1V5UA

Solution structure of the c-terminal pleckstrin homology domain of sbf1 from mouse
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
117
structure length
117
Chain Sequence
b'GSSGSSGRSYEGILYKKGAFMKPWKARWFVLDKTKHQLRYYDHRMDTECKGVIDLAEVEAVAPGTPTIGAPKTVDEKAFFDVKTTRRVYNFCAQDVPSAQQWVDRIQSCLSSGPSSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SET binding factor 1
publication title Solution Structure of the C-terminal Pleckstrin Homology Domain of Sbf1 from Mouse
rcsb
source organism Mus musculus
molecule tags Signaling protein
total genus 15
structure length 117
sequence length 117
ec nomenclature
pdb deposition date 2003-11-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00169 PH PH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 1v5uA00
1UPQA 4B6HA 1EGXA 1ZSQA 5DH9B 1OMWA 5D27A 3KRXA 2HE7A 3MPXA 5CLLB 3RCPA 3QIJA 4DXAB 3ODWA 4D0NB 3PEGA 2COCA 1WJ1A 1IRSA 3HQCA 3F5RA 5C5BB 1U5FA 4GPTB 1FHWA 5KQ4A 1U29A 4HDOA 3GYOA 1DBHA 1XCGA 4A6KA 4K81A 1DROA 3N7CA 4HAZB 5JHGA 1XX0A 1DDMA 1PMSA 4XWXA 2DFKA 4DX90 4NSWA 2NMBA 4ZRKA 2DX1A 4IOYX 1DYNA 1SHCA 2ROVA 1Q67A 3VIAA 5DHFB 2N23A 2D4QA 3SYXA 2UZSA 1U5GA 5HE0A 4CHJA 3BINA 2CAYA 1V61A 1QC6A 1MKEA 2DHKA 1P5TA 2Y8GA 1BAKA 3SNHA 1X11A 2GS0A 2YRYA 1MK9B 1GC7A 1KZ7A 4NY0A 3DXDA 4ZRIA 4GMVA 2LYDA 3QBVB 1U5DA 4F7GA 2W2XC 3SV1A 2ELAA 2KGXB 1FHOA 2QKMA 2K2JA 3KSYA 1TJ6A 1BTKA 1MPHA 1LB1A 3DXCA 2D9WA 3ULCA 1NTVA 2D11A 4HAWB 2YS1A 4K2OA 1H4RA 2D2QA 5GOWB 2P0HA 1EF1A 1U2BA 2D9YA 5EFXA 1WI1A 4HHVA 2DKPA 4TKNA 3A8PA 2YS5A 1FB8A 3PVWA 1UNQA 1ZVRA 2GCLA 2LULA 5KCVA 1W1HA 2QKLA 2D9VA 2RLOA 1E5WA 1GG3A 1XKEA 2DX5A 2K00A 4Z2MB 1AWEA 4C0AA 5JHHA 3TO1A 5FI0A 1WG7A 2J0MA 1V5UA 2AL6A 2G35A 5DI9B 2I1JA 4EJNA 1Z87A 5L81A 2KCJA 2CODA 1FOEA 3PZDA 3O96A 1FAOA 3PP2A 1I2HA 3FEHA 2VSZA 1SGHA 3ULBA 5C5BA 1NU2A 2I5FA 2COFA 4HAYB 3TW1A 1V5PA 4HB2B 1MIZB 5C79A 1H10A 4ZRJA 2YSZA 1NTYA 1MK7B 2EMTA 5DIFB 3CXBB 2V76A 4BBKA 4IFSA 2D9ZA 2JP2A 1ZM0A 1X1FA 5HE1A 4KHAA 2LOXA 1QQGA 1X86A 1WGQA 3WA0A 3ML4A 3HK0A 4F7UP 1U5EA 1XR0B 5D3XA 4PNKA 2MDXA 5D3WA 2DTCA 1ZC4B 3KZ1A 4MY6A 3A8QA 4GMXB 2Z0OA 4HB3B 5KQ1A 2W2XD 2R09A 3PVLA 4H8SA 4YL8A 3SUZA 4A6HA 2RNRB 4GZUA 4KHOA 1ISNA 1EVHA 1XODA 2K2UA 2OTXA 1W1GA 4YONA 2UZRA 1EAZA 2DLWA 2EJ8A 3BJIA 3TCAA 2H7DA 3PVUA 4HAUB 1N3HA 3T06A 2XQNM 2L1CA 5C16A 2GJYA 2D9XA 2I1KA 4PQ0A 1KZGA 2X18A 2L2IA 1UEFA 4CHMA 3KY9A 3VOQA 3A98B 3G9WA 1U27A 1BTNA 2CY4A 2OQBA 3LJUX 1P3RA 1M7EA 3FSSA 2VRWB 4K2PA 4F7HA 2DYNA 1V89A 5D3VA 5LOPB 3ZVRA 1Y5OA 2DYQA 3D8EA 4A6FA 1FGZA 2DKQA 5D3YA 2LKOA 3MDBC 2RVBB 2E2XA 2Y8FA 1V5MA 3ODOA 4HAVB 5HE2A 5CLQB 2I5CA 4KVGB 4HB4B 4A5KA 1LW3A 1MAIA 4KHBB 3P6AA 5LONB 4P7IA 4Y94A 2Q13A 2M38A 2D10A 1UNPA 1OQNA 5J3YA 5HE3A 1J19A 2MFQA 5JLJB 1XD4A 2DN6A 4TYZA 2BCJA 3AU5A 1UPRA 5JP4A 1DDWA 1WVHA 2ZPYA 2P0FA 3FM8C 2IFSA 4DBBA 2CY5A 4Z2NA 1TXDA 2CRFA 5C6RA 2Z0QA 3NSUA 3U8ZA 2H7EA 2J0JA 4MK0A 2YT0A 1BWNA 2HTHB 1UNRA 3D8DA 3M1IB 4DX8A 2MKRA 4GXBA 1B55A 1DDVA 1K5GB 3SO6A 3PG7A 1TQZA 4HATB 1X05A 2AEHA 2Z0PA 1WGUA 3HW2B 1P6SA 1OY2A 2PZ1A 4WSFA 3WYFB 2J59M 4MT7A 1J0WA 2YVCA 4HB0B 2RGNB 4KAXB 3OANA 1GC6A 2J0KA 1KI1B 2GCJA 2NZ8B 3F0WA 2ELBA 1ZC3B 2LG1A 3DXEA 2EMSA 2N0YA 2COAA 2M14A 2UVMA 1NI2A 1M7RA 1Y19B 3ZDTA 4WJ7A 1WJMA 3V5WA 5FI1A 1V88A 4IAPA 2P8VA 1FGYA 1AQCA 2YS3A 3UZTA 2ADZA 2YF0A 2FJLA 3CIKA 1X1GA 2DHJA 3PSCA 4EMOA 2LOZA 2EC1A 4HAXB 1PFJA 4GN1A 1RRPB 2W2WA 2DA0A 1K5DB 4K17A 3P7ZA 2YT1A 5DHAB 4CYEA 2KUPA 3TVVA 2R0DA 1FHXA 2MWNB 4HDQA 4EKUA 1RJ2A 2IYBA 4WVFB 3X23A 3AU4A 3ODXA 3TFMA 3IVFA 1W1DA 1PLSA 3AJ4A 2ROZB 5J3TA 2P0DA 3GYPA 1I7AA 1MIXA 3D8FA 2RUKB 3KRWA 2DHIA 4A6FB 3QWMA 4L6EA 5J3QA 2Y7BA 2RSGA 3U7DA 2VKIA
chains in the Genus database with same CATH superfamily
1UPQA 4B6HA 2YT2A 1EGXA 1ZSQA 5DH9B 1OMWA 5D27A 3KRXA 2HE7A 3MPXA 5CLLB 3RCPA 2R2YA 3QIJA 3NW8A 3ODWA 4DXAB 4D0NB 3PEGA 2COCA 2KR0A 1WJ1A 1IRSA 3HQCA 3F5RA 5C5BB 1U5FA 4GPTB 1FHWA 5KQ4A 1U29A 4HDOA 3GYOA 1DBHA 1XCGA 4A6KA 4K81A 1ZYIA 1DROA 3N7CA 4HAZB 5JHGA 1XX0A 1DDMA 1PMSA 3NWFA 4XWXA 2DFKA 4DX90 4NSWA 2NMBA 4QJ4B 4ZRKA 1T77A 2DX1A 3HIEA 4IOYX 2FJUB 1DYNA 1SHCA 2ROVA 1Q67A 3VIAA 5DHFB 4HSIA 2N23A 2D4QA 3SYXA 2UZSA 1U5GA 5HE0A 4CHJA 3BINA 2CAYA 1V61A 1QC6A 1MKEA 2DHKA 1P5TA 2Y8GA 1BAKA 3SNHA 4QJ3B 1X11A 2GS0A 2YRYA 1MK9B 1GC7A 1KZ7A 4NY0A 3NWDA 3DXDA 4ZRIA 3FVCA 4GMVA 2LYDA 3QBVB 1U5DA 4CSQA 4F7GA 2W2XC 3B77A 3SV1A 2ELAA 2KGXB 1FHOA 2QKMA 2K2JA 3KSYA 1TJ6A 1BTKA 1MPHA 1LB1A 4QJ5B 3DXCA 2D9WA 3ULCA 1NTVA 2D11A 4HAWB 2YS1A 4K2OA 1H4RA 2D2QA 5GOWB 2P0HA 1EF1A 1U2BA 2D9YA 5EFXA 1WI1A 4HHVA 2DKPA 4TKNA 3A8PA 2YS5A 1FB8A 3PVWA 1UNQA 1ZVRA 2GCLA 2LULA 5KCVA 1W1HA 4GNKB 2QKLA 2D9VA 2RLOA 1E5WA 1GG3A 1XKEA 2DX5A 2K00A 4Z2MB 1AWEA 4C0AA 5JHHA 2GUMA 3TO1A 5FI0A 1WG7A 2J0MA 1V5UA 2AL6A 2G35A 5DI9B 3NWAA 2I1JA 4EJNA 1Z87A 5L81A 2KCJA 2CODA 1FOEA 3PZDA 3O96A 1FAOA 3PP2A 1I2HA 3FEHA 2VSZA 1SGHA 3ULBA 5C5BA 1NU2A 2I5FA 2Z13A 2COFA 5LG4B 2Z4DA 4HAYB 3TW1A 1V5PA 2KIEA 4HB2B 1MIZB 5C79A 1H10A 4ZRJA 2YSZA 1NTYA 1MK7B 2EMTA 5DIFB 3CXBB 2V76A 4BBKA 4IFSA 2D9ZA 2JP2A 1ZM0A 1X1FA 5HE1A 4KHAA 1MI1A 2LOXA 1QQGA 1X86A 1WGQA 3WA0A 3ML4A 3HK0A 4F7UP 1U5EA 1XR0B 5D3XA 4PNKA 2MDXA 5D3WA 2DTCA 1ZC4B 3KZ1A 4MY6A 3A8QA 4GMXB 2Z0OA 4HB3B 5KQ1A 2W2XD 2K49A 2R09A 3PVLA 4H8SA 4YL8A 3SUZA 4A6HA 2Z59A 2RNRB 4GZUA 4KHOA 1ISNA 1EVHA 1XODA 2K2UA 2OTXA 4OSNA 1W1GA 5I2MA 4YONA 2UZRA 1EAZA 2DLWA 2EJ8A 3BJIA 3TCAA 2H7DA 3PVUA 4HAUB 1N3HA 3T06A 2XQNM 2L1CA 5C16A 2GJYA 2D9XA 2I1KA 4PQ0A 1KZGA 2X18A 3OHMB 2L2IA 1UEFA 4CHMA 3KY9A 3VOQA 3A98B 3G9WA 1U27A 1BTNA 2CY4A 2OQBA 3LJUX 1P3RA 1M7EA 3FSSA 2VRWB 4K2PA 4F7HA 2DYNA 5M4YB 1V89A 5D3VA 5LOPB 4GOUA 3ZVRA 1Y5OA 2DYQA 3D8EA 4A6FA 1FGZA 2DKQA 5D3YA 2LKOA 5IRSA 2NBVA 3MDBC 2RVBB 2E2XA 4L1RA 2Y8FA 1V5MA 3ODOA 4HAVB 5HE2A 5CLQB 2I5CA 4KVGB 4HB4B 4A5KA 1LW3A 1MAIA 4KHBB 3P6AA 5LONB 4P7IA 4Y94A 2Q13A 2M38A 2D10A 1UNPA 1OQNA 5J3YA 5HE3A 1J19A 2MFQA 5JLJB 1XD4A 2DN6A 4TYZA 2BCJA 3AU5A 1UPRA 5JP4A 1DDWA 1WVHA 2ZPYA 2P0FA 3FM8C 2IFSA 4DBBA 3A58A 2CY5A 4Z2NA 1TXDA 2CRFA 5C6RA 2Z0QA 3NSUA 3U8ZA 2H7EA 2J0JA 4MK0A 2Z14A 2YT0A 2KIGA 1BWNA 2KUQA 2HTHB 1UNRA 3D8DA 3M1IB 4DX8A 2MKRA 4GXBA 1B55A 2RRFA 1DDVA 1K5GB 3SO6A 3PG7A 1TQZA 4HATB 1X05A 2AEHA 2Z0PA 1WGUA 3HW2B 1P6SA 1OY2A 2PZ1A 4WSFA 3WYFB 2J59M 4MT7A 1J0WA 2YVCA 4HB0B 2RGNB 4KAXB 4DIXA 3OANA 1GC6A 2J0KA 1KI1B 2GCJA 2NZ8B 3F0WA 2ELBA 1ZC3B 2LG1A 3DXEA 2EMSA 2N0YA 2COAA 2M14A 2UVMA 1NI2A 1M7RA 1Y19B 3ZDTA 4WJ7A 1WJMA 3U12A 3V5WA 5FI1A 1V88A 4IAPA 2P8VA 1FGYA 1AQCA 2YS3A 3UZTA 2ADZA 5I2SA 2YF0A 4D6WA 2FJLA 3CIKA 1X1GA 2DHJA 3PSCA 4EMOA 2LOZA 2EC1A 4HAXB 1PFJA 4GN1A 1RRPB 2W2WA 2DA0A 1K5DB 4K17A 3P7ZA 2YT1A 5DHAB 4CYEA 2KUPA 3TVVA 2R0DA 1FHXA 2MWNB 4HDQA 4EKUA 1RJ2A 2IYBA 4WVFB 3X23A 3AU4A 3ODXA 4QXAB 3TFMA 3HSAA 3IVFA 2K8EA 1W1DA 1PLSA 3DCXA 3AJ4A 2ROZB 5J3TA 2P0DA 3GYPA 1I7AA 1MIXA 3D8FA 2RUKB 2ZKMX 3KRWA 2DHIA 4A6FB 3QWMA 4L6EA 5J3QA 2Y7BA 2RSGA 4OT1A 4KHBA 3U7DA 2VKIA
chains in the Genus database with same CATH topology
1UPQA 4B6HA 1EGXA 1ZSQA 5DH9B 1OMWA 5D27A 3KRXA 2HE7A 3MPXA 5CLLB 3RCPA 3QIJA 4DXAB 3ODWA 4D0NB 3PEGA 2COCA 1WJ1A 1IRSA 3HQCA 3F5RA 5C5BB 1U5FA 4GPTB 1FHWA 5KQ4A 1U29A 4HDOA 3GYOA 1DBHA 1XCGA 4A6KA 4K81A 1DROA 3N7CA 4HAZB 5JHGA 1XX0A 1DDMA 1PMSA 4XWXA 2DFKA 4DX90 4NSWA 2NMBA 4ZRKA 2DX1A 4IOYX 1DYNA 1SHCA 2ROVA 1Q67A 3VIAA 5DHFB 2N23A 2D4QA 3SYXA 2UZSA 1U5GA 5HE0A 4CHJA 3BINA 2CAYA 1V61A 1QC6A 1MKEA 2DHKA 1P5TA 2Y8GA 1BAKA 3SNHA 1X11A 2GS0A 2YRYA 1MK9B 1GC7A 1KZ7A 4NY0A 3DXDA 4ZRIA 4GMVA 2LYDA 3QBVB 1U5DA 4F7GA 2W2XC 3SV1A 2ELAA 2KGXB 1FHOA 2QKMA 2K2JA 3KSYA 1TJ6A 1BTKA 1MPHA 1LB1A 3DXCA 2D9WA 3ULCA 1NTVA 2D11A 4HAWB 2YS1A 4K2OA 1H4RA 2D2QA 5GOWB 2P0HA 1EF1A 1U2BA 2D9YA 5EFXA 1WI1A 4HHVA 2DKPA 4TKNA 3A8PA 2YS5A 1FB8A 3PVWA 1UNQA 1ZVRA 2GCLA 2LULA 5KCVA 1W1HA 2QKLA 2D9VA 2RLOA 1E5WA 1GG3A 1XKEA 2DX5A 2K00A 4Z2MB 1AWEA 4C0AA 5JHHA 3TO1A 5FI0A 1WG7A 2J0MA 1V5UA 2AL6A 2G35A 5DI9B 2I1JA 4EJNA 1Z87A 5L81A 2KCJA 2CODA 1FOEA 3PZDA 3O96A 1FAOA 3PP2A 1I2HA 3FEHA 2VSZA 1SGHA 3ULBA 5C5BA 1NU2A 2I5FA 2COFA 4HAYB 3TW1A 1V5PA 4HB2B 1MIZB 5C79A 1H10A 4ZRJA 2YSZA 1NTYA 1MK7B 2EMTA 5DIFB 3CXBB 2V76A 4BBKA 4IFSA 2D9ZA 2JP2A 1ZM0A 1X1FA 5HE1A 4KHAA 2LOXA 1QQGA 1X86A 1WGQA 3WA0A 3ML4A 3HK0A 4F7UP 1U5EA 1XR0B 5D3XA 4PNKA 2MDXA 5D3WA 2DTCA 1ZC4B 3KZ1A 4MY6A 3A8QA 4GMXB 2Z0OA 4HB3B 5KQ1A 2W2XD 2R09A 3PVLA 4H8SA 4YL8A 3SUZA 4A6HA 2RNRB 4GZUA 4KHOA 1ISNA 1EVHA 1XODA 2K2UA 2OTXA 1W1GA 4YONA 2UZRA 1EAZA 2DLWA 2EJ8A 3BJIA 3TCAA 2H7DA 3PVUA 4HAUB 1N3HA 3T06A 2XQNM 2L1CA 5C16A 2GJYA 2D9XA 2I1KA 4PQ0A 1KZGA 2X18A 2L2IA 1UEFA 4CHMA 3KY9A 3VOQA 3A98B 3G9WA 1U27A 1BTNA 2CY4A 2OQBA 3LJUX 1P3RA 1M7EA 3FSSA 2VRWB 4K2PA 4F7HA 2DYNA 1V89A 5D3VA 5LOPB 3ZVRA 1Y5OA 2DYQA 3D8EA 4A6FA 1FGZA 2DKQA 5D3YA 2LKOA 3MDBC 2RVBB 2E2XA 2Y8FA 1V5MA 3ODOA 4HAVB 5HE2A 5CLQB 2I5CA 4KVGB 4HB4B 4A5KA 1LW3A 1MAIA 4KHBB 3P6AA 5LONB 4P7IA 4Y94A 2Q13A 2M38A 2D10A 1UNPA 1OQNA 5J3YA 5HE3A 1J19A 2MFQA 5JLJB 1XD4A 2DN6A 4TYZA 2BCJA 3AU5A 1UPRA 5JP4A 1DDWA 1WVHA 2ZPYA 2P0FA 3FM8C 2IFSA 4DBBA 2CY5A 4Z2NA 1TXDA 2CRFA 5C6RA 2Z0QA 3NSUA 3U8ZA 2H7EA 2J0JA 4MK0A 2YT0A 1BWNA 2HTHB 1UNRA 3D8DA 3M1IB 4DX8A 2MKRA 4GXBA 1B55A 1DDVA 1K5GB 3SO6A 3PG7A 1TQZA 4HATB 1X05A 2AEHA 2Z0PA 1WGUA 3HW2B 1P6SA 1OY2A 2PZ1A 4WSFA 3WYFB 2J59M 4MT7A 1J0WA 2YVCA 4HB0B 2RGNB 4KAXB 3OANA 1GC6A 2J0KA 1KI1B 2GCJA 2NZ8B 3F0WA 2ELBA 1ZC3B 2LG1A 3DXEA 2EMSA 2N0YA 2COAA 2M14A 2UVMA 1NI2A 1M7RA 1Y19B 3ZDTA 4WJ7A 1WJMA 3V5WA 5FI1A 1V88A 4IAPA 2P8VA 1FGYA 1AQCA 2YS3A 3UZTA 2ADZA 2YF0A 2FJLA 3CIKA 1X1GA 2DHJA 3PSCA 4EMOA 2LOZA 2EC1A 4HAXB 1PFJA 4GN1A 1RRPB 2W2WA 2DA0A 1K5DB 4K17A 3P7ZA 2YT1A 5DHAB 4CYEA 2KUPA 3TVVA 2R0DA 1FHXA 2MWNB 4HDQA 4EKUA 1RJ2A 2IYBA 4WVFB 3X23A 3AU4A 3ODXA 3TFMA 3IVFA 1W1DA 1PLSA 3AJ4A 2ROZB 5J3TA 2P0DA 3GYPA 1I7AA 1MIXA 3D8FA 2RUKB 3KRWA 2DHIA 4A6FB 3QWMA 4L6EA 5J3QA 2Y7BA 2RSGA 3U7DA 2VKIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UPQ A;  4B6H A;  1EGX A;  1ZSQ A;  5DH9 B;  1OMW A;  5D27 A;  3KRX A;  2HE7 A;  3MPX A;  5CLL B;  3RCP A;  3QIJ A;  4DXA B;  3ODW A;  4D0N B;  3PEG A;  2COC A;  1WJ1 A;  1IRS A;  3HQC A;  3F5R A;  5C5B B;  1U5F A;  4GPT B;  1FHW A;  5KQ4 A;  1U29 A;  4HDO A;  3GYO A;  1DBH A;  1XCG A;  4A6K A;  4K81 A;  1DRO A;  3N7C A;  4HAZ B;  5JHG A;  1XX0 A;  1DDM A;  1PMS A;  4XWX A;  2DFK A;  4DX9 0;  4NSW A;  2NMB A;  4ZRK A;  2DX1 A;  4IOY X;  1DYN A;  1SHC A;  2ROV A;  1Q67 A;  3VIA A;  5DHF B;  2N23 A;  2D4Q A;  3SYX A;  2UZS A;  1U5G A;  5HE0 A;  4CHJ A;  3BIN A;  2CAY A;  1V61 A;  1QC6 A;  1MKE A;  2DHK A;  1P5T A;  2Y8G A;  1BAK A;  3SNH A;  1X11 A;  2GS0 A;  2YRY A;  1MK9 B;  1GC7 A;  1KZ7 A;  4NY0 A;  3DXD A;  4ZRI A;  4GMV A;  2LYD A;  3QBV B;  1U5D A;  4F7G A;  2W2X C;  3SV1 A;  2ELA A;  2KGX B;  1FHO A;  2QKM A;  2K2J A;  3KSY A;  1TJ6 A;  1BTK A;  1MPH A;  1LB1 A;  3DXC A;  2D9W A;  3ULC A;  1NTV A;  2D11 A;  4HAW B;  2YS1 A;  4K2O A;  1H4R A;  2D2Q A;  5GOW B;  2P0H A;  1EF1 A;  1U2B A;  2D9Y A;  5EFX A;  1WI1 A;  4HHV A;  2DKP A;  4TKN A;  3A8P A;  2YS5 A;  1FB8 A;  3PVW A;  1UNQ A;  1ZVR A;  2GCL A;  2LUL A;  5KCV A;  1W1H A;  2QKL A;  2D9V A;  2RLO A;  1E5W A;  1GG3 A;  1XKE A;  2DX5 A;  2K00 A;  4Z2M B;  1AWE A;  4C0A A;  5JHH A;  3TO1 A;  5FI0 A;  1WG7 A;  2J0M A;  1V5U A;  2AL6 A;  2G35 A;  5DI9 B;  2I1J A;  4EJN A;  1Z87 A;  5L81 A;  2KCJ A;  2COD A;  1FOE A;  3PZD A;  3O96 A;  1FAO A;  3PP2 A;  1I2H A;  3FEH A;  2VSZ A;  1SGH A;  3ULB A;  5C5B A;  1NU2 A;  2I5F A;  2COF A;  4HAY B;  3TW1 A;  1V5P A;  4HB2 B;  1MIZ B;  5C79 A;  1H10 A;  4ZRJ A;  2YSZ A;  1NTY A;  1MK7 B;  2EMT A;  5DIF B;  3CXB B;  2V76 A;  4BBK A;  4IFS A;  2D9Z A;  2JP2 A;  1ZM0 A;  1X1F A;  5HE1 A;  4KHA A;  2LOX A;  1QQG A;  1X86 A;  1WGQ A;  3WA0 A;  3ML4 A;  3HK0 A;  4F7U P;  1U5E A;  1XR0 B;  5D3X A;  4PNK A;  2MDX A;  5D3W A;  2DTC A;  1ZC4 B;  3KZ1 A;  4MY6 A;  3A8Q A;  4GMX B;  2Z0O A;  4HB3 B;  5KQ1 A;  2W2X D;  2R09 A;  3PVL A;  4H8S A;  4YL8 A;  3SUZ A;  4A6H A;  2RNR B;  4GZU A;  4KHO A;  1ISN A;  1EVH A;  1XOD A;  2K2U A;  2OTX A;  1W1G A;  4YON A;  2UZR A;  1EAZ A;  2DLW A;  2EJ8 A;  3BJI A;  3TCA A;  2H7D A;  3PVU A;  4HAU B;  1N3H A;  3T06 A;  2XQN M;  2L1C A;  5C16 A;  2GJY A;  2D9X A;  2I1K A;  4PQ0 A;  1KZG A;  2X18 A;  2L2I A;  1UEF A;  4CHM A;  3KY9 A;  3VOQ A;  3A98 B;  3G9W A;  1U27 A;  1BTN A;  2CY4 A;  2OQB A;  3LJU X;  1P3R A;  1M7E A;  3FSS A;  2VRW B;  4K2P A;  4F7H A;  2DYN A;  1V89 A;  5D3V A;  5LOP B;  3ZVR A;  1Y5O A;  2DYQ A;  3D8E A;  4A6F A;  1FGZ A;  2DKQ A;  5D3Y A;  2LKO A;  3MDB C;  2RVB B;  2E2X A;  2Y8F A;  1V5M A;  3ODO A;  4HAV B;  5HE2 A;  5CLQ B;  2I5C A;  4KVG B;  4HB4 B;  4A5K A;  1LW3 A;  1MAI A;  4KHB B;  3P6A A;  5LON B;  4P7I A;  4Y94 A;  2Q13 A;  2M38 A;  2D10 A;  1UNP A;  1OQN A;  5J3Y A;  5HE3 A;  1J19 A;  2MFQ A;  5JLJ B;  1XD4 A;  2DN6 A;  4TYZ A;  2BCJ A;  3AU5 A;  1UPR A;  5JP4 A;  1DDW A;  1WVH A;  2ZPY A;  2P0F A;  3FM8 C;  2IFS A;  4DBB A;  2CY5 A;  4Z2N A;  1TXD A;  2CRF A;  5C6R A;  2Z0Q A;  3NSU A;  3U8Z A;  2H7E A;  2J0J A;  4MK0 A;  2YT0 A;  1BWN A;  2HTH B;  1UNR A;  3D8D A;  3M1I B;  4DX8 A;  2MKR A;  4GXB A;  1B55 A;  1DDV A;  1K5G B;  3SO6 A;  3PG7 A;  1TQZ A;  4HAT B;  1X05 A;  2AEH A;  2Z0P A;  1WGU A;  3HW2 B;  1P6S A;  1OY2 A;  2PZ1 A;  4WSF A;  3WYF B;  2J59 M;  4MT7 A;  1J0W A;  2YVC A;  4HB0 B;  2RGN B;  4KAX B;  3OAN A;  1GC6 A;  2J0K A;  1KI1 B;  2GCJ A;  2NZ8 B;  3F0W A;  2ELB A;  1ZC3 B;  2LG1 A;  3DXE A;  2EMS A;  2N0Y A;  2COA A;  2M14 A;  2UVM A;  1NI2 A;  1M7R A;  1Y19 B;  3ZDT A;  4WJ7 A;  1WJM A;  3V5W A;  5FI1 A;  1V88 A;  4IAP A;  2P8V A;  1FGY A;  1AQC A;  2YS3 A;  3UZT A;  2ADZ A;  2YF0 A;  2FJL A;  3CIK A;  1X1G A;  2DHJ A;  3PSC A;  4EMO A;  2LOZ A;  2EC1 A;  4HAX B;  1PFJ A;  4GN1 A;  1RRP B;  2W2W A;  2DA0 A;  1K5D B;  4K17 A;  3P7Z A;  2YT1 A;  5DHA B;  4CYE A;  2KUP A;  3TVV A;  2R0D A;  1FHX A;  2MWN B;  4HDQ A;  4EKU A;  1RJ2 A;  2IYB A;  4WVF B;  3X23 A;  3AU4 A;  3ODX A;  3TFM A;  3IVF A;  1W1D A;  1PLS A;  3AJ4 A;  2ROZ B;  5J3T A;  2P0D A;  3GYP A;  1I7A A;  1MIX A;  3D8F A;  2RUK B;  3KRW A;  2DHI A;  4A6F B;  3QWM A;  4L6E A;  5J3Q A;  2Y7B A;  2RSG A;  3U7D A;  2VKI A; 
#chains in the Genus database with same CATH topology
 1UPQ A;  4B6H A;  2YT2 A;  1EGX A;  1ZSQ A;  5DH9 B;  1OMW A;  5D27 A;  3KRX A;  2HE7 A;  3MPX A;  5CLL B;  3RCP A;  2R2Y A;  3QIJ A;  3NW8 A;  3ODW A;  4DXA B;  4D0N B;  3PEG A;  2COC A;  2KR0 A;  1WJ1 A;  1IRS A;  3HQC A;  3F5R A;  5C5B B;  1U5F A;  4GPT B;  1FHW A;  5KQ4 A;  1U29 A;  4HDO A;  3GYO A;  1DBH A;  1XCG A;  4A6K A;  4K81 A;  1ZYI A;  1DRO A;  3N7C A;  4HAZ B;  5JHG A;  1XX0 A;  1DDM A;  1PMS A;  3NWF A;  4XWX A;  2DFK A;  4DX9 0;  4NSW A;  2NMB A;  4QJ4 B;  4ZRK A;  1T77 A;  2DX1 A;  3HIE A;  4IOY X;  2FJU B;  1DYN A;  1SHC A;  2ROV A;  1Q67 A;  3VIA A;  5DHF B;  4HSI A;  2N23 A;  2D4Q A;  3SYX A;  2UZS A;  1U5G A;  5HE0 A;  4CHJ A;  3BIN A;  2CAY A;  1V61 A;  1QC6 A;  1MKE A;  2DHK A;  1P5T A;  2Y8G A;  1BAK A;  3SNH A;  4QJ3 B;  1X11 A;  2GS0 A;  2YRY A;  1MK9 B;  1GC7 A;  1KZ7 A;  4NY0 A;  3NWD A;  3DXD A;  4ZRI A;  3FVC A;  4GMV A;  2LYD A;  3QBV B;  1U5D A;  4CSQ A;  4F7G A;  2W2X C;  3B77 A;  3SV1 A;  2ELA A;  2KGX B;  1FHO A;  2QKM A;  2K2J A;  3KSY A;  1TJ6 A;  1BTK A;  1MPH A;  1LB1 A;  4QJ5 B;  3DXC A;  2D9W A;  3ULC A;  1NTV A;  2D11 A;  4HAW B;  2YS1 A;  4K2O A;  1H4R A;  2D2Q A;  5GOW B;  2P0H A;  1EF1 A;  1U2B A;  2D9Y A;  5EFX A;  1WI1 A;  4HHV A;  2DKP A;  4TKN A;  3A8P A;  2YS5 A;  1FB8 A;  3PVW A;  1UNQ A;  1ZVR A;  2GCL A;  2LUL A;  5KCV A;  1W1H A;  4GNK B;  2QKL A;  2D9V A;  2RLO A;  1E5W A;  1GG3 A;  1XKE A;  2DX5 A;  2K00 A;  4Z2M B;  1AWE A;  4C0A A;  5JHH A;  2GUM A;  3TO1 A;  5FI0 A;  1WG7 A;  2J0M A;  1V5U A;  2AL6 A;  2G35 A;  5DI9 B;  3NWA A;  2I1J A;  4EJN A;  1Z87 A;  5L81 A;  2KCJ A;  2COD A;  1FOE A;  3PZD A;  3O96 A;  1FAO A;  3PP2 A;  1I2H A;  3FEH A;  2VSZ A;  1SGH A;  3ULB A;  5C5B A;  1NU2 A;  2I5F A;  2Z13 A;  2COF A;  5LG4 B;  2Z4D A;  4HAY B;  3TW1 A;  1V5P A;  2KIE A;  4HB2 B;  1MIZ B;  5C79 A;  1H10 A;  4ZRJ A;  2YSZ A;  1NTY A;  1MK7 B;  2EMT A;  5DIF B;  3CXB B;  2V76 A;  4BBK A;  4IFS A;  2D9Z A;  2JP2 A;  1ZM0 A;  1X1F A;  5HE1 A;  4KHA A;  1MI1 A;  2LOX A;  1QQG A;  1X86 A;  1WGQ A;  3WA0 A;  3ML4 A;  3HK0 A;  4F7U P;  1U5E A;  1XR0 B;  5D3X A;  4PNK A;  2MDX A;  5D3W A;  2DTC A;  1ZC4 B;  3KZ1 A;  4MY6 A;  3A8Q A;  4GMX B;  2Z0O A;  4HB3 B;  5KQ1 A;  2W2X D;  2K49 A;  2R09 A;  3PVL A;  4H8S A;  4YL8 A;  3SUZ A;  4A6H A;  2Z59 A;  2RNR B;  4GZU A;  4KHO A;  1ISN A;  1EVH A;  1XOD A;  2K2U A;  2OTX A;  4OSN A;  1W1G A;  5I2M A;  4YON A;  2UZR A;  1EAZ A;  2DLW A;  2EJ8 A;  3BJI A;  3TCA A;  2H7D A;  3PVU A;  4HAU B;  1N3H A;  3T06 A;  2XQN M;  2L1C A;  5C16 A;  2GJY A;  2D9X A;  2I1K A;  4PQ0 A;  1KZG A;  2X18 A;  3OHM B;  2L2I A;  1UEF A;  4CHM A;  3KY9 A;  3VOQ A;  3A98 B;  3G9W A;  1U27 A;  1BTN A;  2CY4 A;  2OQB A;  3LJU X;  1P3R A;  1M7E A;  3FSS A;  2VRW B;  4K2P A;  4F7H A;  2DYN A;  5M4Y B;  1V89 A;  5D3V A;  5LOP B;  4GOU A;  3ZVR A;  1Y5O A;  2DYQ A;  3D8E A;  4A6F A;  1FGZ A;  2DKQ A;  5D3Y A;  2LKO A;  5IRS A;  2NBV A;  3MDB C;  2RVB B;  2E2X A;  4L1R A;  2Y8F A;  1V5M A;  3ODO A;  4HAV B;  5HE2 A;  5CLQ B;  2I5C A;  4KVG B;  4HB4 B;  4A5K A;  1LW3 A;  1MAI A;  4KHB B;  3P6A A;  5LON B;  4P7I A;  4Y94 A;  2Q13 A;  2M38 A;  2D10 A;  1UNP A;  1OQN A;  5J3Y A;  5HE3 A;  1J19 A;  2MFQ A;  5JLJ B;  1XD4 A;  2DN6 A;  4TYZ A;  2BCJ A;  3AU5 A;  1UPR A;  5JP4 A;  1DDW A;  1WVH A;  2ZPY A;  2P0F A;  3FM8 C;  2IFS A;  4DBB A;  3A58 A;  2CY5 A;  4Z2N A;  1TXD A;  2CRF A;  5C6R A;  2Z0Q A;  3NSU A;  3U8Z A;  2H7E A;  2J0J A;  4MK0 A;  2Z14 A;  2YT0 A;  2KIG A;  1BWN A;  2KUQ A;  2HTH B;  1UNR A;  3D8D A;  3M1I B;  4DX8 A;  2MKR A;  4GXB A;  1B55 A;  2RRF A;  1DDV A;  1K5G B;  3SO6 A;  3PG7 A;  1TQZ A;  4HAT B;  1X05 A;  2AEH A;  2Z0P A;  1WGU A;  3HW2 B;  1P6S A;  1OY2 A;  2PZ1 A;  4WSF A;  3WYF B;  2J59 M;  4MT7 A;  1J0W A;  2YVC A;  4HB0 B;  2RGN B;  4KAX B;  4DIX A;  3OAN A;  1GC6 A;  2J0K A;  1KI1 B;  2GCJ A;  2NZ8 B;  3F0W A;  2ELB A;  1ZC3 B;  2LG1 A;  3DXE A;  2EMS A;  2N0Y A;  2COA A;  2M14 A;  2UVM A;  1NI2 A;  1M7R A;  1Y19 B;  3ZDT A;  4WJ7 A;  1WJM A;  3U12 A;  3V5W A;  5FI1 A;  1V88 A;  4IAP A;  2P8V A;  1FGY A;  1AQC A;  2YS3 A;  3UZT A;  2ADZ A;  5I2S A;  2YF0 A;  4D6W A;  2FJL A;  3CIK A;  1X1G A;  2DHJ A;  3PSC A;  4EMO A;  2LOZ A;  2EC1 A;  4HAX B;  1PFJ A;  4GN1 A;  1RRP B;  2W2W A;  2DA0 A;  1K5D B;  4K17 A;  3P7Z A;  2YT1 A;  5DHA B;  4CYE A;  2KUP A;  3TVV A;  2R0D A;  1FHX A;  2MWN B;  4HDQ A;  4EKU A;  1RJ2 A;  2IYB A;  4WVF B;  3X23 A;  3AU4 A;  3ODX A;  4QXA B;  3TFM A;  3HSA A;  3IVF A;  2K8E A;  1W1D A;  1PLS A;  3DCX A;  3AJ4 A;  2ROZ B;  5J3T A;  2P0D A;  3GYP A;  1I7A A;  1MIX A;  3D8F A;  2RUK B;  2ZKM X;  3KRW A;  2DHI A;  4A6F B;  3QWM A;  4L6E A;  5J3Q A;  2Y7B A;  2RSG A;  4OT1 A;  4KHB A;  3U7D A;  2VKI A; 
#chains in the Genus database with same CATH homology
 1UPQ A;  4B6H A;  1EGX A;  1ZSQ A;  5DH9 B;  1OMW A;  5D27 A;  3KRX A;  2HE7 A;  3MPX A;  5CLL B;  3RCP A;  3QIJ A;  4DXA B;  3ODW A;  4D0N B;  3PEG A;  2COC A;  1WJ1 A;  1IRS A;  3HQC A;  3F5R A;  5C5B B;  1U5F A;  4GPT B;  1FHW A;  5KQ4 A;  1U29 A;  4HDO A;  3GYO A;  1DBH A;  1XCG A;  4A6K A;  4K81 A;  1DRO A;  3N7C A;  4HAZ B;  5JHG A;  1XX0 A;  1DDM A;  1PMS A;  4XWX A;  2DFK A;  4DX9 0;  4NSW A;  2NMB A;  4ZRK A;  2DX1 A;  4IOY X;  1DYN A;  1SHC A;  2ROV A;  1Q67 A;  3VIA A;  5DHF B;  2N23 A;  2D4Q A;  3SYX A;  2UZS A;  1U5G A;  5HE0 A;  4CHJ A;  3BIN A;  2CAY A;  1V61 A;  1QC6 A;  1MKE A;  2DHK A;  1P5T A;  2Y8G A;  1BAK A;  3SNH A;  1X11 A;  2GS0 A;  2YRY A;  1MK9 B;  1GC7 A;  1KZ7 A;  4NY0 A;  3DXD A;  4ZRI A;  4GMV A;  2LYD A;  3QBV B;  1U5D A;  4F7G A;  2W2X C;  3SV1 A;  2ELA A;  2KGX B;  1FHO A;  2QKM A;  2K2J A;  3KSY A;  1TJ6 A;  1BTK A;  1MPH A;  1LB1 A;  3DXC A;  2D9W A;  3ULC A;  1NTV A;  2D11 A;  4HAW B;  2YS1 A;  4K2O A;  1H4R A;  2D2Q A;  5GOW B;  2P0H A;  1EF1 A;  1U2B A;  2D9Y A;  5EFX A;  1WI1 A;  4HHV A;  2DKP A;  4TKN A;  3A8P A;  2YS5 A;  1FB8 A;  3PVW A;  1UNQ A;  1ZVR A;  2GCL A;  2LUL A;  5KCV A;  1W1H A;  2QKL A;  2D9V A;  2RLO A;  1E5W A;  1GG3 A;  1XKE A;  2DX5 A;  2K00 A;  4Z2M B;  1AWE A;  4C0A A;  5JHH A;  3TO1 A;  5FI0 A;  1WG7 A;  2J0M A;  1V5U A;  2AL6 A;  2G35 A;  5DI9 B;  2I1J A;  4EJN A;  1Z87 A;  5L81 A;  2KCJ A;  2COD A;  1FOE A;  3PZD A;  3O96 A;  1FAO A;  3PP2 A;  1I2H A;  3FEH A;  2VSZ A;  1SGH A;  3ULB A;  5C5B A;  1NU2 A;  2I5F A;  2COF A;  4HAY B;  3TW1 A;  1V5P A;  4HB2 B;  1MIZ B;  5C79 A;  1H10 A;  4ZRJ A;  2YSZ A;  1NTY A;  1MK7 B;  2EMT A;  5DIF B;  3CXB B;  2V76 A;  4BBK A;  4IFS A;  2D9Z A;  2JP2 A;  1ZM0 A;  1X1F A;  5HE1 A;  4KHA A;  2LOX A;  1QQG A;  1X86 A;  1WGQ A;  3WA0 A;  3ML4 A;  3HK0 A;  4F7U P;  1U5E A;  1XR0 B;  5D3X A;  4PNK A;  2MDX A;  5D3W A;  2DTC A;  1ZC4 B;  3KZ1 A;  4MY6 A;  3A8Q A;  4GMX B;  2Z0O A;  4HB3 B;  5KQ1 A;  2W2X D;  2R09 A;  3PVL A;  4H8S A;  4YL8 A;  3SUZ A;  4A6H A;  2RNR B;  4GZU A;  4KHO A;  1ISN A;  1EVH A;  1XOD A;  2K2U A;  2OTX A;  1W1G A;  4YON A;  2UZR A;  1EAZ A;  2DLW A;  2EJ8 A;  3BJI A;  3TCA A;  2H7D A;  3PVU A;  4HAU B;  1N3H A;  3T06 A;  2XQN M;  2L1C A;  5C16 A;  2GJY A;  2D9X A;  2I1K A;  4PQ0 A;  1KZG A;  2X18 A;  2L2I A;  1UEF A;  4CHM A;  3KY9 A;  3VOQ A;  3A98 B;  3G9W A;  1U27 A;  1BTN A;  2CY4 A;  2OQB A;  3LJU X;  1P3R A;  1M7E A;  3FSS A;  2VRW B;  4K2P A;  4F7H A;  2DYN A;  1V89 A;  5D3V A;  5LOP B;  3ZVR A;  1Y5O A;  2DYQ A;  3D8E A;  4A6F A;  1FGZ A;  2DKQ A;  5D3Y A;  2LKO A;  3MDB C;  2RVB B;  2E2X A;  2Y8F A;  1V5M A;  3ODO A;  4HAV B;  5HE2 A;  5CLQ B;  2I5C A;  4KVG B;  4HB4 B;  4A5K A;  1LW3 A;  1MAI A;  4KHB B;  3P6A A;  5LON B;  4P7I A;  4Y94 A;  2Q13 A;  2M38 A;  2D10 A;  1UNP A;  1OQN A;  5J3Y A;  5HE3 A;  1J19 A;  2MFQ A;  5JLJ B;  1XD4 A;  2DN6 A;  4TYZ A;  2BCJ A;  3AU5 A;  1UPR A;  5JP4 A;  1DDW A;  1WVH A;  2ZPY A;  2P0F A;  3FM8 C;  2IFS A;  4DBB A;  2CY5 A;  4Z2N A;  1TXD A;  2CRF A;  5C6R A;  2Z0Q A;  3NSU A;  3U8Z A;  2H7E A;  2J0J A;  4MK0 A;  2YT0 A;  1BWN A;  2HTH B;  1UNR A;  3D8D A;  3M1I B;  4DX8 A;  2MKR A;  4GXB A;  1B55 A;  1DDV A;  1K5G B;  3SO6 A;  3PG7 A;  1TQZ A;  4HAT B;  1X05 A;  2AEH A;  2Z0P A;  1WGU A;  3HW2 B;  1P6S A;  1OY2 A;  2PZ1 A;  4WSF A;  3WYF B;  2J59 M;  4MT7 A;  1J0W A;  2YVC A;  4HB0 B;  2RGN B;  4KAX B;  3OAN A;  1GC6 A;  2J0K A;  1KI1 B;  2GCJ A;  2NZ8 B;  3F0W A;  2ELB A;  1ZC3 B;  2LG1 A;  3DXE A;  2EMS A;  2N0Y A;  2COA A;  2M14 A;  2UVM A;  1NI2 A;  1M7R A;  1Y19 B;  3ZDT A;  4WJ7 A;  1WJM A;  3V5W A;  5FI1 A;  1V88 A;  4IAP A;  2P8V A;  1FGY A;  1AQC A;  2YS3 A;  3UZT A;  2ADZ A;  2YF0 A;  2FJL A;  3CIK A;  1X1G A;  2DHJ A;  3PSC A;  4EMO A;  2LOZ A;  2EC1 A;  4HAX B;  1PFJ A;  4GN1 A;  1RRP B;  2W2W A;  2DA0 A;  1K5D B;  4K17 A;  3P7Z A;  2YT1 A;  5DHA B;  4CYE A;  2KUP A;  3TVV A;  2R0D A;  1FHX A;  2MWN B;  4HDQ A;  4EKU A;  1RJ2 A;  2IYB A;  4WVF B;  3X23 A;  3AU4 A;  3ODX A;  3TFM A;  3IVF A;  1W1D A;  1PLS A;  3AJ4 A;  2ROZ B;  5J3T A;  2P0D A;  3GYP A;  1I7A A;  1MIX A;  3D8F A;  2RUK B;  3KRW A;  2DHI A;  4A6F B;  3QWM A;  4L6E A;  5J3Q A;  2Y7B A;  2RSG A;  3U7D A;  2VKI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...