1V5UA

Solution structure of the c-terminal pleckstrin homology domain of sbf1 from mouse
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
117
structure length
117
Chain Sequence
GSSGSSGRSYEGILYKKGAFMKPWKARWFVLDKTKHQLRYYDHRMDTECKGVIDLAEVEAVAPGTPTIGAPKTVDEKAFFDVKTTRRVYNFCAQDVPSAQQWVDRIQSCLSSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution Structure of the C-terminal Pleckstrin Homology Domain of Sbf1 from Mouse
rcsb
source organism Mus musculus
molecule tags Signaling protein
molecule keywords SET binding factor 1
total genus 15
structure length 117
sequence length 117
ec nomenclature
pdb deposition date 2003-11-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00169 PH PH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 1v5uA00
5CLQB 4A6FB 1E5WA 1ISNA 1X1GA 5FI1A 2Z0PA 3SNHA 4IFSA 5JHGA 2DHIA 1M7EA 3U8ZA 4F7GA 2DN6A 3F0WA 3U7DA 2ELBA 4KVGB 4DXAB 2XQNM 3QIJA 1ZC3B 2ROVA 2DYQA 4H8SA 2Y8FA 2ZPYA 3LJUX 3PZDA 5J3YA 1IRSA 2COCA 1UNQA 2VKIA 1PLSA 3TFMA 2J0JA 4HB3B 5HE3A 1BTKA 4A6FA 4HAZB 1N3HA 1MK7B 1H4RA 1AWEA 3PVLA 4GMVA 4DX90 2OQBA 4L6EA 4WSFA 4ZRJA 2DYNA 4HAUB 2DX1A 4PQ0A 4IAPA 2R0DA 2UZSA 1EF1A 1NI2A 2J0KA 1XCGA 1RJ2A 2I1JA 2YS3A 4HB2B 3TW1A 3O96A 1W1HA 2UVMA 2N23A 2K00A 5DIFB 5EFXA 4IOYX 1WVHA 3DXDA 2K2UA 4P7IA 1OY2A 2P0HA 3KRWA 4K2OA 1GC7A 2P8VA 2YVCA 3ZVRA 3AU4A 2VSZA 5FI0A 3GYOA 1WI1A 2LKOA 1J0WA 4HAYB 2D9XA 4EMOA 5C6RA 5D27A 4A6HA 4DBBA 1NU2A 2ADZA 2GS0A 3X23A 4HATB 2GCJA 3PSCA 3D8DA 1UNRA 1DBHA 4WJ7A 2W2XC 5D3XA 1QQGA 2FJLA 3T06A 5DHFB 5JLJB 3WYFB 2CY4A 3DXEA 2DHKA 3N7CA 4XWXA 3ZDTA 1EAZA 1FHXA 1UEFA 1V5MA 1KZGA 2M38A 3BJIA 2CODA 2DX5A 1BAKA 4A6KA 3MPXA 3PEGA 5LOPB 1MAIA 2KCJA 4GZUA 1OMWA 3SYXA 2E2XA 1MK9B 2ELAA 2MFQA 5C16A 1NTVA 1K5DB 2YT1A 1U5GA 5HE2A 4K81A 1DROA 2EC1A 4MY6A 2D11A 4HB0B 2IFSA 3VOQA 4C0AA 2HE7A 4HDQA 2LOXA 2NMBA 1EVHA 2OTXA 2R09A 3PP2A 1V61A 4Y94A 1Z87A 3PVWA 5D3VA 3AJ4A 4GMXB 4GN1A 4HDOA 3A8QA 1BWNA 4HAVB 3HQCA 3ODWA 4HAXB 3IVFA 4KHAA 1KI1B 3HW2B 1Y5OA 2Z0OA 3AU5A 1WGUA 2CAYA 2DKQA 3KZ1A 1TJ6A 3A8PA 2LULA 1XKEA 2M14A 1J19A 5CLLB 1UNPA 1WJ1A 2H7EA 1ZM0A 2COFA 1M7RA 2CRFA 1FGZA 2V76A 3ULCA 1AQCA 1P5TA 1XR0B 1DDMA 3GYPA 2AL6A 5DI9B 3SO6A 1NTYA 1GG3A 5JP4A 2QKLA 2IYBA 2P0FA 1EGXA 2I1KA 2EMSA 1U29A 3CIKA 1UPRA 2COAA 3FEHA 1WGQA 2ROZB 4Z2NA 2L2IA 3ULBA 1DDWA 3HK0A 1FB8A 2KGXB 4A5KA 4F7HA 2P0DA 1U5EA 2DA0A 1DYNA 5GOWB 2L1CA 4Z2MB 3TO1A 2DTCA 3SV1A 1XX0A 4EKUA 4CHMA 2NZ8B 4HAWB 2H7DA 4GPTB 3WA0A 3G9WA 3RCPA 1PMSA 3P7ZA 2RGNB 2UZRA 1LB1A 2DHJA 4HHVA 4PNKA 3KRXA 5J3QA 5D3WA 5KQ4A 2J0MA 3PVUA 2Y7BA 1P6SA 1I2HA 2K2JA 4DX8A 1U5DA 5KQ1A 2YF0A 4KHOA 4NY0A 4D0NB 1WJMA 3TCAA 2EMTA 3V5WA 2KUPA 1X11A 2GJYA 3BINA 2W2XD 3ODXA 5JHHA 2DFKA 2RUKB 2MWNB 4BBKA 2I5FA 2YT0A 2RSGA 1DDVA 3ODOA 4CHJA 3CXBB 1QC6A 2W2WA 2HTHB 3QBVB 2MDXA 2D2QA 5DH9B 2Z0QA 3NSUA 1V89A 2D9VA 4YONA 5KCVA 1TXDA 3A98B 4ZRIA 2X18A 1ZVRA 4GXBA 1UPQA 1K5GB 4B6HA 1SGHA 3P6AA 2G35A 2QKMA 1SHCA 4KHBB 1XD4A 3FM8C 1Q67A 1W1DA 4TYZA 2JP2A 5C79A 3UZTA 2YSZA 1BTNA 4MK0A 5LONB 1U2BA 1FHOA 3D8EA 2LOZA 2DKPA 2EJ8A 4ZRKA 1MKEA 2D10A 1X1FA 2AEHA 2GCLA 2YS1A 1FAOA 4WVFB 5HE0A 1H10A 1TQZA 2RVBB 3OANA 1KZ7A 4YL8A 1MPHA 1U27A 2N0YA 5L81A 4TKNA 2YS5A 1W1GA 5C5BA 1LW3A 1V5PA 1PFJA 1V5UA 4F7UP 2CY5A 2Y8GA 4KAXB 4K17A 2MKRA 1OQNA 1P3RA 1GC6A 1MIZB 2Q13A 2DLWA 3KY9A 1ZSQA 3ML4A 5D3YA 1Y19B 1MIXA 1XODA 5J3TA 3M1IB 3FSSA 2D9ZA 2PZ1A 1WG7A 2BCJA 2D9WA 1B55A 3D8FA 5HE1A 1X05A 4NSWA 3MDBC 2D9YA 3SUZA 2D4QA 4CYEA 2I5CA 3TVVA 1I7AA 5C5BB 3QWMA 4MT7A 2YRYA 1RRPB 3KSYA 3F5RA 2LG1A 1V88A 1FHWA 2LYDA 4HB4B 1ZC4B 1FGYA 3PG7A 2J59M 1FOEA 1U5FA 2VRWB 4K2PA 1X86A 5DHAB 4EJNA 3DXCA 2RLOA 2RNRB 3VIAA
chains in the Genus database with same CATH superfamily
5CLQB 4A6FB 1E5WA 1ISNA 1X1GA 5FI1A 2Z0PA 3SNHA 4IFSA 5JHGA 2DHIA 3B77A 1M7EA 3U8ZA 4F7GA 2DN6A 3F0WA 3U7DA 5I2SA 2ELBA 3FVCA 4KVGB 4DXAB 2XQNM 3QIJA 1ZYIA 1ZC3B 2ROVA 3U12A 2DYQA 4H8SA 3HIEA 2Y8FA 2ZPYA 3LJUX 3PZDA 5J3YA 1IRSA 2COCA 1UNQA 2VKIA 1PLSA 3TFMA 2J0JA 4HB3B 2YT2A 5HE3A 1BTKA 2KIGA 4A6FA 4HAZB 4CSQA 1N3HA 1MK7B 1H4RA 1AWEA 3PVLA 4GMVA 4DX90 2OQBA 4L6EA 4WSFA 4ZRJA 2DYNA 4HAUB 2DX1A 4PQ0A 4IAPA 2R0DA 2UZSA 1EF1A 1NI2A 2J0KA 1XCGA 1RJ2A 2I1JA 2KR0A 2YS3A 4QJ3B 4HB2B 3TW1A 3NWDA 3O96A 1W1HA 2UVMA 2N23A 2K00A 5DIFB 5EFXA 4IOYX 1WVHA 3DXDA 2K2UA 4P7IA 3OHMB 1OY2A 2P0HA 3KRWA 4K2OA 1GC7A 2P8VA 2YVCA 3ZVRA 3AU4A 2VSZA 5FI0A 3GYOA 1WI1A 2LKOA 1J0WA 4HAYB 2D9XA 4EMOA 5C6RA 5D27A 4A6HA 4DBBA 1NU2A 2ADZA 2GS0A 3X23A 4HATB 2GCJA 3PSCA 3D8DA 1UNRA 1DBHA 4WJ7A 2KUQA 4QJ5B 2W2XC 5D3XA 1QQGA 2FJLA 3T06A 5DHFB 5JLJB 3WYFB 2CY4A 3DXEA 2DHKA 3N7CA 2R2YA 4XWXA 3ZDTA 1EAZA 1FHXA 1UEFA 1V5MA 1KZGA 2Z4DA 2M38A 3BJIA 2CODA 2DX5A 1BAKA 4A6KA 3MPXA 3PEGA 5LOPB 1MAIA 2KCJA 4GZUA 1OMWA 3SYXA 2E2XA 1MK9B 2ELAA 2MFQA 5C16A 1NTVA 1K5DB 2YT1A 1U5GA 5HE2A 4K81A 1DROA 2EC1A 4MY6A 2D11A 4HB0B 2FJUB 2IFSA 3VOQA 4C0AA 2HE7A 4HDQA 2LOXA 2NMBA 1EVHA 2OTXA 2R09A 3PP2A 1V61A 4Y94A 4GOUA 1Z87A 3PVWA 1T77A 5D3VA 3AJ4A 4GMXB 4GN1A 4HDOA 3A8QA 1BWNA 4HAVB 3HQCA 4HSIA 3ODWA 4HAXB 3IVFA 4KHAA 1KI1B 3HW2B 1Y5OA 2Z0OA 3AU5A 1WGUA 2CAYA 2DKQA 3KZ1A 1TJ6A 3A8PA 2LULA 1XKEA 2M14A 1J19A 5CLLB 1UNPA 1WJ1A 2H7EA 1ZM0A 2COFA 1M7RA 2CRFA 1FGZA 2V76A 3ULCA 1AQCA 1P5TA 1XR0B 1DDMA 3GYPA 2AL6A 5DI9B 3SO6A 1NTYA 1GG3A 5JP4A 2QKLA 2IYBA 2P0FA 1EGXA 2I1KA 2EMSA 4D6WA 1U29A 3CIKA 1UPRA 3DCXA 2COAA 2Z13A 3FEHA 1WGQA 2ROZB 4Z2NA 2L2IA 2K8EA 3ULBA 1DDWA 3HK0A 1FB8A 2KGXB 4A5KA 4F7HA 2P0DA 1U5EA 2DA0A 1DYNA 5GOWB 2L1CA 4Z2MB 3TO1A 2DTCA 3SV1A 1XX0A 4EKUA 4CHMA 2NZ8B 3A58A 2H7DA 4HAWB 4GPTB 3WA0A 3G9WA 4OT1A 3RCPA 1PMSA 3P7ZA 2RGNB 2K49A 2UZRA 1LB1A 2DHJA 5LG4B 4HHVA 4PNKA 3KRXA 5J3QA 5D3WA 5KQ4A 2J0MA 3PVUA 2Y7BA 1P6SA 1I2HA 2K2JA 2Z14A 4DX8A 1U5DA 5KQ1A 2YF0A 3NWFA 5IRSA 4KHOA 4NY0A 4D0NB 1WJMA 3TCAA 2EMTA 3V5WA 2KUPA 1X11A 2GJYA 3BINA 2W2XD 3ODXA 3NWAA 5JHHA 2DFKA 2RUKB 2MWNB 4BBKA 2I5FA 2YT0A 2RSGA 1DDVA 3ODOA 4CHJA 3CXBB 1QC6A 5M4YB 2W2WA 2HTHB 3QBVB 2MDXA 2D2QA 1MI1A 5DH9B 2Z0QA 3NSUA 3NW8A 1V89A 2D9VA 4YONA 5KCVA 1TXDA 3A98B 4ZRIA 2X18A 2ZKMX 1ZVRA 4GXBA 1UPQA 1K5GB 4B6HA 1SGHA 3P6AA 2G35A 2QKMA 1SHCA 4KHBB 1XD4A 3FM8C 1Q67A 1W1DA 4TYZA 2JP2A 5C79A 3UZTA 2YSZA 1BTNA 4MK0A 5LONB 1U2BA 1FHOA 5I2MA 3D8EA 2LOZA 2DKPA 2EJ8A 4ZRKA 1MKEA 2D10A 1X1FA 2AEHA 2GCLA 2YS1A 1FAOA 4WVFB 5HE0A 1H10A 1TQZA 2RVBB 3OANA 1KZ7A 2NBVA 4YL8A 1MPHA 1U27A 2N0YA 5L81A 4TKNA 2YS5A 1W1GA 5C5BA 1LW3A 1V5PA 1PFJA 1V5UA 4F7UP 2CY5A 2Y8GA 4KAXB 4K17A 2MKRA 1OQNA 4KHBA 1P3RA 1GC6A 1MIZB 2Q13A 2DLWA 3KY9A 1ZSQA 3ML4A 2Z59A 4QJ4B 2GUMA 5D3YA 3HSAA 1Y19B 1MIXA 1XODA 5J3TA 3M1IB 3FSSA 2D9ZA 2PZ1A 1WG7A 2BCJA 2D9WA 1B55A 3D8FA 5HE1A 1X05A 4NSWA 3MDBC 4GNKB 2D9YA 3SUZA 2D4QA 4CYEA 2I5CA 2KIEA 3TVVA 1I7AA 5C5BB 3QWMA 4MT7A 2YRYA 1RRPB 3KSYA 3F5RA 2LG1A 1V88A 4QXAB 1FHWA 2LYDA 4HB4B 1ZC4B 4OSNA 1FGYA 3PG7A 2J59M 1FOEA 1U5FA 2VRWB 4K2PA 1X86A 4L1RA 5DHAB 2RRFA 4EJNA 3DXCA 4DIXA 2RLOA 2RNRB 3VIAA
chains in the Genus database with same CATH topology
5CLQB 4A6FB 1E5WA 1ISNA 1X1GA 5FI1A 2Z0PA 3SNHA 4IFSA 5JHGA 2DHIA 1M7EA 3U8ZA 4F7GA 2DN6A 3F0WA 3U7DA 2ELBA 4KVGB 4DXAB 2XQNM 3QIJA 1ZC3B 2ROVA 2DYQA 4H8SA 2Y8FA 2ZPYA 3LJUX 3PZDA 5J3YA 1IRSA 2COCA 1UNQA 2VKIA 1PLSA 3TFMA 2J0JA 4HB3B 5HE3A 1BTKA 4A6FA 4HAZB 1N3HA 1MK7B 1H4RA 1AWEA 3PVLA 4GMVA 4DX90 2OQBA 4L6EA 4WSFA 4ZRJA 2DYNA 4HAUB 2DX1A 4PQ0A 4IAPA 2R0DA 2UZSA 1EF1A 1NI2A 2J0KA 1XCGA 1RJ2A 2I1JA 2YS3A 4HB2B 3TW1A 3O96A 1W1HA 2UVMA 2N23A 2K00A 5DIFB 5EFXA 4IOYX 1WVHA 3DXDA 2K2UA 4P7IA 1OY2A 2P0HA 3KRWA 4K2OA 1GC7A 2P8VA 2YVCA 3ZVRA 3AU4A 2VSZA 5FI0A 3GYOA 1WI1A 2LKOA 1J0WA 4HAYB 2D9XA 4EMOA 5C6RA 5D27A 4A6HA 4DBBA 1NU2A 2ADZA 2GS0A 3X23A 4HATB 2GCJA 3PSCA 3D8DA 1UNRA 1DBHA 4WJ7A 2W2XC 5D3XA 1QQGA 2FJLA 3T06A 5DHFB 5JLJB 3WYFB 2CY4A 3DXEA 2DHKA 3N7CA 4XWXA 3ZDTA 1EAZA 1FHXA 1UEFA 1V5MA 1KZGA 2M38A 3BJIA 2CODA 2DX5A 1BAKA 4A6KA 3MPXA 3PEGA 5LOPB 1MAIA 2KCJA 4GZUA 1OMWA 3SYXA 2E2XA 1MK9B 2ELAA 2MFQA 5C16A 1NTVA 1K5DB 2YT1A 1U5GA 5HE2A 4K81A 1DROA 2EC1A 4MY6A 2D11A 4HB0B 2IFSA 3VOQA 4C0AA 2HE7A 4HDQA 2LOXA 2NMBA 1EVHA 2OTXA 2R09A 3PP2A 1V61A 4Y94A 1Z87A 3PVWA 5D3VA 3AJ4A 4GMXB 4GN1A 4HDOA 3A8QA 1BWNA 4HAVB 3HQCA 3ODWA 4HAXB 3IVFA 4KHAA 1KI1B 3HW2B 1Y5OA 2Z0OA 3AU5A 1WGUA 2CAYA 2DKQA 3KZ1A 1TJ6A 3A8PA 2LULA 1XKEA 2M14A 1J19A 5CLLB 1UNPA 1WJ1A 2H7EA 1ZM0A 2COFA 1M7RA 2CRFA 1FGZA 2V76A 3ULCA 1AQCA 1P5TA 1XR0B 1DDMA 3GYPA 2AL6A 5DI9B 3SO6A 1NTYA 1GG3A 5JP4A 2QKLA 2IYBA 2P0FA 1EGXA 2I1KA 2EMSA 1U29A 3CIKA 1UPRA 2COAA 3FEHA 1WGQA 2ROZB 4Z2NA 2L2IA 3ULBA 1DDWA 3HK0A 1FB8A 2KGXB 4A5KA 4F7HA 2P0DA 1U5EA 2DA0A 1DYNA 5GOWB 2L1CA 4Z2MB 3TO1A 2DTCA 3SV1A 1XX0A 4EKUA 4CHMA 2NZ8B 4HAWB 2H7DA 4GPTB 3WA0A 3G9WA 3RCPA 1PMSA 3P7ZA 2RGNB 2UZRA 1LB1A 2DHJA 4HHVA 4PNKA 3KRXA 5J3QA 5D3WA 5KQ4A 2J0MA 3PVUA 2Y7BA 1P6SA 1I2HA 2K2JA 4DX8A 1U5DA 5KQ1A 2YF0A 4KHOA 4NY0A 4D0NB 1WJMA 3TCAA 2EMTA 3V5WA 2KUPA 1X11A 2GJYA 3BINA 2W2XD 3ODXA 5JHHA 2DFKA 2RUKB 2MWNB 4BBKA 2I5FA 2YT0A 2RSGA 1DDVA 3ODOA 4CHJA 3CXBB 1QC6A 2W2WA 2HTHB 3QBVB 2MDXA 2D2QA 5DH9B 2Z0QA 3NSUA 1V89A 2D9VA 4YONA 5KCVA 1TXDA 3A98B 4ZRIA 2X18A 1ZVRA 4GXBA 1UPQA 1K5GB 4B6HA 1SGHA 3P6AA 2G35A 2QKMA 1SHCA 4KHBB 1XD4A 3FM8C 1Q67A 1W1DA 4TYZA 2JP2A 5C79A 3UZTA 2YSZA 1BTNA 4MK0A 5LONB 1U2BA 1FHOA 3D8EA 2LOZA 2DKPA 2EJ8A 4ZRKA 1MKEA 2D10A 1X1FA 2AEHA 2GCLA 2YS1A 1FAOA 4WVFB 5HE0A 1H10A 1TQZA 2RVBB 3OANA 1KZ7A 4YL8A 1MPHA 1U27A 2N0YA 5L81A 4TKNA 2YS5A 1W1GA 5C5BA 1LW3A 1V5PA 1PFJA 1V5UA 4F7UP 2CY5A 2Y8GA 4KAXB 4K17A 2MKRA 1OQNA 1P3RA 1GC6A 1MIZB 2Q13A 2DLWA 3KY9A 1ZSQA 3ML4A 5D3YA 1Y19B 1MIXA 1XODA 5J3TA 3M1IB 3FSSA 2D9ZA 2PZ1A 1WG7A 2BCJA 2D9WA 1B55A 3D8FA 5HE1A 1X05A 4NSWA 3MDBC 2D9YA 3SUZA 2D4QA 4CYEA 2I5CA 3TVVA 1I7AA 5C5BB 3QWMA 4MT7A 2YRYA 1RRPB 3KSYA 3F5RA 2LG1A 1V88A 1FHWA 2LYDA 4HB4B 1ZC4B 1FGYA 3PG7A 2J59M 1FOEA 1U5FA 2VRWB 4K2PA 1X86A 5DHAB 4EJNA 3DXCA 2RLOA 2RNRB 3VIAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CLQ B;  4A6F B;  1E5W A;  1ISN A;  1X1G A;  5FI1 A;  2Z0P A;  3SNH A;  4IFS A;  5JHG A;  2DHI A;  1M7E A;  3U8Z A;  4F7G A;  2DN6 A;  3F0W A;  3U7D A;  2ELB A;  4KVG B;  4DXA B;  2XQN M;  3QIJ A;  1ZC3 B;  2ROV A;  2DYQ A;  4H8S A;  2Y8F A;  2ZPY A;  3LJU X;  3PZD A;  5J3Y A;  1IRS A;  2COC A;  1UNQ A;  2VKI A;  1PLS A;  3TFM A;  2J0J A;  4HB3 B;  5HE3 A;  1BTK A;  4A6F A;  4HAZ B;  1N3H A;  1MK7 B;  1H4R A;  1AWE A;  3PVL A;  4GMV A;  4DX9 0;  2OQB A;  4L6E A;  4WSF A;  4ZRJ A;  2DYN A;  4HAU B;  2DX1 A;  4PQ0 A;  4IAP A;  2R0D A;  2UZS A;  1EF1 A;  1NI2 A;  2J0K A;  1XCG A;  1RJ2 A;  2I1J A;  2YS3 A;  4HB2 B;  3TW1 A;  3O96 A;  1W1H A;  2UVM A;  2N23 A;  2K00 A;  5DIF B;  5EFX A;  4IOY X;  1WVH A;  3DXD A;  2K2U A;  4P7I A;  1OY2 A;  2P0H A;  3KRW A;  4K2O A;  1GC7 A;  2P8V A;  2YVC A;  3ZVR A;  3AU4 A;  2VSZ A;  5FI0 A;  3GYO A;  1WI1 A;  2LKO A;  1J0W A;  4HAY B;  2D9X A;  4EMO A;  5C6R A;  5D27 A;  4A6H A;  4DBB A;  1NU2 A;  2ADZ A;  2GS0 A;  3X23 A;  4HAT B;  2GCJ A;  3PSC A;  3D8D A;  1UNR A;  1DBH A;  4WJ7 A;  2W2X C;  5D3X A;  1QQG A;  2FJL A;  3T06 A;  5DHF B;  5JLJ B;  3WYF B;  2CY4 A;  3DXE A;  2DHK A;  3N7C A;  4XWX A;  3ZDT A;  1EAZ A;  1FHX A;  1UEF A;  1V5M A;  1KZG A;  2M38 A;  3BJI A;  2COD A;  2DX5 A;  1BAK A;  4A6K A;  3MPX A;  3PEG A;  5LOP B;  1MAI A;  2KCJ A;  4GZU A;  1OMW A;  3SYX A;  2E2X A;  1MK9 B;  2ELA A;  2MFQ A;  5C16 A;  1NTV A;  1K5D B;  2YT1 A;  1U5G A;  5HE2 A;  4K81 A;  1DRO A;  2EC1 A;  4MY6 A;  2D11 A;  4HB0 B;  2IFS A;  3VOQ A;  4C0A A;  2HE7 A;  4HDQ A;  2LOX A;  2NMB A;  1EVH A;  2OTX A;  2R09 A;  3PP2 A;  1V61 A;  4Y94 A;  1Z87 A;  3PVW A;  5D3V A;  3AJ4 A;  4GMX B;  4GN1 A;  4HDO A;  3A8Q A;  1BWN A;  4HAV B;  3HQC A;  3ODW A;  4HAX B;  3IVF A;  4KHA A;  1KI1 B;  3HW2 B;  1Y5O A;  2Z0O A;  3AU5 A;  1WGU A;  2CAY A;  2DKQ A;  3KZ1 A;  1TJ6 A;  3A8P A;  2LUL A;  1XKE A;  2M14 A;  1J19 A;  5CLL B;  1UNP A;  1WJ1 A;  2H7E A;  1ZM0 A;  2COF A;  1M7R A;  2CRF A;  1FGZ A;  2V76 A;  3ULC A;  1AQC A;  1P5T A;  1XR0 B;  1DDM A;  3GYP A;  2AL6 A;  5DI9 B;  3SO6 A;  1NTY A;  1GG3 A;  5JP4 A;  2QKL A;  2IYB A;  2P0F A;  1EGX A;  2I1K A;  2EMS A;  1U29 A;  3CIK A;  1UPR A;  2COA A;  3FEH A;  1WGQ A;  2ROZ B;  4Z2N A;  2L2I A;  3ULB A;  1DDW A;  3HK0 A;  1FB8 A;  2KGX B;  4A5K A;  4F7H A;  2P0D A;  1U5E A;  2DA0 A;  1DYN A;  5GOW B;  2L1C A;  4Z2M B;  3TO1 A;  2DTC A;  3SV1 A;  1XX0 A;  4EKU A;  4CHM A;  2NZ8 B;  4HAW B;  2H7D A;  4GPT B;  3WA0 A;  3G9W A;  3RCP A;  1PMS A;  3P7Z A;  2RGN B;  2UZR A;  1LB1 A;  2DHJ A;  4HHV A;  4PNK A;  3KRX A;  5J3Q A;  5D3W A;  5KQ4 A;  2J0M A;  3PVU A;  2Y7B A;  1P6S A;  1I2H A;  2K2J A;  4DX8 A;  1U5D A;  5KQ1 A;  2YF0 A;  4KHO A;  4NY0 A;  4D0N B;  1WJM A;  3TCA A;  2EMT A;  3V5W A;  2KUP A;  1X11 A;  2GJY A;  3BIN A;  2W2X D;  3ODX A;  5JHH A;  2DFK A;  2RUK B;  2MWN B;  4BBK A;  2I5F A;  2YT0 A;  2RSG A;  1DDV A;  3ODO A;  4CHJ A;  3CXB B;  1QC6 A;  2W2W A;  2HTH B;  3QBV B;  2MDX A;  2D2Q A;  5DH9 B;  2Z0Q A;  3NSU A;  1V89 A;  2D9V A;  4YON A;  5KCV A;  1TXD A;  3A98 B;  4ZRI A;  2X18 A;  1ZVR A;  4GXB A;  1UPQ A;  1K5G B;  4B6H A;  1SGH A;  3P6A A;  2G35 A;  2QKM A;  1SHC A;  4KHB B;  1XD4 A;  3FM8 C;  1Q67 A;  1W1D A;  4TYZ A;  2JP2 A;  5C79 A;  3UZT A;  2YSZ A;  1BTN A;  4MK0 A;  5LON B;  1U2B A;  1FHO A;  3D8E A;  2LOZ A;  2DKP A;  2EJ8 A;  4ZRK A;  1MKE A;  2D10 A;  1X1F A;  2AEH A;  2GCL A;  2YS1 A;  1FAO A;  4WVF B;  5HE0 A;  1H10 A;  1TQZ A;  2RVB B;  3OAN A;  1KZ7 A;  4YL8 A;  1MPH A;  1U27 A;  2N0Y A;  5L81 A;  4TKN A;  2YS5 A;  1W1G A;  5C5B A;  1LW3 A;  1V5P A;  1PFJ A;  1V5U A;  4F7U P;  2CY5 A;  2Y8G A;  4KAX B;  4K17 A;  2MKR A;  1OQN A;  1P3R A;  1GC6 A;  1MIZ B;  2Q13 A;  2DLW A;  3KY9 A;  1ZSQ A;  3ML4 A;  5D3Y A;  1Y19 B;  1MIX A;  1XOD A;  5J3T A;  3M1I B;  3FSS A;  2D9Z A;  2PZ1 A;  1WG7 A;  2BCJ A;  2D9W A;  1B55 A;  3D8F A;  5HE1 A;  1X05 A;  4NSW A;  3MDB C;  2D9Y A;  3SUZ A;  2D4Q A;  4CYE A;  2I5C A;  3TVV A;  1I7A A;  5C5B B;  3QWM A;  4MT7 A;  2YRY A;  1RRP B;  3KSY A;  3F5R A;  2LG1 A;  1V88 A;  1FHW A;  2LYD A;  4HB4 B;  1ZC4 B;  1FGY A;  3PG7 A;  2J59 M;  1FOE A;  1U5F A;  2VRW B;  4K2P A;  1X86 A;  5DHA B;  4EJN A;  3DXC A;  2RLO A;  2RNR B;  3VIA A; 
#chains in the Genus database with same CATH topology
 5CLQ B;  4A6F B;  1E5W A;  1ISN A;  1X1G A;  5FI1 A;  2Z0P A;  3SNH A;  4IFS A;  5JHG A;  2DHI A;  3B77 A;  1M7E A;  3U8Z A;  4F7G A;  2DN6 A;  3F0W A;  3U7D A;  5I2S A;  2ELB A;  3FVC A;  4KVG B;  4DXA B;  2XQN M;  3QIJ A;  1ZYI A;  1ZC3 B;  2ROV A;  3U12 A;  2DYQ A;  4H8S A;  3HIE A;  2Y8F A;  2ZPY A;  3LJU X;  3PZD A;  5J3Y A;  1IRS A;  2COC A;  1UNQ A;  2VKI A;  1PLS A;  3TFM A;  2J0J A;  4HB3 B;  2YT2 A;  5HE3 A;  1BTK A;  2KIG A;  4A6F A;  4HAZ B;  4CSQ A;  1N3H A;  1MK7 B;  1H4R A;  1AWE A;  3PVL A;  4GMV A;  4DX9 0;  2OQB A;  4L6E A;  4WSF A;  4ZRJ A;  2DYN A;  4HAU B;  2DX1 A;  4PQ0 A;  4IAP A;  2R0D A;  2UZS A;  1EF1 A;  1NI2 A;  2J0K A;  1XCG A;  1RJ2 A;  2I1J A;  2KR0 A;  2YS3 A;  4QJ3 B;  4HB2 B;  3TW1 A;  3NWD A;  3O96 A;  1W1H A;  2UVM A;  2N23 A;  2K00 A;  5DIF B;  5EFX A;  4IOY X;  1WVH A;  3DXD A;  2K2U A;  4P7I A;  3OHM B;  1OY2 A;  2P0H A;  3KRW A;  4K2O A;  1GC7 A;  2P8V A;  2YVC A;  3ZVR A;  3AU4 A;  2VSZ A;  5FI0 A;  3GYO A;  1WI1 A;  2LKO A;  1J0W A;  4HAY B;  2D9X A;  4EMO A;  5C6R A;  5D27 A;  4A6H A;  4DBB A;  1NU2 A;  2ADZ A;  2GS0 A;  3X23 A;  4HAT B;  2GCJ A;  3PSC A;  3D8D A;  1UNR A;  1DBH A;  4WJ7 A;  2KUQ A;  4QJ5 B;  2W2X C;  5D3X A;  1QQG A;  2FJL A;  3T06 A;  5DHF B;  5JLJ B;  3WYF B;  2CY4 A;  3DXE A;  2DHK A;  3N7C A;  2R2Y A;  4XWX A;  3ZDT A;  1EAZ A;  1FHX A;  1UEF A;  1V5M A;  1KZG A;  2Z4D A;  2M38 A;  3BJI A;  2COD A;  2DX5 A;  1BAK A;  4A6K A;  3MPX A;  3PEG A;  5LOP B;  1MAI A;  2KCJ A;  4GZU A;  1OMW A;  3SYX A;  2E2X A;  1MK9 B;  2ELA A;  2MFQ A;  5C16 A;  1NTV A;  1K5D B;  2YT1 A;  1U5G A;  5HE2 A;  4K81 A;  1DRO A;  2EC1 A;  4MY6 A;  2D11 A;  4HB0 B;  2FJU B;  2IFS A;  3VOQ A;  4C0A A;  2HE7 A;  4HDQ A;  2LOX A;  2NMB A;  1EVH A;  2OTX A;  2R09 A;  3PP2 A;  1V61 A;  4Y94 A;  4GOU A;  1Z87 A;  3PVW A;  1T77 A;  5D3V A;  3AJ4 A;  4GMX B;  4GN1 A;  4HDO A;  3A8Q A;  1BWN A;  4HAV B;  3HQC A;  4HSI A;  3ODW A;  4HAX B;  3IVF A;  4KHA A;  1KI1 B;  3HW2 B;  1Y5O A;  2Z0O A;  3AU5 A;  1WGU A;  2CAY A;  2DKQ A;  3KZ1 A;  1TJ6 A;  3A8P A;  2LUL A;  1XKE A;  2M14 A;  1J19 A;  5CLL B;  1UNP A;  1WJ1 A;  2H7E A;  1ZM0 A;  2COF A;  1M7R A;  2CRF A;  1FGZ A;  2V76 A;  3ULC A;  1AQC A;  1P5T A;  1XR0 B;  1DDM A;  3GYP A;  2AL6 A;  5DI9 B;  3SO6 A;  1NTY A;  1GG3 A;  5JP4 A;  2QKL A;  2IYB A;  2P0F A;  1EGX A;  2I1K A;  2EMS A;  4D6W A;  1U29 A;  3CIK A;  1UPR A;  3DCX A;  2COA A;  2Z13 A;  3FEH A;  1WGQ A;  2ROZ B;  4Z2N A;  2L2I A;  2K8E A;  3ULB A;  1DDW A;  3HK0 A;  1FB8 A;  2KGX B;  4A5K A;  4F7H A;  2P0D A;  1U5E A;  2DA0 A;  1DYN A;  5GOW B;  2L1C A;  4Z2M B;  3TO1 A;  2DTC A;  3SV1 A;  1XX0 A;  4EKU A;  4CHM A;  2NZ8 B;  3A58 A;  2H7D A;  4HAW B;  4GPT B;  3WA0 A;  3G9W A;  4OT1 A;  3RCP A;  1PMS A;  3P7Z A;  2RGN B;  2K49 A;  2UZR A;  1LB1 A;  2DHJ A;  5LG4 B;  4HHV A;  4PNK A;  3KRX A;  5J3Q A;  5D3W A;  5KQ4 A;  2J0M A;  3PVU A;  2Y7B A;  1P6S A;  1I2H A;  2K2J A;  2Z14 A;  4DX8 A;  1U5D A;  5KQ1 A;  2YF0 A;  3NWF A;  5IRS A;  4KHO A;  4NY0 A;  4D0N B;  1WJM A;  3TCA A;  2EMT A;  3V5W A;  2KUP A;  1X11 A;  2GJY A;  3BIN A;  2W2X D;  3ODX A;  3NWA A;  5JHH A;  2DFK A;  2RUK B;  2MWN B;  4BBK A;  2I5F A;  2YT0 A;  2RSG A;  1DDV A;  3ODO A;  4CHJ A;  3CXB B;  1QC6 A;  5M4Y B;  2W2W A;  2HTH B;  3QBV B;  2MDX A;  2D2Q A;  1MI1 A;  5DH9 B;  2Z0Q A;  3NSU A;  3NW8 A;  1V89 A;  2D9V A;  4YON A;  5KCV A;  1TXD A;  3A98 B;  4ZRI A;  2X18 A;  2ZKM X;  1ZVR A;  4GXB A;  1UPQ A;  1K5G B;  4B6H A;  1SGH A;  3P6A A;  2G35 A;  2QKM A;  1SHC A;  4KHB B;  1XD4 A;  3FM8 C;  1Q67 A;  1W1D A;  4TYZ A;  2JP2 A;  5C79 A;  3UZT A;  2YSZ A;  1BTN A;  4MK0 A;  5LON B;  1U2B A;  1FHO A;  5I2M A;  3D8E A;  2LOZ A;  2DKP A;  2EJ8 A;  4ZRK A;  1MKE A;  2D10 A;  1X1F A;  2AEH A;  2GCL A;  2YS1 A;  1FAO A;  4WVF B;  5HE0 A;  1H10 A;  1TQZ A;  2RVB B;  3OAN A;  1KZ7 A;  2NBV A;  4YL8 A;  1MPH A;  1U27 A;  2N0Y A;  5L81 A;  4TKN A;  2YS5 A;  1W1G A;  5C5B A;  1LW3 A;  1V5P A;  1PFJ A;  1V5U A;  4F7U P;  2CY5 A;  2Y8G A;  4KAX B;  4K17 A;  2MKR A;  1OQN A;  4KHB A;  1P3R A;  1GC6 A;  1MIZ B;  2Q13 A;  2DLW A;  3KY9 A;  1ZSQ A;  3ML4 A;  2Z59 A;  4QJ4 B;  2GUM A;  5D3Y A;  3HSA A;  1Y19 B;  1MIX A;  1XOD A;  5J3T A;  3M1I B;  3FSS A;  2D9Z A;  2PZ1 A;  1WG7 A;  2BCJ A;  2D9W A;  1B55 A;  3D8F A;  5HE1 A;  1X05 A;  4NSW A;  3MDB C;  4GNK B;  2D9Y A;  3SUZ A;  2D4Q A;  4CYE A;  2I5C A;  2KIE A;  3TVV A;  1I7A A;  5C5B B;  3QWM A;  4MT7 A;  2YRY A;  1RRP B;  3KSY A;  3F5R A;  2LG1 A;  1V88 A;  4QXA B;  1FHW A;  2LYD A;  4HB4 B;  1ZC4 B;  4OSN A;  1FGY A;  3PG7 A;  2J59 M;  1FOE A;  1U5F A;  2VRW B;  4K2P A;  1X86 A;  4L1R A;  5DHA B;  2RRF A;  4EJN A;  3DXC A;  4DIX A;  2RLO A;  2RNR B;  3VIA A; 
#chains in the Genus database with same CATH homology
 5CLQ B;  4A6F B;  1E5W A;  1ISN A;  1X1G A;  5FI1 A;  2Z0P A;  3SNH A;  4IFS A;  5JHG A;  2DHI A;  1M7E A;  3U8Z A;  4F7G A;  2DN6 A;  3F0W A;  3U7D A;  2ELB A;  4KVG B;  4DXA B;  2XQN M;  3QIJ A;  1ZC3 B;  2ROV A;  2DYQ A;  4H8S A;  2Y8F A;  2ZPY A;  3LJU X;  3PZD A;  5J3Y A;  1IRS A;  2COC A;  1UNQ A;  2VKI A;  1PLS A;  3TFM A;  2J0J A;  4HB3 B;  5HE3 A;  1BTK A;  4A6F A;  4HAZ B;  1N3H A;  1MK7 B;  1H4R A;  1AWE A;  3PVL A;  4GMV A;  4DX9 0;  2OQB A;  4L6E A;  4WSF A;  4ZRJ A;  2DYN A;  4HAU B;  2DX1 A;  4PQ0 A;  4IAP A;  2R0D A;  2UZS A;  1EF1 A;  1NI2 A;  2J0K A;  1XCG A;  1RJ2 A;  2I1J A;  2YS3 A;  4HB2 B;  3TW1 A;  3O96 A;  1W1H A;  2UVM A;  2N23 A;  2K00 A;  5DIF B;  5EFX A;  4IOY X;  1WVH A;  3DXD A;  2K2U A;  4P7I A;  1OY2 A;  2P0H A;  3KRW A;  4K2O A;  1GC7 A;  2P8V A;  2YVC A;  3ZVR A;  3AU4 A;  2VSZ A;  5FI0 A;  3GYO A;  1WI1 A;  2LKO A;  1J0W A;  4HAY B;  2D9X A;  4EMO A;  5C6R A;  5D27 A;  4A6H A;  4DBB A;  1NU2 A;  2ADZ A;  2GS0 A;  3X23 A;  4HAT B;  2GCJ A;  3PSC A;  3D8D A;  1UNR A;  1DBH A;  4WJ7 A;  2W2X C;  5D3X A;  1QQG A;  2FJL A;  3T06 A;  5DHF B;  5JLJ B;  3WYF B;  2CY4 A;  3DXE A;  2DHK A;  3N7C A;  4XWX A;  3ZDT A;  1EAZ A;  1FHX A;  1UEF A;  1V5M A;  1KZG A;  2M38 A;  3BJI A;  2COD A;  2DX5 A;  1BAK A;  4A6K A;  3MPX A;  3PEG A;  5LOP B;  1MAI A;  2KCJ A;  4GZU A;  1OMW A;  3SYX A;  2E2X A;  1MK9 B;  2ELA A;  2MFQ A;  5C16 A;  1NTV A;  1K5D B;  2YT1 A;  1U5G A;  5HE2 A;  4K81 A;  1DRO A;  2EC1 A;  4MY6 A;  2D11 A;  4HB0 B;  2IFS A;  3VOQ A;  4C0A A;  2HE7 A;  4HDQ A;  2LOX A;  2NMB A;  1EVH A;  2OTX A;  2R09 A;  3PP2 A;  1V61 A;  4Y94 A;  1Z87 A;  3PVW A;  5D3V A;  3AJ4 A;  4GMX B;  4GN1 A;  4HDO A;  3A8Q A;  1BWN A;  4HAV B;  3HQC A;  3ODW A;  4HAX B;  3IVF A;  4KHA A;  1KI1 B;  3HW2 B;  1Y5O A;  2Z0O A;  3AU5 A;  1WGU A;  2CAY A;  2DKQ A;  3KZ1 A;  1TJ6 A;  3A8P A;  2LUL A;  1XKE A;  2M14 A;  1J19 A;  5CLL B;  1UNP A;  1WJ1 A;  2H7E A;  1ZM0 A;  2COF A;  1M7R A;  2CRF A;  1FGZ A;  2V76 A;  3ULC A;  1AQC A;  1P5T A;  1XR0 B;  1DDM A;  3GYP A;  2AL6 A;  5DI9 B;  3SO6 A;  1NTY A;  1GG3 A;  5JP4 A;  2QKL A;  2IYB A;  2P0F A;  1EGX A;  2I1K A;  2EMS A;  1U29 A;  3CIK A;  1UPR A;  2COA A;  3FEH A;  1WGQ A;  2ROZ B;  4Z2N A;  2L2I A;  3ULB A;  1DDW A;  3HK0 A;  1FB8 A;  2KGX B;  4A5K A;  4F7H A;  2P0D A;  1U5E A;  2DA0 A;  1DYN A;  5GOW B;  2L1C A;  4Z2M B;  3TO1 A;  2DTC A;  3SV1 A;  1XX0 A;  4EKU A;  4CHM A;  2NZ8 B;  4HAW B;  2H7D A;  4GPT B;  3WA0 A;  3G9W A;  3RCP A;  1PMS A;  3P7Z A;  2RGN B;  2UZR A;  1LB1 A;  2DHJ A;  4HHV A;  4PNK A;  3KRX A;  5J3Q A;  5D3W A;  5KQ4 A;  2J0M A;  3PVU A;  2Y7B A;  1P6S A;  1I2H A;  2K2J A;  4DX8 A;  1U5D A;  5KQ1 A;  2YF0 A;  4KHO A;  4NY0 A;  4D0N B;  1WJM A;  3TCA A;  2EMT A;  3V5W A;  2KUP A;  1X11 A;  2GJY A;  3BIN A;  2W2X D;  3ODX A;  5JHH A;  2DFK A;  2RUK B;  2MWN B;  4BBK A;  2I5F A;  2YT0 A;  2RSG A;  1DDV A;  3ODO A;  4CHJ A;  3CXB B;  1QC6 A;  2W2W A;  2HTH B;  3QBV B;  2MDX A;  2D2Q A;  5DH9 B;  2Z0Q A;  3NSU A;  1V89 A;  2D9V A;  4YON A;  5KCV A;  1TXD A;  3A98 B;  4ZRI A;  2X18 A;  1ZVR A;  4GXB A;  1UPQ A;  1K5G B;  4B6H A;  1SGH A;  3P6A A;  2G35 A;  2QKM A;  1SHC A;  4KHB B;  1XD4 A;  3FM8 C;  1Q67 A;  1W1D A;  4TYZ A;  2JP2 A;  5C79 A;  3UZT A;  2YSZ A;  1BTN A;  4MK0 A;  5LON B;  1U2B A;  1FHO A;  3D8E A;  2LOZ A;  2DKP A;  2EJ8 A;  4ZRK A;  1MKE A;  2D10 A;  1X1F A;  2AEH A;  2GCL A;  2YS1 A;  1FAO A;  4WVF B;  5HE0 A;  1H10 A;  1TQZ A;  2RVB B;  3OAN A;  1KZ7 A;  4YL8 A;  1MPH A;  1U27 A;  2N0Y A;  5L81 A;  4TKN A;  2YS5 A;  1W1G A;  5C5B A;  1LW3 A;  1V5P A;  1PFJ A;  1V5U A;  4F7U P;  2CY5 A;  2Y8G A;  4KAX B;  4K17 A;  2MKR A;  1OQN A;  1P3R A;  1GC6 A;  1MIZ B;  2Q13 A;  2DLW A;  3KY9 A;  1ZSQ A;  3ML4 A;  5D3Y A;  1Y19 B;  1MIX A;  1XOD A;  5J3T A;  3M1I B;  3FSS A;  2D9Z A;  2PZ1 A;  1WG7 A;  2BCJ A;  2D9W A;  1B55 A;  3D8F A;  5HE1 A;  1X05 A;  4NSW A;  3MDB C;  2D9Y A;  3SUZ A;  2D4Q A;  4CYE A;  2I5C A;  3TVV A;  1I7A A;  5C5B B;  3QWM A;  4MT7 A;  2YRY A;  1RRP B;  3KSY A;  3F5R A;  2LG1 A;  1V88 A;  1FHW A;  2LYD A;  4HB4 B;  1ZC4 B;  1FGY A;  3PG7 A;  2J59 M;  1FOE A;  1U5F A;  2VRW B;  4K2P A;  1X86 A;  5DHA B;  4EJN A;  3DXC A;  2RLO A;  2RNR B;  3VIA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...