2K2JA

Nmr solution structure of the split ph domain from phospholipase c gamma 2
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
117
structure length
117
Chain Sequence
KKDEHKQQGELYMWDSIDQKWTRHYCAIADAKLSFSDDIEQTMEEDNPLGSLCRGILDLNTYNVVKAPQGKNQKSFVFILEPKQQGDPPVEFATDRVEELFEWFQSIREITWKIDTK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase ga
publication title Rac Regulates Its Effector Phospholipase C{gamma}2 through Interaction with a Split Pleckstrin Homology Domain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase, signaling protein
total genus 11
structure length 117
sequence length 117
ec nomenclature ec 3.1.4.11: Phosphoinositide phospholipase C.
pdb deposition date 2008-04-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2k2jA00
4A6FB 3T06A 3BINA 2DHIA 4XWXA 2HTHB 4WVFB 1FB8A 1X1FA 2LG1A 5DHFB 2CAYA 1U5DA 1TQZA 2W2WA 4Z2MB 1ZC3B 3MPXA 2M38A 4CYEA 1ZVRA 3SV1A 1KI1B 2YRYA 4HB4B 4PQ0A 4H8SA 3SUZA 2AL6A 3PVWA 4DX8A 2YS1A 1RJ2A 1I2HA 2LOZA 2MWNB 4GZUA 3D8DA 1WVHA 1AQCA 5L81A 4K17A 1J19A 1WI1A 2CRFA 2GJYA 4HAXB 5DH9B 3TVVA 3TO1A 5D3VA 2EMTA 2MKRA 1RRPB 2MDXA 4A6KA 4IAPA 2NMBA 2DYQA 2GCJA 3IVFA 2DFKA 3TCAA 1NI2A 1U5GA 2K00A 1P5TA 2DHJA 1X05A 2YF0A 1W1HA 1NU2A 4GMVA 5HE0A 4HDOA 4YONA 5CLLB 5J3YA 1WJ1A 4KAXB 4ZRKA 3HW2B 5LOPB 3ODXA 2P0DA 3FEHA 4CHJA 1TXDA 1W1DA 4C0AA 5KQ4A 2DA0A 1GG3A 5C5BA 2NZ8B 3CXBB 4MT7A 3A8QA 2I5CA 4BBKA 4GN1A 1BAKA 1DBHA 4GXBA 1PMSA 2ROZB 4YL8A 3KSYA 3ULBA 1ZSQA 2Q13A 2N23A 3FSSA 3SO6A 3F0WA 1U2BA 1AWEA 5JLJB 3PEGA 4WJ7A 4IFSA 5LONB 5HE1A 2VKIA 5JP4A 4ZRJA 3AU5A 1K5DB 4CHMA 1V88A 3ULCA 2N0YA 2ELBA 1FHWA 2DX1A 2Y7BA 1SHCA 1QC6A 1V89A 1MIXA 1EF1A 3NSUA 2W2XC 3KRXA 3WYFB 1X11A 2J59M 2KCJA 5D3WA 1WJMA 2VSZA 1EVHA 3KY9A 1NTYA 4NSWA 4A6FA 1Y19B 5D27A 5KCVA 4HB3B 2RLOA 5HE3A 1BWNA 2YS5A 4HAVB 3A98B 2MFQA 5D3XA 2DN6A 2COAA 4D0NB 2DX5A 3PVUA 1EAZA 2R09A 4EKUA 2DKQA 2PZ1A 2J0KA 4EJNA 4IOYX 2V76A 1BTNA 3ZVRA 5GOWB 5HE2A 2DYNA 1NTVA 2D9XA 2LOXA 3PP2A 4DXAB 3VIAA 1FAOA 3A8PA 2Z0QA 2OQBA 2JP2A 4KHOA 1M7RA 2Z0PA 3BJIA 3GYPA 2D4QA 4A6HA 1I7AA 1PFJA 2D2QA 2ADZA 2XQNM 2H7EA 5KQ1A 4EMOA 4A5KA 5JHGA 3ML4A 5CLQB 3D8EA 1Z87A 1EGXA 5EFXA 1XKEA 2KGXB 4F7HA 1U27A 1FHXA 3O96A 1OMWA 1DYNA 2FJLA 3RCPA 4DX90 1ISNA 2YVCA 3AJ4A 2I1JA 2VRWB 4HB2B 2IYBA 2D11A 4KHAA 3ODOA 3ZDTA 4K2PA 1GC7A 2YT1A 4ZRIA 1KZ7A 2YSZA 3AU4A 3SNHA 4HB0B 2DHKA 2QKMA 3WA0A 4DBBA 1QQGA 1UEFA 1UPRA 2W2XD 3QBVB 1PLSA 1OQNA 2D9WA 2P0FA 3MDBC 2CY4A 3G9WA 5J3QA 2YS3A 4HAUB 2AEHA 4HHVA 3HQCA 3DXEA 1WGQA 2Y8GA 2HE7A 1LB1A 1V5UA 4HAWB 3TW1A 2OTXA 1UPQA 4PNKA 4K2OA 2D9YA 4P7IA 2K2UA 1V61A 1WGUA 2J0MA 1H10A 1MIZB 2E2XA 2RUKB 2UZSA 1Y5OA 2CY5A 1FOEA 2YT0A 1Q67A 1SGHA 2R0DA 3U7DA 1MK7B 3DXDA 3P6AA 2Z0OA 3SYXA 2LYDA 2H7DA 3LJUX 5C16A 3DXCA 2ZPYA 1X86A 1WG7A 4HAYB 2GS0A 2D9VA 1V5MA 5DIFB 4MK0A 4MY6A 3UZTA 3VOQA 2QKLA 3QIJA 2D10A 1DDWA 1XODA 2KUPA 2IFSA 5JHHA 1XR0B 1K5GB 1DDVA 1KZGA 1FGYA 4TYZA 4GMXB 2ELAA 3PVLA 4K81A 5C79A 1V5PA 3PG7A 4L6EA 3ODWA 1J0WA 2P8VA 1UNRA 2M14A 2LULA 3KZ1A 2EJ8A 3HK0A 2I5FA 3P7ZA 1U5EA 2ROVA 1UNPA 2RSGA 1ZC4B 3TFMA 5DI9B 2G35A 2EC1A 1U29A 2P0HA 2RVBB 1MPHA 1B55A 2RGNB 1DDMA 1E5WA 2J0JA 2Y8FA 1LW3A 2COFA 2UZRA 4HAZB 1OY2A 5C6RA 1N3HA 1XX0A 1UNQA 2BCJA 4KVGB 2UVMA 3N7CA 1P6SA 3PZDA 1IRSA 1MK9B 1TJ6A 1XCGA 3KRWA 1W1GA 4KHBB 3QWMA 2K2JA 1X1GA 3V5WA 3X23A 1FHOA 2DTCA 2D9ZA 3OANA 2DKPA 4GPTB 3FM8C 1MAIA 1P3RA 4B6HA 1MKEA 4HDQA 5C5BB 2L2IA 1DROA 3F5RA 1H4RA 2L1CA 5D3YA 2COCA 3GYOA 3D8FA 2RNRB 3U8ZA 4WSFA 2DLWA 2LKOA 4NY0A 5J3TA 1XD4A 2EMSA 4HATB 4F7GA 4F7UP 1ZM0A 5DHAB 2GCLA 1FGZA 2CODA 1U5FA 3CIKA 1BTKA 2X18A 4TKNA 3PSCA 3M1IB 1GC6A 5FI0A 5FI1A 2I1KA 4Y94A 4Z2NA 1M7EA
chains in the Genus database with same CATH superfamily
4A6FB 2GUMA 3T06A 3BINA 2DHIA 2KIEA 4XWXA 2HTHB 4WVFB 1FB8A 3OHMB 1X1FA 2LG1A 5DHFB 2CAYA 1U5DA 1TQZA 2W2WA 4Z2MB 2Z4DA 1ZC3B 3MPXA 2M38A 4CYEA 1ZVRA 3SV1A 1KI1B 2K8EA 2YRYA 4HB4B 4PQ0A 4H8SA 4QJ3B 3SUZA 2AL6A 3PVWA 4DX8A 2YS1A 1RJ2A 1I2HA 2LOZA 2MWNB 4GZUA 3D8DA 1WVHA 1AQCA 5L81A 5LG4B 4K17A 1J19A 1WI1A 2ZKMX 2CRFA 2GJYA 2FJUB 4HAXB 5DH9B 3TVVA 3TO1A 5D3VA 2EMTA 2MKRA 1RRPB 2MDXA 4A6KA 4IAPA 2NMBA 2DYQA 2GCJA 3IVFA 4L1RA 2DFKA 3TCAA 1NI2A 1U5GA 2K00A 1P5TA 2DHJA 1X05A 2YF0A 1W1HA 1NU2A 4GMVA 5HE0A 2RRFA 4HDOA 4KHBA 4YONA 5CLLB 5J3YA 1WJ1A 4KAXB 4ZRKA 3HW2B 3NWFA 5LOPB 3ODXA 1MI1A 2P0DA 3FEHA 4CHJA 1TXDA 1W1DA 4C0AA 5KQ4A 3HSAA 2DA0A 1GG3A 5C5BA 2NZ8B 3CXBB 4MT7A 3A8QA 2I5CA 4BBKA 4GN1A 1BAKA 1DBHA 4GXBA 1PMSA 2ROZB 4YL8A 3KSYA 3ULBA 1ZSQA 2Q13A 2N23A 2Z13A 3FSSA 3SO6A 4OT1A 3F0WA 1U2BA 1AWEA 5JLJB 3PEGA 4WJ7A 4IFSA 5LONB 5HE1A 2VKIA 5JP4A 4ZRJA 3AU5A 1K5DB 4CHMA 1V88A 3ULCA 2N0YA 2ELBA 2KIGA 1FHWA 2DX1A 2Y7BA 1SHCA 1QC6A 1V89A 1MIXA 1EF1A 3KRXA 2W2XC 3NSUA 3WYFB 1X11A 2J59M 2KCJA 5D3WA 1WJMA 2VSZA 1EVHA 3KY9A 1NTYA 4NSWA 4A6FA 1Y19B 5D27A 5KCVA 4HB3B 2RLOA 5HE3A 1BWNA 2YS5A 4HAVB 3A98B 2MFQA 5D3XA 2DN6A 2COAA 4D0NB 2DX5A 3PVUA 1EAZA 2R09A 4EKUA 2DKQA 2PZ1A 2J0KA 4EJNA 4IOYX 2V76A 2Z59A 1BTNA 3ZVRA 5GOWB 5HE2A 2DYNA 1NTVA 2D9XA 2LOXA 3PP2A 4DXAB 3VIAA 1FAOA 3A8PA 2Z0QA 2OQBA 3HIEA 2JP2A 4KHOA 1M7RA 2Z0PA 4HSIA 3BJIA 3GYPA 2D4QA 4A6HA 1I7AA 1PFJA 2D2QA 2ADZA 2XQNM 2H7EA 5KQ1A 4EMOA 4A5KA 5JHGA 3ML4A 5CLQB 3D8EA 1Z87A 1EGXA 5EFXA 1XKEA 2KGXB 4F7HA 1U27A 1FHXA 1OMWA 3O96A 1DYNA 2FJLA 3RCPA 4DX90 1ISNA 2YVCA 3AJ4A 2I1JA 2VRWB 4HB2B 2IYBA 2D11A 4KHAA 3ODOA 3ZDTA 4K2PA 1GC7A 4DIXA 2YT1A 4ZRIA 1KZ7A 2YSZA 2YT2A 3AU4A 3SNHA 4HB0B 2DHKA 2QKMA 3WA0A 4DBBA 1QQGA 1UEFA 3NW8A 1UPRA 2W2XD 3QBVB 1PLSA 1OQNA 2D9WA 2P0FA 3MDBC 2CY4A 3G9WA 5J3QA 2YS3A 4HAUB 2AEHA 4HHVA 3HQCA 3DXEA 1WGQA 2Y8GA 2Z14A 2HE7A 1LB1A 4GNKB 1V5UA 4HAWB 3TW1A 2KR0A 2OTXA 1UPQA 4PNKA 4K2OA 2D9YA 4P7IA 2K2UA 4D6WA 1V61A 1WGUA 2J0MA 1H10A 1MIZB 2E2XA 2RUKB 2UZSA 1Y5OA 2CY5A 1FOEA 2YT0A 1Q67A 1SGHA 2R0DA 3U7DA 1MK7B 3DXDA 1ZYIA 3P6AA 4OSNA 2Z0OA 3SYXA 2LYDA 2H7DA 3LJUX 5C16A 3DXCA 4QJ4B 2ZPYA 1X86A 2NBVA 1WG7A 4HAYB 2GS0A 2D9VA 1V5MA 5DIFB 4MK0A 4MY6A 3UZTA 3VOQA 2QKLA 3QIJA 2D10A 1DDWA 1XODA 2KUPA 2IFSA 5JHHA 1XR0B 1K5GB 1DDVA 3NWAA 1KZGA 1FGYA 2R2YA 4TYZA 4GMXB 2ELAA 3PVLA 4K81A 4QXAB 5C79A 1V5PA 3B77A 3PG7A 4L6EA 3ODWA 1J0WA 2P8VA 1UNRA 4GOUA 2M14A 2LULA 3KZ1A 2EJ8A 3HK0A 2I5FA 3P7ZA 4CSQA 1U5EA 2ROVA 4QJ5B 1UNPA 2RSGA 5I2MA 1ZC4B 3TFMA 5DI9B 2G35A 2EC1A 1U29A 2P0HA 2RVBB 1MPHA 1B55A 2RGNB 1DDMA 3FVCA 1E5WA 2J0JA 2Y8FA 1LW3A 2COFA 2UZRA 4HAZB 1OY2A 2K49A 5C6RA 1N3HA 1XX0A 1UNQA 2BCJA 4KVGB 2UVMA 3N7CA 1P6SA 3PZDA 1IRSA 3A58A 1MK9B 1TJ6A 1XCGA 3KRWA 1W1GA 4KHBB 3QWMA 3NWDA 2K2JA 1X1GA 3V5WA 5M4YB 3X23A 1FHOA 2DTCA 2D9ZA 3OANA 2DKPA 4GPTB 5I2SA 3FM8C 1MAIA 1P3RA 4B6HA 1MKEA 4HDQA 5C5BB 2L2IA 1DROA 3F5RA 2KUQA 1H4RA 2L1CA 5D3YA 2COCA 3GYOA 3D8FA 2RNRB 3U8ZA 1T77A 4WSFA 2DLWA 2LKOA 4NY0A 5J3TA 1XD4A 2EMSA 4HATB 4F7GA 4F7UP 1ZM0A 5DHAB 3DCXA 2GCLA 1FGZA 2CODA 1U5FA 3CIKA 1BTKA 5IRSA 2X18A 4TKNA 3PSCA 3M1IB 1GC6A 5FI0A 5FI1A 2I1KA 4Y94A 4Z2NA 3U12A 1M7EA
chains in the Genus database with same CATH topology
4A6FB 3T06A 3BINA 2DHIA 4XWXA 2HTHB 4WVFB 1FB8A 1X1FA 2LG1A 5DHFB 2CAYA 1U5DA 1TQZA 2W2WA 4Z2MB 1ZC3B 3MPXA 2M38A 4CYEA 1ZVRA 3SV1A 1KI1B 2YRYA 4HB4B 4PQ0A 4H8SA 3SUZA 2AL6A 3PVWA 4DX8A 2YS1A 1RJ2A 1I2HA 2LOZA 2MWNB 4GZUA 3D8DA 1WVHA 1AQCA 5L81A 4K17A 1J19A 1WI1A 2CRFA 2GJYA 4HAXB 5DH9B 3TVVA 3TO1A 5D3VA 2EMTA 2MKRA 1RRPB 2MDXA 4A6KA 4IAPA 2NMBA 2DYQA 2GCJA 3IVFA 2DFKA 3TCAA 1NI2A 1U5GA 2K00A 1P5TA 2DHJA 1X05A 2YF0A 1W1HA 1NU2A 4GMVA 5HE0A 4HDOA 4YONA 5CLLB 5J3YA 1WJ1A 4KAXB 4ZRKA 3HW2B 5LOPB 3ODXA 2P0DA 3FEHA 4CHJA 1TXDA 1W1DA 4C0AA 5KQ4A 2DA0A 1GG3A 5C5BA 2NZ8B 3CXBB 4MT7A 3A8QA 2I5CA 4BBKA 4GN1A 1BAKA 1DBHA 4GXBA 1PMSA 2ROZB 4YL8A 3KSYA 3ULBA 1ZSQA 2Q13A 2N23A 3FSSA 3SO6A 3F0WA 1U2BA 1AWEA 5JLJB 3PEGA 4WJ7A 4IFSA 5LONB 5HE1A 2VKIA 5JP4A 4ZRJA 3AU5A 1K5DB 4CHMA 1V88A 3ULCA 2N0YA 2ELBA 1FHWA 2DX1A 2Y7BA 1SHCA 1QC6A 1V89A 1MIXA 1EF1A 3NSUA 2W2XC 3KRXA 3WYFB 1X11A 2J59M 2KCJA 5D3WA 1WJMA 2VSZA 1EVHA 3KY9A 1NTYA 4NSWA 4A6FA 1Y19B 5D27A 5KCVA 4HB3B 2RLOA 5HE3A 1BWNA 2YS5A 4HAVB 3A98B 2MFQA 5D3XA 2DN6A 2COAA 4D0NB 2DX5A 3PVUA 1EAZA 2R09A 4EKUA 2DKQA 2PZ1A 2J0KA 4EJNA 4IOYX 2V76A 1BTNA 3ZVRA 5GOWB 5HE2A 2DYNA 1NTVA 2D9XA 2LOXA 3PP2A 4DXAB 3VIAA 1FAOA 3A8PA 2Z0QA 2OQBA 2JP2A 4KHOA 1M7RA 2Z0PA 3BJIA 3GYPA 2D4QA 4A6HA 1I7AA 1PFJA 2D2QA 2ADZA 2XQNM 2H7EA 5KQ1A 4EMOA 4A5KA 5JHGA 3ML4A 5CLQB 3D8EA 1Z87A 1EGXA 5EFXA 1XKEA 2KGXB 4F7HA 1U27A 1FHXA 3O96A 1OMWA 1DYNA 2FJLA 3RCPA 4DX90 1ISNA 2YVCA 3AJ4A 2I1JA 2VRWB 4HB2B 2IYBA 2D11A 4KHAA 3ODOA 3ZDTA 4K2PA 1GC7A 2YT1A 4ZRIA 1KZ7A 2YSZA 3AU4A 3SNHA 4HB0B 2DHKA 2QKMA 3WA0A 4DBBA 1QQGA 1UEFA 1UPRA 2W2XD 3QBVB 1PLSA 1OQNA 2D9WA 2P0FA 3MDBC 2CY4A 3G9WA 5J3QA 2YS3A 4HAUB 2AEHA 4HHVA 3HQCA 3DXEA 1WGQA 2Y8GA 2HE7A 1LB1A 1V5UA 4HAWB 3TW1A 2OTXA 1UPQA 4PNKA 4K2OA 2D9YA 4P7IA 2K2UA 1V61A 1WGUA 2J0MA 1H10A 1MIZB 2E2XA 2RUKB 2UZSA 1Y5OA 2CY5A 1FOEA 2YT0A 1Q67A 1SGHA 2R0DA 3U7DA 1MK7B 3DXDA 3P6AA 2Z0OA 3SYXA 2LYDA 2H7DA 3LJUX 5C16A 3DXCA 2ZPYA 1X86A 1WG7A 4HAYB 2GS0A 2D9VA 1V5MA 5DIFB 4MK0A 4MY6A 3UZTA 3VOQA 2QKLA 3QIJA 2D10A 1DDWA 1XODA 2KUPA 2IFSA 5JHHA 1XR0B 1K5GB 1DDVA 1KZGA 1FGYA 4TYZA 4GMXB 2ELAA 3PVLA 4K81A 5C79A 1V5PA 3PG7A 4L6EA 3ODWA 1J0WA 2P8VA 1UNRA 2M14A 2LULA 3KZ1A 2EJ8A 3HK0A 2I5FA 3P7ZA 1U5EA 2ROVA 1UNPA 2RSGA 1ZC4B 3TFMA 5DI9B 2G35A 2EC1A 1U29A 2P0HA 2RVBB 1MPHA 1B55A 2RGNB 1DDMA 1E5WA 2J0JA 2Y8FA 1LW3A 2COFA 2UZRA 4HAZB 1OY2A 5C6RA 1N3HA 1XX0A 1UNQA 2BCJA 4KVGB 2UVMA 3N7CA 1P6SA 3PZDA 1IRSA 1MK9B 1TJ6A 1XCGA 3KRWA 1W1GA 4KHBB 3QWMA 2K2JA 1X1GA 3V5WA 3X23A 1FHOA 2DTCA 2D9ZA 3OANA 2DKPA 4GPTB 3FM8C 1MAIA 1P3RA 4B6HA 1MKEA 4HDQA 5C5BB 2L2IA 1DROA 3F5RA 1H4RA 2L1CA 5D3YA 2COCA 3GYOA 3D8FA 2RNRB 3U8ZA 4WSFA 2DLWA 2LKOA 4NY0A 5J3TA 1XD4A 2EMSA 4HATB 4F7GA 4F7UP 1ZM0A 5DHAB 2GCLA 1FGZA 2CODA 1U5FA 3CIKA 1BTKA 2X18A 4TKNA 3PSCA 3M1IB 1GC6A 5FI0A 5FI1A 2I1KA 4Y94A 4Z2NA 1M7EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4A6F B;  3T06 A;  3BIN A;  2DHI A;  4XWX A;  2HTH B;  4WVF B;  1FB8 A;  1X1F A;  2LG1 A;  5DHF B;  2CAY A;  1U5D A;  1TQZ A;  2W2W A;  4Z2M B;  1ZC3 B;  3MPX A;  2M38 A;  4CYE A;  1ZVR A;  3SV1 A;  1KI1 B;  2YRY A;  4HB4 B;  4PQ0 A;  4H8S A;  3SUZ A;  2AL6 A;  3PVW A;  4DX8 A;  2YS1 A;  1RJ2 A;  1I2H A;  2LOZ A;  2MWN B;  4GZU A;  3D8D A;  1WVH A;  1AQC A;  5L81 A;  4K17 A;  1J19 A;  1WI1 A;  2CRF A;  2GJY A;  4HAX B;  5DH9 B;  3TVV A;  3TO1 A;  5D3V A;  2EMT A;  2MKR A;  1RRP B;  2MDX A;  4A6K A;  4IAP A;  2NMB A;  2DYQ A;  2GCJ A;  3IVF A;  2DFK A;  3TCA A;  1NI2 A;  1U5G A;  2K00 A;  1P5T A;  2DHJ A;  1X05 A;  2YF0 A;  1W1H A;  1NU2 A;  4GMV A;  5HE0 A;  4HDO A;  4YON A;  5CLL B;  5J3Y A;  1WJ1 A;  4KAX B;  4ZRK A;  3HW2 B;  5LOP B;  3ODX A;  2P0D A;  3FEH A;  4CHJ A;  1TXD A;  1W1D A;  4C0A A;  5KQ4 A;  2DA0 A;  1GG3 A;  5C5B A;  2NZ8 B;  3CXB B;  4MT7 A;  3A8Q A;  2I5C A;  4BBK A;  4GN1 A;  1BAK A;  1DBH A;  4GXB A;  1PMS A;  2ROZ B;  4YL8 A;  3KSY A;  3ULB A;  1ZSQ A;  2Q13 A;  2N23 A;  3FSS A;  3SO6 A;  3F0W A;  1U2B A;  1AWE A;  5JLJ B;  3PEG A;  4WJ7 A;  4IFS A;  5LON B;  5HE1 A;  2VKI A;  5JP4 A;  4ZRJ A;  3AU5 A;  1K5D B;  4CHM A;  1V88 A;  3ULC A;  2N0Y A;  2ELB A;  1FHW A;  2DX1 A;  2Y7B A;  1SHC A;  1QC6 A;  1V89 A;  1MIX A;  1EF1 A;  3NSU A;  2W2X C;  3KRX A;  3WYF B;  1X11 A;  2J59 M;  2KCJ A;  5D3W A;  1WJM A;  2VSZ A;  1EVH A;  3KY9 A;  1NTY A;  4NSW A;  4A6F A;  1Y19 B;  5D27 A;  5KCV A;  4HB3 B;  2RLO A;  5HE3 A;  1BWN A;  2YS5 A;  4HAV B;  3A98 B;  2MFQ A;  5D3X A;  2DN6 A;  2COA A;  4D0N B;  2DX5 A;  3PVU A;  1EAZ A;  2R09 A;  4EKU A;  2DKQ A;  2PZ1 A;  2J0K A;  4EJN A;  4IOY X;  2V76 A;  1BTN A;  3ZVR A;  5GOW B;  5HE2 A;  2DYN A;  1NTV A;  2D9X A;  2LOX A;  3PP2 A;  4DXA B;  3VIA A;  1FAO A;  3A8P A;  2Z0Q A;  2OQB A;  2JP2 A;  4KHO A;  1M7R A;  2Z0P A;  3BJI A;  3GYP A;  2D4Q A;  4A6H A;  1I7A A;  1PFJ A;  2D2Q A;  2ADZ A;  2XQN M;  2H7E A;  5KQ1 A;  4EMO A;  4A5K A;  5JHG A;  3ML4 A;  5CLQ B;  3D8E A;  1Z87 A;  1EGX A;  5EFX A;  1XKE A;  2KGX B;  4F7H A;  1U27 A;  1FHX A;  3O96 A;  1OMW A;  1DYN A;  2FJL A;  3RCP A;  4DX9 0;  1ISN A;  2YVC A;  3AJ4 A;  2I1J A;  2VRW B;  4HB2 B;  2IYB A;  2D11 A;  4KHA A;  3ODO A;  3ZDT A;  4K2P A;  1GC7 A;  2YT1 A;  4ZRI A;  1KZ7 A;  2YSZ A;  3AU4 A;  3SNH A;  4HB0 B;  2DHK A;  2QKM A;  3WA0 A;  4DBB A;  1QQG A;  1UEF A;  1UPR A;  2W2X D;  3QBV B;  1PLS A;  1OQN A;  2D9W A;  2P0F A;  3MDB C;  2CY4 A;  3G9W A;  5J3Q A;  2YS3 A;  4HAU B;  2AEH A;  4HHV A;  3HQC A;  3DXE A;  1WGQ A;  2Y8G A;  2HE7 A;  1LB1 A;  1V5U A;  4HAW B;  3TW1 A;  2OTX A;  1UPQ A;  4PNK A;  4K2O A;  2D9Y A;  4P7I A;  2K2U A;  1V61 A;  1WGU A;  2J0M A;  1H10 A;  1MIZ B;  2E2X A;  2RUK B;  2UZS A;  1Y5O A;  2CY5 A;  1FOE A;  2YT0 A;  1Q67 A;  1SGH A;  2R0D A;  3U7D A;  1MK7 B;  3DXD A;  3P6A A;  2Z0O A;  3SYX A;  2LYD A;  2H7D A;  3LJU X;  5C16 A;  3DXC A;  2ZPY A;  1X86 A;  1WG7 A;  4HAY B;  2GS0 A;  2D9V A;  1V5M A;  5DIF B;  4MK0 A;  4MY6 A;  3UZT A;  3VOQ A;  2QKL A;  3QIJ A;  2D10 A;  1DDW A;  1XOD A;  2KUP A;  2IFS A;  5JHH A;  1XR0 B;  1K5G B;  1DDV A;  1KZG A;  1FGY A;  4TYZ A;  4GMX B;  2ELA A;  3PVL A;  4K81 A;  5C79 A;  1V5P A;  3PG7 A;  4L6E A;  3ODW A;  1J0W A;  2P8V A;  1UNR A;  2M14 A;  2LUL A;  3KZ1 A;  2EJ8 A;  3HK0 A;  2I5F A;  3P7Z A;  1U5E A;  2ROV A;  1UNP A;  2RSG A;  1ZC4 B;  3TFM A;  5DI9 B;  2G35 A;  2EC1 A;  1U29 A;  2P0H A;  2RVB B;  1MPH A;  1B55 A;  2RGN B;  1DDM A;  1E5W A;  2J0J A;  2Y8F A;  1LW3 A;  2COF A;  2UZR A;  4HAZ B;  1OY2 A;  5C6R A;  1N3H A;  1XX0 A;  1UNQ A;  2BCJ A;  4KVG B;  2UVM A;  3N7C A;  1P6S A;  3PZD A;  1IRS A;  1MK9 B;  1TJ6 A;  1XCG A;  3KRW A;  1W1G A;  4KHB B;  3QWM A;  2K2J A;  1X1G A;  3V5W A;  3X23 A;  1FHO A;  2DTC A;  2D9Z A;  3OAN A;  2DKP A;  4GPT B;  3FM8 C;  1MAI A;  1P3R A;  4B6H A;  1MKE A;  4HDQ A;  5C5B B;  2L2I A;  1DRO A;  3F5R A;  1H4R A;  2L1C A;  5D3Y A;  2COC A;  3GYO A;  3D8F A;  2RNR B;  3U8Z A;  4WSF A;  2DLW A;  2LKO A;  4NY0 A;  5J3T A;  1XD4 A;  2EMS A;  4HAT B;  4F7G A;  4F7U P;  1ZM0 A;  5DHA B;  2GCL A;  1FGZ A;  2COD A;  1U5F A;  3CIK A;  1BTK A;  2X18 A;  4TKN A;  3PSC A;  3M1I B;  1GC6 A;  5FI0 A;  5FI1 A;  2I1K A;  4Y94 A;  4Z2N A;  1M7E A; 
#chains in the Genus database with same CATH topology
 4A6F B;  2GUM A;  3T06 A;  3BIN A;  2DHI A;  2KIE A;  4XWX A;  2HTH B;  4WVF B;  1FB8 A;  3OHM B;  1X1F A;  2LG1 A;  5DHF B;  2CAY A;  1U5D A;  1TQZ A;  2W2W A;  4Z2M B;  2Z4D A;  1ZC3 B;  3MPX A;  2M38 A;  4CYE A;  1ZVR A;  3SV1 A;  1KI1 B;  2K8E A;  2YRY A;  4HB4 B;  4PQ0 A;  4H8S A;  4QJ3 B;  3SUZ A;  2AL6 A;  3PVW A;  4DX8 A;  2YS1 A;  1RJ2 A;  1I2H A;  2LOZ A;  2MWN B;  4GZU A;  3D8D A;  1WVH A;  1AQC A;  5L81 A;  5LG4 B;  4K17 A;  1J19 A;  1WI1 A;  2ZKM X;  2CRF A;  2GJY A;  2FJU B;  4HAX B;  5DH9 B;  3TVV A;  3TO1 A;  5D3V A;  2EMT A;  2MKR A;  1RRP B;  2MDX A;  4A6K A;  4IAP A;  2NMB A;  2DYQ A;  2GCJ A;  3IVF A;  4L1R A;  2DFK A;  3TCA A;  1NI2 A;  1U5G A;  2K00 A;  1P5T A;  2DHJ A;  1X05 A;  2YF0 A;  1W1H A;  1NU2 A;  4GMV A;  5HE0 A;  2RRF A;  4HDO A;  4KHB A;  4YON A;  5CLL B;  5J3Y A;  1WJ1 A;  4KAX B;  4ZRK A;  3HW2 B;  3NWF A;  5LOP B;  3ODX A;  1MI1 A;  2P0D A;  3FEH A;  4CHJ A;  1TXD A;  1W1D A;  4C0A A;  5KQ4 A;  3HSA A;  2DA0 A;  1GG3 A;  5C5B A;  2NZ8 B;  3CXB B;  4MT7 A;  3A8Q A;  2I5C A;  4BBK A;  4GN1 A;  1BAK A;  1DBH A;  4GXB A;  1PMS A;  2ROZ B;  4YL8 A;  3KSY A;  3ULB A;  1ZSQ A;  2Q13 A;  2N23 A;  2Z13 A;  3FSS A;  3SO6 A;  4OT1 A;  3F0W A;  1U2B A;  1AWE A;  5JLJ B;  3PEG A;  4WJ7 A;  4IFS A;  5LON B;  5HE1 A;  2VKI A;  5JP4 A;  4ZRJ A;  3AU5 A;  1K5D B;  4CHM A;  1V88 A;  3ULC A;  2N0Y A;  2ELB A;  2KIG A;  1FHW A;  2DX1 A;  2Y7B A;  1SHC A;  1QC6 A;  1V89 A;  1MIX A;  1EF1 A;  3KRX A;  2W2X C;  3NSU A;  3WYF B;  1X11 A;  2J59 M;  2KCJ A;  5D3W A;  1WJM A;  2VSZ A;  1EVH A;  3KY9 A;  1NTY A;  4NSW A;  4A6F A;  1Y19 B;  5D27 A;  5KCV A;  4HB3 B;  2RLO A;  5HE3 A;  1BWN A;  2YS5 A;  4HAV B;  3A98 B;  2MFQ A;  5D3X A;  2DN6 A;  2COA A;  4D0N B;  2DX5 A;  3PVU A;  1EAZ A;  2R09 A;  4EKU A;  2DKQ A;  2PZ1 A;  2J0K A;  4EJN A;  4IOY X;  2V76 A;  2Z59 A;  1BTN A;  3ZVR A;  5GOW B;  5HE2 A;  2DYN A;  1NTV A;  2D9X A;  2LOX A;  3PP2 A;  4DXA B;  3VIA A;  1FAO A;  3A8P A;  2Z0Q A;  2OQB A;  3HIE A;  2JP2 A;  4KHO A;  1M7R A;  2Z0P A;  4HSI A;  3BJI A;  3GYP A;  2D4Q A;  4A6H A;  1I7A A;  1PFJ A;  2D2Q A;  2ADZ A;  2XQN M;  2H7E A;  5KQ1 A;  4EMO A;  4A5K A;  5JHG A;  3ML4 A;  5CLQ B;  3D8E A;  1Z87 A;  1EGX A;  5EFX A;  1XKE A;  2KGX B;  4F7H A;  1U27 A;  1FHX A;  1OMW A;  3O96 A;  1DYN A;  2FJL A;  3RCP A;  4DX9 0;  1ISN A;  2YVC A;  3AJ4 A;  2I1J A;  2VRW B;  4HB2 B;  2IYB A;  2D11 A;  4KHA A;  3ODO A;  3ZDT A;  4K2P A;  1GC7 A;  4DIX A;  2YT1 A;  4ZRI A;  1KZ7 A;  2YSZ A;  2YT2 A;  3AU4 A;  3SNH A;  4HB0 B;  2DHK A;  2QKM A;  3WA0 A;  4DBB A;  1QQG A;  1UEF A;  3NW8 A;  1UPR A;  2W2X D;  3QBV B;  1PLS A;  1OQN A;  2D9W A;  2P0F A;  3MDB C;  2CY4 A;  3G9W A;  5J3Q A;  2YS3 A;  4HAU B;  2AEH A;  4HHV A;  3HQC A;  3DXE A;  1WGQ A;  2Y8G A;  2Z14 A;  2HE7 A;  1LB1 A;  4GNK B;  1V5U A;  4HAW B;  3TW1 A;  2KR0 A;  2OTX A;  1UPQ A;  4PNK A;  4K2O A;  2D9Y A;  4P7I A;  2K2U A;  4D6W A;  1V61 A;  1WGU A;  2J0M A;  1H10 A;  1MIZ B;  2E2X A;  2RUK B;  2UZS A;  1Y5O A;  2CY5 A;  1FOE A;  2YT0 A;  1Q67 A;  1SGH A;  2R0D A;  3U7D A;  1MK7 B;  3DXD A;  1ZYI A;  3P6A A;  4OSN A;  2Z0O A;  3SYX A;  2LYD A;  2H7D A;  3LJU X;  5C16 A;  3DXC A;  4QJ4 B;  2ZPY A;  1X86 A;  2NBV A;  1WG7 A;  4HAY B;  2GS0 A;  2D9V A;  1V5M A;  5DIF B;  4MK0 A;  4MY6 A;  3UZT A;  3VOQ A;  2QKL A;  3QIJ A;  2D10 A;  1DDW A;  1XOD A;  2KUP A;  2IFS A;  5JHH A;  1XR0 B;  1K5G B;  1DDV A;  3NWA A;  1KZG A;  1FGY A;  2R2Y A;  4TYZ A;  4GMX B;  2ELA A;  3PVL A;  4K81 A;  4QXA B;  5C79 A;  1V5P A;  3B77 A;  3PG7 A;  4L6E A;  3ODW A;  1J0W A;  2P8V A;  1UNR A;  4GOU A;  2M14 A;  2LUL A;  3KZ1 A;  2EJ8 A;  3HK0 A;  2I5F A;  3P7Z A;  4CSQ A;  1U5E A;  2ROV A;  4QJ5 B;  1UNP A;  2RSG A;  5I2M A;  1ZC4 B;  3TFM A;  5DI9 B;  2G35 A;  2EC1 A;  1U29 A;  2P0H A;  2RVB B;  1MPH A;  1B55 A;  2RGN B;  1DDM A;  3FVC A;  1E5W A;  2J0J A;  2Y8F A;  1LW3 A;  2COF A;  2UZR A;  4HAZ B;  1OY2 A;  2K49 A;  5C6R A;  1N3H A;  1XX0 A;  1UNQ A;  2BCJ A;  4KVG B;  2UVM A;  3N7C A;  1P6S A;  3PZD A;  1IRS A;  3A58 A;  1MK9 B;  1TJ6 A;  1XCG A;  3KRW A;  1W1G A;  4KHB B;  3QWM A;  3NWD A;  2K2J A;  1X1G A;  3V5W A;  5M4Y B;  3X23 A;  1FHO A;  2DTC A;  2D9Z A;  3OAN A;  2DKP A;  4GPT B;  5I2S A;  3FM8 C;  1MAI A;  1P3R A;  4B6H A;  1MKE A;  4HDQ A;  5C5B B;  2L2I A;  1DRO A;  3F5R A;  2KUQ A;  1H4R A;  2L1C A;  5D3Y A;  2COC A;  3GYO A;  3D8F A;  2RNR B;  3U8Z A;  1T77 A;  4WSF A;  2DLW A;  2LKO A;  4NY0 A;  5J3T A;  1XD4 A;  2EMS A;  4HAT B;  4F7G A;  4F7U P;  1ZM0 A;  5DHA B;  3DCX A;  2GCL A;  1FGZ A;  2COD A;  1U5F A;  3CIK A;  1BTK A;  5IRS A;  2X18 A;  4TKN A;  3PSC A;  3M1I B;  1GC6 A;  5FI0 A;  5FI1 A;  2I1K A;  4Y94 A;  4Z2N A;  3U12 A;  1M7E A; 
#chains in the Genus database with same CATH homology
 4A6F B;  3T06 A;  3BIN A;  2DHI A;  4XWX A;  2HTH B;  4WVF B;  1FB8 A;  1X1F A;  2LG1 A;  5DHF B;  2CAY A;  1U5D A;  1TQZ A;  2W2W A;  4Z2M B;  1ZC3 B;  3MPX A;  2M38 A;  4CYE A;  1ZVR A;  3SV1 A;  1KI1 B;  2YRY A;  4HB4 B;  4PQ0 A;  4H8S A;  3SUZ A;  2AL6 A;  3PVW A;  4DX8 A;  2YS1 A;  1RJ2 A;  1I2H A;  2LOZ A;  2MWN B;  4GZU A;  3D8D A;  1WVH A;  1AQC A;  5L81 A;  4K17 A;  1J19 A;  1WI1 A;  2CRF A;  2GJY A;  4HAX B;  5DH9 B;  3TVV A;  3TO1 A;  5D3V A;  2EMT A;  2MKR A;  1RRP B;  2MDX A;  4A6K A;  4IAP A;  2NMB A;  2DYQ A;  2GCJ A;  3IVF A;  2DFK A;  3TCA A;  1NI2 A;  1U5G A;  2K00 A;  1P5T A;  2DHJ A;  1X05 A;  2YF0 A;  1W1H A;  1NU2 A;  4GMV A;  5HE0 A;  4HDO A;  4YON A;  5CLL B;  5J3Y A;  1WJ1 A;  4KAX B;  4ZRK A;  3HW2 B;  5LOP B;  3ODX A;  2P0D A;  3FEH A;  4CHJ A;  1TXD A;  1W1D A;  4C0A A;  5KQ4 A;  2DA0 A;  1GG3 A;  5C5B A;  2NZ8 B;  3CXB B;  4MT7 A;  3A8Q A;  2I5C A;  4BBK A;  4GN1 A;  1BAK A;  1DBH A;  4GXB A;  1PMS A;  2ROZ B;  4YL8 A;  3KSY A;  3ULB A;  1ZSQ A;  2Q13 A;  2N23 A;  3FSS A;  3SO6 A;  3F0W A;  1U2B A;  1AWE A;  5JLJ B;  3PEG A;  4WJ7 A;  4IFS A;  5LON B;  5HE1 A;  2VKI A;  5JP4 A;  4ZRJ A;  3AU5 A;  1K5D B;  4CHM A;  1V88 A;  3ULC A;  2N0Y A;  2ELB A;  1FHW A;  2DX1 A;  2Y7B A;  1SHC A;  1QC6 A;  1V89 A;  1MIX A;  1EF1 A;  3NSU A;  2W2X C;  3KRX A;  3WYF B;  1X11 A;  2J59 M;  2KCJ A;  5D3W A;  1WJM A;  2VSZ A;  1EVH A;  3KY9 A;  1NTY A;  4NSW A;  4A6F A;  1Y19 B;  5D27 A;  5KCV A;  4HB3 B;  2RLO A;  5HE3 A;  1BWN A;  2YS5 A;  4HAV B;  3A98 B;  2MFQ A;  5D3X A;  2DN6 A;  2COA A;  4D0N B;  2DX5 A;  3PVU A;  1EAZ A;  2R09 A;  4EKU A;  2DKQ A;  2PZ1 A;  2J0K A;  4EJN A;  4IOY X;  2V76 A;  1BTN A;  3ZVR A;  5GOW B;  5HE2 A;  2DYN A;  1NTV A;  2D9X A;  2LOX A;  3PP2 A;  4DXA B;  3VIA A;  1FAO A;  3A8P A;  2Z0Q A;  2OQB A;  2JP2 A;  4KHO A;  1M7R A;  2Z0P A;  3BJI A;  3GYP A;  2D4Q A;  4A6H A;  1I7A A;  1PFJ A;  2D2Q A;  2ADZ A;  2XQN M;  2H7E A;  5KQ1 A;  4EMO A;  4A5K A;  5JHG A;  3ML4 A;  5CLQ B;  3D8E A;  1Z87 A;  1EGX A;  5EFX A;  1XKE A;  2KGX B;  4F7H A;  1U27 A;  1FHX A;  3O96 A;  1OMW A;  1DYN A;  2FJL A;  3RCP A;  4DX9 0;  1ISN A;  2YVC A;  3AJ4 A;  2I1J A;  2VRW B;  4HB2 B;  2IYB A;  2D11 A;  4KHA A;  3ODO A;  3ZDT A;  4K2P A;  1GC7 A;  2YT1 A;  4ZRI A;  1KZ7 A;  2YSZ A;  3AU4 A;  3SNH A;  4HB0 B;  2DHK A;  2QKM A;  3WA0 A;  4DBB A;  1QQG A;  1UEF A;  1UPR A;  2W2X D;  3QBV B;  1PLS A;  1OQN A;  2D9W A;  2P0F A;  3MDB C;  2CY4 A;  3G9W A;  5J3Q A;  2YS3 A;  4HAU B;  2AEH A;  4HHV A;  3HQC A;  3DXE A;  1WGQ A;  2Y8G A;  2HE7 A;  1LB1 A;  1V5U A;  4HAW B;  3TW1 A;  2OTX A;  1UPQ A;  4PNK A;  4K2O A;  2D9Y A;  4P7I A;  2K2U A;  1V61 A;  1WGU A;  2J0M A;  1H10 A;  1MIZ B;  2E2X A;  2RUK B;  2UZS A;  1Y5O A;  2CY5 A;  1FOE A;  2YT0 A;  1Q67 A;  1SGH A;  2R0D A;  3U7D A;  1MK7 B;  3DXD A;  3P6A A;  2Z0O A;  3SYX A;  2LYD A;  2H7D A;  3LJU X;  5C16 A;  3DXC A;  2ZPY A;  1X86 A;  1WG7 A;  4HAY B;  2GS0 A;  2D9V A;  1V5M A;  5DIF B;  4MK0 A;  4MY6 A;  3UZT A;  3VOQ A;  2QKL A;  3QIJ A;  2D10 A;  1DDW A;  1XOD A;  2KUP A;  2IFS A;  5JHH A;  1XR0 B;  1K5G B;  1DDV A;  1KZG A;  1FGY A;  4TYZ A;  4GMX B;  2ELA A;  3PVL A;  4K81 A;  5C79 A;  1V5P A;  3PG7 A;  4L6E A;  3ODW A;  1J0W A;  2P8V A;  1UNR A;  2M14 A;  2LUL A;  3KZ1 A;  2EJ8 A;  3HK0 A;  2I5F A;  3P7Z A;  1U5E A;  2ROV A;  1UNP A;  2RSG A;  1ZC4 B;  3TFM A;  5DI9 B;  2G35 A;  2EC1 A;  1U29 A;  2P0H A;  2RVB B;  1MPH A;  1B55 A;  2RGN B;  1DDM A;  1E5W A;  2J0J A;  2Y8F A;  1LW3 A;  2COF A;  2UZR A;  4HAZ B;  1OY2 A;  5C6R A;  1N3H A;  1XX0 A;  1UNQ A;  2BCJ A;  4KVG B;  2UVM A;  3N7C A;  1P6S A;  3PZD A;  1IRS A;  1MK9 B;  1TJ6 A;  1XCG A;  3KRW A;  1W1G A;  4KHB B;  3QWM A;  2K2J A;  1X1G A;  3V5W A;  3X23 A;  1FHO A;  2DTC A;  2D9Z A;  3OAN A;  2DKP A;  4GPT B;  3FM8 C;  1MAI A;  1P3R A;  4B6H A;  1MKE A;  4HDQ A;  5C5B B;  2L2I A;  1DRO A;  3F5R A;  1H4R A;  2L1C A;  5D3Y A;  2COC A;  3GYO A;  3D8F A;  2RNR B;  3U8Z A;  4WSF A;  2DLW A;  2LKO A;  4NY0 A;  5J3T A;  1XD4 A;  2EMS A;  4HAT B;  4F7G A;  4F7U P;  1ZM0 A;  5DHA B;  2GCL A;  1FGZ A;  2COD A;  1U5F A;  3CIK A;  1BTK A;  2X18 A;  4TKN A;  3PSC A;  3M1I B;  1GC6 A;  5FI0 A;  5FI1 A;  2I1K A;  4Y94 A;  4Z2N A;  1M7E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...