2K2JA

Nmr solution structure of the split ph domain from phospholipase c gamma 2
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
117
structure length
117
Chain Sequence
KKDEHKQQGELYMWDSIDQKWTRHYCAIADAKLSFSDDIEQTMEEDNPLGSLCRGILDLNTYNVVKAPQGKNQKSFVFILEPKQQGDPPVEFATDRVEELFEWFQSIREITWKIDTK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Rac Regulates Its Effector Phospholipase C{gamma}2 through Interaction with a Split Pleckstrin Homology Domain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase, signaling protein
molecule keywords 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase ga
total genus 11
structure length 117
sequence length 117
ec nomenclature ec 3.1.4.11: Phosphoinositide phospholipase C.
pdb deposition date 2008-04-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2k2jA00
5C79A 1XCGA 2MKRA 4ZRIA 1EVHA 1FHWA 5J3QA 1UNRA 4DX90 1DDVA 4CYEA 2FJLA 2QKMA 3GYPA 1WG7A 2EJ8A 2ELBA 1OMWA 1MAIA 2J0MA 3ZVRA 1FAOA 2K2JA 1FGZA 2X18A 3TCAA 1FHXA 2KUPA 5DHFB 2YVCA 3DXDA 1XD4A 1UNPA 4GZUA 2VRWB 1AWEA 4HHVA 5J3YA 3TW1A 1ZC3B 1WVHA 5L81A 4HB3B 4IAPA 4WVFB 1OY2A 2P0FA 1U5EA 3CIKA 3PEGA 5KQ4A 4IOYX 1PFJA 2D10A 4Z2MB 5DIFB 1V5PA 4D0NB 2P8VA 4K17A 2DHIA 2Z0QA 4K2OA 1K5DB 4PQ0A 4GN1A 2H7EA 2HTHB 4WSFA 4Y94A 1NI2A 2YT1A 3CXBB 3O96A 3PSCA 2DYNA 2D9WA 4ZRKA 3A98B 5D3WA 3TFMA 1FGYA 2CRFA 3PG7A 2Y8GA 1PLSA 1H4RA 1XKEA 4HDQA 3ZDTA 5JHGA 1MIXA 2D11A 3SUZA 4YONA 3D8FA 1RJ2A 3MPXA 2Q13A 1ISNA 1U29A 2M38A 4HATB 4KHBB 1U2BA 2LOZA 5DI9B 1GC6A 1FHOA 1H10A 3V5WA 4F7HA 1K5GB 4MT7A 2DHJA 4ZRJA 3ULCA 4A6KA 4GPTB 3PP2A 4TKNA 3AU4A 1U5FA 3U8ZA 2Z0PA 2EMTA 4HB0B 1PMSA 3D8EA 2DFKA 2ZPYA 3OANA 4KVGB 3P7ZA 2KGXB 2M14A 2L1CA 2EMSA 4HB2B 2IFSA 2YF0A 2LG1A 1FB8A 1UEFA 1MKEA 2COCA 2ROVA 2OQBA 3M1IB 4K81A 1RRPB 3FM8C 5HE1A 1GC7A 2LULA 1P6SA 5KCVA 3RCPA 4A6HA 1MK9B 4EMOA 2KCJA 2I5CA 1EF1A 2RGNB 3QWMA 2K2UA 3HQCA 3BJIA 1UNQA 1DDMA 1TJ6A 1IRSA 1U27A 1UPRA 4NSWA 3SV1A 1LB1A 1MK7B 2J0KA 5DHAB 2IYBA 2JP2A 3BINA 2COAA 3KRXA 4GMVA 2GJYA 2AL6A 2COFA 2CODA 1U5DA 1V61A 1ZC4B 1V89A 1X1GA 3KY9A 5HE2A 2DLWA 2GS0A 4A6FB 3U7DA 1WGQA 2ELAA 4BBKA 3QIJA 5FI0A 2W2WA 1MIZB 4DBBA 4PNKA 1W1GA 1I2HA 2QKLA 1DBHA 2XQNM 1DROA 1QC6A 3ML4A 2CAYA 2R0DA 3PVLA 5JP4A 3HW2B 2DN6A 2VSZA 2YS3A 1WJ1A 2NZ8B 4L6EA 2H7DA 1ZM0A 2J0JA 5D27A 1ZSQA 5HE3A 3VOQA 2RLOA 1FOEA 2NMBA 4WJ7A 1X1FA 2DA0A 1W1DA 4XWXA 1OQNA 2HE7A 5C6RA 5J3TA 3KZ1A 2EC1A 4GMXB 5HE0A 2UZSA 2AEHA 1ZVRA 2DYQA 3ODXA 3PVWA 4TYZA 3QBVB 3AU5A 2YS5A 1SGHA 2L2IA 2D9XA 2J59M 2G35A 5CLQB 4HAUB 4KAXB 2LOXA 3P6AA 3GYOA 1AQCA 3ODWA 5C5BA 1XR0B 2D4QA 2DKPA 1TXDA 3DXCA 4EJNA 1WGUA 1B55A 3D8DA 3MDBC 4IFSA 2YSZA 1V5UA 4HDOA 1UPQA 1XODA 5CLLB 4H8SA 4HAWB 1X05A 5FI1A 2Y7BA 3KRWA 3ODOA 4C0AA 1U5GA 4MY6A 1TQZA 1DDWA 5D3XA 1SHCA 2E2XA 3DXEA 2N0YA 3LJUX 2Z0OA 4GXBA 1N3HA 3KSYA 1V5MA 1QQGA 2I1KA 5LONB 5EFXA 1Y19B 5DH9B 2P0DA 3WYFB 3WA0A 4HB4B 4DX8A 3NSUA 3PZDA 1X86A 3G9WA 3UZTA 2GCJA 3TVVA 2RVBB 1DYNA 2UVMA 1Q67A 2RUKB 4KHOA 4B6HA 1KI1B 2UZRA 2MDXA 4HAZB 5JHHA 3A8QA 2LKOA 5D3YA 1E5WA 1M7EA 2CY5A 1XX0A 2YS1A 2ROZB 2OTXA 3IVFA 4EKUA 2DX5A 5C5BB 2D9VA 3ULBA 2R09A 3F0WA 4CHJA 5GOWB 1EGXA 2I1JA 5C16A 1LW3A 5LOPB 4P7IA 3FSSA 1BTNA 5D3VA 1Y5OA 1WI1A 2LYDA 1J19A 2DKQA 5KQ1A 1BWNA 3SO6A 1Z87A 1J0WA 4KHAA 3SYXA 2DTCA 4CHMA 4A6FA 2D2QA 2MWNB 1W1HA 2P0HA 2DX1A 1MPHA 1KZ7A 3HK0A 3T06A 3AJ4A 1NU2A 3VIAA 2ADZA 3PVUA 3FEHA 3N7CA 1P5TA 4HAXB 3TO1A 4Z2NA 5JLJB 2D9YA 1M7RA 2YT0A 3F5RA 2V76A 2BCJA 2K00A 2VKIA 3X23A 1X11A 2I5FA 1NTYA 4YL8A 4DXAB 1BAKA 4HAYB 1WJMA 2YRYA 3A8PA 2DHKA 2MFQA 2PZ1A 2Y8FA 2RNRB 1BTKA 2N23A 4F7GA 1P3RA 2GCLA 4A5KA 1NTVA 2CY4A 4F7UP 4K2PA 4MK0A 1GG3A 2RSGA 4NY0A 2D9ZA 3SNHA 1EAZA 1I7AA 1KZGA 1V88A 2W2XC 4HAVB 2W2XD
chains in the Genus database with same CATH superfamily
5C79A 4OT1A 1XCGA 2MKRA 4GNKB 4ZRIA 1EVHA 1FHWA 5J3QA 1UNRA 2Z59A 4DX90 2K8EA 1DDVA 4CYEA 2FJLA 2QKMA 3GYPA 1WG7A 2EJ8A 2ELBA 1OMWA 3A58A 1MAIA 2J0MA 3ZVRA 1MI1A 1FAOA 2K2JA 1FGZA 2X18A 3TCAA 1FHXA 2KUPA 5DHFB 2YVCA 3DXDA 1XD4A 1UNPA 4GZUA 2VRWB 1AWEA 3HSAA 4HHVA 5J3YA 3TW1A 1ZC3B 1WVHA 5L81A 4HB3B 4IAPA 4WVFB 1OY2A 2P0FA 1U5EA 3CIKA 4OSNA 3PEGA 5KQ4A 4IOYX 1PFJA 2D10A 4QJ4B 4Z2MB 5DIFB 1V5PA 4D0NB 2P8VA 4K17A 2DHIA 2Z0QA 3B77A 4K2OA 1K5DB 4PQ0A 4GN1A 2H7EA 2HTHB 4WSFA 4Y94A 1NI2A 2YT1A 3CXBB 3O96A 3PSCA 2DYNA 2D9WA 4ZRKA 3A98B 5D3WA 3TFMA 1FGYA 2CRFA 3PG7A 2Y8GA 2KUQA 1PLSA 1H4RA 1XKEA 4HDQA 3ZDTA 5JHGA 2KR0A 1MIXA 2D11A 3SUZA 4YONA 3D8FA 1RJ2A 2RRFA 3MPXA 2Q13A 1ISNA 1U29A 2ZKMX 2M38A 4HATB 4KHBB 1U2BA 2LOZA 5DI9B 1GC6A 1FHOA 1H10A 3V5WA 4F7HA 1K5GB 4MT7A 2DHJA 4ZRJA 3ULCA 4A6KA 4GPTB 3PP2A 4TKNA 3AU4A 1U5FA 3U8ZA 2Z0PA 2EMTA 4HB0B 1PMSA 3D8EA 2DFKA 2ZPYA 3OANA 4KVGB 3P7ZA 2KGXB 2M14A 2L1CA 2EMSA 4HB2B 2IFSA 2YF0A 2LG1A 1FB8A 1UEFA 1MKEA 2COCA 2ROVA 2OQBA 3M1IB 3OHMB 4K81A 1RRPB 3FM8C 3U12A 5HE1A 1GC7A 2LULA 1P6SA 5KCVA 3RCPA 4A6HA 1MK9B 4EMOA 2KCJA 2I5CA 1EF1A 2RGNB 3QWMA 2K2UA 3HQCA 3BJIA 4GOUA 1UNQA 1DDMA 1TJ6A 1IRSA 1U27A 1UPRA 4NSWA 3SV1A 1LB1A 1MK7B 2J0KA 5DHAB 2IYBA 2JP2A 3BINA 2COAA 3KRXA 4GMVA 2GJYA 2AL6A 2COFA 2CODA 1U5DA 1V61A 1ZC4B 1V89A 1X1GA 4HSIA 3KY9A 5HE2A 2DLWA 2GS0A 4A6FB 3U7DA 1ZYIA 2KIEA 1WGQA 2ELAA 4BBKA 4QXAB 3QIJA 5FI0A 2W2WA 1MIZB 4DBBA 5I2MA 4PNKA 1W1GA 1I2HA 2QKLA 4QJ5B 1DBHA 2XQNM 4L1RA 1DROA 1QC6A 3ML4A 2CAYA 2R0DA 3PVLA 5JP4A 3HW2B 2DN6A 2VSZA 2YS3A 1WJ1A 2FJUB 2NZ8B 4L6EA 2H7DA 3NWDA 1ZM0A 2J0JA 5D27A 1ZSQA 5HE3A 3VOQA 2RLOA 1FOEA 2NMBA 4WJ7A 4DIXA 1X1FA 2DA0A 1W1DA 4XWXA 1OQNA 2HE7A 5C6RA 5J3TA 3KZ1A 2EC1A 4GMXB 5HE0A 2UZSA 2AEHA 1ZVRA 2DYQA 3ODXA 3PVWA 4TYZA 3QBVB 3AU5A 5IRSA 2YS5A 1SGHA 2L2IA 2D9XA 2Z4DA 2J59M 2G35A 5CLQB 4HAUB 4KAXB 2LOXA 3P6AA 3GYOA 1AQCA 2R2YA 3ODWA 5C5BA 1XR0B 2D4QA 2DKPA 1TXDA 3DXCA 4EJNA 1WGUA 1B55A 3D8DA 3MDBC 4IFSA 2YSZA 1V5UA 4HDOA 1UPQA 1XODA 5CLLB 4H8SA 4HAWB 1X05A 5FI1A 2Y7BA 3KRWA 3ODOA 4C0AA 1U5GA 2YT2A 4MY6A 1TQZA 1DDWA 5D3XA 1SHCA 2E2XA 3DXEA 2N0YA 4D6WA 3LJUX 2Z0OA 4GXBA 1N3HA 3KSYA 1V5MA 1QQGA 2I1KA 5LONB 5EFXA 1Y19B 3HIEA 5DH9B 2P0DA 3WYFB 3WA0A 4HB4B 4DX8A 3NSUA 3PZDA 1X86A 4KHBA 3G9WA 3UZTA 2GCJA 1T77A 3TVVA 2RVBB 1DYNA 5I2SA 2UVMA 1Q67A 2RUKB 4KHOA 4B6HA 1KI1B 2UZRA 2MDXA 2NBVA 4HAZB 5JHHA 3A8QA 2LKOA 3NWFA 5D3YA 1E5WA 1M7EA 2CY5A 1XX0A 2YS1A 2Z14A 2ROZB 2OTXA 3IVFA 4EKUA 2DX5A 5C5BB 2D9VA 3ULBA 2R09A 3F0WA 4CHJA 5GOWB 1EGXA 2I1JA 5C16A 4CSQA 1LW3A 5LOPB 4P7IA 3FSSA 1BTNA 5D3VA 1Y5OA 1WI1A 2LYDA 1J19A 2DKQA 5KQ1A 1BWNA 3SO6A 1Z87A 3NW8A 1J0WA 4KHAA 3SYXA 2DTCA 4CHMA 4A6FA 2D2QA 2MWNB 1W1HA 2P0HA 2DX1A 2K49A 2Z13A 1MPHA 5M4YB 1KZ7A 4QJ3B 3HK0A 3T06A 3AJ4A 1NU2A 3VIAA 2ADZA 3PVUA 3FEHA 3N7CA 2KIGA 1P5TA 4HAXB 3TO1A 4Z2NA 5JLJB 2D9YA 1M7RA 2YT0A 3F5RA 2GUMA 2V76A 2BCJA 2K00A 2VKIA 3X23A 1X11A 3NWAA 2I5FA 5LG4B 1NTYA 4YL8A 4DXAB 1BAKA 4HAYB 1WJMA 2YRYA 3A8PA 2DHKA 2MFQA 2PZ1A 2Y8FA 2RNRB 1BTKA 2N23A 4F7GA 1P3RA 2GCLA 4A5KA 1NTVA 2CY4A 3FVCA 4F7UP 4K2PA 4MK0A 3DCXA 1GG3A 2RSGA 4NY0A 2D9ZA 3SNHA 1EAZA 1I7AA 1KZGA 1V88A 2W2XC 4HAVB 2W2XD
chains in the Genus database with same CATH topology
5C79A 1XCGA 2MKRA 4ZRIA 1EVHA 1FHWA 5J3QA 1UNRA 4DX90 1DDVA 4CYEA 2FJLA 2QKMA 3GYPA 1WG7A 2EJ8A 2ELBA 1OMWA 1MAIA 2J0MA 3ZVRA 1FAOA 2K2JA 1FGZA 2X18A 3TCAA 1FHXA 2KUPA 5DHFB 2YVCA 3DXDA 1XD4A 1UNPA 4GZUA 2VRWB 1AWEA 4HHVA 5J3YA 3TW1A 1ZC3B 1WVHA 5L81A 4HB3B 4IAPA 4WVFB 1OY2A 2P0FA 1U5EA 3CIKA 3PEGA 5KQ4A 4IOYX 1PFJA 2D10A 4Z2MB 5DIFB 1V5PA 4D0NB 2P8VA 4K17A 2DHIA 2Z0QA 4K2OA 1K5DB 4PQ0A 4GN1A 2H7EA 2HTHB 4WSFA 4Y94A 1NI2A 2YT1A 3CXBB 3O96A 3PSCA 2DYNA 2D9WA 4ZRKA 3A98B 5D3WA 3TFMA 1FGYA 2CRFA 3PG7A 2Y8GA 1PLSA 1H4RA 1XKEA 4HDQA 3ZDTA 5JHGA 1MIXA 2D11A 3SUZA 4YONA 3D8FA 1RJ2A 3MPXA 2Q13A 1ISNA 1U29A 2M38A 4HATB 4KHBB 1U2BA 2LOZA 5DI9B 1GC6A 1FHOA 1H10A 3V5WA 4F7HA 1K5GB 4MT7A 2DHJA 4ZRJA 3ULCA 4A6KA 4GPTB 3PP2A 4TKNA 3AU4A 1U5FA 3U8ZA 2Z0PA 2EMTA 4HB0B 1PMSA 3D8EA 2DFKA 2ZPYA 3OANA 4KVGB 3P7ZA 2KGXB 2M14A 2L1CA 2EMSA 4HB2B 2IFSA 2YF0A 2LG1A 1FB8A 1UEFA 1MKEA 2COCA 2ROVA 2OQBA 3M1IB 4K81A 1RRPB 3FM8C 5HE1A 1GC7A 2LULA 1P6SA 5KCVA 3RCPA 4A6HA 1MK9B 4EMOA 2KCJA 2I5CA 1EF1A 2RGNB 3QWMA 2K2UA 3HQCA 3BJIA 1UNQA 1DDMA 1TJ6A 1IRSA 1U27A 1UPRA 4NSWA 3SV1A 1LB1A 1MK7B 2J0KA 5DHAB 2IYBA 2JP2A 3BINA 2COAA 3KRXA 4GMVA 2GJYA 2AL6A 2COFA 2CODA 1U5DA 1V61A 1ZC4B 1V89A 1X1GA 3KY9A 5HE2A 2DLWA 2GS0A 4A6FB 3U7DA 1WGQA 2ELAA 4BBKA 3QIJA 5FI0A 2W2WA 1MIZB 4DBBA 4PNKA 1W1GA 1I2HA 2QKLA 1DBHA 2XQNM 1DROA 1QC6A 3ML4A 2CAYA 2R0DA 3PVLA 5JP4A 3HW2B 2DN6A 2VSZA 2YS3A 1WJ1A 2NZ8B 4L6EA 2H7DA 1ZM0A 2J0JA 5D27A 1ZSQA 5HE3A 3VOQA 2RLOA 1FOEA 2NMBA 4WJ7A 1X1FA 2DA0A 1W1DA 4XWXA 1OQNA 2HE7A 5C6RA 5J3TA 3KZ1A 2EC1A 4GMXB 5HE0A 2UZSA 2AEHA 1ZVRA 2DYQA 3ODXA 3PVWA 4TYZA 3QBVB 3AU5A 2YS5A 1SGHA 2L2IA 2D9XA 2J59M 2G35A 5CLQB 4HAUB 4KAXB 2LOXA 3P6AA 3GYOA 1AQCA 3ODWA 5C5BA 1XR0B 2D4QA 2DKPA 1TXDA 3DXCA 4EJNA 1WGUA 1B55A 3D8DA 3MDBC 4IFSA 2YSZA 1V5UA 4HDOA 1UPQA 1XODA 5CLLB 4H8SA 4HAWB 1X05A 5FI1A 2Y7BA 3KRWA 3ODOA 4C0AA 1U5GA 4MY6A 1TQZA 1DDWA 5D3XA 1SHCA 2E2XA 3DXEA 2N0YA 3LJUX 2Z0OA 4GXBA 1N3HA 3KSYA 1V5MA 1QQGA 2I1KA 5LONB 5EFXA 1Y19B 5DH9B 2P0DA 3WYFB 3WA0A 4HB4B 4DX8A 3NSUA 3PZDA 1X86A 3G9WA 3UZTA 2GCJA 3TVVA 2RVBB 1DYNA 2UVMA 1Q67A 2RUKB 4KHOA 4B6HA 1KI1B 2UZRA 2MDXA 4HAZB 5JHHA 3A8QA 2LKOA 5D3YA 1E5WA 1M7EA 2CY5A 1XX0A 2YS1A 2ROZB 2OTXA 3IVFA 4EKUA 2DX5A 5C5BB 2D9VA 3ULBA 2R09A 3F0WA 4CHJA 5GOWB 1EGXA 2I1JA 5C16A 1LW3A 5LOPB 4P7IA 3FSSA 1BTNA 5D3VA 1Y5OA 1WI1A 2LYDA 1J19A 2DKQA 5KQ1A 1BWNA 3SO6A 1Z87A 1J0WA 4KHAA 3SYXA 2DTCA 4CHMA 4A6FA 2D2QA 2MWNB 1W1HA 2P0HA 2DX1A 1MPHA 1KZ7A 3HK0A 3T06A 3AJ4A 1NU2A 3VIAA 2ADZA 3PVUA 3FEHA 3N7CA 1P5TA 4HAXB 3TO1A 4Z2NA 5JLJB 2D9YA 1M7RA 2YT0A 3F5RA 2V76A 2BCJA 2K00A 2VKIA 3X23A 1X11A 2I5FA 1NTYA 4YL8A 4DXAB 1BAKA 4HAYB 1WJMA 2YRYA 3A8PA 2DHKA 2MFQA 2PZ1A 2Y8FA 2RNRB 1BTKA 2N23A 4F7GA 1P3RA 2GCLA 4A5KA 1NTVA 2CY4A 4F7UP 4K2PA 4MK0A 1GG3A 2RSGA 4NY0A 2D9ZA 3SNHA 1EAZA 1I7AA 1KZGA 1V88A 2W2XC 4HAVB 2W2XD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5C79 A;  1XCG A;  2MKR A;  4ZRI A;  1EVH A;  1FHW A;  5J3Q A;  1UNR A;  4DX9 0;  1DDV A;  4CYE A;  2FJL A;  2QKM A;  3GYP A;  1WG7 A;  2EJ8 A;  2ELB A;  1OMW A;  1MAI A;  2J0M A;  3ZVR A;  1FAO A;  2K2J A;  1FGZ A;  2X18 A;  3TCA A;  1FHX A;  2KUP A;  5DHF B;  2YVC A;  3DXD A;  1XD4 A;  1UNP A;  4GZU A;  2VRW B;  1AWE A;  4HHV A;  5J3Y A;  3TW1 A;  1ZC3 B;  1WVH A;  5L81 A;  4HB3 B;  4IAP A;  4WVF B;  1OY2 A;  2P0F A;  1U5E A;  3CIK A;  3PEG A;  5KQ4 A;  4IOY X;  1PFJ A;  2D10 A;  4Z2M B;  5DIF B;  1V5P A;  4D0N B;  2P8V A;  4K17 A;  2DHI A;  2Z0Q A;  4K2O A;  1K5D B;  4PQ0 A;  4GN1 A;  2H7E A;  2HTH B;  4WSF A;  4Y94 A;  1NI2 A;  2YT1 A;  3CXB B;  3O96 A;  3PSC A;  2DYN A;  2D9W A;  4ZRK A;  3A98 B;  5D3W A;  3TFM A;  1FGY A;  2CRF A;  3PG7 A;  2Y8G A;  1PLS A;  1H4R A;  1XKE A;  4HDQ A;  3ZDT A;  5JHG A;  1MIX A;  2D11 A;  3SUZ A;  4YON A;  3D8F A;  1RJ2 A;  3MPX A;  2Q13 A;  1ISN A;  1U29 A;  2M38 A;  4HAT B;  4KHB B;  1U2B A;  2LOZ A;  5DI9 B;  1GC6 A;  1FHO A;  1H10 A;  3V5W A;  4F7H A;  1K5G B;  4MT7 A;  2DHJ A;  4ZRJ A;  3ULC A;  4A6K A;  4GPT B;  3PP2 A;  4TKN A;  3AU4 A;  1U5F A;  3U8Z A;  2Z0P A;  2EMT A;  4HB0 B;  1PMS A;  3D8E A;  2DFK A;  2ZPY A;  3OAN A;  4KVG B;  3P7Z A;  2KGX B;  2M14 A;  2L1C A;  2EMS A;  4HB2 B;  2IFS A;  2YF0 A;  2LG1 A;  1FB8 A;  1UEF A;  1MKE A;  2COC A;  2ROV A;  2OQB A;  3M1I B;  4K81 A;  1RRP B;  3FM8 C;  5HE1 A;  1GC7 A;  2LUL A;  1P6S A;  5KCV A;  3RCP A;  4A6H A;  1MK9 B;  4EMO A;  2KCJ A;  2I5C A;  1EF1 A;  2RGN B;  3QWM A;  2K2U A;  3HQC A;  3BJI A;  1UNQ A;  1DDM A;  1TJ6 A;  1IRS A;  1U27 A;  1UPR A;  4NSW A;  3SV1 A;  1LB1 A;  1MK7 B;  2J0K A;  5DHA B;  2IYB A;  2JP2 A;  3BIN A;  2COA A;  3KRX A;  4GMV A;  2GJY A;  2AL6 A;  2COF A;  2COD A;  1U5D A;  1V61 A;  1ZC4 B;  1V89 A;  1X1G A;  3KY9 A;  5HE2 A;  2DLW A;  2GS0 A;  4A6F B;  3U7D A;  1WGQ A;  2ELA A;  4BBK A;  3QIJ A;  5FI0 A;  2W2W A;  1MIZ B;  4DBB A;  4PNK A;  1W1G A;  1I2H A;  2QKL A;  1DBH A;  2XQN M;  1DRO A;  1QC6 A;  3ML4 A;  2CAY A;  2R0D A;  3PVL A;  5JP4 A;  3HW2 B;  2DN6 A;  2VSZ A;  2YS3 A;  1WJ1 A;  2NZ8 B;  4L6E A;  2H7D A;  1ZM0 A;  2J0J A;  5D27 A;  1ZSQ A;  5HE3 A;  3VOQ A;  2RLO A;  1FOE A;  2NMB A;  4WJ7 A;  1X1F A;  2DA0 A;  1W1D A;  4XWX A;  1OQN A;  2HE7 A;  5C6R A;  5J3T A;  3KZ1 A;  2EC1 A;  4GMX B;  5HE0 A;  2UZS A;  2AEH A;  1ZVR A;  2DYQ A;  3ODX A;  3PVW A;  4TYZ A;  3QBV B;  3AU5 A;  2YS5 A;  1SGH A;  2L2I A;  2D9X A;  2J59 M;  2G35 A;  5CLQ B;  4HAU B;  4KAX B;  2LOX A;  3P6A A;  3GYO A;  1AQC A;  3ODW A;  5C5B A;  1XR0 B;  2D4Q A;  2DKP A;  1TXD A;  3DXC A;  4EJN A;  1WGU A;  1B55 A;  3D8D A;  3MDB C;  4IFS A;  2YSZ A;  1V5U A;  4HDO A;  1UPQ A;  1XOD A;  5CLL B;  4H8S A;  4HAW B;  1X05 A;  5FI1 A;  2Y7B A;  3KRW A;  3ODO A;  4C0A A;  1U5G A;  4MY6 A;  1TQZ A;  1DDW A;  5D3X A;  1SHC A;  2E2X A;  3DXE A;  2N0Y A;  3LJU X;  2Z0O A;  4GXB A;  1N3H A;  3KSY A;  1V5M A;  1QQG A;  2I1K A;  5LON B;  5EFX A;  1Y19 B;  5DH9 B;  2P0D A;  3WYF B;  3WA0 A;  4HB4 B;  4DX8 A;  3NSU A;  3PZD A;  1X86 A;  3G9W A;  3UZT A;  2GCJ A;  3TVV A;  2RVB B;  1DYN A;  2UVM A;  1Q67 A;  2RUK B;  4KHO A;  4B6H A;  1KI1 B;  2UZR A;  2MDX A;  4HAZ B;  5JHH A;  3A8Q A;  2LKO A;  5D3Y A;  1E5W A;  1M7E A;  2CY5 A;  1XX0 A;  2YS1 A;  2ROZ B;  2OTX A;  3IVF A;  4EKU A;  2DX5 A;  5C5B B;  2D9V A;  3ULB A;  2R09 A;  3F0W A;  4CHJ A;  5GOW B;  1EGX A;  2I1J A;  5C16 A;  1LW3 A;  5LOP B;  4P7I A;  3FSS A;  1BTN A;  5D3V A;  1Y5O A;  1WI1 A;  2LYD A;  1J19 A;  2DKQ A;  5KQ1 A;  1BWN A;  3SO6 A;  1Z87 A;  1J0W A;  4KHA A;  3SYX A;  2DTC A;  4CHM A;  4A6F A;  2D2Q A;  2MWN B;  1W1H A;  2P0H A;  2DX1 A;  1MPH A;  1KZ7 A;  3HK0 A;  3T06 A;  3AJ4 A;  1NU2 A;  3VIA A;  2ADZ A;  3PVU A;  3FEH A;  3N7C A;  1P5T A;  4HAX B;  3TO1 A;  4Z2N A;  5JLJ B;  2D9Y A;  1M7R A;  2YT0 A;  3F5R A;  2V76 A;  2BCJ A;  2K00 A;  2VKI A;  3X23 A;  1X11 A;  2I5F A;  1NTY A;  4YL8 A;  4DXA B;  1BAK A;  4HAY B;  1WJM A;  2YRY A;  3A8P A;  2DHK A;  2MFQ A;  2PZ1 A;  2Y8F A;  2RNR B;  1BTK A;  2N23 A;  4F7G A;  1P3R A;  2GCL A;  4A5K A;  1NTV A;  2CY4 A;  4F7U P;  4K2P A;  4MK0 A;  1GG3 A;  2RSG A;  4NY0 A;  2D9Z A;  3SNH A;  1EAZ A;  1I7A A;  1KZG A;  1V88 A;  2W2X C;  4HAV B;  2W2X D; 
#chains in the Genus database with same CATH topology
 5C79 A;  4OT1 A;  1XCG A;  2MKR A;  4GNK B;  4ZRI A;  1EVH A;  1FHW A;  5J3Q A;  1UNR A;  2Z59 A;  4DX9 0;  2K8E A;  1DDV A;  4CYE A;  2FJL A;  2QKM A;  3GYP A;  1WG7 A;  2EJ8 A;  2ELB A;  1OMW A;  3A58 A;  1MAI A;  2J0M A;  3ZVR A;  1MI1 A;  1FAO A;  2K2J A;  1FGZ A;  2X18 A;  3TCA A;  1FHX A;  2KUP A;  5DHF B;  2YVC A;  3DXD A;  1XD4 A;  1UNP A;  4GZU A;  2VRW B;  1AWE A;  3HSA A;  4HHV A;  5J3Y A;  3TW1 A;  1ZC3 B;  1WVH A;  5L81 A;  4HB3 B;  4IAP A;  4WVF B;  1OY2 A;  2P0F A;  1U5E A;  3CIK A;  4OSN A;  3PEG A;  5KQ4 A;  4IOY X;  1PFJ A;  2D10 A;  4QJ4 B;  4Z2M B;  5DIF B;  1V5P A;  4D0N B;  2P8V A;  4K17 A;  2DHI A;  2Z0Q A;  3B77 A;  4K2O A;  1K5D B;  4PQ0 A;  4GN1 A;  2H7E A;  2HTH B;  4WSF A;  4Y94 A;  1NI2 A;  2YT1 A;  3CXB B;  3O96 A;  3PSC A;  2DYN A;  2D9W A;  4ZRK A;  3A98 B;  5D3W A;  3TFM A;  1FGY A;  2CRF A;  3PG7 A;  2Y8G A;  2KUQ A;  1PLS A;  1H4R A;  1XKE A;  4HDQ A;  3ZDT A;  5JHG A;  2KR0 A;  1MIX A;  2D11 A;  3SUZ A;  4YON A;  3D8F A;  1RJ2 A;  2RRF A;  3MPX A;  2Q13 A;  1ISN A;  1U29 A;  2ZKM X;  2M38 A;  4HAT B;  4KHB B;  1U2B A;  2LOZ A;  5DI9 B;  1GC6 A;  1FHO A;  1H10 A;  3V5W A;  4F7H A;  1K5G B;  4MT7 A;  2DHJ A;  4ZRJ A;  3ULC A;  4A6K A;  4GPT B;  3PP2 A;  4TKN A;  3AU4 A;  1U5F A;  3U8Z A;  2Z0P A;  2EMT A;  4HB0 B;  1PMS A;  3D8E A;  2DFK A;  2ZPY A;  3OAN A;  4KVG B;  3P7Z A;  2KGX B;  2M14 A;  2L1C A;  2EMS A;  4HB2 B;  2IFS A;  2YF0 A;  2LG1 A;  1FB8 A;  1UEF A;  1MKE A;  2COC A;  2ROV A;  2OQB A;  3M1I B;  3OHM B;  4K81 A;  1RRP B;  3FM8 C;  3U12 A;  5HE1 A;  1GC7 A;  2LUL A;  1P6S A;  5KCV A;  3RCP A;  4A6H A;  1MK9 B;  4EMO A;  2KCJ A;  2I5C A;  1EF1 A;  2RGN B;  3QWM A;  2K2U A;  3HQC A;  3BJI A;  4GOU A;  1UNQ A;  1DDM A;  1TJ6 A;  1IRS A;  1U27 A;  1UPR A;  4NSW A;  3SV1 A;  1LB1 A;  1MK7 B;  2J0K A;  5DHA B;  2IYB A;  2JP2 A;  3BIN A;  2COA A;  3KRX A;  4GMV A;  2GJY A;  2AL6 A;  2COF A;  2COD A;  1U5D A;  1V61 A;  1ZC4 B;  1V89 A;  1X1G A;  4HSI A;  3KY9 A;  5HE2 A;  2DLW A;  2GS0 A;  4A6F B;  3U7D A;  1ZYI A;  2KIE A;  1WGQ A;  2ELA A;  4BBK A;  4QXA B;  3QIJ A;  5FI0 A;  2W2W A;  1MIZ B;  4DBB A;  5I2M A;  4PNK A;  1W1G A;  1I2H A;  2QKL A;  4QJ5 B;  1DBH A;  2XQN M;  4L1R A;  1DRO A;  1QC6 A;  3ML4 A;  2CAY A;  2R0D A;  3PVL A;  5JP4 A;  3HW2 B;  2DN6 A;  2VSZ A;  2YS3 A;  1WJ1 A;  2FJU B;  2NZ8 B;  4L6E A;  2H7D A;  3NWD A;  1ZM0 A;  2J0J A;  5D27 A;  1ZSQ A;  5HE3 A;  3VOQ A;  2RLO A;  1FOE A;  2NMB A;  4WJ7 A;  4DIX A;  1X1F A;  2DA0 A;  1W1D A;  4XWX A;  1OQN A;  2HE7 A;  5C6R A;  5J3T A;  3KZ1 A;  2EC1 A;  4GMX B;  5HE0 A;  2UZS A;  2AEH A;  1ZVR A;  2DYQ A;  3ODX A;  3PVW A;  4TYZ A;  3QBV B;  3AU5 A;  5IRS A;  2YS5 A;  1SGH A;  2L2I A;  2D9X A;  2Z4D A;  2J59 M;  2G35 A;  5CLQ B;  4HAU B;  4KAX B;  2LOX A;  3P6A A;  3GYO A;  1AQC A;  2R2Y A;  3ODW A;  5C5B A;  1XR0 B;  2D4Q A;  2DKP A;  1TXD A;  3DXC A;  4EJN A;  1WGU A;  1B55 A;  3D8D A;  3MDB C;  4IFS A;  2YSZ A;  1V5U A;  4HDO A;  1UPQ A;  1XOD A;  5CLL B;  4H8S A;  4HAW B;  1X05 A;  5FI1 A;  2Y7B A;  3KRW A;  3ODO A;  4C0A A;  1U5G A;  2YT2 A;  4MY6 A;  1TQZ A;  1DDW A;  5D3X A;  1SHC A;  2E2X A;  3DXE A;  2N0Y A;  4D6W A;  3LJU X;  2Z0O A;  4GXB A;  1N3H A;  3KSY A;  1V5M A;  1QQG A;  2I1K A;  5LON B;  5EFX A;  1Y19 B;  3HIE A;  5DH9 B;  2P0D A;  3WYF B;  3WA0 A;  4HB4 B;  4DX8 A;  3NSU A;  3PZD A;  1X86 A;  4KHB A;  3G9W A;  3UZT A;  2GCJ A;  1T77 A;  3TVV A;  2RVB B;  1DYN A;  5I2S A;  2UVM A;  1Q67 A;  2RUK B;  4KHO A;  4B6H A;  1KI1 B;  2UZR A;  2MDX A;  2NBV A;  4HAZ B;  5JHH A;  3A8Q A;  2LKO A;  3NWF A;  5D3Y A;  1E5W A;  1M7E A;  2CY5 A;  1XX0 A;  2YS1 A;  2Z14 A;  2ROZ B;  2OTX A;  3IVF A;  4EKU A;  2DX5 A;  5C5B B;  2D9V A;  3ULB A;  2R09 A;  3F0W A;  4CHJ A;  5GOW B;  1EGX A;  2I1J A;  5C16 A;  4CSQ A;  1LW3 A;  5LOP B;  4P7I A;  3FSS A;  1BTN A;  5D3V A;  1Y5O A;  1WI1 A;  2LYD A;  1J19 A;  2DKQ A;  5KQ1 A;  1BWN A;  3SO6 A;  1Z87 A;  3NW8 A;  1J0W A;  4KHA A;  3SYX A;  2DTC A;  4CHM A;  4A6F A;  2D2Q A;  2MWN B;  1W1H A;  2P0H A;  2DX1 A;  2K49 A;  2Z13 A;  1MPH A;  5M4Y B;  1KZ7 A;  4QJ3 B;  3HK0 A;  3T06 A;  3AJ4 A;  1NU2 A;  3VIA A;  2ADZ A;  3PVU A;  3FEH A;  3N7C A;  2KIG A;  1P5T A;  4HAX B;  3TO1 A;  4Z2N A;  5JLJ B;  2D9Y A;  1M7R A;  2YT0 A;  3F5R A;  2GUM A;  2V76 A;  2BCJ A;  2K00 A;  2VKI A;  3X23 A;  1X11 A;  3NWA A;  2I5F A;  5LG4 B;  1NTY A;  4YL8 A;  4DXA B;  1BAK A;  4HAY B;  1WJM A;  2YRY A;  3A8P A;  2DHK A;  2MFQ A;  2PZ1 A;  2Y8F A;  2RNR B;  1BTK A;  2N23 A;  4F7G A;  1P3R A;  2GCL A;  4A5K A;  1NTV A;  2CY4 A;  3FVC A;  4F7U P;  4K2P A;  4MK0 A;  3DCX A;  1GG3 A;  2RSG A;  4NY0 A;  2D9Z A;  3SNH A;  1EAZ A;  1I7A A;  1KZG A;  1V88 A;  2W2X C;  4HAV B;  2W2X D; 
#chains in the Genus database with same CATH homology
 5C79 A;  1XCG A;  2MKR A;  4ZRI A;  1EVH A;  1FHW A;  5J3Q A;  1UNR A;  4DX9 0;  1DDV A;  4CYE A;  2FJL A;  2QKM A;  3GYP A;  1WG7 A;  2EJ8 A;  2ELB A;  1OMW A;  1MAI A;  2J0M A;  3ZVR A;  1FAO A;  2K2J A;  1FGZ A;  2X18 A;  3TCA A;  1FHX A;  2KUP A;  5DHF B;  2YVC A;  3DXD A;  1XD4 A;  1UNP A;  4GZU A;  2VRW B;  1AWE A;  4HHV A;  5J3Y A;  3TW1 A;  1ZC3 B;  1WVH A;  5L81 A;  4HB3 B;  4IAP A;  4WVF B;  1OY2 A;  2P0F A;  1U5E A;  3CIK A;  3PEG A;  5KQ4 A;  4IOY X;  1PFJ A;  2D10 A;  4Z2M B;  5DIF B;  1V5P A;  4D0N B;  2P8V A;  4K17 A;  2DHI A;  2Z0Q A;  4K2O A;  1K5D B;  4PQ0 A;  4GN1 A;  2H7E A;  2HTH B;  4WSF A;  4Y94 A;  1NI2 A;  2YT1 A;  3CXB B;  3O96 A;  3PSC A;  2DYN A;  2D9W A;  4ZRK A;  3A98 B;  5D3W A;  3TFM A;  1FGY A;  2CRF A;  3PG7 A;  2Y8G A;  1PLS A;  1H4R A;  1XKE A;  4HDQ A;  3ZDT A;  5JHG A;  1MIX A;  2D11 A;  3SUZ A;  4YON A;  3D8F A;  1RJ2 A;  3MPX A;  2Q13 A;  1ISN A;  1U29 A;  2M38 A;  4HAT B;  4KHB B;  1U2B A;  2LOZ A;  5DI9 B;  1GC6 A;  1FHO A;  1H10 A;  3V5W A;  4F7H A;  1K5G B;  4MT7 A;  2DHJ A;  4ZRJ A;  3ULC A;  4A6K A;  4GPT B;  3PP2 A;  4TKN A;  3AU4 A;  1U5F A;  3U8Z A;  2Z0P A;  2EMT A;  4HB0 B;  1PMS A;  3D8E A;  2DFK A;  2ZPY A;  3OAN A;  4KVG B;  3P7Z A;  2KGX B;  2M14 A;  2L1C A;  2EMS A;  4HB2 B;  2IFS A;  2YF0 A;  2LG1 A;  1FB8 A;  1UEF A;  1MKE A;  2COC A;  2ROV A;  2OQB A;  3M1I B;  4K81 A;  1RRP B;  3FM8 C;  5HE1 A;  1GC7 A;  2LUL A;  1P6S A;  5KCV A;  3RCP A;  4A6H A;  1MK9 B;  4EMO A;  2KCJ A;  2I5C A;  1EF1 A;  2RGN B;  3QWM A;  2K2U A;  3HQC A;  3BJI A;  1UNQ A;  1DDM A;  1TJ6 A;  1IRS A;  1U27 A;  1UPR A;  4NSW A;  3SV1 A;  1LB1 A;  1MK7 B;  2J0K A;  5DHA B;  2IYB A;  2JP2 A;  3BIN A;  2COA A;  3KRX A;  4GMV A;  2GJY A;  2AL6 A;  2COF A;  2COD A;  1U5D A;  1V61 A;  1ZC4 B;  1V89 A;  1X1G A;  3KY9 A;  5HE2 A;  2DLW A;  2GS0 A;  4A6F B;  3U7D A;  1WGQ A;  2ELA A;  4BBK A;  3QIJ A;  5FI0 A;  2W2W A;  1MIZ B;  4DBB A;  4PNK A;  1W1G A;  1I2H A;  2QKL A;  1DBH A;  2XQN M;  1DRO A;  1QC6 A;  3ML4 A;  2CAY A;  2R0D A;  3PVL A;  5JP4 A;  3HW2 B;  2DN6 A;  2VSZ A;  2YS3 A;  1WJ1 A;  2NZ8 B;  4L6E A;  2H7D A;  1ZM0 A;  2J0J A;  5D27 A;  1ZSQ A;  5HE3 A;  3VOQ A;  2RLO A;  1FOE A;  2NMB A;  4WJ7 A;  1X1F A;  2DA0 A;  1W1D A;  4XWX A;  1OQN A;  2HE7 A;  5C6R A;  5J3T A;  3KZ1 A;  2EC1 A;  4GMX B;  5HE0 A;  2UZS A;  2AEH A;  1ZVR A;  2DYQ A;  3ODX A;  3PVW A;  4TYZ A;  3QBV B;  3AU5 A;  2YS5 A;  1SGH A;  2L2I A;  2D9X A;  2J59 M;  2G35 A;  5CLQ B;  4HAU B;  4KAX B;  2LOX A;  3P6A A;  3GYO A;  1AQC A;  3ODW A;  5C5B A;  1XR0 B;  2D4Q A;  2DKP A;  1TXD A;  3DXC A;  4EJN A;  1WGU A;  1B55 A;  3D8D A;  3MDB C;  4IFS A;  2YSZ A;  1V5U A;  4HDO A;  1UPQ A;  1XOD A;  5CLL B;  4H8S A;  4HAW B;  1X05 A;  5FI1 A;  2Y7B A;  3KRW A;  3ODO A;  4C0A A;  1U5G A;  4MY6 A;  1TQZ A;  1DDW A;  5D3X A;  1SHC A;  2E2X A;  3DXE A;  2N0Y A;  3LJU X;  2Z0O A;  4GXB A;  1N3H A;  3KSY A;  1V5M A;  1QQG A;  2I1K A;  5LON B;  5EFX A;  1Y19 B;  5DH9 B;  2P0D A;  3WYF B;  3WA0 A;  4HB4 B;  4DX8 A;  3NSU A;  3PZD A;  1X86 A;  3G9W A;  3UZT A;  2GCJ A;  3TVV A;  2RVB B;  1DYN A;  2UVM A;  1Q67 A;  2RUK B;  4KHO A;  4B6H A;  1KI1 B;  2UZR A;  2MDX A;  4HAZ B;  5JHH A;  3A8Q A;  2LKO A;  5D3Y A;  1E5W A;  1M7E A;  2CY5 A;  1XX0 A;  2YS1 A;  2ROZ B;  2OTX A;  3IVF A;  4EKU A;  2DX5 A;  5C5B B;  2D9V A;  3ULB A;  2R09 A;  3F0W A;  4CHJ A;  5GOW B;  1EGX A;  2I1J A;  5C16 A;  1LW3 A;  5LOP B;  4P7I A;  3FSS A;  1BTN A;  5D3V A;  1Y5O A;  1WI1 A;  2LYD A;  1J19 A;  2DKQ A;  5KQ1 A;  1BWN A;  3SO6 A;  1Z87 A;  1J0W A;  4KHA A;  3SYX A;  2DTC A;  4CHM A;  4A6F A;  2D2Q A;  2MWN B;  1W1H A;  2P0H A;  2DX1 A;  1MPH A;  1KZ7 A;  3HK0 A;  3T06 A;  3AJ4 A;  1NU2 A;  3VIA A;  2ADZ A;  3PVU A;  3FEH A;  3N7C A;  1P5T A;  4HAX B;  3TO1 A;  4Z2N A;  5JLJ B;  2D9Y A;  1M7R A;  2YT0 A;  3F5R A;  2V76 A;  2BCJ A;  2K00 A;  2VKI A;  3X23 A;  1X11 A;  2I5F A;  1NTY A;  4YL8 A;  4DXA B;  1BAK A;  4HAY B;  1WJM A;  2YRY A;  3A8P A;  2DHK A;  2MFQ A;  2PZ1 A;  2Y8F A;  2RNR B;  1BTK A;  2N23 A;  4F7G A;  1P3R A;  2GCL A;  4A5K A;  1NTV A;  2CY4 A;  4F7U P;  4K2P A;  4MK0 A;  1GG3 A;  2RSG A;  4NY0 A;  2D9Z A;  3SNH A;  1EAZ A;  1I7A A;  1KZG A;  1V88 A;  2W2X C;  4HAV B;  2W2X D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...