2K2JA

Nmr solution structure of the split ph domain from phospholipase c gamma 2
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
117
structure length
117
Chain Sequence
KKDEHKQQGELYMWDSIDQKWTRHYCAIADAKLSFSDDIEQTMEEDNPLGSLCRGILDLNTYNVVKAPQGKNQKSFVFILEPKQQGDPPVEFATDRVEELFEWFQSIREITWKIDTK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase, signaling protein
molecule keywords 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase ga
publication title Rac Regulates Its Effector Phospholipase C{gamma}2 through Interaction with a Split Pleckstrin Homology Domain.
pubmed doi rcsb
source organism Homo sapiens
total genus 11
structure length 117
sequence length 117
ec nomenclature ec 3.1.4.11: Phosphoinositide phospholipase C.
pdb deposition date 2008-04-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2k2jA00
2K2UA 5D3XA 3U8ZA 4F7HA 4K2OA 3F5RA 3DXDA 1NTYA 2DKQA 1Y19B 3PVWA 2FJLA 3GYPA 2AEHA 1P6SA 1I7AA 5J3TA 5C16A 1U5EA 4HDQA 2H7DA 3D8EA 4D0NB 2VRWB 1XKEA 1ZSQA 1MPHA 3PZDA 5C6RA 1SGHA 5J3QA 3LJUX 1TXDA 4HAVB 1UEFA 1Q67A 3BINA 3ODXA 4HB4B 4WSFA 3QBVB 3TCAA 1Z87A 2E2XA 2MKRA 1U2BA 2I1JA 4DX90 3V5WA 5KQ4A 3D8DA 2XQNM 3PVUA 1DDVA 5LOPB 2P8VA 1GC7A 1DDMA 1MKEA 2CODA 3VOQA 2UVMA 2YT1A 2K2JA 2NMBA 2V76A 2D9ZA 1XX0A 1MAIA 2X18A 2YRYA 1WG7A 4KHOA 1PFJA 2P0HA 4YL8A 5JHHA 5D27A 2LG1A 4H8SA 3QIJA 1GG3A 3PVLA 1XODA 5C5BB 2COCA 4HB2B 2MFQA 2DN6A 2VSZA 1ZVRA 2D9XA 1DROA 2L1CA 2EMSA 4WVFB 1ZC4B 3BJIA 4HAZB 2DFKA 5JP4A 1FB8A 1UPRA 4CHMA 5HE3A 3SYXA 2W2XC 2J0MA 2MWNB 4HDOA 5DHFB 5DI9B 1X86A 1QC6A 1ZM0A 3SO6A 2L2IA 4B6HA 1V5UA 2DTCA 2D9WA 4GN1A 4NSWA 2COFA 2ELBA 2YS3A 2YSZA 2P0FA 2CY4A 3KSYA 1Y5OA 4DBBA 4IOYX 3IVFA 2HE7A 2RUKB 1QQGA 4GMVA 2N0YA 3T06A 3A8PA 4GZUA 1GC6A 2KUPA 4DXAB 2DYQA 4P7IA 3ML4A 1AWEA 1OMWA 5C79A 3FEHA 5JHGA 3PSCA 2D2QA 1EF1A 2GJYA 3TO1A 4ZRJA 4A6KA 1B55A 2R0DA 2K00A 4K2PA 3SUZA 2J0JA 2Y7BA 1V61A 5DH9B 1V88A 2J59M 1FOEA 1KI1B 2P0DA 1DBHA 5FI0A 1UNQA 2CY5A 2DHJA 4MT7A 1RRPB 1H10A 1K5GB 1XR0B 4A6FB 1ISNA 1OQNA 1MK9B 5DHAB 1PMSA 2M14A 4CYEA 1UPQA 3PG7A 2LULA 3OANA 1NU2A 2KCJA 3KRWA 2IYBA 1FAOA 1K5DB 1P3RA 2EMTA 1W1HA 1WGUA 4HATB 1U5DA 1ZC3B 4EKUA 2HTHB 4KVGB 5L81A 2AL6A 2YS1A 2I5CA 2Y8FA 2H7EA 1P5TA 3SV1A 2DX1A 3HQCA 2D9VA 1DYNA 2LYDA 1V5MA 2D11A 3ODOA 4HHVA 3DXCA 3U7DA 5CLLB 1DDWA 4A5KA 4MK0A 4HB3B 5EFXA 4HAUB 5HE0A 4EJNA 3AJ4A 3NSUA 2BCJA 1LB1A 4HAWB 1M7EA 2PZ1A 4Z2NA 5DIFB 2VKIA 2DHIA 3TVVA 2DA0A 3AU4A 2ROZB 2Z0QA 2W2WA 3FM8C 3ULCA 2RLOA 5JLJB 2CRFA 2QKLA 2RGNB 4TYZA 3P7ZA 4DX8A 4EMOA 2RSGA 2NZ8B 3HW2B 1KZ7A 1SHCA 2EC1A 2YT0A 1WVHA 3HK0A 4GPTB 5GOWB 3RCPA 2M38A 2YVCA 4Y94A 4YONA 5KCVA 2GS0A 5HE1A 2G35A 4PNKA 2ADZA 1BTNA 4IAPA 4CHJA 1WGQA 2W2XD 3MDBC 2ZPYA 5FI1A 4PQ0A 5D3VA 3ODWA 4F7GA 2R09A 1BAKA 5CLQB 1IRSA 4K81A 1MK7B 1NTVA 1KZGA 4HAXB 1MIXA 4WJ7A 1XD4A 2D4QA 3ULBA 3KRXA 1UNPA 1EVHA 2GCLA 3PP2A 5D3YA 1EAZA 2YF0A 2RNRB 4NY0A 2ROVA 3F0WA 4KHBB 1RJ2A 3KY9A 2OQBA 5LONB 3TW1A 3VIAA 1J0WA 4A6HA 1FGYA 3A8QA 3G9WA 2MDXA 2UZSA 1X1FA 2CAYA 3CXBB 1EGXA 4KHAA 1NI2A 2DLWA 1BTKA 3D8FA 4KAXB 4A6FA 2LOXA 1X1GA 3AU5A 1OY2A 3DXEA 1U5GA 2ELAA 1BWNA 2KGXB 1AQCA 1N3HA 5D3WA 2QKMA 1WJ1A 2LKOA 3GYOA 1X05A 1U5FA 4ZRKA 2DHKA 1U29A 2JP2A 1J19A 1I2HA 5HE2A 2N23A 4BBKA 4HB0B 4GXBA 4MY6A 1W1GA 3WYFB 3CIKA 1MIZB 2Z0PA 4TKNA 2GCJA 3ZVRA 3ZDTA 1FHXA 3O96A 3P6AA 1LW3A 3QWMA 2UZRA 4Z2MB 4F7UP 1M7RA 1FGZA 4K17A 1UNRA 2J0KA 4HAYB 5C5BA 1X11A 3X23A 3SNHA 1V89A 3TFMA 2COAA 1E5WA 4IFSA 4GMXB 2DYNA 1TJ6A 3WA0A 1PLSA 2IFSA 4C0AA 2RVBB 2I5FA 2YS5A 3MPXA 4XWXA 2EJ8A 1FHOA 4ZRIA 4L6EA 1V5PA 3N7CA 2I1KA 2Q13A 1FHWA 5KQ1A 3A98B 2Z0OA 1WI1A 1H4RA 2D10A 3PEGA 3UZTA 3FSSA 2LOZA 1U27A 5J3YA 2D9YA 1W1DA 1TQZA 1XCGA 1WJMA 3KZ1A 3M1IB 2DX5A 2DKPA 2Y8GA 2OTXA
chains in the Genus database with same CATH superfamily
2K2UA 5D3XA 3U8ZA 4F7HA 4K2OA 4QJ5B 3F5RA 3DXDA 1NTYA 2DKQA 1Y19B 3PVWA 2FJLA 3GYPA 2AEHA 1P6SA 1I7AA 5J3TA 5C16A 1U5EA 4HDQA 2H7DA 3D8EA 4D0NB 2VRWB 1XKEA 1ZSQA 1MPHA 3PZDA 5C6RA 1SGHA 5J3QA 3FVCA 3LJUX 1TXDA 4HAVB 1UEFA 4QJ3B 1Q67A 3BINA 3ODXA 4HB4B 4WSFA 3QBVB 3TCAA 2K49A 1Z87A 2E2XA 4DIXA 2MKRA 4L1RA 1U2BA 2I1JA 4DX90 3V5WA 5KQ4A 2NBVA 3D8DA 2XQNM 3PVUA 1DDVA 5LOPB 2P8VA 1GC7A 1DDMA 1MKEA 2CODA 3VOQA 2UVMA 2YT1A 2K2JA 2Z4DA 2NMBA 2V76A 2D9ZA 1XX0A 1MAIA 2X18A 2YRYA 1WG7A 4KHOA 1PFJA 2P0HA 4YL8A 5JHHA 5D27A 2LG1A 4H8SA 3QIJA 1GG3A 3PVLA 1XODA 5C5BB 2YT2A 2COCA 4HB2B 2MFQA 2DN6A 2ZKMX 2VSZA 1ZVRA 2D9XA 1DROA 2L1CA 2EMSA 4WVFB 1ZC4B 3BJIA 4HAZB 2DFKA 5JP4A 1FB8A 1UPRA 4CHMA 5HE3A 3SYXA 2W2XC 2J0MA 2MWNB 4HDOA 5DHFB 5DI9B 1X86A 2Z59A 1QC6A 3NWDA 1ZM0A 2FJUB 3SO6A 2L2IA 4B6HA 1V5UA 2DTCA 2D9WA 4GN1A 3NW8A 4NSWA 4HSIA 2COFA 2ELBA 2YS3A 2YSZA 2P0FA 2CY4A 3HIEA 3KSYA 1ZYIA 1Y5OA 4DBBA 5I2SA 4IOYX 3IVFA 2HE7A 2RUKB 1QQGA 4GMVA 2N0YA 3T06A 3A8PA 4GZUA 5M4YB 1GC6A 2KUPA 4DXAB 2DYQA 4P7IA 3ML4A 1AWEA 1OMWA 5C79A 3FEHA 5JHGA 2KUQA 3PSCA 2D2QA 1EF1A 2GJYA 3TO1A 4ZRJA 4OSNA 4A6KA 1B55A 2R0DA 2K00A 4K2PA 3SUZA 2J0JA 2Y7BA 1V61A 5DH9B 1MI1A 1V88A 2J59M 1FOEA 2Z14A 1KI1B 2P0DA 1DBHA 5FI0A 1UNQA 2CY5A 2DHJA 4MT7A 1RRPB 1H10A 1K5GB 1XR0B 4A6FB 1ISNA 4KHBA 1OQNA 1MK9B 5DHAB 1PMSA 2M14A 4CYEA 1UPQA 3PG7A 2R2YA 5I2MA 2LULA 3OANA 1NU2A 2KCJA 3KRWA 2IYBA 1FAOA 1K5DB 1P3RA 2EMTA 1W1HA 1WGUA 2GUMA 1U5DA 4HATB 3DCXA 1ZC3B 4EKUA 2HTHB 4KVGB 5L81A 2AL6A 2YS1A 2I5CA 2Y8FA 2H7EA 1P5TA 3SV1A 2DX1A 3HQCA 2D9VA 1DYNA 2LYDA 1V5MA 2D11A 3ODOA 4HHVA 3DXCA 3U7DA 5CLLB 1DDWA 4A5KA 4MK0A 4HB3B 5EFXA 4HAUB 5HE0A 4EJNA 3AJ4A 3NSUA 2BCJA 1LB1A 4HAWB 1M7EA 2PZ1A 4Z2NA 5DIFB 2VKIA 2DHIA 3TVVA 4GOUA 2DA0A 3AU4A 2ROZB 2Z0QA 2W2WA 2KIEA 3FM8C 3ULCA 5LG4B 2RLOA 5JLJB 2CRFA 2QKLA 2RGNB 4TYZA 3P7ZA 4DX8A 4EMOA 2RSGA 2NZ8B 3HW2B 1KZ7A 1SHCA 2EC1A 2YT0A 1WVHA 3HK0A 4GPTB 5GOWB 3RCPA 2M38A 2YVCA 4Y94A 4YONA 4CSQA 5KCVA 3NWAA 2GS0A 5HE1A 2G35A 4PNKA 2ADZA 1BTNA 4IAPA 4CHJA 1WGQA 2W2XD 3MDBC 2ZPYA 5FI1A 4PQ0A 2KR0A 2Z13A 5D3VA 3ODWA 4F7GA 2R09A 1BAKA 5CLQB 1IRSA 4K81A 1MK7B 1NTVA 1KZGA 4HAXB 1T77A 1MIXA 4WJ7A 1XD4A 2D4QA 3ULBA 2K8EA 3KRXA 1UNPA 1EVHA 2GCLA 3PP2A 5D3YA 1EAZA 2YF0A 2RNRB 4NY0A 2ROVA 3F0WA 4KHBB 1RJ2A 3KY9A 2OQBA 5LONB 3TW1A 3VIAA 1J0WA 3A58A 4A6HA 1FGYA 3A8QA 3G9WA 2MDXA 2UZSA 1X1FA 2CAYA 3CXBB 1EGXA 4KHAA 1NI2A 4QXAB 2DLWA 1BTKA 3D8FA 4GNKB 4KAXB 4OT1A 2RRFA 4A6FA 2LOXA 1X1GA 3AU5A 3HSAA 1OY2A 3DXEA 1U5GA 2ELAA 1BWNA 2KGXB 1AQCA 1N3HA 5D3WA 2QKMA 1WJ1A 2LKOA 3GYOA 1X05A 1U5FA 4ZRKA 2DHKA 1U29A 2JP2A 1J19A 1I2HA 5HE2A 2N23A 4BBKA 4HB0B 4GXBA 4D6WA 4MY6A 1W1GA 3WYFB 3NWFA 3CIKA 1MIZB 2Z0PA 4TKNA 2GCJA 3ZVRA 3ZDTA 1FHXA 3O96A 3P6AA 1LW3A 5IRSA 3QWMA 2UZRA 4Z2MB 4F7UP 1M7RA 1FGZA 4K17A 1UNRA 2J0KA 4HAYB 5C5BA 1X11A 3U12A 3X23A 3SNHA 2KIGA 1V89A 3TFMA 2COAA 1E5WA 3OHMB 4IFSA 4GMXB 2DYNA 1TJ6A 3WA0A 1PLSA 2IFSA 4C0AA 2RVBB 2I5FA 2YS5A 3MPXA 4XWXA 2EJ8A 3B77A 1FHOA 4ZRIA 4L6EA 1V5PA 3N7CA 2I1KA 2Q13A 1FHWA 5KQ1A 3A98B 2Z0OA 1WI1A 1H4RA 2D10A 3PEGA 3UZTA 3FSSA 2LOZA 1U27A 5J3YA 2D9YA 1W1DA 4QJ4B 1TQZA 1XCGA 1WJMA 3KZ1A 3M1IB 2DX5A 2DKPA 2Y8GA 2OTXA
chains in the Genus database with same CATH topology
2K2UA 5D3XA 3U8ZA 4F7HA 4K2OA 3F5RA 3DXDA 1NTYA 2DKQA 1Y19B 3PVWA 2FJLA 3GYPA 2AEHA 1P6SA 1I7AA 5J3TA 5C16A 1U5EA 4HDQA 2H7DA 3D8EA 4D0NB 2VRWB 1XKEA 1ZSQA 1MPHA 3PZDA 5C6RA 1SGHA 5J3QA 3LJUX 1TXDA 4HAVB 1UEFA 1Q67A 3BINA 3ODXA 4HB4B 4WSFA 3QBVB 3TCAA 1Z87A 2E2XA 2MKRA 1U2BA 2I1JA 4DX90 3V5WA 5KQ4A 3D8DA 2XQNM 3PVUA 1DDVA 5LOPB 2P8VA 1GC7A 1DDMA 1MKEA 2CODA 3VOQA 2UVMA 2YT1A 2K2JA 2NMBA 2V76A 2D9ZA 1XX0A 1MAIA 2X18A 2YRYA 1WG7A 4KHOA 1PFJA 2P0HA 4YL8A 5JHHA 5D27A 2LG1A 4H8SA 3QIJA 1GG3A 3PVLA 1XODA 5C5BB 2COCA 4HB2B 2MFQA 2DN6A 2VSZA 1ZVRA 2D9XA 1DROA 2L1CA 2EMSA 4WVFB 1ZC4B 3BJIA 4HAZB 2DFKA 5JP4A 1FB8A 1UPRA 4CHMA 5HE3A 3SYXA 2W2XC 2J0MA 2MWNB 4HDOA 5DHFB 5DI9B 1X86A 1QC6A 1ZM0A 3SO6A 2L2IA 4B6HA 1V5UA 2DTCA 2D9WA 4GN1A 4NSWA 2COFA 2ELBA 2YS3A 2YSZA 2P0FA 2CY4A 3KSYA 1Y5OA 4DBBA 4IOYX 3IVFA 2HE7A 2RUKB 1QQGA 4GMVA 2N0YA 3T06A 3A8PA 4GZUA 1GC6A 2KUPA 4DXAB 2DYQA 4P7IA 3ML4A 1AWEA 1OMWA 5C79A 3FEHA 5JHGA 3PSCA 2D2QA 1EF1A 2GJYA 3TO1A 4ZRJA 4A6KA 1B55A 2R0DA 2K00A 4K2PA 3SUZA 2J0JA 2Y7BA 1V61A 5DH9B 1V88A 2J59M 1FOEA 1KI1B 2P0DA 1DBHA 5FI0A 1UNQA 2CY5A 2DHJA 4MT7A 1RRPB 1H10A 1K5GB 1XR0B 4A6FB 1ISNA 1OQNA 1MK9B 5DHAB 1PMSA 2M14A 4CYEA 1UPQA 3PG7A 2LULA 3OANA 1NU2A 2KCJA 3KRWA 2IYBA 1FAOA 1K5DB 1P3RA 2EMTA 1W1HA 1WGUA 4HATB 1U5DA 1ZC3B 4EKUA 2HTHB 4KVGB 5L81A 2AL6A 2YS1A 2I5CA 2Y8FA 2H7EA 1P5TA 3SV1A 2DX1A 3HQCA 2D9VA 1DYNA 2LYDA 1V5MA 2D11A 3ODOA 4HHVA 3DXCA 3U7DA 5CLLB 1DDWA 4A5KA 4MK0A 4HB3B 5EFXA 4HAUB 5HE0A 4EJNA 3AJ4A 3NSUA 2BCJA 1LB1A 4HAWB 1M7EA 2PZ1A 4Z2NA 5DIFB 2VKIA 2DHIA 3TVVA 2DA0A 3AU4A 2ROZB 2Z0QA 2W2WA 3FM8C 3ULCA 2RLOA 5JLJB 2CRFA 2QKLA 2RGNB 4TYZA 3P7ZA 4DX8A 4EMOA 2RSGA 2NZ8B 3HW2B 1KZ7A 1SHCA 2EC1A 2YT0A 1WVHA 3HK0A 4GPTB 5GOWB 3RCPA 2M38A 2YVCA 4Y94A 4YONA 5KCVA 2GS0A 5HE1A 2G35A 4PNKA 2ADZA 1BTNA 4IAPA 4CHJA 1WGQA 2W2XD 3MDBC 2ZPYA 5FI1A 4PQ0A 5D3VA 3ODWA 4F7GA 2R09A 1BAKA 5CLQB 1IRSA 4K81A 1MK7B 1NTVA 1KZGA 4HAXB 1MIXA 4WJ7A 1XD4A 2D4QA 3ULBA 3KRXA 1UNPA 1EVHA 2GCLA 3PP2A 5D3YA 1EAZA 2YF0A 2RNRB 4NY0A 2ROVA 3F0WA 4KHBB 1RJ2A 3KY9A 2OQBA 5LONB 3TW1A 3VIAA 1J0WA 4A6HA 1FGYA 3A8QA 3G9WA 2MDXA 2UZSA 1X1FA 2CAYA 3CXBB 1EGXA 4KHAA 1NI2A 2DLWA 1BTKA 3D8FA 4KAXB 4A6FA 2LOXA 1X1GA 3AU5A 1OY2A 3DXEA 1U5GA 2ELAA 1BWNA 2KGXB 1AQCA 1N3HA 5D3WA 2QKMA 1WJ1A 2LKOA 3GYOA 1X05A 1U5FA 4ZRKA 2DHKA 1U29A 2JP2A 1J19A 1I2HA 5HE2A 2N23A 4BBKA 4HB0B 4GXBA 4MY6A 1W1GA 3WYFB 3CIKA 1MIZB 2Z0PA 4TKNA 2GCJA 3ZVRA 3ZDTA 1FHXA 3O96A 3P6AA 1LW3A 3QWMA 2UZRA 4Z2MB 4F7UP 1M7RA 1FGZA 4K17A 1UNRA 2J0KA 4HAYB 5C5BA 1X11A 3X23A 3SNHA 1V89A 3TFMA 2COAA 1E5WA 4IFSA 4GMXB 2DYNA 1TJ6A 3WA0A 1PLSA 2IFSA 4C0AA 2RVBB 2I5FA 2YS5A 3MPXA 4XWXA 2EJ8A 1FHOA 4ZRIA 4L6EA 1V5PA 3N7CA 2I1KA 2Q13A 1FHWA 5KQ1A 3A98B 2Z0OA 1WI1A 1H4RA 2D10A 3PEGA 3UZTA 3FSSA 2LOZA 1U27A 5J3YA 2D9YA 1W1DA 1TQZA 1XCGA 1WJMA 3KZ1A 3M1IB 2DX5A 2DKPA 2Y8GA 2OTXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2K2U A;  5D3X A;  3U8Z A;  4F7H A;  4K2O A;  3F5R A;  3DXD A;  1NTY A;  2DKQ A;  1Y19 B;  3PVW A;  2FJL A;  3GYP A;  2AEH A;  1P6S A;  1I7A A;  5J3T A;  5C16 A;  1U5E A;  4HDQ A;  2H7D A;  3D8E A;  4D0N B;  2VRW B;  1XKE A;  1ZSQ A;  1MPH A;  3PZD A;  5C6R A;  1SGH A;  5J3Q A;  3LJU X;  1TXD A;  4HAV B;  1UEF A;  1Q67 A;  3BIN A;  3ODX A;  4HB4 B;  4WSF A;  3QBV B;  3TCA A;  1Z87 A;  2E2X A;  2MKR A;  1U2B A;  2I1J A;  4DX9 0;  3V5W A;  5KQ4 A;  3D8D A;  2XQN M;  3PVU A;  1DDV A;  5LOP B;  2P8V A;  1GC7 A;  1DDM A;  1MKE A;  2COD A;  3VOQ A;  2UVM A;  2YT1 A;  2K2J A;  2NMB A;  2V76 A;  2D9Z A;  1XX0 A;  1MAI A;  2X18 A;  2YRY A;  1WG7 A;  4KHO A;  1PFJ A;  2P0H A;  4YL8 A;  5JHH A;  5D27 A;  2LG1 A;  4H8S A;  3QIJ A;  1GG3 A;  3PVL A;  1XOD A;  5C5B B;  2COC A;  4HB2 B;  2MFQ A;  2DN6 A;  2VSZ A;  1ZVR A;  2D9X A;  1DRO A;  2L1C A;  2EMS A;  4WVF B;  1ZC4 B;  3BJI A;  4HAZ B;  2DFK A;  5JP4 A;  1FB8 A;  1UPR A;  4CHM A;  5HE3 A;  3SYX A;  2W2X C;  2J0M A;  2MWN B;  4HDO A;  5DHF B;  5DI9 B;  1X86 A;  1QC6 A;  1ZM0 A;  3SO6 A;  2L2I A;  4B6H A;  1V5U A;  2DTC A;  2D9W A;  4GN1 A;  4NSW A;  2COF A;  2ELB A;  2YS3 A;  2YSZ A;  2P0F A;  2CY4 A;  3KSY A;  1Y5O A;  4DBB A;  4IOY X;  3IVF A;  2HE7 A;  2RUK B;  1QQG A;  4GMV A;  2N0Y A;  3T06 A;  3A8P A;  4GZU A;  1GC6 A;  2KUP A;  4DXA B;  2DYQ A;  4P7I A;  3ML4 A;  1AWE A;  1OMW A;  5C79 A;  3FEH A;  5JHG A;  3PSC A;  2D2Q A;  1EF1 A;  2GJY A;  3TO1 A;  4ZRJ A;  4A6K A;  1B55 A;  2R0D A;  2K00 A;  4K2P A;  3SUZ A;  2J0J A;  2Y7B A;  1V61 A;  5DH9 B;  1V88 A;  2J59 M;  1FOE A;  1KI1 B;  2P0D A;  1DBH A;  5FI0 A;  1UNQ A;  2CY5 A;  2DHJ A;  4MT7 A;  1RRP B;  1H10 A;  1K5G B;  1XR0 B;  4A6F B;  1ISN A;  1OQN A;  1MK9 B;  5DHA B;  1PMS A;  2M14 A;  4CYE A;  1UPQ A;  3PG7 A;  2LUL A;  3OAN A;  1NU2 A;  2KCJ A;  3KRW A;  2IYB A;  1FAO A;  1K5D B;  1P3R A;  2EMT A;  1W1H A;  1WGU A;  4HAT B;  1U5D A;  1ZC3 B;  4EKU A;  2HTH B;  4KVG B;  5L81 A;  2AL6 A;  2YS1 A;  2I5C A;  2Y8F A;  2H7E A;  1P5T A;  3SV1 A;  2DX1 A;  3HQC A;  2D9V A;  1DYN A;  2LYD A;  1V5M A;  2D11 A;  3ODO A;  4HHV A;  3DXC A;  3U7D A;  5CLL B;  1DDW A;  4A5K A;  4MK0 A;  4HB3 B;  5EFX A;  4HAU B;  5HE0 A;  4EJN A;  3AJ4 A;  3NSU A;  2BCJ A;  1LB1 A;  4HAW B;  1M7E A;  2PZ1 A;  4Z2N A;  5DIF B;  2VKI A;  2DHI A;  3TVV A;  2DA0 A;  3AU4 A;  2ROZ B;  2Z0Q A;  2W2W A;  3FM8 C;  3ULC A;  2RLO A;  5JLJ B;  2CRF A;  2QKL A;  2RGN B;  4TYZ A;  3P7Z A;  4DX8 A;  4EMO A;  2RSG A;  2NZ8 B;  3HW2 B;  1KZ7 A;  1SHC A;  2EC1 A;  2YT0 A;  1WVH A;  3HK0 A;  4GPT B;  5GOW B;  3RCP A;  2M38 A;  2YVC A;  4Y94 A;  4YON A;  5KCV A;  2GS0 A;  5HE1 A;  2G35 A;  4PNK A;  2ADZ A;  1BTN A;  4IAP A;  4CHJ A;  1WGQ A;  2W2X D;  3MDB C;  2ZPY A;  5FI1 A;  4PQ0 A;  5D3V A;  3ODW A;  4F7G A;  2R09 A;  1BAK A;  5CLQ B;  1IRS A;  4K81 A;  1MK7 B;  1NTV A;  1KZG A;  4HAX B;  1MIX A;  4WJ7 A;  1XD4 A;  2D4Q A;  3ULB A;  3KRX A;  1UNP A;  1EVH A;  2GCL A;  3PP2 A;  5D3Y A;  1EAZ A;  2YF0 A;  2RNR B;  4NY0 A;  2ROV A;  3F0W A;  4KHB B;  1RJ2 A;  3KY9 A;  2OQB A;  5LON B;  3TW1 A;  3VIA A;  1J0W A;  4A6H A;  1FGY A;  3A8Q A;  3G9W A;  2MDX A;  2UZS A;  1X1F A;  2CAY A;  3CXB B;  1EGX A;  4KHA A;  1NI2 A;  2DLW A;  1BTK A;  3D8F A;  4KAX B;  4A6F A;  2LOX A;  1X1G A;  3AU5 A;  1OY2 A;  3DXE A;  1U5G A;  2ELA A;  1BWN A;  2KGX B;  1AQC A;  1N3H A;  5D3W A;  2QKM A;  1WJ1 A;  2LKO A;  3GYO A;  1X05 A;  1U5F A;  4ZRK A;  2DHK A;  1U29 A;  2JP2 A;  1J19 A;  1I2H A;  5HE2 A;  2N23 A;  4BBK A;  4HB0 B;  4GXB A;  4MY6 A;  1W1G A;  3WYF B;  3CIK A;  1MIZ B;  2Z0P A;  4TKN A;  2GCJ A;  3ZVR A;  3ZDT A;  1FHX A;  3O96 A;  3P6A A;  1LW3 A;  3QWM A;  2UZR A;  4Z2M B;  4F7U P;  1M7R A;  1FGZ A;  4K17 A;  1UNR A;  2J0K A;  4HAY B;  5C5B A;  1X11 A;  3X23 A;  3SNH A;  1V89 A;  3TFM A;  2COA A;  1E5W A;  4IFS A;  4GMX B;  2DYN A;  1TJ6 A;  3WA0 A;  1PLS A;  2IFS A;  4C0A A;  2RVB B;  2I5F A;  2YS5 A;  3MPX A;  4XWX A;  2EJ8 A;  1FHO A;  4ZRI A;  4L6E A;  1V5P A;  3N7C A;  2I1K A;  2Q13 A;  1FHW A;  5KQ1 A;  3A98 B;  2Z0O A;  1WI1 A;  1H4R A;  2D10 A;  3PEG A;  3UZT A;  3FSS A;  2LOZ A;  1U27 A;  5J3Y A;  2D9Y A;  1W1D A;  1TQZ A;  1XCG A;  1WJM A;  3KZ1 A;  3M1I B;  2DX5 A;  2DKP A;  2Y8G A;  2OTX A; 
#chains in the Genus database with same CATH topology
 2K2U A;  5D3X A;  3U8Z A;  4F7H A;  4K2O A;  4QJ5 B;  3F5R A;  3DXD A;  1NTY A;  2DKQ A;  1Y19 B;  3PVW A;  2FJL A;  3GYP A;  2AEH A;  1P6S A;  1I7A A;  5J3T A;  5C16 A;  1U5E A;  4HDQ A;  2H7D A;  3D8E A;  4D0N B;  2VRW B;  1XKE A;  1ZSQ A;  1MPH A;  3PZD A;  5C6R A;  1SGH A;  5J3Q A;  3FVC A;  3LJU X;  1TXD A;  4HAV B;  1UEF A;  4QJ3 B;  1Q67 A;  3BIN A;  3ODX A;  4HB4 B;  4WSF A;  3QBV B;  3TCA A;  2K49 A;  1Z87 A;  2E2X A;  4DIX A;  2MKR A;  4L1R A;  1U2B A;  2I1J A;  4DX9 0;  3V5W A;  5KQ4 A;  2NBV A;  3D8D A;  2XQN M;  3PVU A;  1DDV A;  5LOP B;  2P8V A;  1GC7 A;  1DDM A;  1MKE A;  2COD A;  3VOQ A;  2UVM A;  2YT1 A;  2K2J A;  2Z4D A;  2NMB A;  2V76 A;  2D9Z A;  1XX0 A;  1MAI A;  2X18 A;  2YRY A;  1WG7 A;  4KHO A;  1PFJ A;  2P0H A;  4YL8 A;  5JHH A;  5D27 A;  2LG1 A;  4H8S A;  3QIJ A;  1GG3 A;  3PVL A;  1XOD A;  5C5B B;  2YT2 A;  2COC A;  4HB2 B;  2MFQ A;  2DN6 A;  2ZKM X;  2VSZ A;  1ZVR A;  2D9X A;  1DRO A;  2L1C A;  2EMS A;  4WVF B;  1ZC4 B;  3BJI A;  4HAZ B;  2DFK A;  5JP4 A;  1FB8 A;  1UPR A;  4CHM A;  5HE3 A;  3SYX A;  2W2X C;  2J0M A;  2MWN B;  4HDO A;  5DHF B;  5DI9 B;  1X86 A;  2Z59 A;  1QC6 A;  3NWD A;  1ZM0 A;  2FJU B;  3SO6 A;  2L2I A;  4B6H A;  1V5U A;  2DTC A;  2D9W A;  4GN1 A;  3NW8 A;  4NSW A;  4HSI A;  2COF A;  2ELB A;  2YS3 A;  2YSZ A;  2P0F A;  2CY4 A;  3HIE A;  3KSY A;  1ZYI A;  1Y5O A;  4DBB A;  5I2S A;  4IOY X;  3IVF A;  2HE7 A;  2RUK B;  1QQG A;  4GMV A;  2N0Y A;  3T06 A;  3A8P A;  4GZU A;  5M4Y B;  1GC6 A;  2KUP A;  4DXA B;  2DYQ A;  4P7I A;  3ML4 A;  1AWE A;  1OMW A;  5C79 A;  3FEH A;  5JHG A;  2KUQ A;  3PSC A;  2D2Q A;  1EF1 A;  2GJY A;  3TO1 A;  4ZRJ A;  4OSN A;  4A6K A;  1B55 A;  2R0D A;  2K00 A;  4K2P A;  3SUZ A;  2J0J A;  2Y7B A;  1V61 A;  5DH9 B;  1MI1 A;  1V88 A;  2J59 M;  1FOE A;  2Z14 A;  1KI1 B;  2P0D A;  1DBH A;  5FI0 A;  1UNQ A;  2CY5 A;  2DHJ A;  4MT7 A;  1RRP B;  1H10 A;  1K5G B;  1XR0 B;  4A6F B;  1ISN A;  4KHB A;  1OQN A;  1MK9 B;  5DHA B;  1PMS A;  2M14 A;  4CYE A;  1UPQ A;  3PG7 A;  2R2Y A;  5I2M A;  2LUL A;  3OAN A;  1NU2 A;  2KCJ A;  3KRW A;  2IYB A;  1FAO A;  1K5D B;  1P3R A;  2EMT A;  1W1H A;  1WGU A;  2GUM A;  1U5D A;  4HAT B;  3DCX A;  1ZC3 B;  4EKU A;  2HTH B;  4KVG B;  5L81 A;  2AL6 A;  2YS1 A;  2I5C A;  2Y8F A;  2H7E A;  1P5T A;  3SV1 A;  2DX1 A;  3HQC A;  2D9V A;  1DYN A;  2LYD A;  1V5M A;  2D11 A;  3ODO A;  4HHV A;  3DXC A;  3U7D A;  5CLL B;  1DDW A;  4A5K A;  4MK0 A;  4HB3 B;  5EFX A;  4HAU B;  5HE0 A;  4EJN A;  3AJ4 A;  3NSU A;  2BCJ A;  1LB1 A;  4HAW B;  1M7E A;  2PZ1 A;  4Z2N A;  5DIF B;  2VKI A;  2DHI A;  3TVV A;  4GOU A;  2DA0 A;  3AU4 A;  2ROZ B;  2Z0Q A;  2W2W A;  2KIE A;  3FM8 C;  3ULC A;  5LG4 B;  2RLO A;  5JLJ B;  2CRF A;  2QKL A;  2RGN B;  4TYZ A;  3P7Z A;  4DX8 A;  4EMO A;  2RSG A;  2NZ8 B;  3HW2 B;  1KZ7 A;  1SHC A;  2EC1 A;  2YT0 A;  1WVH A;  3HK0 A;  4GPT B;  5GOW B;  3RCP A;  2M38 A;  2YVC A;  4Y94 A;  4YON A;  4CSQ A;  5KCV A;  3NWA A;  2GS0 A;  5HE1 A;  2G35 A;  4PNK A;  2ADZ A;  1BTN A;  4IAP A;  4CHJ A;  1WGQ A;  2W2X D;  3MDB C;  2ZPY A;  5FI1 A;  4PQ0 A;  2KR0 A;  2Z13 A;  5D3V A;  3ODW A;  4F7G A;  2R09 A;  1BAK A;  5CLQ B;  1IRS A;  4K81 A;  1MK7 B;  1NTV A;  1KZG A;  4HAX B;  1T77 A;  1MIX A;  4WJ7 A;  1XD4 A;  2D4Q A;  3ULB A;  2K8E A;  3KRX A;  1UNP A;  1EVH A;  2GCL A;  3PP2 A;  5D3Y A;  1EAZ A;  2YF0 A;  2RNR B;  4NY0 A;  2ROV A;  3F0W A;  4KHB B;  1RJ2 A;  3KY9 A;  2OQB A;  5LON B;  3TW1 A;  3VIA A;  1J0W A;  3A58 A;  4A6H A;  1FGY A;  3A8Q A;  3G9W A;  2MDX A;  2UZS A;  1X1F A;  2CAY A;  3CXB B;  1EGX A;  4KHA A;  1NI2 A;  4QXA B;  2DLW A;  1BTK A;  3D8F A;  4GNK B;  4KAX B;  4OT1 A;  2RRF A;  4A6F A;  2LOX A;  1X1G A;  3AU5 A;  3HSA A;  1OY2 A;  3DXE A;  1U5G A;  2ELA A;  1BWN A;  2KGX B;  1AQC A;  1N3H A;  5D3W A;  2QKM A;  1WJ1 A;  2LKO A;  3GYO A;  1X05 A;  1U5F A;  4ZRK A;  2DHK A;  1U29 A;  2JP2 A;  1J19 A;  1I2H A;  5HE2 A;  2N23 A;  4BBK A;  4HB0 B;  4GXB A;  4D6W A;  4MY6 A;  1W1G A;  3WYF B;  3NWF A;  3CIK A;  1MIZ B;  2Z0P A;  4TKN A;  2GCJ A;  3ZVR A;  3ZDT A;  1FHX A;  3O96 A;  3P6A A;  1LW3 A;  5IRS A;  3QWM A;  2UZR A;  4Z2M B;  4F7U P;  1M7R A;  1FGZ A;  4K17 A;  1UNR A;  2J0K A;  4HAY B;  5C5B A;  1X11 A;  3U12 A;  3X23 A;  3SNH A;  2KIG A;  1V89 A;  3TFM A;  2COA A;  1E5W A;  3OHM B;  4IFS A;  4GMX B;  2DYN A;  1TJ6 A;  3WA0 A;  1PLS A;  2IFS A;  4C0A A;  2RVB B;  2I5F A;  2YS5 A;  3MPX A;  4XWX A;  2EJ8 A;  3B77 A;  1FHO A;  4ZRI A;  4L6E A;  1V5P A;  3N7C A;  2I1K A;  2Q13 A;  1FHW A;  5KQ1 A;  3A98 B;  2Z0O A;  1WI1 A;  1H4R A;  2D10 A;  3PEG A;  3UZT A;  3FSS A;  2LOZ A;  1U27 A;  5J3Y A;  2D9Y A;  1W1D A;  4QJ4 B;  1TQZ A;  1XCG A;  1WJM A;  3KZ1 A;  3M1I B;  2DX5 A;  2DKP A;  2Y8G A;  2OTX A; 
#chains in the Genus database with same CATH homology
 2K2U A;  5D3X A;  3U8Z A;  4F7H A;  4K2O A;  3F5R A;  3DXD A;  1NTY A;  2DKQ A;  1Y19 B;  3PVW A;  2FJL A;  3GYP A;  2AEH A;  1P6S A;  1I7A A;  5J3T A;  5C16 A;  1U5E A;  4HDQ A;  2H7D A;  3D8E A;  4D0N B;  2VRW B;  1XKE A;  1ZSQ A;  1MPH A;  3PZD A;  5C6R A;  1SGH A;  5J3Q A;  3LJU X;  1TXD A;  4HAV B;  1UEF A;  1Q67 A;  3BIN A;  3ODX A;  4HB4 B;  4WSF A;  3QBV B;  3TCA A;  1Z87 A;  2E2X A;  2MKR A;  1U2B A;  2I1J A;  4DX9 0;  3V5W A;  5KQ4 A;  3D8D A;  2XQN M;  3PVU A;  1DDV A;  5LOP B;  2P8V A;  1GC7 A;  1DDM A;  1MKE A;  2COD A;  3VOQ A;  2UVM A;  2YT1 A;  2K2J A;  2NMB A;  2V76 A;  2D9Z A;  1XX0 A;  1MAI A;  2X18 A;  2YRY A;  1WG7 A;  4KHO A;  1PFJ A;  2P0H A;  4YL8 A;  5JHH A;  5D27 A;  2LG1 A;  4H8S A;  3QIJ A;  1GG3 A;  3PVL A;  1XOD A;  5C5B B;  2COC A;  4HB2 B;  2MFQ A;  2DN6 A;  2VSZ A;  1ZVR A;  2D9X A;  1DRO A;  2L1C A;  2EMS A;  4WVF B;  1ZC4 B;  3BJI A;  4HAZ B;  2DFK A;  5JP4 A;  1FB8 A;  1UPR A;  4CHM A;  5HE3 A;  3SYX A;  2W2X C;  2J0M A;  2MWN B;  4HDO A;  5DHF B;  5DI9 B;  1X86 A;  1QC6 A;  1ZM0 A;  3SO6 A;  2L2I A;  4B6H A;  1V5U A;  2DTC A;  2D9W A;  4GN1 A;  4NSW A;  2COF A;  2ELB A;  2YS3 A;  2YSZ A;  2P0F A;  2CY4 A;  3KSY A;  1Y5O A;  4DBB A;  4IOY X;  3IVF A;  2HE7 A;  2RUK B;  1QQG A;  4GMV A;  2N0Y A;  3T06 A;  3A8P A;  4GZU A;  1GC6 A;  2KUP A;  4DXA B;  2DYQ A;  4P7I A;  3ML4 A;  1AWE A;  1OMW A;  5C79 A;  3FEH A;  5JHG A;  3PSC A;  2D2Q A;  1EF1 A;  2GJY A;  3TO1 A;  4ZRJ A;  4A6K A;  1B55 A;  2R0D A;  2K00 A;  4K2P A;  3SUZ A;  2J0J A;  2Y7B A;  1V61 A;  5DH9 B;  1V88 A;  2J59 M;  1FOE A;  1KI1 B;  2P0D A;  1DBH A;  5FI0 A;  1UNQ A;  2CY5 A;  2DHJ A;  4MT7 A;  1RRP B;  1H10 A;  1K5G B;  1XR0 B;  4A6F B;  1ISN A;  1OQN A;  1MK9 B;  5DHA B;  1PMS A;  2M14 A;  4CYE A;  1UPQ A;  3PG7 A;  2LUL A;  3OAN A;  1NU2 A;  2KCJ A;  3KRW A;  2IYB A;  1FAO A;  1K5D B;  1P3R A;  2EMT A;  1W1H A;  1WGU A;  4HAT B;  1U5D A;  1ZC3 B;  4EKU A;  2HTH B;  4KVG B;  5L81 A;  2AL6 A;  2YS1 A;  2I5C A;  2Y8F A;  2H7E A;  1P5T A;  3SV1 A;  2DX1 A;  3HQC A;  2D9V A;  1DYN A;  2LYD A;  1V5M A;  2D11 A;  3ODO A;  4HHV A;  3DXC A;  3U7D A;  5CLL B;  1DDW A;  4A5K A;  4MK0 A;  4HB3 B;  5EFX A;  4HAU B;  5HE0 A;  4EJN A;  3AJ4 A;  3NSU A;  2BCJ A;  1LB1 A;  4HAW B;  1M7E A;  2PZ1 A;  4Z2N A;  5DIF B;  2VKI A;  2DHI A;  3TVV A;  2DA0 A;  3AU4 A;  2ROZ B;  2Z0Q A;  2W2W A;  3FM8 C;  3ULC A;  2RLO A;  5JLJ B;  2CRF A;  2QKL A;  2RGN B;  4TYZ A;  3P7Z A;  4DX8 A;  4EMO A;  2RSG A;  2NZ8 B;  3HW2 B;  1KZ7 A;  1SHC A;  2EC1 A;  2YT0 A;  1WVH A;  3HK0 A;  4GPT B;  5GOW B;  3RCP A;  2M38 A;  2YVC A;  4Y94 A;  4YON A;  5KCV A;  2GS0 A;  5HE1 A;  2G35 A;  4PNK A;  2ADZ A;  1BTN A;  4IAP A;  4CHJ A;  1WGQ A;  2W2X D;  3MDB C;  2ZPY A;  5FI1 A;  4PQ0 A;  5D3V A;  3ODW A;  4F7G A;  2R09 A;  1BAK A;  5CLQ B;  1IRS A;  4K81 A;  1MK7 B;  1NTV A;  1KZG A;  4HAX B;  1MIX A;  4WJ7 A;  1XD4 A;  2D4Q A;  3ULB A;  3KRX A;  1UNP A;  1EVH A;  2GCL A;  3PP2 A;  5D3Y A;  1EAZ A;  2YF0 A;  2RNR B;  4NY0 A;  2ROV A;  3F0W A;  4KHB B;  1RJ2 A;  3KY9 A;  2OQB A;  5LON B;  3TW1 A;  3VIA A;  1J0W A;  4A6H A;  1FGY A;  3A8Q A;  3G9W A;  2MDX A;  2UZS A;  1X1F A;  2CAY A;  3CXB B;  1EGX A;  4KHA A;  1NI2 A;  2DLW A;  1BTK A;  3D8F A;  4KAX B;  4A6F A;  2LOX A;  1X1G A;  3AU5 A;  1OY2 A;  3DXE A;  1U5G A;  2ELA A;  1BWN A;  2KGX B;  1AQC A;  1N3H A;  5D3W A;  2QKM A;  1WJ1 A;  2LKO A;  3GYO A;  1X05 A;  1U5F A;  4ZRK A;  2DHK A;  1U29 A;  2JP2 A;  1J19 A;  1I2H A;  5HE2 A;  2N23 A;  4BBK A;  4HB0 B;  4GXB A;  4MY6 A;  1W1G A;  3WYF B;  3CIK A;  1MIZ B;  2Z0P A;  4TKN A;  2GCJ A;  3ZVR A;  3ZDT A;  1FHX A;  3O96 A;  3P6A A;  1LW3 A;  3QWM A;  2UZR A;  4Z2M B;  4F7U P;  1M7R A;  1FGZ A;  4K17 A;  1UNR A;  2J0K A;  4HAY B;  5C5B A;  1X11 A;  3X23 A;  3SNH A;  1V89 A;  3TFM A;  2COA A;  1E5W A;  4IFS A;  4GMX B;  2DYN A;  1TJ6 A;  3WA0 A;  1PLS A;  2IFS A;  4C0A A;  2RVB B;  2I5F A;  2YS5 A;  3MPX A;  4XWX A;  2EJ8 A;  1FHO A;  4ZRI A;  4L6E A;  1V5P A;  3N7C A;  2I1K A;  2Q13 A;  1FHW A;  5KQ1 A;  3A98 B;  2Z0O A;  1WI1 A;  1H4R A;  2D10 A;  3PEG A;  3UZT A;  3FSS A;  2LOZ A;  1U27 A;  5J3Y A;  2D9Y A;  1W1D A;  1TQZ A;  1XCG A;  1WJM A;  3KZ1 A;  3M1I B;  2DX5 A;  2DKP A;  2Y8G A;  2OTX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...