1V5UA

Solution structure of the c-terminal pleckstrin homology domain of sbf1 from mouse
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
117
structure length
117
Chain Sequence
GSSGSSGRSYEGILYKKGAFMKPWKARWFVLDKTKHQLRYYDHRMDTECKGVIDLAEVEAVAPGTPTIGAPKTVDEKAFFDVKTTRRVYNFCAQDVPSAQQWVDRIQSCLSSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SET binding factor 1
publication title Solution Structure of the C-terminal Pleckstrin Homology Domain of Sbf1 from Mouse
rcsb
source organism Mus musculus
molecule tags Signaling protein
total genus 15
structure length 117
sequence length 117
ec nomenclature
pdb deposition date 2003-11-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00169 PH PH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 1v5uA00
3SV1A 1BWNA 1RJ2A 2RGNB 4HB3B 2YT1A 3TW1A 5EFXA 4GN1A 5J3TA 3WA0A 2I1JA 2GCJA 3RCPA 1DBHA 1UNQA 2D10A 1K5DB 5DHFB 2D9YA 1FGYA 2P0FA 2AL6A 4K2PA 3IVFA 2UZSA 1Q67A 4IFSA 4CHJA 2D4QA 2Y8FA 1WI1A 4L6EA 2M14A 4K17A 1LB1A 4WVFB 2VKIA 3LJUX 2AEHA 2J0KA 3SNHA 2L2IA 2XQNM 4GPTB 4B6HA 4PNKA 4DXAB 2P0HA 1I7AA 3U8ZA 1M7EA 2EMSA 1B55A 5C5BA 5HE1A 1V89A 3PP2A 4HAXB 1AQCA 1XX0A 1LW3A 2ZPYA 4EMOA 2N0YA 3ZVRA 2G35A 1J0WA 3FM8C 2MWNB 1MAIA 3BJIA 2W2WA 5JP4A 1UPRA 1MIXA 1X05A 1UNPA 1U29A 2DHKA 3MPXA 4XWXA 2DFKA 2R0DA 3A98B 2KGXB 4GMXB 2P8VA 5DHAB 3HW2B 5C5BB 3AU4A 1UPQA 3M1IB 3ZDTA 1NTVA 1J19A 5DH9B 2Q13A 3FSSA 1OQNA 1SGHA 2COCA 2ROZB 2DKPA 3X23A 1EVHA 1PMSA 2MFQA 2Y7BA 3SYXA 2GCLA 3D8FA 2D9ZA 3ULCA 3QBVB 4F7GA 2YSZA 1V5UA 3O96A 1PFJA 2J0MA 2I5CA 2OQBA 2RUKB 4A6KA 1QQGA 1V5MA 1V5PA 1DDMA 2COAA 1FHOA 1EGXA 1WJMA 3OANA 2LKOA 1ZSQA 4DX90 2KCJA 3G9WA 1WGQA 3P6AA 2VSZA 5HE0A 1WGUA 2JP2A 2D9XA 3TVVA 2COFA 3A8QA 2I1KA 3F5RA 1PLSA 1MIZB 3FEHA 2CY4A 1GC6A 2D11A 1ZC4B 1N3HA 3QIJA 3NSUA 3U7DA 4D0NB 5HE2A 1BAKA 2BCJA 2MDXA 2Z0PA 1U5FA 1WG7A 1KI1B 2N23A 3D8DA 2IFSA 3KRWA 1TQZA 4IAPA 5HE3A 4F7HA 1FHXA 5JHHA 1TXDA 1OMWA 4K2OA 1U5DA 5C6RA 1Z87A 2DX5A 4HDQA 4IOYX 2DN6A 5L81A 4MY6A 4ZRKA 1SHCA 4EKUA 2ELBA 2GJYA 2IYBA 2R09A 3TCAA 3CXBB 1P6SA 3PG7A 1EAZA 4KHOA 1IRSA 4Y94A 2H7EA 3DXCA 1BTNA 3TFMA 3PVLA 4EJNA 5FI0A 4WJ7A 1FAOA 2Z0QA 2YS5A 2NMBA 1Y5OA 2CODA 4YL8A 5DIFB 1FHWA 3TO1A 4HATB 2P0DA 1P3RA 1W1DA 2H7DA 2PZ1A 4GZUA 1FOEA 3KSYA 1DDWA 4H8SA 1DYNA 4K81A 2DX1A 1Y19B 5D3XA 5D3WA 4TKNA 4TYZA 2J59M 2DKQA 3KY9A 3P7ZA 3DXEA 1BTKA 2RSGA 1MPHA 3PSCA 4HB2B 1FGZA 5C79A 4KHAA 4A6FA 4BBKA 2UVMA 1XODA 3QWMA 3N7CA 1U27A 1GC7A 1I2HA 1UNRA 2DLWA 2RVBB 1H4RA 2DHIA 3KRXA 2Z0OA 2DYQA 2K2UA 4Z2MB 3PVUA 2Y8GA 1RRPB 1NI2A 2UZRA 4ZRJA 4C0AA 2LOXA 1W1HA 5D3YA 1XD4A 5LONB 3BINA 3HK0A 1GG3A 5J3YA 1MK9B 5CLQB 3PEGA 4GXBA 2LULA 3ODXA 5JLJB 1U2BA 2YRYA 4A6FB 4KVGB 1TJ6A 1ZM0A 1ZC3B 2YS3A 2HTHB 1QC6A 5GOWB 1X86A 2D9VA 2D2QA 1FB8A 1X11A 1K5GB 1OY2A 3T06A 2VRWB 4HAWB 4MK0A 2E2XA 4MT7A 3D8EA 1ISNA 2KUPA 3UZTA 5CLLB 2ADZA 2DA0A 2K00A 3PZDA 4HB4B 3V5WA 1AWEA 1KZ7A 4WSFA 3CIKA 3SO6A 3HQCA 1WVHA 1M7RA 1EF1A 2W2XC 2DYNA 2EMTA 5KQ1A 1MKEA 3GYPA 1XKEA 5D3VA 4A6HA 2HE7A 2RNRB 4DBBA 5JHGA 3ODOA 5FI1A 1X1FA 2ROVA 1NTYA 1P5TA 3SUZA 4P7IA 2QKLA 4PQ0A 2DTCA 4HDOA 4HAVB 3ML4A 1NU2A 4NY0A 3PVWA 1DDVA 1UEFA 4HHVA 2DHJA 5C16A 2RLOA 4HAZB 1XR0B 3ODWA 2K2JA 3VIAA 2CRFA 2W2XD 4A5KA 1U5EA 3GYOA 4YONA 2CAYA 2ELAA 4HAYB 3F0WA 3WYFB 5KQ4A 2X18A 2J0JA 1DROA 4HAUB 1V88A 3DXDA 2YT0A 5D27A 3ULBA 3VOQA 2EJ8A 5J3QA 1W1GA 2V76A 2L1CA 5KCVA 5DI9B 2MKRA 1XCGA 2EC1A 1H10A 2GS0A 2YVCA 3KZ1A 2M38A 5LOPB 4DX8A 1V61A 2D9WA 3MDBC 2CY5A 2OTXA 4Z2NA 2LG1A 4KHBB 2QKMA 1X1GA 2YS1A 1WJ1A 3AU5A 1MK7B 4HB0B 1U5GA 1KZGA 2LOZA 4NSWA 4F7UP 1ZVRA 2YF0A 4KAXB 2LYDA 4ZRIA 4GMVA 3AJ4A 2NZ8B 4CYEA 2I5FA 1E5WA 2FJLA 3A8PA 4CHMA
chains in the Genus database with same CATH superfamily
3SV1A 1BWNA 1RJ2A 2RGNB 4HB3B 2YT1A 3TW1A 5EFXA 4GN1A 5J3TA 3WA0A 2I1JA 2GCJA 3RCPA 1DBHA 1UNQA 2D10A 2YT2A 3U12A 1K5DB 5DHFB 2D9YA 1FGYA 2P0FA 2AL6A 4K2PA 4D6WA 3IVFA 2UZSA 1Q67A 4IFSA 4CHJA 4CSQA 2D4QA 2Y8FA 1WI1A 4L6EA 2M14A 4K17A 1LB1A 4WVFB 2VKIA 3LJUX 2AEHA 2J0KA 3SNHA 2L2IA 5I2MA 3A58A 2XQNM 4GPTB 4B6HA 4PNKA 4DXAB 2P0HA 1I7AA 3U8ZA 1M7EA 2R2YA 2EMSA 1B55A 5C5BA 5HE1A 1V89A 3PP2A 4HAXB 1AQCA 4GOUA 1XX0A 1LW3A 2ZPYA 4EMOA 2N0YA 3ZVRA 2G35A 1J0WA 3FM8C 2MWNB 1MAIA 3BJIA 2W2WA 5JP4A 1UPRA 4OT1A 1MIXA 1X05A 1UNPA 1U29A 2DHKA 3MPXA 4XWXA 2DFKA 2R0DA 3A98B 2KGXB 4GMXB 2P8VA 5DHAB 2Z13A 3HW2B 5C5BB 3AU4A 1UPQA 3M1IB 3ZDTA 1NTVA 1J19A 5DH9B 2Q13A 3FSSA 1OQNA 1SGHA 2COCA 2ROZB 2DKPA 3X23A 1EVHA 1PMSA 2MFQA 2Y7BA 3SYXA 2GCLA 3D8FA 2D9ZA 3ULCA 3QBVB 4F7GA 2YSZA 1V5UA 3O96A 1PFJA 2J0MA 2I5CA 2OQBA 2RUKB 4L1RA 4A6KA 1QQGA 1V5MA 1V5PA 1DDMA 2K8EA 2COAA 1FHOA 1EGXA 1WJMA 3OANA 2LKOA 1ZSQA 2Z59A 4DX90 2KCJA 3G9WA 1WGQA 3P6AA 2VSZA 5HE0A 1WGUA 2K49A 2JP2A 2D9XA 3TVVA 2COFA 3A8QA 3HIEA 2I1KA 3F5RA 1PLSA 1MIZB 3FEHA 2CY4A 1GC6A 2D11A 1ZC4B 1N3HA 3QIJA 3NSUA 3U7DA 3DCXA 4D0NB 5HE2A 1BAKA 2BCJA 2MDXA 2Z0PA 1U5FA 1WG7A 3NWAA 1KI1B 2N23A 3D8DA 2IFSA 3KRWA 1TQZA 4IAPA 5HE3A 4F7HA 1FHXA 5LG4B 5JHHA 1TXDA 1OMWA 2KR0A 4K2OA 1U5DA 5C6RA 1Z87A 2DX5A 4HDQA 4IOYX 2DN6A 5L81A 4MY6A 4ZRKA 1SHCA 4EKUA 2ELBA 2GJYA 2IYBA 2R09A 3TCAA 3CXBB 1P6SA 3PG7A 1EAZA 4KHOA 1IRSA 5M4YB 4Y94A 2H7EA 3DXCA 1BTNA 3TFMA 3PVLA 4EJNA 5FI0A 4WJ7A 1FAOA 2KIGA 2Z0QA 2YS5A 2NMBA 1Y5OA 4QJ5B 2CODA 4YL8A 5DIFB 1FHWA 3TO1A 4HATB 2P0DA 1P3RA 1W1DA 2H7DA 2PZ1A 4GZUA 2ZKMX 4QJ4B 4HSIA 1FOEA 3KSYA 1DDWA 4H8SA 1DYNA 4K81A 2DX1A 5IRSA 1Y19B 5D3XA 5D3WA 4TKNA 4TYZA 2J59M 2DKQA 3KY9A 3P7ZA 3DXEA 3FVCA 1BTKA 2RSGA 1MPHA 3PSCA 4HB2B 1FGZA 4QJ3B 5C79A 4KHAA 4A6FA 4BBKA 2UVMA 1XODA 3QWMA 3N7CA 4KHBA 1U27A 1GC7A 1I2HA 4GNKB 1UNRA 2DLWA 3B77A 2RVBB 1H4RA 2DHIA 3KRXA 2Z0OA 2DYQA 2K2UA 4Z2MB 2Z14A 3PVUA 2Y8GA 1RRPB 1NI2A 2UZRA 3NWDA 4ZRJA 4C0AA 2LOXA 1W1HA 5D3YA 1XD4A 5LONB 3BINA 3HK0A 1GG3A 5J3YA 1MK9B 5CLQB 3PEGA 4GXBA 2LULA 3ODXA 5JLJB 1U2BA 2YRYA 4A6FB 4KVGB 1TJ6A 1ZM0A 1ZC3B 2YS3A 2HTHB 1QC6A 5GOWB 1X86A 2D9VA 2GUMA 2D2QA 2KUQA 1FB8A 1X11A 1K5GB 1OY2A 3T06A 2VRWB 4HAWB 4MK0A 2E2XA 4MT7A 3D8EA 1ISNA 2KUPA 3UZTA 5CLLB 2ADZA 2DA0A 2RRFA 2K00A 3PZDA 4HB4B 3V5WA 1AWEA 1KZ7A 4WSFA 3CIKA 3SO6A 3HQCA 1WVHA 1M7RA 1EF1A 2W2XC 2DYNA 2EMTA 5KQ1A 1MKEA 3GYPA 1XKEA 3NW8A 5D3VA 4A6HA 2HE7A 2RNRB 3HSAA 4DBBA 5JHGA 3ODOA 5FI1A 2NBVA 1X1FA 2ROVA 2FJUB 2Z4DA 1NTYA 1P5TA 3SUZA 4P7IA 2QKLA 4PQ0A 2DTCA 4HDOA 4HAVB 3ML4A 1NU2A 1T77A 4NY0A 3PVWA 1DDVA 1UEFA 4HHVA 1ZYIA 2DHJA 5C16A 2RLOA 4HAZB 4DIXA 1XR0B 3ODWA 2K2JA 3VIAA 2CRFA 2W2XD 4A5KA 1U5EA 3GYOA 4YONA 3OHMB 2CAYA 2ELAA 4HAYB 3F0WA 3WYFB 5I2SA 5KQ4A 2X18A 2J0JA 1DROA 4HAUB 1V88A 3DXDA 2YT0A 5D27A 3ULBA 3VOQA 2EJ8A 1MI1A 5J3QA 1W1GA 2V76A 2L1CA 5KCVA 5DI9B 2MKRA 1XCGA 2EC1A 4QXAB 1H10A 2GS0A 2YVCA 3KZ1A 2M38A 5LOPB 4DX8A 1V61A 2D9WA 3MDBC 2CY5A 2OTXA 4Z2NA 2LG1A 4KHBB 2QKMA 1X1GA 2YS1A 2KIEA 1WJ1A 3AU5A 1MK7B 4HB0B 1U5GA 1KZGA 2LOZA 4NSWA 4F7UP 1ZVRA 2YF0A 4KAXB 2LYDA 3NWFA 4ZRIA 4GMVA 3AJ4A 2NZ8B 4CYEA 4OSNA 2I5FA 1E5WA 2FJLA 3A8PA 4CHMA
chains in the Genus database with same CATH topology
3SV1A 1BWNA 1RJ2A 2RGNB 4HB3B 2YT1A 3TW1A 5EFXA 4GN1A 5J3TA 3WA0A 2I1JA 2GCJA 3RCPA 1DBHA 1UNQA 2D10A 1K5DB 5DHFB 2D9YA 1FGYA 2P0FA 2AL6A 4K2PA 3IVFA 2UZSA 1Q67A 4IFSA 4CHJA 2D4QA 2Y8FA 1WI1A 4L6EA 2M14A 4K17A 1LB1A 4WVFB 2VKIA 3LJUX 2AEHA 2J0KA 3SNHA 2L2IA 2XQNM 4GPTB 4B6HA 4PNKA 4DXAB 2P0HA 1I7AA 3U8ZA 1M7EA 2EMSA 1B55A 5C5BA 5HE1A 1V89A 3PP2A 4HAXB 1AQCA 1XX0A 1LW3A 2ZPYA 4EMOA 2N0YA 3ZVRA 2G35A 1J0WA 3FM8C 2MWNB 1MAIA 3BJIA 2W2WA 5JP4A 1UPRA 1MIXA 1X05A 1UNPA 1U29A 2DHKA 3MPXA 4XWXA 2DFKA 2R0DA 3A98B 2KGXB 4GMXB 2P8VA 5DHAB 3HW2B 5C5BB 3AU4A 1UPQA 3M1IB 3ZDTA 1NTVA 1J19A 5DH9B 2Q13A 3FSSA 1OQNA 1SGHA 2COCA 2ROZB 2DKPA 3X23A 1EVHA 1PMSA 2MFQA 2Y7BA 3SYXA 2GCLA 3D8FA 2D9ZA 3ULCA 3QBVB 4F7GA 2YSZA 1V5UA 3O96A 1PFJA 2J0MA 2I5CA 2OQBA 2RUKB 4A6KA 1QQGA 1V5MA 1V5PA 1DDMA 2COAA 1FHOA 1EGXA 1WJMA 3OANA 2LKOA 1ZSQA 4DX90 2KCJA 3G9WA 1WGQA 3P6AA 2VSZA 5HE0A 1WGUA 2JP2A 2D9XA 3TVVA 2COFA 3A8QA 2I1KA 3F5RA 1PLSA 1MIZB 3FEHA 2CY4A 1GC6A 2D11A 1ZC4B 1N3HA 3QIJA 3NSUA 3U7DA 4D0NB 5HE2A 1BAKA 2BCJA 2MDXA 2Z0PA 1U5FA 1WG7A 1KI1B 2N23A 3D8DA 2IFSA 3KRWA 1TQZA 4IAPA 5HE3A 4F7HA 1FHXA 5JHHA 1TXDA 1OMWA 4K2OA 1U5DA 5C6RA 1Z87A 2DX5A 4HDQA 4IOYX 2DN6A 5L81A 4MY6A 4ZRKA 1SHCA 4EKUA 2ELBA 2GJYA 2IYBA 2R09A 3TCAA 3CXBB 1P6SA 3PG7A 1EAZA 4KHOA 1IRSA 4Y94A 2H7EA 3DXCA 1BTNA 3TFMA 3PVLA 4EJNA 5FI0A 4WJ7A 1FAOA 2Z0QA 2YS5A 2NMBA 1Y5OA 2CODA 4YL8A 5DIFB 1FHWA 3TO1A 4HATB 2P0DA 1P3RA 1W1DA 2H7DA 2PZ1A 4GZUA 1FOEA 3KSYA 1DDWA 4H8SA 1DYNA 4K81A 2DX1A 1Y19B 5D3XA 5D3WA 4TKNA 4TYZA 2J59M 2DKQA 3KY9A 3P7ZA 3DXEA 1BTKA 2RSGA 1MPHA 3PSCA 4HB2B 1FGZA 5C79A 4KHAA 4A6FA 4BBKA 2UVMA 1XODA 3QWMA 3N7CA 1U27A 1GC7A 1I2HA 1UNRA 2DLWA 2RVBB 1H4RA 2DHIA 3KRXA 2Z0OA 2DYQA 2K2UA 4Z2MB 3PVUA 2Y8GA 1RRPB 1NI2A 2UZRA 4ZRJA 4C0AA 2LOXA 1W1HA 5D3YA 1XD4A 5LONB 3BINA 3HK0A 1GG3A 5J3YA 1MK9B 5CLQB 3PEGA 4GXBA 2LULA 3ODXA 5JLJB 1U2BA 2YRYA 4A6FB 4KVGB 1TJ6A 1ZM0A 1ZC3B 2YS3A 2HTHB 1QC6A 5GOWB 1X86A 2D9VA 2D2QA 1FB8A 1X11A 1K5GB 1OY2A 3T06A 2VRWB 4HAWB 4MK0A 2E2XA 4MT7A 3D8EA 1ISNA 2KUPA 3UZTA 5CLLB 2ADZA 2DA0A 2K00A 3PZDA 4HB4B 3V5WA 1AWEA 1KZ7A 4WSFA 3CIKA 3SO6A 3HQCA 1WVHA 1M7RA 1EF1A 2W2XC 2DYNA 2EMTA 5KQ1A 1MKEA 3GYPA 1XKEA 5D3VA 4A6HA 2HE7A 2RNRB 4DBBA 5JHGA 3ODOA 5FI1A 1X1FA 2ROVA 1NTYA 1P5TA 3SUZA 4P7IA 2QKLA 4PQ0A 2DTCA 4HDOA 4HAVB 3ML4A 1NU2A 4NY0A 3PVWA 1DDVA 1UEFA 4HHVA 2DHJA 5C16A 2RLOA 4HAZB 1XR0B 3ODWA 2K2JA 3VIAA 2CRFA 2W2XD 4A5KA 1U5EA 3GYOA 4YONA 2CAYA 2ELAA 4HAYB 3F0WA 3WYFB 5KQ4A 2X18A 2J0JA 1DROA 4HAUB 1V88A 3DXDA 2YT0A 5D27A 3ULBA 3VOQA 2EJ8A 5J3QA 1W1GA 2V76A 2L1CA 5KCVA 5DI9B 2MKRA 1XCGA 2EC1A 1H10A 2GS0A 2YVCA 3KZ1A 2M38A 5LOPB 4DX8A 1V61A 2D9WA 3MDBC 2CY5A 2OTXA 4Z2NA 2LG1A 4KHBB 2QKMA 1X1GA 2YS1A 1WJ1A 3AU5A 1MK7B 4HB0B 1U5GA 1KZGA 2LOZA 4NSWA 4F7UP 1ZVRA 2YF0A 4KAXB 2LYDA 4ZRIA 4GMVA 3AJ4A 2NZ8B 4CYEA 2I5FA 1E5WA 2FJLA 3A8PA 4CHMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SV1 A;  1BWN A;  1RJ2 A;  2RGN B;  4HB3 B;  2YT1 A;  3TW1 A;  5EFX A;  4GN1 A;  5J3T A;  3WA0 A;  2I1J A;  2GCJ A;  3RCP A;  1DBH A;  1UNQ A;  2D10 A;  1K5D B;  5DHF B;  2D9Y A;  1FGY A;  2P0F A;  2AL6 A;  4K2P A;  3IVF A;  2UZS A;  1Q67 A;  4IFS A;  4CHJ A;  2D4Q A;  2Y8F A;  1WI1 A;  4L6E A;  2M14 A;  4K17 A;  1LB1 A;  4WVF B;  2VKI A;  3LJU X;  2AEH A;  2J0K A;  3SNH A;  2L2I A;  2XQN M;  4GPT B;  4B6H A;  4PNK A;  4DXA B;  2P0H A;  1I7A A;  3U8Z A;  1M7E A;  2EMS A;  1B55 A;  5C5B A;  5HE1 A;  1V89 A;  3PP2 A;  4HAX B;  1AQC A;  1XX0 A;  1LW3 A;  2ZPY A;  4EMO A;  2N0Y A;  3ZVR A;  2G35 A;  1J0W A;  3FM8 C;  2MWN B;  1MAI A;  3BJI A;  2W2W A;  5JP4 A;  1UPR A;  1MIX A;  1X05 A;  1UNP A;  1U29 A;  2DHK A;  3MPX A;  4XWX A;  2DFK A;  2R0D A;  3A98 B;  2KGX B;  4GMX B;  2P8V A;  5DHA B;  3HW2 B;  5C5B B;  3AU4 A;  1UPQ A;  3M1I B;  3ZDT A;  1NTV A;  1J19 A;  5DH9 B;  2Q13 A;  3FSS A;  1OQN A;  1SGH A;  2COC A;  2ROZ B;  2DKP A;  3X23 A;  1EVH A;  1PMS A;  2MFQ A;  2Y7B A;  3SYX A;  2GCL A;  3D8F A;  2D9Z A;  3ULC A;  3QBV B;  4F7G A;  2YSZ A;  1V5U A;  3O96 A;  1PFJ A;  2J0M A;  2I5C A;  2OQB A;  2RUK B;  4A6K A;  1QQG A;  1V5M A;  1V5P A;  1DDM A;  2COA A;  1FHO A;  1EGX A;  1WJM A;  3OAN A;  2LKO A;  1ZSQ A;  4DX9 0;  2KCJ A;  3G9W A;  1WGQ A;  3P6A A;  2VSZ A;  5HE0 A;  1WGU A;  2JP2 A;  2D9X A;  3TVV A;  2COF A;  3A8Q A;  2I1K A;  3F5R A;  1PLS A;  1MIZ B;  3FEH A;  2CY4 A;  1GC6 A;  2D11 A;  1ZC4 B;  1N3H A;  3QIJ A;  3NSU A;  3U7D A;  4D0N B;  5HE2 A;  1BAK A;  2BCJ A;  2MDX A;  2Z0P A;  1U5F A;  1WG7 A;  1KI1 B;  2N23 A;  3D8D A;  2IFS A;  3KRW A;  1TQZ A;  4IAP A;  5HE3 A;  4F7H A;  1FHX A;  5JHH A;  1TXD A;  1OMW A;  4K2O A;  1U5D A;  5C6R A;  1Z87 A;  2DX5 A;  4HDQ A;  4IOY X;  2DN6 A;  5L81 A;  4MY6 A;  4ZRK A;  1SHC A;  4EKU A;  2ELB A;  2GJY A;  2IYB A;  2R09 A;  3TCA A;  3CXB B;  1P6S A;  3PG7 A;  1EAZ A;  4KHO A;  1IRS A;  4Y94 A;  2H7E A;  3DXC A;  1BTN A;  3TFM A;  3PVL A;  4EJN A;  5FI0 A;  4WJ7 A;  1FAO A;  2Z0Q A;  2YS5 A;  2NMB A;  1Y5O A;  2COD A;  4YL8 A;  5DIF B;  1FHW A;  3TO1 A;  4HAT B;  2P0D A;  1P3R A;  1W1D A;  2H7D A;  2PZ1 A;  4GZU A;  1FOE A;  3KSY A;  1DDW A;  4H8S A;  1DYN A;  4K81 A;  2DX1 A;  1Y19 B;  5D3X A;  5D3W A;  4TKN A;  4TYZ A;  2J59 M;  2DKQ A;  3KY9 A;  3P7Z A;  3DXE A;  1BTK A;  2RSG A;  1MPH A;  3PSC A;  4HB2 B;  1FGZ A;  5C79 A;  4KHA A;  4A6F A;  4BBK A;  2UVM A;  1XOD A;  3QWM A;  3N7C A;  1U27 A;  1GC7 A;  1I2H A;  1UNR A;  2DLW A;  2RVB B;  1H4R A;  2DHI A;  3KRX A;  2Z0O A;  2DYQ A;  2K2U A;  4Z2M B;  3PVU A;  2Y8G A;  1RRP B;  1NI2 A;  2UZR A;  4ZRJ A;  4C0A A;  2LOX A;  1W1H A;  5D3Y A;  1XD4 A;  5LON B;  3BIN A;  3HK0 A;  1GG3 A;  5J3Y A;  1MK9 B;  5CLQ B;  3PEG A;  4GXB A;  2LUL A;  3ODX A;  5JLJ B;  1U2B A;  2YRY A;  4A6F B;  4KVG B;  1TJ6 A;  1ZM0 A;  1ZC3 B;  2YS3 A;  2HTH B;  1QC6 A;  5GOW B;  1X86 A;  2D9V A;  2D2Q A;  1FB8 A;  1X11 A;  1K5G B;  1OY2 A;  3T06 A;  2VRW B;  4HAW B;  4MK0 A;  2E2X A;  4MT7 A;  3D8E A;  1ISN A;  2KUP A;  3UZT A;  5CLL B;  2ADZ A;  2DA0 A;  2K00 A;  3PZD A;  4HB4 B;  3V5W A;  1AWE A;  1KZ7 A;  4WSF A;  3CIK A;  3SO6 A;  3HQC A;  1WVH A;  1M7R A;  1EF1 A;  2W2X C;  2DYN A;  2EMT A;  5KQ1 A;  1MKE A;  3GYP A;  1XKE A;  5D3V A;  4A6H A;  2HE7 A;  2RNR B;  4DBB A;  5JHG A;  3ODO A;  5FI1 A;  1X1F A;  2ROV A;  1NTY A;  1P5T A;  3SUZ A;  4P7I A;  2QKL A;  4PQ0 A;  2DTC A;  4HDO A;  4HAV B;  3ML4 A;  1NU2 A;  4NY0 A;  3PVW A;  1DDV A;  1UEF A;  4HHV A;  2DHJ A;  5C16 A;  2RLO A;  4HAZ B;  1XR0 B;  3ODW A;  2K2J A;  3VIA A;  2CRF A;  2W2X D;  4A5K A;  1U5E A;  3GYO A;  4YON A;  2CAY A;  2ELA A;  4HAY B;  3F0W A;  3WYF B;  5KQ4 A;  2X18 A;  2J0J A;  1DRO A;  4HAU B;  1V88 A;  3DXD A;  2YT0 A;  5D27 A;  3ULB A;  3VOQ A;  2EJ8 A;  5J3Q A;  1W1G A;  2V76 A;  2L1C A;  5KCV A;  5DI9 B;  2MKR A;  1XCG A;  2EC1 A;  1H10 A;  2GS0 A;  2YVC A;  3KZ1 A;  2M38 A;  5LOP B;  4DX8 A;  1V61 A;  2D9W A;  3MDB C;  2CY5 A;  2OTX A;  4Z2N A;  2LG1 A;  4KHB B;  2QKM A;  1X1G A;  2YS1 A;  1WJ1 A;  3AU5 A;  1MK7 B;  4HB0 B;  1U5G A;  1KZG A;  2LOZ A;  4NSW A;  4F7U P;  1ZVR A;  2YF0 A;  4KAX B;  2LYD A;  4ZRI A;  4GMV A;  3AJ4 A;  2NZ8 B;  4CYE A;  2I5F A;  1E5W A;  2FJL A;  3A8P A;  4CHM A; 
#chains in the Genus database with same CATH topology
 3SV1 A;  1BWN A;  1RJ2 A;  2RGN B;  4HB3 B;  2YT1 A;  3TW1 A;  5EFX A;  4GN1 A;  5J3T A;  3WA0 A;  2I1J A;  2GCJ A;  3RCP A;  1DBH A;  1UNQ A;  2D10 A;  2YT2 A;  3U12 A;  1K5D B;  5DHF B;  2D9Y A;  1FGY A;  2P0F A;  2AL6 A;  4K2P A;  4D6W A;  3IVF A;  2UZS A;  1Q67 A;  4IFS A;  4CHJ A;  4CSQ A;  2D4Q A;  2Y8F A;  1WI1 A;  4L6E A;  2M14 A;  4K17 A;  1LB1 A;  4WVF B;  2VKI A;  3LJU X;  2AEH A;  2J0K A;  3SNH A;  2L2I A;  5I2M A;  3A58 A;  2XQN M;  4GPT B;  4B6H A;  4PNK A;  4DXA B;  2P0H A;  1I7A A;  3U8Z A;  1M7E A;  2R2Y A;  2EMS A;  1B55 A;  5C5B A;  5HE1 A;  1V89 A;  3PP2 A;  4HAX B;  1AQC A;  4GOU A;  1XX0 A;  1LW3 A;  2ZPY A;  4EMO A;  2N0Y A;  3ZVR A;  2G35 A;  1J0W A;  3FM8 C;  2MWN B;  1MAI A;  3BJI A;  2W2W A;  5JP4 A;  1UPR A;  4OT1 A;  1MIX A;  1X05 A;  1UNP A;  1U29 A;  2DHK A;  3MPX A;  4XWX A;  2DFK A;  2R0D A;  3A98 B;  2KGX B;  4GMX B;  2P8V A;  5DHA B;  2Z13 A;  3HW2 B;  5C5B B;  3AU4 A;  1UPQ A;  3M1I B;  3ZDT A;  1NTV A;  1J19 A;  5DH9 B;  2Q13 A;  3FSS A;  1OQN A;  1SGH A;  2COC A;  2ROZ B;  2DKP A;  3X23 A;  1EVH A;  1PMS A;  2MFQ A;  2Y7B A;  3SYX A;  2GCL A;  3D8F A;  2D9Z A;  3ULC A;  3QBV B;  4F7G A;  2YSZ A;  1V5U A;  3O96 A;  1PFJ A;  2J0M A;  2I5C A;  2OQB A;  2RUK B;  4L1R A;  4A6K A;  1QQG A;  1V5M A;  1V5P A;  1DDM A;  2K8E A;  2COA A;  1FHO A;  1EGX A;  1WJM A;  3OAN A;  2LKO A;  1ZSQ A;  2Z59 A;  4DX9 0;  2KCJ A;  3G9W A;  1WGQ A;  3P6A A;  2VSZ A;  5HE0 A;  1WGU A;  2K49 A;  2JP2 A;  2D9X A;  3TVV A;  2COF A;  3A8Q A;  3HIE A;  2I1K A;  3F5R A;  1PLS A;  1MIZ B;  3FEH A;  2CY4 A;  1GC6 A;  2D11 A;  1ZC4 B;  1N3H A;  3QIJ A;  3NSU A;  3U7D A;  3DCX A;  4D0N B;  5HE2 A;  1BAK A;  2BCJ A;  2MDX A;  2Z0P A;  1U5F A;  1WG7 A;  3NWA A;  1KI1 B;  2N23 A;  3D8D A;  2IFS A;  3KRW A;  1TQZ A;  4IAP A;  5HE3 A;  4F7H A;  1FHX A;  5LG4 B;  5JHH A;  1TXD A;  1OMW A;  2KR0 A;  4K2O A;  1U5D A;  5C6R A;  1Z87 A;  2DX5 A;  4HDQ A;  4IOY X;  2DN6 A;  5L81 A;  4MY6 A;  4ZRK A;  1SHC A;  4EKU A;  2ELB A;  2GJY A;  2IYB A;  2R09 A;  3TCA A;  3CXB B;  1P6S A;  3PG7 A;  1EAZ A;  4KHO A;  1IRS A;  5M4Y B;  4Y94 A;  2H7E A;  3DXC A;  1BTN A;  3TFM A;  3PVL A;  4EJN A;  5FI0 A;  4WJ7 A;  1FAO A;  2KIG A;  2Z0Q A;  2YS5 A;  2NMB A;  1Y5O A;  4QJ5 B;  2COD A;  4YL8 A;  5DIF B;  1FHW A;  3TO1 A;  4HAT B;  2P0D A;  1P3R A;  1W1D A;  2H7D A;  2PZ1 A;  4GZU A;  2ZKM X;  4QJ4 B;  4HSI A;  1FOE A;  3KSY A;  1DDW A;  4H8S A;  1DYN A;  4K81 A;  2DX1 A;  5IRS A;  1Y19 B;  5D3X A;  5D3W A;  4TKN A;  4TYZ A;  2J59 M;  2DKQ A;  3KY9 A;  3P7Z A;  3DXE A;  3FVC A;  1BTK A;  2RSG A;  1MPH A;  3PSC A;  4HB2 B;  1FGZ A;  4QJ3 B;  5C79 A;  4KHA A;  4A6F A;  4BBK A;  2UVM A;  1XOD A;  3QWM A;  3N7C A;  4KHB A;  1U27 A;  1GC7 A;  1I2H A;  4GNK B;  1UNR A;  2DLW A;  3B77 A;  2RVB B;  1H4R A;  2DHI A;  3KRX A;  2Z0O A;  2DYQ A;  2K2U A;  4Z2M B;  2Z14 A;  3PVU A;  2Y8G A;  1RRP B;  1NI2 A;  2UZR A;  3NWD A;  4ZRJ A;  4C0A A;  2LOX A;  1W1H A;  5D3Y A;  1XD4 A;  5LON B;  3BIN A;  3HK0 A;  1GG3 A;  5J3Y A;  1MK9 B;  5CLQ B;  3PEG A;  4GXB A;  2LUL A;  3ODX A;  5JLJ B;  1U2B A;  2YRY A;  4A6F B;  4KVG B;  1TJ6 A;  1ZM0 A;  1ZC3 B;  2YS3 A;  2HTH B;  1QC6 A;  5GOW B;  1X86 A;  2D9V A;  2GUM A;  2D2Q A;  2KUQ A;  1FB8 A;  1X11 A;  1K5G B;  1OY2 A;  3T06 A;  2VRW B;  4HAW B;  4MK0 A;  2E2X A;  4MT7 A;  3D8E A;  1ISN A;  2KUP A;  3UZT A;  5CLL B;  2ADZ A;  2DA0 A;  2RRF A;  2K00 A;  3PZD A;  4HB4 B;  3V5W A;  1AWE A;  1KZ7 A;  4WSF A;  3CIK A;  3SO6 A;  3HQC A;  1WVH A;  1M7R A;  1EF1 A;  2W2X C;  2DYN A;  2EMT A;  5KQ1 A;  1MKE A;  3GYP A;  1XKE A;  3NW8 A;  5D3V A;  4A6H A;  2HE7 A;  2RNR B;  3HSA A;  4DBB A;  5JHG A;  3ODO A;  5FI1 A;  2NBV A;  1X1F A;  2ROV A;  2FJU B;  2Z4D A;  1NTY A;  1P5T A;  3SUZ A;  4P7I A;  2QKL A;  4PQ0 A;  2DTC A;  4HDO A;  4HAV B;  3ML4 A;  1NU2 A;  1T77 A;  4NY0 A;  3PVW A;  1DDV A;  1UEF A;  4HHV A;  1ZYI A;  2DHJ A;  5C16 A;  2RLO A;  4HAZ B;  4DIX A;  1XR0 B;  3ODW A;  2K2J A;  3VIA A;  2CRF A;  2W2X D;  4A5K A;  1U5E A;  3GYO A;  4YON A;  3OHM B;  2CAY A;  2ELA A;  4HAY B;  3F0W A;  3WYF B;  5I2S A;  5KQ4 A;  2X18 A;  2J0J A;  1DRO A;  4HAU B;  1V88 A;  3DXD A;  2YT0 A;  5D27 A;  3ULB A;  3VOQ A;  2EJ8 A;  1MI1 A;  5J3Q A;  1W1G A;  2V76 A;  2L1C A;  5KCV A;  5DI9 B;  2MKR A;  1XCG A;  2EC1 A;  4QXA B;  1H10 A;  2GS0 A;  2YVC A;  3KZ1 A;  2M38 A;  5LOP B;  4DX8 A;  1V61 A;  2D9W A;  3MDB C;  2CY5 A;  2OTX A;  4Z2N A;  2LG1 A;  4KHB B;  2QKM A;  1X1G A;  2YS1 A;  2KIE A;  1WJ1 A;  3AU5 A;  1MK7 B;  4HB0 B;  1U5G A;  1KZG A;  2LOZ A;  4NSW A;  4F7U P;  1ZVR A;  2YF0 A;  4KAX B;  2LYD A;  3NWF A;  4ZRI A;  4GMV A;  3AJ4 A;  2NZ8 B;  4CYE A;  4OSN A;  2I5F A;  1E5W A;  2FJL A;  3A8P A;  4CHM A; 
#chains in the Genus database with same CATH homology
 3SV1 A;  1BWN A;  1RJ2 A;  2RGN B;  4HB3 B;  2YT1 A;  3TW1 A;  5EFX A;  4GN1 A;  5J3T A;  3WA0 A;  2I1J A;  2GCJ A;  3RCP A;  1DBH A;  1UNQ A;  2D10 A;  1K5D B;  5DHF B;  2D9Y A;  1FGY A;  2P0F A;  2AL6 A;  4K2P A;  3IVF A;  2UZS A;  1Q67 A;  4IFS A;  4CHJ A;  2D4Q A;  2Y8F A;  1WI1 A;  4L6E A;  2M14 A;  4K17 A;  1LB1 A;  4WVF B;  2VKI A;  3LJU X;  2AEH A;  2J0K A;  3SNH A;  2L2I A;  2XQN M;  4GPT B;  4B6H A;  4PNK A;  4DXA B;  2P0H A;  1I7A A;  3U8Z A;  1M7E A;  2EMS A;  1B55 A;  5C5B A;  5HE1 A;  1V89 A;  3PP2 A;  4HAX B;  1AQC A;  1XX0 A;  1LW3 A;  2ZPY A;  4EMO A;  2N0Y A;  3ZVR A;  2G35 A;  1J0W A;  3FM8 C;  2MWN B;  1MAI A;  3BJI A;  2W2W A;  5JP4 A;  1UPR A;  1MIX A;  1X05 A;  1UNP A;  1U29 A;  2DHK A;  3MPX A;  4XWX A;  2DFK A;  2R0D A;  3A98 B;  2KGX B;  4GMX B;  2P8V A;  5DHA B;  3HW2 B;  5C5B B;  3AU4 A;  1UPQ A;  3M1I B;  3ZDT A;  1NTV A;  1J19 A;  5DH9 B;  2Q13 A;  3FSS A;  1OQN A;  1SGH A;  2COC A;  2ROZ B;  2DKP A;  3X23 A;  1EVH A;  1PMS A;  2MFQ A;  2Y7B A;  3SYX A;  2GCL A;  3D8F A;  2D9Z A;  3ULC A;  3QBV B;  4F7G A;  2YSZ A;  1V5U A;  3O96 A;  1PFJ A;  2J0M A;  2I5C A;  2OQB A;  2RUK B;  4A6K A;  1QQG A;  1V5M A;  1V5P A;  1DDM A;  2COA A;  1FHO A;  1EGX A;  1WJM A;  3OAN A;  2LKO A;  1ZSQ A;  4DX9 0;  2KCJ A;  3G9W A;  1WGQ A;  3P6A A;  2VSZ A;  5HE0 A;  1WGU A;  2JP2 A;  2D9X A;  3TVV A;  2COF A;  3A8Q A;  2I1K A;  3F5R A;  1PLS A;  1MIZ B;  3FEH A;  2CY4 A;  1GC6 A;  2D11 A;  1ZC4 B;  1N3H A;  3QIJ A;  3NSU A;  3U7D A;  4D0N B;  5HE2 A;  1BAK A;  2BCJ A;  2MDX A;  2Z0P A;  1U5F A;  1WG7 A;  1KI1 B;  2N23 A;  3D8D A;  2IFS A;  3KRW A;  1TQZ A;  4IAP A;  5HE3 A;  4F7H A;  1FHX A;  5JHH A;  1TXD A;  1OMW A;  4K2O A;  1U5D A;  5C6R A;  1Z87 A;  2DX5 A;  4HDQ A;  4IOY X;  2DN6 A;  5L81 A;  4MY6 A;  4ZRK A;  1SHC A;  4EKU A;  2ELB A;  2GJY A;  2IYB A;  2R09 A;  3TCA A;  3CXB B;  1P6S A;  3PG7 A;  1EAZ A;  4KHO A;  1IRS A;  4Y94 A;  2H7E A;  3DXC A;  1BTN A;  3TFM A;  3PVL A;  4EJN A;  5FI0 A;  4WJ7 A;  1FAO A;  2Z0Q A;  2YS5 A;  2NMB A;  1Y5O A;  2COD A;  4YL8 A;  5DIF B;  1FHW A;  3TO1 A;  4HAT B;  2P0D A;  1P3R A;  1W1D A;  2H7D A;  2PZ1 A;  4GZU A;  1FOE A;  3KSY A;  1DDW A;  4H8S A;  1DYN A;  4K81 A;  2DX1 A;  1Y19 B;  5D3X A;  5D3W A;  4TKN A;  4TYZ A;  2J59 M;  2DKQ A;  3KY9 A;  3P7Z A;  3DXE A;  1BTK A;  2RSG A;  1MPH A;  3PSC A;  4HB2 B;  1FGZ A;  5C79 A;  4KHA A;  4A6F A;  4BBK A;  2UVM A;  1XOD A;  3QWM A;  3N7C A;  1U27 A;  1GC7 A;  1I2H A;  1UNR A;  2DLW A;  2RVB B;  1H4R A;  2DHI A;  3KRX A;  2Z0O A;  2DYQ A;  2K2U A;  4Z2M B;  3PVU A;  2Y8G A;  1RRP B;  1NI2 A;  2UZR A;  4ZRJ A;  4C0A A;  2LOX A;  1W1H A;  5D3Y A;  1XD4 A;  5LON B;  3BIN A;  3HK0 A;  1GG3 A;  5J3Y A;  1MK9 B;  5CLQ B;  3PEG A;  4GXB A;  2LUL A;  3ODX A;  5JLJ B;  1U2B A;  2YRY A;  4A6F B;  4KVG B;  1TJ6 A;  1ZM0 A;  1ZC3 B;  2YS3 A;  2HTH B;  1QC6 A;  5GOW B;  1X86 A;  2D9V A;  2D2Q A;  1FB8 A;  1X11 A;  1K5G B;  1OY2 A;  3T06 A;  2VRW B;  4HAW B;  4MK0 A;  2E2X A;  4MT7 A;  3D8E A;  1ISN A;  2KUP A;  3UZT A;  5CLL B;  2ADZ A;  2DA0 A;  2K00 A;  3PZD A;  4HB4 B;  3V5W A;  1AWE A;  1KZ7 A;  4WSF A;  3CIK A;  3SO6 A;  3HQC A;  1WVH A;  1M7R A;  1EF1 A;  2W2X C;  2DYN A;  2EMT A;  5KQ1 A;  1MKE A;  3GYP A;  1XKE A;  5D3V A;  4A6H A;  2HE7 A;  2RNR B;  4DBB A;  5JHG A;  3ODO A;  5FI1 A;  1X1F A;  2ROV A;  1NTY A;  1P5T A;  3SUZ A;  4P7I A;  2QKL A;  4PQ0 A;  2DTC A;  4HDO A;  4HAV B;  3ML4 A;  1NU2 A;  4NY0 A;  3PVW A;  1DDV A;  1UEF A;  4HHV A;  2DHJ A;  5C16 A;  2RLO A;  4HAZ B;  1XR0 B;  3ODW A;  2K2J A;  3VIA A;  2CRF A;  2W2X D;  4A5K A;  1U5E A;  3GYO A;  4YON A;  2CAY A;  2ELA A;  4HAY B;  3F0W A;  3WYF B;  5KQ4 A;  2X18 A;  2J0J A;  1DRO A;  4HAU B;  1V88 A;  3DXD A;  2YT0 A;  5D27 A;  3ULB A;  3VOQ A;  2EJ8 A;  5J3Q A;  1W1G A;  2V76 A;  2L1C A;  5KCV A;  5DI9 B;  2MKR A;  1XCG A;  2EC1 A;  1H10 A;  2GS0 A;  2YVC A;  3KZ1 A;  2M38 A;  5LOP B;  4DX8 A;  1V61 A;  2D9W A;  3MDB C;  2CY5 A;  2OTX A;  4Z2N A;  2LG1 A;  4KHB B;  2QKM A;  1X1G A;  2YS1 A;  1WJ1 A;  3AU5 A;  1MK7 B;  4HB0 B;  1U5G A;  1KZG A;  2LOZ A;  4NSW A;  4F7U P;  1ZVR A;  2YF0 A;  4KAX B;  2LYD A;  4ZRI A;  4GMV A;  3AJ4 A;  2NZ8 B;  4CYE A;  2I5F A;  1E5W A;  2FJL A;  3A8P A;  4CHM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...