1U2B A;  2YS3 A;  2JP2 A;  4ZRK A;  2PZ1 A;  1RJ2 A;  2D11 A;  4ZRJ A;  3SNH A;  3O96 A;  1H10 A;  2RVB B;  1GC6 A;  4PQ0 A;  4A5K A;  1V61 A;  2MWN B;  4HAV B;  4NY0 A;  2RNR B;  2DX5 A;  1RRP B;  1UPQ A;  1MKE A;  2CAY A;  1FAO A;  2LKO A;  1W1G A;  3DXE A;  2IYB A;  3P6A A;  1ZM0 A;  2EMT A;  4KHA A;  2QKM A;  2H7E A;  4A6H A;  2Z0P A;  1MK9 B;  2ZPY A;  1DDV A;  3PVU A;  2DTC A;  1X05 A;  3ZDT A;  1NI2 A;  3FSS A;  1AQC A;  4DXA B;  4HB0 B;  4A6F B;  1PFJ A;  5HE1 A;  1U29 A;  3ODW A;  2ELB A;  2LOX A;  2RUK B;  3DXC A;  5EFX A;  4H8S A;  3U7D A;  2GS0 A;  5C6R A;  2N23 A;  2R0D A;  1QQG A;  1V89 A;  5JP4 A;  2D9V A;  1OQN A;  1WVH A;  2Z0Q A;  3P7Z A;  3PVL A;  2DN6 A;  4EMO A;  1U5G A;  5JHG A;  3QBV B;  1MIZ B;  2HE7 A;  4GMX B;  2FJL A;  3LJU X;  5DHA B;  2V76 A;  5CLL B;  4A6K A;  5JLJ B;  2BCJ A;  2LYD A;  2OQB A;  1LB1 A;  1NTY A;  2D4Q A;  1GC7 A;  1FHX A;  5C5B A;  2HTH B;  2P0D A;  2M38 A;  5JHH A;  1SGH A;  2I1K A;  3IVF A;  2EC1 A;  2R09 A;  1OY2 A;  1V88 A;  1IRS A;  1EF1 A;  3AU5 A;  2I5F A;  1WJM A;  1ZVR A;  5C16 A;  2KCJ A;  1K5D B;  4CYE A;  4WSF A;  2DHI A;  2IFS A;  1X11 A;  2COA A;  1P6S A;  5KQ1 A;  2H7D A;  1DBH A;  3M1I B;  1X86 A;  3A98 B;  3PG7 A;  2J59 M;  1Y5O A;  2LG1 A;  4HAX B;  4CHJ A;  4KAX B;  1DYN A;  2P0F A;  2NZ8 B;  5KCV A;  3OAN A;  3ODX A;  1SHC A;  2LUL A;  1MK7 B;  5LOP B;  1V5U A;  4HB2 B;  4K2P A;  3G9W A;  4HAU B;  2AL6 A;  4P7I A;  1Y19 B;  4DX9 0;  4WJ7 A;  3BIN A;  1WG7 A;  3ULC A;  2DHK A;  4KHB B;  2CY5 A;  2GCJ A;  1V5M A;  2DX1 A;  3HQC A;  1PMS A;  2DFK A;  1I7A A;  1WJ1 A;  4Y94 A;  4CHM A;  3X23 A;  5KQ4 A;  5L81 A;  1FHW A;  2P8V A;  4MY6 A;  4TKN A;  2K2U A;  3D8F A;  1UPR A;  3WA0 A;  3PSC A;  3UZT A;  2NMB A;  1ZC4 B;  2GCL A;  4PNK A;  3ULB A;  4Z2N A;  1OMW A;  3D8E A;  1XCG A;  1MAI A;  2P0H A;  3KSY A;  2DKQ A;  2RGN B;  3ZVR A;  4HHV A;  3DXD A;  4D0N B;  2COF A;  4F7U P;  2M14 A;  1KZ7 A;  2D9X A;  5FI0 A;  4HDQ A;  3HW2 B;  1K5G B;  1TQZ A;  3KRX A;  3SO6 A;  5J3Q A;  5HE2 A;  2CRF A;  3KY9 A;  2OTX A;  3FM8 C;  1EVH A;  2Y8F A;  2D9Y A;  3F5R A;  2ROV A;  4B6H A;  2D9Z A;  1FOE A;  1EGX A;  2ADZ A;  2VSZ A;  2COD A;  1TXD A;  1UNP A;  5FI1 A;  2UZR A;  4XWX A;  4GN1 A;  2YVC A;  1Z87 A;  2DYN A;  3BJI A;  2DLW A;  3QIJ A;  5C5B B;  4NSW A;  5CLQ B;  1W1H A;  5D3X A;  3SV1 A;  4GZU A;  1FGZ A;  1TJ6 A;  3FEH A;  5J3Y A;  2YS5 A;  4MT7 A;  1BTN A;  5D3W A;  1V5P A;  2E2X A;  1ISN A;  2ROZ B;  3TFM A;  1ZC3 B;  2I5C A;  3CIK A;  1XX0 A;  3HK0 A;  2DYQ A;  3N7C A;  2MDX A;  2XQN M;  2YT1 A;  3F0W A;  3GYP A;  4MK0 A;  2D2Q A;  1MIX A;  3WYF B;  3TO1 A;  1UNQ A;  2MKR A;  1J19 A;  2CY4 A;  2DA0 A;  4K2O A;  1XD4 A;  2DKP A;  2N0Y A;  1U27 A;  2COC A;  4K81 A;  2Y8G A;  5HE3 A;  1KI1 B;  1BWN A;  2YS1 A;  3KZ1 A;  5LON B;  3QWM A;  2EJ8 A;  1FHO A;  3PVW A;  4KVG B;  2D10 A;  1P5T A;  1ZSQ A;  1U5F A;  2YRY A;  1NTV A;  1U5D A;  5DIF B;  2UVM A;  4HB4 B;  5GOW B;  4GMV A;  2ELA A;  2YSZ A;  2X18 A;  3SYX A;  2VRW B;  4HB3 B;  1AWE A;  1X1F A;  4Z2M B;  1H4R A;  2K00 A;  2MFQ A;  3SUZ A;  4IFS A;  4IOY X;  1XKE A;  2GJY A;  5DI9 B;  1XR0 B;  4TYZ A;  4DX8 A;  1FGY A;  3NSU A;  4DBB A;  2W2W A;  1N3H A;  2DHJ A;  3TVV A;  2UZS A; 
#chains in the Genus database with same CATH topology
 2Q13 A;  5D3Y A;  3V5W A;  4HAT B;  1WGU A;  4GXB A;  4QJ3 B;  3MPX A;  3CXB B;  4GPT B;  4HAW B;  3D8D A;  4KHO A;  1MPH A;  3KRW A;  4EKU A;  4IAP A;  1DRO A;  1UEF A;  3MDB C;  2L1C A;  1E5W A;  4F7H A;  2VKI A;  1W1D A;  2I1J A;  2NBV A;  5HE0 A;  3RCP A;  1P3R A;  2Z0O A;  1DDW A;  3VOQ A;  1NU2 A;  1BAK A;  3T06 A;  2QKL A;  4HAZ B;  4A6F A;  4YL8 A;  4EJN A;  2RLO A;  2KUP A;  4OSN A;  2D9W A;  5D27 A;  2J0K A;  3A8Q A;  1QC6 A;  1B55 A;  4HSI A;  4OT1 A;  3TCA A;  3NWF A;  1UNR A;  1M7R A;  4YON A;  2Z14 A;  2J0J A;  2YF0 A;  1J0W A;  4K17 A;  5C79 A;  3AU4 A;  3PEG A;  4D6W A;  1Q67 A;  2G35 A;  1KZG A;  2Y7B A;  1LW3 A;  1U5E A;  3A8P A;  1EAZ A;  1I2H A;  2W2X C;  2K2J A;  1M7E A;  4ZRI A;  5D3V A;  4L6E A;  2J0M A;  5J3T A;  3GYO A;  2KGX B;  2KIG A;  5DHF B;  4BBK A;  4HAY B;  1BTK A;  2KIE A;  2LOZ A;  1XOD A;  2EMS A;  4F7G A;  4HDO A;  5DH9 B;  3ML4 A;  2Z13 A;  2RSG A;  1X1G A;  2Z4D A;  2YT0 A;  3TW1 A;  2W2X D;  3AJ4 A;  3VIA A;  4C0A A;  1GG3 A;  3PP2 A;  1FB8 A;  1DDM A;  3PZD A;  1PLS A;  2AEH A;  1WGQ A;  3ODO A;  3U8Z A;  1WI1 A;  1MI1 A;  4WVF B;  2L2I A;  1U2B A;  2YS3 A;  2JP2 A;  4ZRK A;  2PZ1 A;  1RJ2 A;  2D11 A;  4ZRJ A;  3SNH A;  3O96 A;  1H10 A;  2RVB B;  4KHB A;  1GC6 A;  4PQ0 A;  4A5K A;  1V61 A;  2MWN B;  4HAV B;  4NY0 A;  4QJ5 B;  2RNR B;  2DX5 A;  1RRP B;  1UPQ A;  1MKE A;  3U12 A;  2CAY A;  1FAO A;  2LKO A;  1W1G A;  2KR0 A;  3DXE A;  2IYB A;  3P6A A;  1ZM0 A;  2EMT A;  4KHA A;  2QKM A;  2H7E A;  4A6H A;  2Z0P A;  1MK9 B;  2ZPY A;  1DDV A;  3PVU A;  2DTC A;  1X05 A;  3OHM B;  3ZDT A;  1NI2 A;  3FSS A;  1AQC A;  4DXA B;  4HB0 B;  4A6F B;  1PFJ A;  5HE1 A;  1U29 A;  2ELB A;  2LOX A;  2RUK B;  3ODW A;  3DXC A;  3NWD A;  5EFX A;  4H8S A;  3U7D A;  2GS0 A;  5C6R A;  2N23 A;  2R0D A;  1QQG A;  4CSQ A;  1V89 A;  5JP4 A;  2D9V A;  1OQN A;  1WVH A;  2R2Y A;  3DCX A;  2Z0Q A;  3P7Z A;  3PVL A;  2DN6 A;  4EMO A;  1U5G A;  5JHG A;  5M4Y B;  3QBV B;  1MIZ B;  2HE7 A;  4GMX B;  2FJL A;  3LJU X;  5DHA B;  2V76 A;  5CLL B;  4A6K A;  5JLJ B;  2BCJ A;  2LYD A;  2OQB A;  1LB1 A;  1NTY A;  2D4Q A;  1GC7 A;  1FHX A;  5C5B A;  2HTH B;  2P0D A;  2M38 A;  5JHH A;  1SGH A;  2I1K A;  2GUM A;  3IVF A;  2EC1 A;  2R09 A;  1OY2 A;  1V88 A;  3HIE A;  1IRS A;  1EF1 A;  3AU5 A;  2I5F A;  4GNK B;  1WJM A;  1ZVR A;  5C16 A;  2KCJ A;  1K5D B;  4CYE A;  4WSF A;  2DHI A;  2IFS A;  1X11 A;  2COA A;  1P6S A;  5KQ1 A;  2H7D A;  1DBH A;  3M1I B;  1X86 A;  3A98 B;  5I2S A;  3PG7 A;  2J59 M;  1Y5O A;  2Z59 A;  2LG1 A;  4HAX B;  2YT2 A;  4CHJ A;  4KAX B;  3B77 A;  1DYN A;  2P0F A;  2NZ8 B;  5KCV A;  3OAN A;  3ODX A;  1SHC A;  2LUL A;  1MK7 B;  2ZKM X;  5LOP B;  1V5U A;  4HB2 B;  4K2P A;  3G9W A;  4HAU B;  2AL6 A;  4P7I A;  1Y19 B;  4DX9 0;  4WJ7 A;  3BIN A;  1WG7 A;  3ULC A;  2FJU B;  2DHK A;  5LG4 B;  4KHB B;  2CY5 A;  2GCJ A;  1V5M A;  2DX1 A;  3HQC A;  1PMS A;  2DFK A;  1I7A A;  1WJ1 A;  4Y94 A;  4CHM A;  3NW8 A;  3X23 A;  5KQ4 A;  5L81 A;  1FHW A;  2P8V A;  4QXA B;  4MY6 A;  4TKN A;  2K2U A;  3D8F A;  1UPR A;  3WA0 A;  3PSC A;  3UZT A;  2NMB A;  3FVC A;  1ZC4 B;  2GCL A;  4PNK A;  3ULB A;  4Z2N A;  1OMW A;  3D8E A;  1XCG A;  1MAI A;  2P0H A;  3KSY A;  2DKQ A;  3NWA A;  2RGN B;  3ZVR A;  4HHV A;  3DXD A;  4D0N B;  2COF A;  4F7U P;  2M14 A;  1KZ7 A;  2D9X A;  5FI0 A;  4HDQ A;  3HW2 B;  1K5G B;  1TQZ A;  3KRX A;  3SO6 A;  2K8E A;  5J3Q A;  5HE2 A;  2CRF A;  3KY9 A;  2OTX A;  3FM8 C;  1EVH A;  2Y8F A;  2D9Y A;  3F5R A;  2ROV A;  4B6H A;  2D9Z A;  1FOE A;  1EGX A;  2ADZ A;  2VSZ A;  2COD A;  1TXD A;  1UNP A;  4DIX A;  4GOU A;  5FI1 A;  2UZR A;  4XWX A;  4GN1 A;  2YVC A;  1Z87 A;  2DYN A;  3BJI A;  2DLW A;  3QIJ A;  5C5B B;  4NSW A;  5CLQ B;  1W1H A;  3HSA A;  5D3X A;  3SV1 A;  4L1R A;  4GZU A;  1FGZ A;  1TJ6 A;  3FEH A;  5J3Y A;  2YS5 A;  4MT7 A;  1BTN A;  5D3W A;  1V5P A;  2E2X A;  1ISN A;  2K49 A;  2ROZ B;  3TFM A;  1ZC3 B;  2I5C A;  3CIK A;  1XX0 A;  3HK0 A;  2DYQ A;  3A58 A;  1ZYI A;  3N7C A;  2MDX A;  2XQN M;  2YT1 A;  3F0W A;  3GYP A;  4MK0 A;  2D2Q A;  1MIX A;  3WYF B;  3TO1 A;  1UNQ A;  2MKR A;  1J19 A;  2CY4 A;  2DA0 A;  4K2O A;  4QJ4 B;  1XD4 A;  2DKP A;  2N0Y A;  1U27 A;  2COC A;  5I2M A;  4K81 A;  2Y8G A;  5HE3 A;  1KI1 B;  1BWN A;  2YS1 A;  3KZ1 A;  5LON B;  3QWM A;  2EJ8 A;  1FHO A;  3PVW A;  4KVG B;  2D10 A;  1P5T A;  1ZSQ A;  1U5F A;  2YRY A;  1NTV A;  1U5D A;  5DIF B;  2UVM A;  4HB4 B;  5GOW B;  2KUQ A;  4GMV A;  5IRS A;  2ELA A;  2YSZ A;  2X18 A;  2RRF A;  3SYX A;  2VRW B;  4HB3 B;  1AWE A;  1X1F A;  4Z2M B;  1H4R A;  2K00 A;  2MFQ A;  3SUZ A;  4IFS A;  4IOY X;  1XKE A;  2GJY A;  5DI9 B;  1XR0 B;  4TYZ A;  4DX8 A;  1FGY A;  3NSU A;  4DBB A;  2W2W A;  1N3H A;  2DHJ A;  3TVV A;  1T77 A;  2UZS A; 
#chains in the Genus database with same CATH homology
 2Q13 A;  5D3Y A;  3V5W A;  4HAT B;  1WGU A;  4GXB A;  3MPX A;  3CXB B;  4GPT B;  4HAW B;  3D8D A;  4KHO A;  1MPH A;  3KRW A;  4EKU A;  4IAP A;  1DRO A;  1UEF A;  3MDB C;  2L1C A;  1E5W A;  4F7H A;  2VKI A;  1W1D A;  2I1J A;  5HE0 A;  3RCP A;  1P3R A;  2Z0O A;  1DDW A;  3VOQ A;  1NU2 A;  1BAK A;  3T06 A;  2QKL A;  4HAZ B;  4A6F A;  4YL8 A;  4EJN A;  2RLO A;  2KUP A;  2D9W A;  5D27 A;  2J0K A;  3A8Q A;  1QC6 A;  1B55 A;  3TCA A;  1UNR A;  1M7R A;  4YON A;  2J0J A;  2YF0 A;  1J0W A;  4K17 A;  5C79 A;  3AU4 A;  3PEG A;  1Q67 A;  2G35 A;  1KZG A;  2Y7B A;  1LW3 A;  1U5E A;  3A8P A;  1EAZ A;  1I2H A;  2W2X C;  2K2J A;  1M7E A;  4ZRI A;  5D3V A;  4L6E A;  2J0M A;  5J3T A;  3GYO A;  2KGX B;  5DHF B;  4BBK A;  4HAY B;  1BTK A;  2LOZ A;  1XOD A;  2EMS A;  4F7G A;  4HDO A;  5DH9 B;  3ML4 A;  2RSG A;  1X1G A;  2YT0 A;  3TW1 A;  2W2X D;  3AJ4 A;  3VIA A;  4C0A A;  1GG3 A;  3PP2 A;  1FB8 A;  1DDM A;  3PZD A;  1PLS A;  2AEH A;  1WGQ A;  3ODO A;  3U8Z A;  1WI1 A;  4WVF B;  2L2I A;  1U2B A;  2YS3 A;  2JP2 A;  4ZRK A;  2PZ1 A;  1RJ2 A;  2D11 A;  4ZRJ A;  3SNH A;  3O96 A;  1H10 A;  2RVB B;  1GC6 A;  4PQ0 A;  4A5K A;  1V61 A;  2MWN B;  4HAV B;  4NY0 A;  2RNR B;  2DX5 A;  1RRP B;  1UPQ A;  1MKE A;  2CAY A;  1FAO A;  2LKO A;  1W1G A;  3DXE A;  2IYB A;  3P6A A;  1ZM0 A;  2EMT A;  4KHA A;  2QKM A;  2H7E A;  4A6H A;  2Z0P A;  1MK9 B;  2ZPY A;  1DDV A;  3PVU A;  2DTC A;  1X05 A;  3ZDT A;  1NI2 A;  3FSS A;  1AQC A;  4DXA B;  4HB0 B;  4A6F B;  1PFJ A;  5HE1 A;  1U29 A;  3ODW A;  2ELB A;  2LOX A;  2RUK B;  3DXC A;  5EFX A;  4H8S A;  3U7D A;  2GS0 A;  5C6R A;  2N23 A;  2R0D A;  1QQG A;  1V89 A;  5JP4 A;  2D9V A;  1OQN A;  1WVH A;  2Z0Q A;  3P7Z A;  3PVL A;  2DN6 A;  4EMO A;  1U5G A;  5JHG A;  3QBV B;  1MIZ B;  2HE7 A;  4GMX B;  2FJL A;  3LJU X;  5DHA B;  2V76 A;  5CLL B;  4A6K A;  5JLJ B;  2BCJ A;  2LYD A;  2OQB A;  1LB1 A;  1NTY A;  2D4Q A;  1GC7 A;  1FHX A;  5C5B A;  2HTH B;  2P0D A;  2M38 A;  5JHH A;  1SGH A;  2I1K A;  3IVF A;  2EC1 A;  2R09 A;  1OY2 A;  1V88 A;  1IRS A;  1EF1 A;  3AU5 A;  2I5F A;  1WJM A;  1ZVR A;  5C16 A;  2KCJ A;  1K5D B;  4CYE A;  4WSF A;  2DHI A;  2IFS A;  1X11 A;  2COA A;  1P6S A;  5KQ1 A;  2H7D A;  1DBH A;  3M1I B;  1X86 A;  3A98 B;  3PG7 A;  2J59 M;  1Y5O A;  2LG1 A;  4HAX B;  4CHJ A;  4KAX B;  1DYN A;  2P0F A;  2NZ8 B;  5KCV A;  3OAN A;  3ODX A;  1SHC A;  2LUL A;  1MK7 B;  5LOP B;  1V5U A;  4HB2 B;  4K2P A;  3G9W A;  4HAU B;  2AL6 A;  4P7I A;  1Y19 B;  4DX9 0;  4WJ7 A;  3BIN A;  1WG7 A;  3ULC A;  2DHK A;  4KHB B;  2CY5 A;  2GCJ A;  1V5M A;  2DX1 A;  3HQC A;  1PMS A;  2DFK A;  1I7A A;  1WJ1 A;  4Y94 A;  4CHM A;  3X23 A;  5KQ4 A;  5L81 A;  1FHW A;  2P8V A;  4MY6 A;  4TKN A;  2K2U A;  3D8F A;  1UPR A;  3WA0 A;  3PSC A;  3UZT A;  2NMB A;  1ZC4 B;  2GCL A;  4PNK A;  3ULB A;  4Z2N A;  1OMW A;  3D8E A;  1XCG A;  1MAI A;  2P0H A;  3KSY A;  2DKQ A;  2RGN B;  3ZVR A;  4HHV A;  3DXD A;  4D0N B;  2COF A;  4F7U P;  2M14 A;  1KZ7 A;  2D9X A;  5FI0 A;  4HDQ A;  3HW2 B;  1K5G B;  1TQZ A;  3KRX A;  3SO6 A;  5J3Q A;  5HE2 A;  2CRF A;  3KY9 A;  2OTX A;  3FM8 C;  1EVH A;  2Y8F A;  2D9Y A;  3F5R A;  2ROV A;  4B6H A;  2D9Z A;  1FOE A;  1EGX A;  2ADZ A;  2VSZ A;  2COD A;  1TXD A;  1UNP A;  5FI1 A;  2UZR A;  4XWX A;  4GN1 A;  2YVC A;  1Z87 A;  2DYN A;  3BJI A;  2DLW A;  3QIJ A;  5C5B B;  4NSW A;  5CLQ B;  1W1H A;  5D3X A;  3SV1 A;  4GZU A;  1FGZ A;  1TJ6 A;  3FEH A;  5J3Y A;  2YS5 A;  4MT7 A;  1BTN A;  5D3W A;  1V5P A;  2E2X A;  1ISN A;  2ROZ B;  3TFM A;  1ZC3 B;  2I5C A;  3CIK A;  1XX0 A;  3HK0 A;  2DYQ A;  3N7C A;  2MDX A;  2XQN M;  2YT1 A;  3F0W A;  3GYP A;  4MK0 A;  2D2Q A;  1MIX A;  3WYF B;  3TO1 A;  1UNQ A;  2MKR A;  1J19 A;  2CY4 A;  2DA0 A;  4K2O A;  1XD4 A;  2DKP A;  2N0Y A;  1U27 A;  2COC A;  4K81 A;  2Y8G A;  5HE3 A;  1KI1 B;  1BWN A;  2YS1 A;  3KZ1 A;  5LON B;  3QWM A;  2EJ8 A;  1FHO A;  3PVW A;  4KVG B;  2D10 A;  1P5T A;  1ZSQ A;  1U5F A;  2YRY A;  1NTV A;  1U5D A;  5DIF B;  2UVM A;  4HB4 B;  5GOW B;  4GMV A;  2ELA A;  2YSZ A;  2X18 A;  3SYX A;  2VRW B;  4HB3 B;  1AWE A;  1X1F A;  4Z2M B;  1H4R A;  2K00 A;  2MFQ A;  3SUZ A;  4IFS A;  4IOY X;  1XKE A;  2GJY A;  5DI9 B;  1XR0 B;  4TYZ A;  4DX8 A;  1FGY A;  3NSU A;  4DBB A;  2W2W A;  1N3H A;  2DHJ A;  3TVV A;  2UZS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...