2K2JA

Nmr solution structure of the split ph domain from phospholipase c gamma 2
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
117
structure length
117
Chain Sequence
KKDEHKQQGELYMWDSIDQKWTRHYCAIADAKLSFSDDIEQTMEEDNPLGSLCRGILDLNTYNVVKAPQGKNQKSFVFILEPKQQGDPPVEFATDRVEELFEWFQSIREITWKIDTK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase ga
publication title Rac Regulates Its Effector Phospholipase C{gamma}2 through Interaction with a Split Pleckstrin Homology Domain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase, signaling protein
total genus 11
structure length 117
sequence length 117
ec nomenclature ec 3.1.4.11: Phosphoinositide phospholipase C.
pdb deposition date 2008-04-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2k2jA00
1TXDA 1EGXA 1DDWA 1PFJA 3P7ZA 2HE7A 2IFSA 4PQ0A 2YT0A 3A8QA 2COCA 2CRFA 4HB4B 4Y94A 2RNRB 5L81A 1E5WA 2ELBA 5HE3A 1Z87A 2D9YA 2K2JA 2H7EA 4HAXB 1MPHA 1UPRA 1V5PA 4P7IA 1WVHA 2J0MA 4ZRIA 4KAXB 2AEHA 1GG3A 3M1IB 1QC6A 2BCJA 1Q67A 4HAVB 2D11A 2DHIA 2YSZA 4HDQA 1V88A 1UEFA 2LOZA 3ODWA 1Y19B 4YONA 2LYDA 4CHJA 2K00A 2Q13A 1OQNA 4F7UP 4GN1A 2VSZA 5JHHA 1EF1A 1ZM0A 1M7EA 3TCAA 4BBKA 2UZRA 5C5BB 2YVCA 4D0NB 5DIFB 3P6AA 4F7HA 3TVVA 3AU4A 2M38A 2P0DA 4KHAA 5KQ1A 2I1KA 1ZSQA 2Z0OA 2JP2A 1OY2A 1P3RA 1X1FA 2L1CA 1MKEA 2D10A 2YS1A 2W2XD 2RGNB 4MT7A 1GC6A 3DXEA 2R09A 1BWNA 4CHMA 1ISNA 5JP4A 3PVUA 1FAOA 1K5GB 3U7DA 2RLOA 2DA0A 5J3QA 1U2BA 3N7CA 4L6EA 4EMOA 1MK7B 3DXDA 4DX8A 3MDBC 1SHCA 2P8VA 2LOXA 2M14A 5JLJB 1AQCA 5D3WA 3KRXA 2YS3A 1N3HA 4K17A 2GCLA 2CY4A 1DYNA 2N23A 3FM8C 4HB0B 3RCPA 4Z2NA 4K2OA 1WG7A 4HAYB 3U8ZA 1FHWA 1WJ1A 1EAZA 1NI2A 2EC1A 5GOWB 4ZRKA 1U27A 1OMWA 1RJ2A 3TO1A 5FI0A 1MIXA 4A6FB 1I7AA 2Y7BA 3OANA 1U5FA 4A6HA 1K5DB 5C16A 1H4RA 4ZRJA 1BTNA 2EMSA 2CAYA 3SO6A 5HE0A 1UNPA 4IFSA 2VRWB 2NMBA 4K2PA 3WA0A 3DXCA 3SNHA 3PP2A 3F5RA 2L2IA 3WYFB 1FHOA 1H10A 3SUZA 2Y8FA 3PVLA 2D9VA 3V5WA 4K81A 2RUKB 4HAUB 2DN6A 3PZDA 2AL6A 1XODA 2ROZB 2I1JA 3ULBA 3ZVRA 1SGHA 5LOPB 2D9XA 1X11A 1J0WA 4A5KA 4DX90 3BINA 5FI1A 1EVHA 2LKOA 2RVBB 2E2XA 1FGZA 3VIAA 4IAPA 3ZDTA 2I5CA 2J0JA 1ZC3B 1DDVA 4IOYX 2PZ1A 5C6RA 2CY5A 5HE1A 5DI9B 2GJYA 3X23A 1W1HA 3PEGA 1V61A 4A6KA 3FEHA 2K2UA 5CLLB 2YF0A 1P6SA 4EJNA 4C0AA 5J3TA 3T06A 3FSSA 1MK9B 2ZPYA 1NTYA 1BTKA 4WVFB 2EJ8A 1X86A 3QIJA 5DHFB 2MFQA 1WGUA 1FGYA 1XR0B 1U5GA 1ZVRA 1WI1A 2ADZA 5DHAB 3TW1A 4B6HA 1Y5OA 1UPQA 4HB2B 5D3YA 3ML4A 1V5MA 1MIZB 1U5DA 2Z0QA 1WJMA 4PNKA 1NTVA 3CIKA 4XWXA 3UZTA 3F0WA 2P0HA 2H7DA 2YS5A 2LG1A 4Z2MB 1KZ7A 2X18A 4HAZB 1UNQA 4CYEA 2MKRA 3HW2B 1BAKA 1FOEA 1V89A 1KZGA 1DDMA 3VOQA 2MWNB 4H8SA 3D8EA 1MAIA 1X05A 1XD4A 2D4QA 1P5TA 5J3YA 2QKMA 1GC7A 1LB1A 2ELAA 3BJIA 2P0FA 5LONB 3KRWA 2IYBA 1DROA 3ULCA 2NZ8B 3IVFA 4DXAB 4MY6A 2VKIA 2OTXA 5CLQB 5EFXA 1NU2A 2FJLA 2MDXA 2Y8GA 1XX0A 3HK0A 3CXBB 1TQZA 1UNRA 2DLWA 4DBBA 2UZSA 4YL8A 4HATB 1WGQA 3QBVB 3SYXA 4GXBA 3D8DA 1PLSA 2XQNM 3G9WA 5C5BA 2DHJA 5D27A 4WSFA 1U29A 3LJUX 1FB8A 3PSCA 3HQCA 4KHOA 1IRSA 5C79A 3PVWA 2W2XC 2QKLA 5HE2A 2ROVA 5KQ4A 4HDOA 1V5UA 3AJ4A 1J19A 2LULA 1B55A 4NY0A 2YT1A 2EMTA 4HB3B 1PMSA 2HTHB 3KZ1A 2KGXB 2DYQA 5D3VA 1U5EA 4GPTB 2DTCA 1ZC4B 4GMXB 3KSYA 2R0DA 2D9ZA 2V76A 1AWEA 1XKEA 3PG7A 3D8FA 2DKQA 2KUPA 3TFMA 2W2WA 2GS0A 3A8PA 2D9WA 3O96A 5DH9B 2KCJA 4EKUA 4WJ7A 2DYNA 2Z0PA 2OQBA 2J59M 4TKNA 3ODXA 5KCVA 4F7GA 2DKPA 2GCJA 2G35A 3NSUA 5D3XA 1DBHA 2J0KA 2D2QA 2DFKA 1KI1B 4GMVA 3GYOA 4MK0A 1W1GA 1W1DA 1FHXA 1I2HA 2YRYA 3ODOA 3A98B 1M7RA 2N0YA 3MPXA 3SV1A 1XCGA 4A6FA 1LW3A 2COAA 4TYZA 4NSWA 3QWMA 3GYPA 5JHGA 1TJ6A 2RSGA 1RRPB 2DX5A 3AU5A 4KHBB 4KVGB 2I5FA 4GZUA 2CODA 3KY9A 2COFA 2DX1A 1X1GA 1QQGA 2DHKA 4HHVA 2UVMA 4HAWB
chains in the Genus database with same CATH superfamily
1TXDA 1EGXA 1DDWA 1PFJA 3P7ZA 2HE7A 2IFSA 4PQ0A 2YT0A 3A8QA 4QJ4B 2COCA 2CRFA 4HB4B 4Y94A 2RNRB 5L81A 1E5WA 2ELBA 5HE3A 1Z87A 2KUQA 2D9YA 2K2JA 2H7EA 2RRFA 4HAXB 1MPHA 1UPRA 1V5PA 4P7IA 1WVHA 2J0MA 4ZRIA 4KAXB 2AEHA 1GG3A 3M1IB 1QC6A 2BCJA 1Q67A 4HAVB 4QJ3B 2D11A 2DHIA 2YSZA 4HDQA 1V88A 3NWAA 1UEFA 2LOZA 3ODWA 1Y19B 4YONA 2LYDA 4CHJA 4HSIA 2K00A 2Q13A 1OQNA 4F7UP 4GN1A 2VSZA 5JHHA 1EF1A 1ZM0A 1ZYIA 1M7EA 3TCAA 4BBKA 2UZRA 1T77A 2KIEA 5C5BB 2YVCA 4D0NB 5DIFB 3P6AA 4F7HA 3TVVA 2Z59A 3AU4A 2M38A 2P0DA 4KHAA 5KQ1A 2I1KA 1ZSQA 2Z0OA 2JP2A 1OY2A 1P3RA 1X1FA 2L1CA 1MKEA 2D10A 2YS1A 2W2XD 2RGNB 4MT7A 1GC6A 3DXEA 2R09A 1BWNA 4CHMA 1ISNA 5JP4A 3PVUA 1FAOA 1K5GB 3U7DA 2RLOA 2R2YA 2DA0A 5J3QA 1U2BA 3N7CA 4L6EA 4EMOA 1MK7B 3DXDA 4DX8A 3MDBC 1SHCA 2FJUB 2P8VA 2LOXA 2M14A 5JLJB 1AQCA 5D3WA 3KRXA 2YS3A 1N3HA 3A58A 4K17A 5I2SA 2GCLA 2CY4A 1DYNA 2N23A 3FM8C 4HB0B 3RCPA 2Z4DA 4Z2NA 4K2OA 1WG7A 4HAYB 3U8ZA 1FHWA 1WJ1A 1EAZA 1NI2A 2EC1A 5GOWB 4ZRKA 1U27A 2Z14A 1OMWA 1RJ2A 3TO1A 5FI0A 1MIXA 3OHMB 4L1RA 4A6FB 1I7AA 2Y7BA 3OANA 1U5FA 5M4YB 4A6HA 1K5DB 5C16A 1H4RA 4ZRJA 1BTNA 2EMSA 2CAYA 3SO6A 3B77A 5HE0A 1UNPA 4IFSA 2VRWB 2NMBA 4K2PA 3WA0A 3DXCA 3SNHA 3PP2A 3F5RA 2L2IA 3WYFB 1FHOA 1H10A 3SUZA 2Y8FA 3PVLA 2Z13A 3U12A 2D9VA 3V5WA 4K81A 3NW8A 2RUKB 4HAUB 2DN6A 3PZDA 2AL6A 1XODA 2ROZB 2I1JA 3ULBA 3ZVRA 1SGHA 5LOPB 3NWFA 2D9XA 1X11A 1J0WA 4A5KA 4DX90 3BINA 4D6WA 5FI1A 1EVHA 2LKOA 2RVBB 2E2XA 1FGZA 3VIAA 4IAPA 3ZDTA 2I5CA 2J0JA 1ZC3B 1DDVA 4IOYX 2PZ1A 5C6RA 2CY5A 5HE1A 5DI9B 5LG4B 2GJYA 3HIEA 3X23A 1W1HA 3PEGA 1V61A 4A6KA 3FEHA 2K2UA 5CLLB 2YF0A 1P6SA 3FVCA 4EJNA 4C0AA 5J3TA 3T06A 3FSSA 1MK9B 2ZPYA 1NTYA 1BTKA 4WVFB 2EJ8A 1X86A 3QIJA 5DHFB 4CSQA 5I2MA 2MFQA 1WGUA 1FGYA 1XR0B 1U5GA 1ZVRA 1WI1A 2ADZA 5DHAB 3TW1A 4B6HA 1Y5OA 2K8EA 1UPQA 4HB2B 2KIGA 3ML4A 5D3YA 1V5MA 2ZKMX 1MIZB 2GUMA 1U5DA 2Z0QA 1WJMA 4PNKA 1NTVA 3CIKA 4XWXA 3UZTA 4DIXA 4KHBA 3F0WA 2P0HA 2H7DA 2YS5A 2LG1A 4Z2MB 1KZ7A 2X18A 4HAZB 1UNQA 4CYEA 2MKRA 3HW2B 1BAKA 1FOEA 1V89A 2YT2A 1KZGA 1DDMA 3VOQA 3NWDA 2MWNB 4H8SA 3D8EA 2KR0A 1MAIA 1X05A 1XD4A 2D4QA 1P5TA 5J3YA 2QKMA 1GC7A 1LB1A 2ELAA 3BJIA 3HSAA 2P0FA 5LONB 3KRWA 2IYBA 1DROA 3ULCA 2NZ8B 3IVFA 4DXAB 4MY6A 2VKIA 3DCXA 2OTXA 5CLQB 5EFXA 1NU2A 2FJLA 2MDXA 2Y8GA 1XX0A 3HK0A 3CXBB 1TQZA 1UNRA 2DLWA 4DBBA 2K49A 2UZSA 4YL8A 4HATB 1WGQA 3QBVB 4QXAB 3SYXA 4QJ5B 4GXBA 3D8DA 1PLSA 2XQNM 3G9WA 5C5BA 2DHJA 5D27A 4WSFA 1U29A 3LJUX 1FB8A 3PSCA 3HQCA 4KHOA 1IRSA 5C79A 3PVWA 2W2XC 2QKLA 5HE2A 2ROVA 5KQ4A 4HDOA 1V5UA 3AJ4A 1J19A 2LULA 1B55A 4NY0A 2YT1A 2EMTA 4HB3B 1PMSA 2HTHB 3KZ1A 2KGXB 2DYQA 4GOUA 1U5EA 5D3VA 4GPTB 2DTCA 1ZC4B 4GMXB 1MI1A 3KSYA 2R0DA 2D9ZA 2V76A 1AWEA 1XKEA 3PG7A 3D8FA 2DKQA 2KUPA 4GNKB 3TFMA 2W2WA 2GS0A 3A8PA 2D9WA 3O96A 5DH9B 2KCJA 4EKUA 4WJ7A 2DYNA 2Z0PA 2OQBA 2J59M 4TKNA 2NBVA 3ODXA 4OT1A 5KCVA 4F7GA 2DKPA 2GCJA 2G35A 3NSUA 5D3XA 5IRSA 1DBHA 2J0KA 2D2QA 4OSNA 2DFKA 1KI1B 4GMVA 3GYOA 4MK0A 1W1GA 1W1DA 1FHXA 1I2HA 2YRYA 3ODOA 3A98B 1M7RA 2N0YA 3MPXA 3SV1A 1XCGA 4A6FA 1LW3A 2COAA 4TYZA 4NSWA 3QWMA 3GYPA 5JHGA 1TJ6A 2RSGA 1RRPB 2DX5A 3AU5A 4KHBB 4KVGB 2I5FA 4GZUA 2CODA 3KY9A 2COFA 2DX1A 1X1GA 1QQGA 2DHKA 4HHVA 2UVMA 4HAWB
chains in the Genus database with same CATH topology
1TXDA 1EGXA 1DDWA 1PFJA 3P7ZA 2HE7A 2IFSA 4PQ0A 2YT0A 3A8QA 2COCA 2CRFA 4HB4B 4Y94A 2RNRB 5L81A 1E5WA 2ELBA 5HE3A 1Z87A 2D9YA 2K2JA 2H7EA 4HAXB 1MPHA 1UPRA 1V5PA 4P7IA 1WVHA 2J0MA 4ZRIA 4KAXB 2AEHA 1GG3A 3M1IB 1QC6A 2BCJA 1Q67A 4HAVB 2D11A 2DHIA 2YSZA 4HDQA 1V88A 1UEFA 2LOZA 3ODWA 1Y19B 4YONA 2LYDA 4CHJA 2K00A 2Q13A 1OQNA 4F7UP 4GN1A 2VSZA 5JHHA 1EF1A 1ZM0A 1M7EA 3TCAA 4BBKA 2UZRA 5C5BB 2YVCA 4D0NB 5DIFB 3P6AA 4F7HA 3TVVA 3AU4A 2M38A 2P0DA 4KHAA 5KQ1A 2I1KA 1ZSQA 2Z0OA 2JP2A 1OY2A 1P3RA 1X1FA 2L1CA 1MKEA 2D10A 2YS1A 2W2XD 2RGNB 4MT7A 1GC6A 3DXEA 2R09A 1BWNA 4CHMA 1ISNA 5JP4A 3PVUA 1FAOA 1K5GB 3U7DA 2RLOA 2DA0A 5J3QA 1U2BA 3N7CA 4L6EA 4EMOA 1MK7B 3DXDA 4DX8A 3MDBC 1SHCA 2P8VA 2LOXA 2M14A 5JLJB 1AQCA 5D3WA 3KRXA 2YS3A 1N3HA 4K17A 2GCLA 2CY4A 1DYNA 2N23A 3FM8C 4HB0B 3RCPA 4Z2NA 4K2OA 1WG7A 4HAYB 3U8ZA 1FHWA 1WJ1A 1EAZA 1NI2A 2EC1A 5GOWB 4ZRKA 1U27A 1OMWA 1RJ2A 3TO1A 5FI0A 1MIXA 4A6FB 1I7AA 2Y7BA 3OANA 1U5FA 4A6HA 1K5DB 5C16A 1H4RA 4ZRJA 1BTNA 2EMSA 2CAYA 3SO6A 5HE0A 1UNPA 4IFSA 2VRWB 2NMBA 4K2PA 3WA0A 3DXCA 3SNHA 3PP2A 3F5RA 2L2IA 3WYFB 1FHOA 1H10A 3SUZA 2Y8FA 3PVLA 2D9VA 3V5WA 4K81A 2RUKB 4HAUB 2DN6A 3PZDA 2AL6A 1XODA 2ROZB 2I1JA 3ULBA 3ZVRA 1SGHA 5LOPB 2D9XA 1X11A 1J0WA 4A5KA 4DX90 3BINA 5FI1A 1EVHA 2LKOA 2RVBB 2E2XA 1FGZA 3VIAA 4IAPA 3ZDTA 2I5CA 2J0JA 1ZC3B 1DDVA 4IOYX 2PZ1A 5C6RA 2CY5A 5HE1A 5DI9B 2GJYA 3X23A 1W1HA 3PEGA 1V61A 4A6KA 3FEHA 2K2UA 5CLLB 2YF0A 1P6SA 4EJNA 4C0AA 5J3TA 3T06A 3FSSA 1MK9B 2ZPYA 1NTYA 1BTKA 4WVFB 2EJ8A 1X86A 3QIJA 5DHFB 2MFQA 1WGUA 1FGYA 1XR0B 1U5GA 1ZVRA 1WI1A 2ADZA 5DHAB 3TW1A 4B6HA 1Y5OA 1UPQA 4HB2B 5D3YA 3ML4A 1V5MA 1MIZB 1U5DA 2Z0QA 1WJMA 4PNKA 1NTVA 3CIKA 4XWXA 3UZTA 3F0WA 2P0HA 2H7DA 2YS5A 2LG1A 4Z2MB 1KZ7A 2X18A 4HAZB 1UNQA 4CYEA 2MKRA 3HW2B 1BAKA 1FOEA 1V89A 1KZGA 1DDMA 3VOQA 2MWNB 4H8SA 3D8EA 1MAIA 1X05A 1XD4A 2D4QA 1P5TA 5J3YA 2QKMA 1GC7A 1LB1A 2ELAA 3BJIA 2P0FA 5LONB 3KRWA 2IYBA 1DROA 3ULCA 2NZ8B 3IVFA 4DXAB 4MY6A 2VKIA 2OTXA 5CLQB 5EFXA 1NU2A 2FJLA 2MDXA 2Y8GA 1XX0A 3HK0A 3CXBB 1TQZA 1UNRA 2DLWA 4DBBA 2UZSA 4YL8A 4HATB 1WGQA 3QBVB 3SYXA 4GXBA 3D8DA 1PLSA 2XQNM 3G9WA 5C5BA 2DHJA 5D27A 4WSFA 1U29A 3LJUX 1FB8A 3PSCA 3HQCA 4KHOA 1IRSA 5C79A 3PVWA 2W2XC 2QKLA 5HE2A 2ROVA 5KQ4A 4HDOA 1V5UA 3AJ4A 1J19A 2LULA 1B55A 4NY0A 2YT1A 2EMTA 4HB3B 1PMSA 2HTHB 3KZ1A 2KGXB 2DYQA 5D3VA 1U5EA 4GPTB 2DTCA 1ZC4B 4GMXB 3KSYA 2R0DA 2D9ZA 2V76A 1AWEA 1XKEA 3PG7A 3D8FA 2DKQA 2KUPA 3TFMA 2W2WA 2GS0A 3A8PA 2D9WA 3O96A 5DH9B 2KCJA 4EKUA 4WJ7A 2DYNA 2Z0PA 2OQBA 2J59M 4TKNA 3ODXA 5KCVA 4F7GA 2DKPA 2GCJA 2G35A 3NSUA 5D3XA 1DBHA 2J0KA 2D2QA 2DFKA 1KI1B 4GMVA 3GYOA 4MK0A 1W1GA 1W1DA 1FHXA 1I2HA 2YRYA 3ODOA 3A98B 1M7RA 2N0YA 3MPXA 3SV1A 1XCGA 4A6FA 1LW3A 2COAA 4TYZA 4NSWA 3QWMA 3GYPA 5JHGA 1TJ6A 2RSGA 1RRPB 2DX5A 3AU5A 4KHBB 4KVGB 2I5FA 4GZUA 2CODA 3KY9A 2COFA 2DX1A 1X1GA 1QQGA 2DHKA 4HHVA 2UVMA 4HAWB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TXD A;  1EGX A;  1DDW A;  1PFJ A;  3P7Z A;  2HE7 A;  2IFS A;  4PQ0 A;  2YT0 A;  3A8Q A;  2COC A;  2CRF A;  4HB4 B;  4Y94 A;  2RNR B;  5L81 A;  1E5W A;  2ELB A;  5HE3 A;  1Z87 A;  2D9Y A;  2K2J A;  2H7E A;  4HAX B;  1MPH A;  1UPR A;  1V5P A;  4P7I A;  1WVH A;  2J0M A;  4ZRI A;  4KAX B;  2AEH A;  1GG3 A;  3M1I B;  1QC6 A;  2BCJ A;  1Q67 A;  4HAV B;  2D11 A;  2DHI A;  2YSZ A;  4HDQ A;  1V88 A;  1UEF A;  2LOZ A;  3ODW A;  1Y19 B;  4YON A;  2LYD A;  4CHJ A;  2K00 A;  2Q13 A;  1OQN A;  4F7U P;  4GN1 A;  2VSZ A;  5JHH A;  1EF1 A;  1ZM0 A;  1M7E A;  3TCA A;  4BBK A;  2UZR A;  5C5B B;  2YVC A;  4D0N B;  5DIF B;  3P6A A;  4F7H A;  3TVV A;  3AU4 A;  2M38 A;  2P0D A;  4KHA A;  5KQ1 A;  2I1K A;  1ZSQ A;  2Z0O A;  2JP2 A;  1OY2 A;  1P3R A;  1X1F A;  2L1C A;  1MKE A;  2D10 A;  2YS1 A;  2W2X D;  2RGN B;  4MT7 A;  1GC6 A;  3DXE A;  2R09 A;  1BWN A;  4CHM A;  1ISN A;  5JP4 A;  3PVU A;  1FAO A;  1K5G B;  3U7D A;  2RLO A;  2DA0 A;  5J3Q A;  1U2B A;  3N7C A;  4L6E A;  4EMO A;  1MK7 B;  3DXD A;  4DX8 A;  3MDB C;  1SHC A;  2P8V A;  2LOX A;  2M14 A;  5JLJ B;  1AQC A;  5D3W A;  3KRX A;  2YS3 A;  1N3H A;  4K17 A;  2GCL A;  2CY4 A;  1DYN A;  2N23 A;  3FM8 C;  4HB0 B;  3RCP A;  4Z2N A;  4K2O A;  1WG7 A;  4HAY B;  3U8Z A;  1FHW A;  1WJ1 A;  1EAZ A;  1NI2 A;  2EC1 A;  5GOW B;  4ZRK A;  1U27 A;  1OMW A;  1RJ2 A;  3TO1 A;  5FI0 A;  1MIX A;  4A6F B;  1I7A A;  2Y7B A;  3OAN A;  1U5F A;  4A6H A;  1K5D B;  5C16 A;  1H4R A;  4ZRJ A;  1BTN A;  2EMS A;  2CAY A;  3SO6 A;  5HE0 A;  1UNP A;  4IFS A;  2VRW B;  2NMB A;  4K2P A;  3WA0 A;  3DXC A;  3SNH A;  3PP2 A;  3F5R A;  2L2I A;  3WYF B;  1FHO A;  1H10 A;  3SUZ A;  2Y8F A;  3PVL A;  2D9V A;  3V5W A;  4K81 A;  2RUK B;  4HAU B;  2DN6 A;  3PZD A;  2AL6 A;  1XOD A;  2ROZ B;  2I1J A;  3ULB A;  3ZVR A;  1SGH A;  5LOP B;  2D9X A;  1X11 A;  1J0W A;  4A5K A;  4DX9 0;  3BIN A;  5FI1 A;  1EVH A;  2LKO A;  2RVB B;  2E2X A;  1FGZ A;  3VIA A;  4IAP A;  3ZDT A;  2I5C A;  2J0J A;  1ZC3 B;  1DDV A;  4IOY X;  2PZ1 A;  5C6R A;  2CY5 A;  5HE1 A;  5DI9 B;  2GJY A;  3X23 A;  1W1H A;  3PEG A;  1V61 A;  4A6K A;  3FEH A;  2K2U A;  5CLL B;  2YF0 A;  1P6S A;  4EJN A;  4C0A A;  5J3T A;  3T06 A;  3FSS A;  1MK9 B;  2ZPY A;  1NTY A;  1BTK A;  4WVF B;  2EJ8 A;  1X86 A;  3QIJ A;  5DHF B;  2MFQ A;  1WGU A;  1FGY A;  1XR0 B;  1U5G A;  1ZVR A;  1WI1 A;  2ADZ A;  5DHA B;  3TW1 A;  4B6H A;  1Y5O A;  1UPQ A;  4HB2 B;  5D3Y A;  3ML4 A;  1V5M A;  1MIZ B;  1U5D A;  2Z0Q A;  1WJM A;  4PNK A;  1NTV A;  3CIK A;  4XWX A;  3UZT A;  3F0W A;  2P0H A;  2H7D A;  2YS5 A;  2LG1 A;  4Z2M B;  1KZ7 A;  2X18 A;  4HAZ B;  1UNQ A;  4CYE A;  2MKR A;  3HW2 B;  1BAK A;  1FOE A;  1V89 A;  1KZG A;  1DDM A;  3VOQ A;  2MWN B;  4H8S A;  3D8E A;  1MAI A;  1X05 A;  1XD4 A;  2D4Q A;  1P5T A;  5J3Y A;  2QKM A;  1GC7 A;  1LB1 A;  2ELA A;  3BJI A;  2P0F A;  5LON B;  3KRW A;  2IYB A;  1DRO A;  3ULC A;  2NZ8 B;  3IVF A;  4DXA B;  4MY6 A;  2VKI A;  2OTX A;  5CLQ B;  5EFX A;  1NU2 A;  2FJL A;  2MDX A;  2Y8G A;  1XX0 A;  3HK0 A;  3CXB B;  1TQZ A;  1UNR A;  2DLW A;  4DBB A;  2UZS A;  4YL8 A;  4HAT B;  1WGQ A;  3QBV B;  3SYX A;  4GXB A;  3D8D A;  1PLS A;  2XQN M;  3G9W A;  5C5B A;  2DHJ A;  5D27 A;  4WSF A;  1U29 A;  3LJU X;  1FB8 A;  3PSC A;  3HQC A;  4KHO A;  1IRS A;  5C79 A;  3PVW A;  2W2X C;  2QKL A;  5HE2 A;  2ROV A;  5KQ4 A;  4HDO A;  1V5U A;  3AJ4 A;  1J19 A;  2LUL A;  1B55 A;  4NY0 A;  2YT1 A;  2EMT A;  4HB3 B;  1PMS A;  2HTH B;  3KZ1 A;  2KGX B;  2DYQ A;  5D3V A;  1U5E A;  4GPT B;  2DTC A;  1ZC4 B;  4GMX B;  3KSY A;  2R0D A;  2D9Z A;  2V76 A;  1AWE A;  1XKE A;  3PG7 A;  3D8F A;  2DKQ A;  2KUP A;  3TFM A;  2W2W A;  2GS0 A;  3A8P A;  2D9W A;  3O96 A;  5DH9 B;  2KCJ A;  4EKU A;  4WJ7 A;  2DYN A;  2Z0P A;  2OQB A;  2J59 M;  4TKN A;  3ODX A;  5KCV A;  4F7G A;  2DKP A;  2GCJ A;  2G35 A;  3NSU A;  5D3X A;  1DBH A;  2J0K A;  2D2Q A;  2DFK A;  1KI1 B;  4GMV A;  3GYO A;  4MK0 A;  1W1G A;  1W1D A;  1FHX A;  1I2H A;  2YRY A;  3ODO A;  3A98 B;  1M7R A;  2N0Y A;  3MPX A;  3SV1 A;  1XCG A;  4A6F A;  1LW3 A;  2COA A;  4TYZ A;  4NSW A;  3QWM A;  3GYP A;  5JHG A;  1TJ6 A;  2RSG A;  1RRP B;  2DX5 A;  3AU5 A;  4KHB B;  4KVG B;  2I5F A;  4GZU A;  2COD A;  3KY9 A;  2COF A;  2DX1 A;  1X1G A;  1QQG A;  2DHK A;  4HHV A;  2UVM A;  4HAW B; 
#chains in the Genus database with same CATH topology
 1TXD A;  1EGX A;  1DDW A;  1PFJ A;  3P7Z A;  2HE7 A;  2IFS A;  4PQ0 A;  2YT0 A;  3A8Q A;  4QJ4 B;  2COC A;  2CRF A;  4HB4 B;  4Y94 A;  2RNR B;  5L81 A;  1E5W A;  2ELB A;  5HE3 A;  1Z87 A;  2KUQ A;  2D9Y A;  2K2J A;  2H7E A;  2RRF A;  4HAX B;  1MPH A;  1UPR A;  1V5P A;  4P7I A;  1WVH A;  2J0M A;  4ZRI A;  4KAX B;  2AEH A;  1GG3 A;  3M1I B;  1QC6 A;  2BCJ A;  1Q67 A;  4HAV B;  4QJ3 B;  2D11 A;  2DHI A;  2YSZ A;  4HDQ A;  1V88 A;  3NWA A;  1UEF A;  2LOZ A;  3ODW A;  1Y19 B;  4YON A;  2LYD A;  4CHJ A;  4HSI A;  2K00 A;  2Q13 A;  1OQN A;  4F7U P;  4GN1 A;  2VSZ A;  5JHH A;  1EF1 A;  1ZM0 A;  1ZYI A;  1M7E A;  3TCA A;  4BBK A;  2UZR A;  1T77 A;  2KIE A;  5C5B B;  2YVC A;  4D0N B;  5DIF B;  3P6A A;  4F7H A;  3TVV A;  2Z59 A;  3AU4 A;  2M38 A;  2P0D A;  4KHA A;  5KQ1 A;  2I1K A;  1ZSQ A;  2Z0O A;  2JP2 A;  1OY2 A;  1P3R A;  1X1F A;  2L1C A;  1MKE A;  2D10 A;  2YS1 A;  2W2X D;  2RGN B;  4MT7 A;  1GC6 A;  3DXE A;  2R09 A;  1BWN A;  4CHM A;  1ISN A;  5JP4 A;  3PVU A;  1FAO A;  1K5G B;  3U7D A;  2RLO A;  2R2Y A;  2DA0 A;  5J3Q A;  1U2B A;  3N7C A;  4L6E A;  4EMO A;  1MK7 B;  3DXD A;  4DX8 A;  3MDB C;  1SHC A;  2FJU B;  2P8V A;  2LOX A;  2M14 A;  5JLJ B;  1AQC A;  5D3W A;  3KRX A;  2YS3 A;  1N3H A;  3A58 A;  4K17 A;  5I2S A;  2GCL A;  2CY4 A;  1DYN A;  2N23 A;  3FM8 C;  4HB0 B;  3RCP A;  2Z4D A;  4Z2N A;  4K2O A;  1WG7 A;  4HAY B;  3U8Z A;  1FHW A;  1WJ1 A;  1EAZ A;  1NI2 A;  2EC1 A;  5GOW B;  4ZRK A;  1U27 A;  2Z14 A;  1OMW A;  1RJ2 A;  3TO1 A;  5FI0 A;  1MIX A;  3OHM B;  4L1R A;  4A6F B;  1I7A A;  2Y7B A;  3OAN A;  1U5F A;  5M4Y B;  4A6H A;  1K5D B;  5C16 A;  1H4R A;  4ZRJ A;  1BTN A;  2EMS A;  2CAY A;  3SO6 A;  3B77 A;  5HE0 A;  1UNP A;  4IFS A;  2VRW B;  2NMB A;  4K2P A;  3WA0 A;  3DXC A;  3SNH A;  3PP2 A;  3F5R A;  2L2I A;  3WYF B;  1FHO A;  1H10 A;  3SUZ A;  2Y8F A;  3PVL A;  2Z13 A;  3U12 A;  2D9V A;  3V5W A;  4K81 A;  3NW8 A;  2RUK B;  4HAU B;  2DN6 A;  3PZD A;  2AL6 A;  1XOD A;  2ROZ B;  2I1J A;  3ULB A;  3ZVR A;  1SGH A;  5LOP B;  3NWF A;  2D9X A;  1X11 A;  1J0W A;  4A5K A;  4DX9 0;  3BIN A;  4D6W A;  5FI1 A;  1EVH A;  2LKO A;  2RVB B;  2E2X A;  1FGZ A;  3VIA A;  4IAP A;  3ZDT A;  2I5C A;  2J0J A;  1ZC3 B;  1DDV A;  4IOY X;  2PZ1 A;  5C6R A;  2CY5 A;  5HE1 A;  5DI9 B;  5LG4 B;  2GJY A;  3HIE A;  3X23 A;  1W1H A;  3PEG A;  1V61 A;  4A6K A;  3FEH A;  2K2U A;  5CLL B;  2YF0 A;  1P6S A;  3FVC A;  4EJN A;  4C0A A;  5J3T A;  3T06 A;  3FSS A;  1MK9 B;  2ZPY A;  1NTY A;  1BTK A;  4WVF B;  2EJ8 A;  1X86 A;  3QIJ A;  5DHF B;  4CSQ A;  5I2M A;  2MFQ A;  1WGU A;  1FGY A;  1XR0 B;  1U5G A;  1ZVR A;  1WI1 A;  2ADZ A;  5DHA B;  3TW1 A;  4B6H A;  1Y5O A;  2K8E A;  1UPQ A;  4HB2 B;  2KIG A;  3ML4 A;  5D3Y A;  1V5M A;  2ZKM X;  1MIZ B;  2GUM A;  1U5D A;  2Z0Q A;  1WJM A;  4PNK A;  1NTV A;  3CIK A;  4XWX A;  3UZT A;  4DIX A;  4KHB A;  3F0W A;  2P0H A;  2H7D A;  2YS5 A;  2LG1 A;  4Z2M B;  1KZ7 A;  2X18 A;  4HAZ B;  1UNQ A;  4CYE A;  2MKR A;  3HW2 B;  1BAK A;  1FOE A;  1V89 A;  2YT2 A;  1KZG A;  1DDM A;  3VOQ A;  3NWD A;  2MWN B;  4H8S A;  3D8E A;  2KR0 A;  1MAI A;  1X05 A;  1XD4 A;  2D4Q A;  1P5T A;  5J3Y A;  2QKM A;  1GC7 A;  1LB1 A;  2ELA A;  3BJI A;  3HSA A;  2P0F A;  5LON B;  3KRW A;  2IYB A;  1DRO A;  3ULC A;  2NZ8 B;  3IVF A;  4DXA B;  4MY6 A;  2VKI A;  3DCX A;  2OTX A;  5CLQ B;  5EFX A;  1NU2 A;  2FJL A;  2MDX A;  2Y8G A;  1XX0 A;  3HK0 A;  3CXB B;  1TQZ A;  1UNR A;  2DLW A;  4DBB A;  2K49 A;  2UZS A;  4YL8 A;  4HAT B;  1WGQ A;  3QBV B;  4QXA B;  3SYX A;  4QJ5 B;  4GXB A;  3D8D A;  1PLS A;  2XQN M;  3G9W A;  5C5B A;  2DHJ A;  5D27 A;  4WSF A;  1U29 A;  3LJU X;  1FB8 A;  3PSC A;  3HQC A;  4KHO A;  1IRS A;  5C79 A;  3PVW A;  2W2X C;  2QKL A;  5HE2 A;  2ROV A;  5KQ4 A;  4HDO A;  1V5U A;  3AJ4 A;  1J19 A;  2LUL A;  1B55 A;  4NY0 A;  2YT1 A;  2EMT A;  4HB3 B;  1PMS A;  2HTH B;  3KZ1 A;  2KGX B;  2DYQ A;  4GOU A;  1U5E A;  5D3V A;  4GPT B;  2DTC A;  1ZC4 B;  4GMX B;  1MI1 A;  3KSY A;  2R0D A;  2D9Z A;  2V76 A;  1AWE A;  1XKE A;  3PG7 A;  3D8F A;  2DKQ A;  2KUP A;  4GNK B;  3TFM A;  2W2W A;  2GS0 A;  3A8P A;  2D9W A;  3O96 A;  5DH9 B;  2KCJ A;  4EKU A;  4WJ7 A;  2DYN A;  2Z0P A;  2OQB A;  2J59 M;  4TKN A;  2NBV A;  3ODX A;  4OT1 A;  5KCV A;  4F7G A;  2DKP A;  2GCJ A;  2G35 A;  3NSU A;  5D3X A;  5IRS A;  1DBH A;  2J0K A;  2D2Q A;  4OSN A;  2DFK A;  1KI1 B;  4GMV A;  3GYO A;  4MK0 A;  1W1G A;  1W1D A;  1FHX A;  1I2H A;  2YRY A;  3ODO A;  3A98 B;  1M7R A;  2N0Y A;  3MPX A;  3SV1 A;  1XCG A;  4A6F A;  1LW3 A;  2COA A;  4TYZ A;  4NSW A;  3QWM A;  3GYP A;  5JHG A;  1TJ6 A;  2RSG A;  1RRP B;  2DX5 A;  3AU5 A;  4KHB B;  4KVG B;  2I5F A;  4GZU A;  2COD A;  3KY9 A;  2COF A;  2DX1 A;  1X1G A;  1QQG A;  2DHK A;  4HHV A;  2UVM A;  4HAW B; 
#chains in the Genus database with same CATH homology
 1TXD A;  1EGX A;  1DDW A;  1PFJ A;  3P7Z A;  2HE7 A;  2IFS A;  4PQ0 A;  2YT0 A;  3A8Q A;  2COC A;  2CRF A;  4HB4 B;  4Y94 A;  2RNR B;  5L81 A;  1E5W A;  2ELB A;  5HE3 A;  1Z87 A;  2D9Y A;  2K2J A;  2H7E A;  4HAX B;  1MPH A;  1UPR A;  1V5P A;  4P7I A;  1WVH A;  2J0M A;  4ZRI A;  4KAX B;  2AEH A;  1GG3 A;  3M1I B;  1QC6 A;  2BCJ A;  1Q67 A;  4HAV B;  2D11 A;  2DHI A;  2YSZ A;  4HDQ A;  1V88 A;  1UEF A;  2LOZ A;  3ODW A;  1Y19 B;  4YON A;  2LYD A;  4CHJ A;  2K00 A;  2Q13 A;  1OQN A;  4F7U P;  4GN1 A;  2VSZ A;  5JHH A;  1EF1 A;  1ZM0 A;  1M7E A;  3TCA A;  4BBK A;  2UZR A;  5C5B B;  2YVC A;  4D0N B;  5DIF B;  3P6A A;  4F7H A;  3TVV A;  3AU4 A;  2M38 A;  2P0D A;  4KHA A;  5KQ1 A;  2I1K A;  1ZSQ A;  2Z0O A;  2JP2 A;  1OY2 A;  1P3R A;  1X1F A;  2L1C A;  1MKE A;  2D10 A;  2YS1 A;  2W2X D;  2RGN B;  4MT7 A;  1GC6 A;  3DXE A;  2R09 A;  1BWN A;  4CHM A;  1ISN A;  5JP4 A;  3PVU A;  1FAO A;  1K5G B;  3U7D A;  2RLO A;  2DA0 A;  5J3Q A;  1U2B A;  3N7C A;  4L6E A;  4EMO A;  1MK7 B;  3DXD A;  4DX8 A;  3MDB C;  1SHC A;  2P8V A;  2LOX A;  2M14 A;  5JLJ B;  1AQC A;  5D3W A;  3KRX A;  2YS3 A;  1N3H A;  4K17 A;  2GCL A;  2CY4 A;  1DYN A;  2N23 A;  3FM8 C;  4HB0 B;  3RCP A;  4Z2N A;  4K2O A;  1WG7 A;  4HAY B;  3U8Z A;  1FHW A;  1WJ1 A;  1EAZ A;  1NI2 A;  2EC1 A;  5GOW B;  4ZRK A;  1U27 A;  1OMW A;  1RJ2 A;  3TO1 A;  5FI0 A;  1MIX A;  4A6F B;  1I7A A;  2Y7B A;  3OAN A;  1U5F A;  4A6H A;  1K5D B;  5C16 A;  1H4R A;  4ZRJ A;  1BTN A;  2EMS A;  2CAY A;  3SO6 A;  5HE0 A;  1UNP A;  4IFS A;  2VRW B;  2NMB A;  4K2P A;  3WA0 A;  3DXC A;  3SNH A;  3PP2 A;  3F5R A;  2L2I A;  3WYF B;  1FHO A;  1H10 A;  3SUZ A;  2Y8F A;  3PVL A;  2D9V A;  3V5W A;  4K81 A;  2RUK B;  4HAU B;  2DN6 A;  3PZD A;  2AL6 A;  1XOD A;  2ROZ B;  2I1J A;  3ULB A;  3ZVR A;  1SGH A;  5LOP B;  2D9X A;  1X11 A;  1J0W A;  4A5K A;  4DX9 0;  3BIN A;  5FI1 A;  1EVH A;  2LKO A;  2RVB B;  2E2X A;  1FGZ A;  3VIA A;  4IAP A;  3ZDT A;  2I5C A;  2J0J A;  1ZC3 B;  1DDV A;  4IOY X;  2PZ1 A;  5C6R A;  2CY5 A;  5HE1 A;  5DI9 B;  2GJY A;  3X23 A;  1W1H A;  3PEG A;  1V61 A;  4A6K A;  3FEH A;  2K2U A;  5CLL B;  2YF0 A;  1P6S A;  4EJN A;  4C0A A;  5J3T A;  3T06 A;  3FSS A;  1MK9 B;  2ZPY A;  1NTY A;  1BTK A;  4WVF B;  2EJ8 A;  1X86 A;  3QIJ A;  5DHF B;  2MFQ A;  1WGU A;  1FGY A;  1XR0 B;  1U5G A;  1ZVR A;  1WI1 A;  2ADZ A;  5DHA B;  3TW1 A;  4B6H A;  1Y5O A;  1UPQ A;  4HB2 B;  5D3Y A;  3ML4 A;  1V5M A;  1MIZ B;  1U5D A;  2Z0Q A;  1WJM A;  4PNK A;  1NTV A;  3CIK A;  4XWX A;  3UZT A;  3F0W A;  2P0H A;  2H7D A;  2YS5 A;  2LG1 A;  4Z2M B;  1KZ7 A;  2X18 A;  4HAZ B;  1UNQ A;  4CYE A;  2MKR A;  3HW2 B;  1BAK A;  1FOE A;  1V89 A;  1KZG A;  1DDM A;  3VOQ A;  2MWN B;  4H8S A;  3D8E A;  1MAI A;  1X05 A;  1XD4 A;  2D4Q A;  1P5T A;  5J3Y A;  2QKM A;  1GC7 A;  1LB1 A;  2ELA A;  3BJI A;  2P0F A;  5LON B;  3KRW A;  2IYB A;  1DRO A;  3ULC A;  2NZ8 B;  3IVF A;  4DXA B;  4MY6 A;  2VKI A;  2OTX A;  5CLQ B;  5EFX A;  1NU2 A;  2FJL A;  2MDX A;  2Y8G A;  1XX0 A;  3HK0 A;  3CXB B;  1TQZ A;  1UNR A;  2DLW A;  4DBB A;  2UZS A;  4YL8 A;  4HAT B;  1WGQ A;  3QBV B;  3SYX A;  4GXB A;  3D8D A;  1PLS A;  2XQN M;  3G9W A;  5C5B A;  2DHJ A;  5D27 A;  4WSF A;  1U29 A;  3LJU X;  1FB8 A;  3PSC A;  3HQC A;  4KHO A;  1IRS A;  5C79 A;  3PVW A;  2W2X C;  2QKL A;  5HE2 A;  2ROV A;  5KQ4 A;  4HDO A;  1V5U A;  3AJ4 A;  1J19 A;  2LUL A;  1B55 A;  4NY0 A;  2YT1 A;  2EMT A;  4HB3 B;  1PMS A;  2HTH B;  3KZ1 A;  2KGX B;  2DYQ A;  5D3V A;  1U5E A;  4GPT B;  2DTC A;  1ZC4 B;  4GMX B;  3KSY A;  2R0D A;  2D9Z A;  2V76 A;  1AWE A;  1XKE A;  3PG7 A;  3D8F A;  2DKQ A;  2KUP A;  3TFM A;  2W2W A;  2GS0 A;  3A8P A;  2D9W A;  3O96 A;  5DH9 B;  2KCJ A;  4EKU A;  4WJ7 A;  2DYN A;  2Z0P A;  2OQB A;  2J59 M;  4TKN A;  3ODX A;  5KCV A;  4F7G A;  2DKP A;  2GCJ A;  2G35 A;  3NSU A;  5D3X A;  1DBH A;  2J0K A;  2D2Q A;  2DFK A;  1KI1 B;  4GMV A;  3GYO A;  4MK0 A;  1W1G A;  1W1D A;  1FHX A;  1I2H A;  2YRY A;  3ODO A;  3A98 B;  1M7R A;  2N0Y A;  3MPX A;  3SV1 A;  1XCG A;  4A6F A;  1LW3 A;  2COA A;  4TYZ A;  4NSW A;  3QWM A;  3GYP A;  5JHG A;  1TJ6 A;  2RSG A;  1RRP B;  2DX5 A;  3AU5 A;  4KHB B;  4KVG B;  2I5F A;  4GZU A;  2COD A;  3KY9 A;  2COF A;  2DX1 A;  1X1G A;  1QQG A;  2DHK A;  4HHV A;  2UVM A;  4HAW B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...