1V5UA

Solution structure of the c-terminal pleckstrin homology domain of sbf1 from mouse
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
117
structure length
117
Chain Sequence
GSSGSSGRSYEGILYKKGAFMKPWKARWFVLDKTKHQLRYYDHRMDTECKGVIDLAEVEAVAPGTPTIGAPKTVDEKAFFDVKTTRRVYNFCAQDVPSAQQWVDRIQSCLSSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords SET binding factor 1
publication title Solution Structure of the C-terminal Pleckstrin Homology Domain of Sbf1 from Mouse
rcsb
source organism Mus musculus
total genus 15
structure length 117
sequence length 117
ec nomenclature
pdb deposition date 2003-11-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00169 PH PH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 1v5uA00
3QWMA 3TCAA 1B55A 2J0KA 2Y8GA 1QC6A 2K00A 2RSGA 3TFMA 1MAIA 2FJLA 2MDXA 4HB0B 4YONA 5L81A 1W1GA 2MFQA 3OANA 4PNKA 3MPXA 3ODWA 2RLOA 4MY6A 1W1DA 1LW3A 1BTKA 1WVHA 2NZ8B 4F7UP 1U29A 2JP2A 3ULBA 1GC7A 5EFXA 1NTYA 1I7AA 2KUPA 1E5WA 5C79A 3CIKA 4IFSA 4K2OA 4TYZA 5C5BB 2P8VA 3M1IB 4DX8A 1J19A 3O96A 3UZTA 1DDWA 2VSZA 2H7DA 4IOYX 1WJ1A 4NSWA 5FI1A 4F7HA 1FAOA 1UPQA 2DYNA 4P7IA 3U7DA 3ZVRA 1X05A 1Q67A 3A98B 1DDVA 1WGUA 1UNQA 1V88A 1I2HA 2RUKB 4EJNA 5JHGA 5DHAB 4HHVA 4CHJA 4GN1A 1V5UA 3HW2B 2W2WA 3WA0A 4EMOA 2DX5A 3ODXA 1MIZB 1FOEA 3ODOA 5CLQB 2UVMA 2J0MA 3T06A 2Y8FA 3WYFB 2Q13A 2YS1A 2VKIA 1K5DB 3ML4A 1J0WA 2L1CA 3PEGA 2ADZA 4A6FA 2K2JA 4GXBA 3GYOA 2COFA 3QBVB 1NU2A 2YRYA 5C16A 4HAWB 4A5KA 4ZRIA 2LYDA 1Y19B 1K5GB 2DHIA 5GOWB 1EF1A 2YVCA 4B6HA 5HE3A 2EMTA 2LKOA 2QKMA 1M7EA 1OY2A 1FGZA 1QQGA 1N3HA 1M7RA 5C6RA 4PQ0A 1GC6A 2L2IA 3A8PA 5LONB 3AJ4A 2MWNB 2RGNB 2EC1A 2K2UA 5LOPB 3VIAA 5FI0A 1PMSA 2I1JA 1KZ7A 2IYBA 3KRWA 2LOXA 4KAXB 4K17A 1KZGA 4TKNA 4HATB 5KCVA 5JP4A 2D4QA 3KRXA 2DYQA 4WSFA 1XR0B 1XD4A 1U5GA 5DHFB 4YL8A 1U5DA 3AU4A 4HAYB 2ROVA 2I5FA 1U5FA 1ZSQA 4Z2MB 2YSZA 2UZSA 3HK0A 1FHOA 3PVUA 1MKEA 2D10A 5DI9B 1BWNA 1U27A 1WI1A 1LB1A 1Y5OA 2HE7A 1PLSA 2CY5A 2Z0PA 3TVVA 3KZ1A 2DHJA 2RNRB 5D3WA 4KHAA 3IVFA 4DBBA 2LOZA 1BTNA 1NI2A 3DXDA 1IRSA 3ZDTA 4Z2NA 4F7GA 5HE0A 1UPRA 1WJMA 3SV1A 3U8ZA 1MK7B 2YS5A 2XQNM 2D11A 4KHBB 3SUZA 1BAKA 2PZ1A 2YT0A 1TQZA 1XCGA 1X1GA 2W2XD 3N7CA 2Z0OA 3V5WA 2ZPYA 1MIXA 2DA0A 3LJUX 3DXEA 4DX90 2GCLA 3F5RA 2D9VA 5D3XA 4HDQA 2VRWB 1DDMA 2RVBB 3DXCA 1X1FA 1DYNA 2DTCA 3NSUA 5DIFB 1XODA 2D2QA 4GMXB 3X23A 1UNPA 2DLWA 2DKQA 2X18A 2OTXA 3TW1A 4CYEA 1RRPB 3PP2A 5HE2A 4Y94A 4HB2B 1W1HA 3PSCA 1V5MA 4IAPA 2R09A 1ZC4B 2Z0QA 1RJ2A 1EAZA 2H7EA 5J3YA 5JLJB 1UEFA 2UZRA 2G35A 1FHXA 4HAVB 1ZC3B 1X11A 3FM8C 2Y7BA 2YS3A 2LG1A 4A6KA 2KGXB 2DN6A 3FSSA 4GZUA 2KCJA 2EMSA 1OMWA 4H8SA 4K81A 1ZM0A 2YT1A 2D9YA 2I5CA 4MT7A 2D9XA 4EKUA 3KSYA 4HAUB 2V76A 3A8QA 4HB3B 2J59M 4L6EA 2OQBA 3SO6A 3KY9A 3PVWA 2COAA 1EVHA 4K2PA 4HDOA 1TJ6A 2M14A 2P0FA 1FGYA 1U2BA 1TXDA 2ELAA 5DH9B 2YF0A 3HQCA 5D3VA 1AWEA 5C5BA 1MK9B 1EGXA 1NTVA 4GPTB 3CXBB 4DXAB 3AU5A 4A6HA 5KQ4A 3D8DA 4MK0A 2DHKA 5D3YA 1P6SA 3PZDA 2IFSA 1MPHA 4HB4B 3QIJA 2I1KA 4HAXB 1V5PA 2QKLA 1SHCA 5CLLB 2NMBA 1Z87A 4C0AA 1SGHA 2E2XA 4GMVA 1XKEA 2DX1A 5KQ1A 2BCJA 2LULA 4BBKA 2GJYA 1FHWA 1WGQA 2CY4A 3F0WA 3VOQA 3MDBC 2MKRA 2ELBA 2CRFA 1KI1B 2DFKA 2CAYA 4CHMA 4XWXA 4A6FB 2EJ8A 1XX0A 3SYXA 2AEHA 2R0DA 5JHHA 3G9WA 1FB8A 4NY0A 1V61A 1ISNA 4D0NB 3PVLA 3P6AA 3BINA 2CODA 3BJIA 4ZRKA 1U5EA 3FEHA 2D9ZA 1ZVRA 1AQCA 2W2XC 4WJ7A 2N0YA 5J3TA 1WG7A 3PG7A 4KHOA 5HE1A 1PFJA 1DBHA 1X86A 3GYPA 3TO1A 2N23A 2J0JA 2DKPA 3D8EA 1H4RA 3P7ZA 2GS0A 2AL6A 1UNRA 2D9WA 3RCPA 4WVFB 1P3RA 5D27A 3SNHA 1P5TA 2COCA 2HTHB 1DROA 3D8FA 1GG3A 4HAZB 1V89A 2ROZB 2P0DA 4ZRJA 3ULCA 5J3QA 2GCJA 4KVGB 1OQNA 1H10A 2M38A 2P0HA
chains in the Genus database with same CATH superfamily
3QWMA 3TCAA 3NWDA 1B55A 2J0KA 2Y8GA 1QC6A 2K00A 2RSGA 3TFMA 3HSAA 1MI1A 1MAIA 2FJLA 2MDXA 4HB0B 4YONA 5L81A 1W1GA 3HIEA 1T77A 2MFQA 3OANA 4PNKA 3NWFA 3MPXA 3ODWA 2RLOA 4MY6A 1W1DA 1LW3A 1BTKA 1WVHA 2NZ8B 4F7UP 1U29A 2JP2A 3ULBA 1GC7A 5EFXA 1NTYA 1I7AA 2KUPA 1E5WA 4OSNA 5C79A 3CIKA 4IFSA 4K2OA 4TYZA 5C5BB 2P8VA 3M1IB 4DX8A 1J19A 3O96A 2ZKMX 3UZTA 1DDWA 2VSZA 4D6WA 2H7DA 4DIXA 4IOYX 1WJ1A 4NSWA 5FI1A 4F7HA 1FAOA 1UPQA 2DYNA 4P7IA 3U7DA 3ZVRA 1X05A 1Q67A 3A98B 1DDVA 3NW8A 1WGUA 1UNQA 1V88A 1I2HA 2RUKB 2GUMA 4EJNA 5JHGA 5DHAB 4HHVA 4CHJA 4KHBA 4GN1A 1V5UA 3HW2B 2W2WA 3WA0A 4EMOA 2DX5A 3ODXA 2KR0A 1MIZB 4QJ4B 1FOEA 3ODOA 5CLQB 2UVMA 2J0MA 3T06A 2Y8FA 3WYFB 2Q13A 2YS1A 2Z4DA 2VKIA 1K5DB 3ML4A 1J0WA 2L1CA 3PEGA 2ADZA 4A6FA 5I2SA 4QJ3B 2K2JA 4GXBA 3GYOA 2COFA 3QBVB 1NU2A 2KUQA 2YRYA 5C16A 4HAWB 4A5KA 4ZRIA 2LYDA 1Y19B 1K5GB 2DHIA 5GOWB 1EF1A 2YVCA 4B6HA 5HE3A 2EMTA 2LKOA 2QKMA 1M7EA 4CSQA 1OY2A 1FGZA 1QQGA 1N3HA 1M7RA 5C6RA 4PQ0A 1GC6A 2L2IA 3A8PA 5LONB 3AJ4A 2MWNB 2RGNB 3DCXA 2EC1A 4OT1A 2R2YA 2K2UA 5LOPB 2K8EA 3VIAA 5FI0A 1PMSA 2I1JA 1KZ7A 2IYBA 3KRWA 2LOXA 4KAXB 4K17A 1KZGA 4TKNA 4HATB 5KCVA 5JP4A 2D4QA 3KRXA 5I2MA 2DYQA 4WSFA 1XR0B 1XD4A 3NWAA 1U5GA 5DHFB 4YL8A 1U5DA 3AU4A 4HAYB 4L1RA 2Z59A 3OHMB 2ROVA 2RRFA 2I5FA 1U5FA 1ZSQA 2Z13A 4Z2MB 2YSZA 2UZSA 3HK0A 1FHOA 3PVUA 1MKEA 2D10A 5DI9B 1BWNA 1U27A 3B77A 1WI1A 2YT2A 1LB1A 1Y5OA 2HE7A 1PLSA 2CY5A 2Z0PA 3TVVA 3KZ1A 2DHJA 2KIEA 2RNRB 5D3WA 4KHAA 3IVFA 4DBBA 2LOZA 1BTNA 1NI2A 3DXDA 1IRSA 5LG4B 3ZDTA 4Z2NA 4F7GA 5HE0A 1UPRA 1WJMA 3SV1A 3U8ZA 2FJUB 3FVCA 1MK7B 2YS5A 2XQNM 2D11A 4QXAB 4KHBB 3SUZA 5IRSA 2PZ1A 1BAKA 2YT0A 1TQZA 2NBVA 1XCGA 1X1GA 2W2XD 3N7CA 2Z0OA 3V5WA 2ZPYA 1MIXA 2DA0A 3LJUX 3DXEA 4DX90 2GCLA 3F5RA 2D9VA 5D3XA 4HDQA 2VRWB 1DDMA 2RVBB 3DXCA 1X1FA 1DYNA 2DTCA 3NSUA 5DIFB 1XODA 2D2QA 3A58A 4GMXB 1UNPA 3X23A 2DLWA 2DKQA 2X18A 2OTXA 3TW1A 4CYEA 4GNKB 4HSIA 1RRPB 3PP2A 5HE2A 4Y94A 4HB2B 1W1HA 3PSCA 1V5MA 4IAPA 2R09A 1ZC4B 2K49A 2Z0QA 1RJ2A 1EAZA 2H7EA 5M4YB 5J3YA 5JLJB 1UEFA 2UZRA 2G35A 1FHXA 4HAVB 1ZC3B 1X11A 3FM8C 2Y7BA 2YS3A 2LG1A 4A6KA 2KGXB 2DN6A 3FSSA 4GZUA 2KCJA 2Z14A 2EMSA 1OMWA 4H8SA 4K81A 1ZM0A 2YT1A 2D9YA 2I5CA 4MT7A 2D9XA 4EKUA 3KSYA 4HAUB 2V76A 3A8QA 4HB3B 2J59M 4L6EA 2OQBA 3SO6A 3KY9A 3PVWA 2COAA 1EVHA 4K2PA 4HDOA 1TJ6A 2M14A 2P0FA 1FGYA 1U2BA 1TXDA 2ELAA 5DH9B 2YF0A 3HQCA 5D3VA 1AWEA 5C5BA 1MK9B 4GOUA 1EGXA 1NTVA 4GPTB 3CXBB 4DXAB 3AU5A 4A6HA 5KQ4A 3D8DA 4MK0A 2DHKA 5D3YA 1P6SA 3PZDA 2IFSA 1MPHA 4HB4B 3QIJA 2I1KA 4HAXB 1V5PA 2QKLA 1SHCA 5CLLB 2NMBA 1Z87A 4QJ5B 4C0AA 1SGHA 2E2XA 4GMVA 1XKEA 2DX1A 5KQ1A 2BCJA 2LULA 4BBKA 2GJYA 1FHWA 1WGQA 2CY4A 3F0WA 3VOQA 3U12A 3MDBC 2MKRA 2ELBA 2CRFA 1KI1B 2DFKA 2CAYA 4CHMA 4XWXA 4A6FB 2EJ8A 1XX0A 3SYXA 2AEHA 2KIGA 2R0DA 5JHHA 3G9WA 1FB8A 4NY0A 1V61A 1ISNA 4D0NB 1ZYIA 3PVLA 3P6AA 3BINA 2CODA 3BJIA 4ZRKA 1U5EA 3FEHA 2D9ZA 1ZVRA 1AQCA 2W2XC 4WJ7A 2N0YA 5J3TA 1WG7A 3PG7A 4KHOA 5HE1A 1PFJA 1DBHA 1X86A 3GYPA 3TO1A 2N23A 2J0JA 2DKPA 3D8EA 1H4RA 3P7ZA 2GS0A 2AL6A 1UNRA 2D9WA 3RCPA 4WVFB 1P3RA 5D27A 3SNHA 1P5TA 2COCA 2HTHB 1DROA 3D8FA 1GG3A 4HAZB 1V89A 2ROZB 2P0DA 4ZRJA 3ULCA 5J3QA 2GCJA 4KVGB 1OQNA 1H10A 2M38A 2P0HA
chains in the Genus database with same CATH topology
3QWMA 3TCAA 1B55A 2J0KA 2Y8GA 1QC6A 2K00A 2RSGA 3TFMA 1MAIA 2FJLA 2MDXA 4HB0B 4YONA 5L81A 1W1GA 2MFQA 3OANA 4PNKA 3MPXA 3ODWA 2RLOA 4MY6A 1W1DA 1LW3A 1BTKA 1WVHA 2NZ8B 4F7UP 1U29A 2JP2A 3ULBA 1GC7A 5EFXA 1NTYA 1I7AA 2KUPA 1E5WA 5C79A 3CIKA 4IFSA 4K2OA 4TYZA 5C5BB 2P8VA 3M1IB 4DX8A 1J19A 3O96A 3UZTA 1DDWA 2VSZA 2H7DA 4IOYX 1WJ1A 4NSWA 5FI1A 4F7HA 1FAOA 1UPQA 2DYNA 4P7IA 3U7DA 3ZVRA 1X05A 1Q67A 3A98B 1DDVA 1WGUA 1UNQA 1V88A 1I2HA 2RUKB 4EJNA 5JHGA 5DHAB 4HHVA 4CHJA 4GN1A 1V5UA 3HW2B 2W2WA 3WA0A 4EMOA 2DX5A 3ODXA 1MIZB 1FOEA 3ODOA 5CLQB 2UVMA 2J0MA 3T06A 2Y8FA 3WYFB 2Q13A 2YS1A 2VKIA 1K5DB 3ML4A 1J0WA 2L1CA 3PEGA 2ADZA 4A6FA 2K2JA 4GXBA 3GYOA 2COFA 3QBVB 1NU2A 2YRYA 5C16A 4HAWB 4A5KA 4ZRIA 2LYDA 1Y19B 1K5GB 2DHIA 5GOWB 1EF1A 2YVCA 4B6HA 5HE3A 2EMTA 2LKOA 2QKMA 1M7EA 1OY2A 1FGZA 1QQGA 1N3HA 1M7RA 5C6RA 4PQ0A 1GC6A 2L2IA 3A8PA 5LONB 3AJ4A 2MWNB 2RGNB 2EC1A 2K2UA 5LOPB 3VIAA 5FI0A 1PMSA 2I1JA 1KZ7A 2IYBA 3KRWA 2LOXA 4KAXB 4K17A 1KZGA 4TKNA 4HATB 5KCVA 5JP4A 2D4QA 3KRXA 2DYQA 4WSFA 1XR0B 1XD4A 1U5GA 5DHFB 4YL8A 1U5DA 3AU4A 4HAYB 2ROVA 2I5FA 1U5FA 1ZSQA 4Z2MB 2YSZA 2UZSA 3HK0A 1FHOA 3PVUA 1MKEA 2D10A 5DI9B 1BWNA 1U27A 1WI1A 1LB1A 1Y5OA 2HE7A 1PLSA 2CY5A 2Z0PA 3TVVA 3KZ1A 2DHJA 2RNRB 5D3WA 4KHAA 3IVFA 4DBBA 2LOZA 1BTNA 1NI2A 3DXDA 1IRSA 3ZDTA 4Z2NA 4F7GA 5HE0A 1UPRA 1WJMA 3SV1A 3U8ZA 1MK7B 2YS5A 2XQNM 2D11A 4KHBB 3SUZA 1BAKA 2PZ1A 2YT0A 1TQZA 1XCGA 1X1GA 2W2XD 3N7CA 2Z0OA 3V5WA 2ZPYA 1MIXA 2DA0A 3LJUX 3DXEA 4DX90 2GCLA 3F5RA 2D9VA 5D3XA 4HDQA 2VRWB 1DDMA 2RVBB 3DXCA 1X1FA 1DYNA 2DTCA 3NSUA 5DIFB 1XODA 2D2QA 4GMXB 3X23A 1UNPA 2DLWA 2DKQA 2X18A 2OTXA 3TW1A 4CYEA 1RRPB 3PP2A 5HE2A 4Y94A 4HB2B 1W1HA 3PSCA 1V5MA 4IAPA 2R09A 1ZC4B 2Z0QA 1RJ2A 1EAZA 2H7EA 5J3YA 5JLJB 1UEFA 2UZRA 2G35A 1FHXA 4HAVB 1ZC3B 1X11A 3FM8C 2Y7BA 2YS3A 2LG1A 4A6KA 2KGXB 2DN6A 3FSSA 4GZUA 2KCJA 2EMSA 1OMWA 4H8SA 4K81A 1ZM0A 2YT1A 2D9YA 2I5CA 4MT7A 2D9XA 4EKUA 3KSYA 4HAUB 2V76A 3A8QA 4HB3B 2J59M 4L6EA 2OQBA 3SO6A 3KY9A 3PVWA 2COAA 1EVHA 4K2PA 4HDOA 1TJ6A 2M14A 2P0FA 1FGYA 1U2BA 1TXDA 2ELAA 5DH9B 2YF0A 3HQCA 5D3VA 1AWEA 5C5BA 1MK9B 1EGXA 1NTVA 4GPTB 3CXBB 4DXAB 3AU5A 4A6HA 5KQ4A 3D8DA 4MK0A 2DHKA 5D3YA 1P6SA 3PZDA 2IFSA 1MPHA 4HB4B 3QIJA 2I1KA 4HAXB 1V5PA 2QKLA 1SHCA 5CLLB 2NMBA 1Z87A 4C0AA 1SGHA 2E2XA 4GMVA 1XKEA 2DX1A 5KQ1A 2BCJA 2LULA 4BBKA 2GJYA 1FHWA 1WGQA 2CY4A 3F0WA 3VOQA 3MDBC 2MKRA 2ELBA 2CRFA 1KI1B 2DFKA 2CAYA 4CHMA 4XWXA 4A6FB 2EJ8A 1XX0A 3SYXA 2AEHA 2R0DA 5JHHA 3G9WA 1FB8A 4NY0A 1V61A 1ISNA 4D0NB 3PVLA 3P6AA 3BINA 2CODA 3BJIA 4ZRKA 1U5EA 3FEHA 2D9ZA 1ZVRA 1AQCA 2W2XC 4WJ7A 2N0YA 5J3TA 1WG7A 3PG7A 4KHOA 5HE1A 1PFJA 1DBHA 1X86A 3GYPA 3TO1A 2N23A 2J0JA 2DKPA 3D8EA 1H4RA 3P7ZA 2GS0A 2AL6A 1UNRA 2D9WA 3RCPA 4WVFB 1P3RA 5D27A 3SNHA 1P5TA 2COCA 2HTHB 1DROA 3D8FA 1GG3A 4HAZB 1V89A 2ROZB 2P0DA 4ZRJA 3ULCA 5J3QA 2GCJA 4KVGB 1OQNA 1H10A 2M38A 2P0HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QWM A;  3TCA A;  1B55 A;  2J0K A;  2Y8G A;  1QC6 A;  2K00 A;  2RSG A;  3TFM A;  1MAI A;  2FJL A;  2MDX A;  4HB0 B;  4YON A;  5L81 A;  1W1G A;  2MFQ A;  3OAN A;  4PNK A;  3MPX A;  3ODW A;  2RLO A;  4MY6 A;  1W1D A;  1LW3 A;  1BTK A;  1WVH A;  2NZ8 B;  4F7U P;  1U29 A;  2JP2 A;  3ULB A;  1GC7 A;  5EFX A;  1NTY A;  1I7A A;  2KUP A;  1E5W A;  5C79 A;  3CIK A;  4IFS A;  4K2O A;  4TYZ A;  5C5B B;  2P8V A;  3M1I B;  4DX8 A;  1J19 A;  3O96 A;  3UZT A;  1DDW A;  2VSZ A;  2H7D A;  4IOY X;  1WJ1 A;  4NSW A;  5FI1 A;  4F7H A;  1FAO A;  1UPQ A;  2DYN A;  4P7I A;  3U7D A;  3ZVR A;  1X05 A;  1Q67 A;  3A98 B;  1DDV A;  1WGU A;  1UNQ A;  1V88 A;  1I2H A;  2RUK B;  4EJN A;  5JHG A;  5DHA B;  4HHV A;  4CHJ A;  4GN1 A;  1V5U A;  3HW2 B;  2W2W A;  3WA0 A;  4EMO A;  2DX5 A;  3ODX A;  1MIZ B;  1FOE A;  3ODO A;  5CLQ B;  2UVM A;  2J0M A;  3T06 A;  2Y8F A;  3WYF B;  2Q13 A;  2YS1 A;  2VKI A;  1K5D B;  3ML4 A;  1J0W A;  2L1C A;  3PEG A;  2ADZ A;  4A6F A;  2K2J A;  4GXB A;  3GYO A;  2COF A;  3QBV B;  1NU2 A;  2YRY A;  5C16 A;  4HAW B;  4A5K A;  4ZRI A;  2LYD A;  1Y19 B;  1K5G B;  2DHI A;  5GOW B;  1EF1 A;  2YVC A;  4B6H A;  5HE3 A;  2EMT A;  2LKO A;  2QKM A;  1M7E A;  1OY2 A;  1FGZ A;  1QQG A;  1N3H A;  1M7R A;  5C6R A;  4PQ0 A;  1GC6 A;  2L2I A;  3A8P A;  5LON B;  3AJ4 A;  2MWN B;  2RGN B;  2EC1 A;  2K2U A;  5LOP B;  3VIA A;  5FI0 A;  1PMS A;  2I1J A;  1KZ7 A;  2IYB A;  3KRW A;  2LOX A;  4KAX B;  4K17 A;  1KZG A;  4TKN A;  4HAT B;  5KCV A;  5JP4 A;  2D4Q A;  3KRX A;  2DYQ A;  4WSF A;  1XR0 B;  1XD4 A;  1U5G A;  5DHF B;  4YL8 A;  1U5D A;  3AU4 A;  4HAY B;  2ROV A;  2I5F A;  1U5F A;  1ZSQ A;  4Z2M B;  2YSZ A;  2UZS A;  3HK0 A;  1FHO A;  3PVU A;  1MKE A;  2D10 A;  5DI9 B;  1BWN A;  1U27 A;  1WI1 A;  1LB1 A;  1Y5O A;  2HE7 A;  1PLS A;  2CY5 A;  2Z0P A;  3TVV A;  3KZ1 A;  2DHJ A;  2RNR B;  5D3W A;  4KHA A;  3IVF A;  4DBB A;  2LOZ A;  1BTN A;  1NI2 A;  3DXD A;  1IRS A;  3ZDT A;  4Z2N A;  4F7G A;  5HE0 A;  1UPR A;  1WJM A;  3SV1 A;  3U8Z A;  1MK7 B;  2YS5 A;  2XQN M;  2D11 A;  4KHB B;  3SUZ A;  1BAK A;  2PZ1 A;  2YT0 A;  1TQZ A;  1XCG A;  1X1G A;  2W2X D;  3N7C A;  2Z0O A;  3V5W A;  2ZPY A;  1MIX A;  2DA0 A;  3LJU X;  3DXE A;  4DX9 0;  2GCL A;  3F5R A;  2D9V A;  5D3X A;  4HDQ A;  2VRW B;  1DDM A;  2RVB B;  3DXC A;  1X1F A;  1DYN A;  2DTC A;  3NSU A;  5DIF B;  1XOD A;  2D2Q A;  4GMX B;  3X23 A;  1UNP A;  2DLW A;  2DKQ A;  2X18 A;  2OTX A;  3TW1 A;  4CYE A;  1RRP B;  3PP2 A;  5HE2 A;  4Y94 A;  4HB2 B;  1W1H A;  3PSC A;  1V5M A;  4IAP A;  2R09 A;  1ZC4 B;  2Z0Q A;  1RJ2 A;  1EAZ A;  2H7E A;  5J3Y A;  5JLJ B;  1UEF A;  2UZR A;  2G35 A;  1FHX A;  4HAV B;  1ZC3 B;  1X11 A;  3FM8 C;  2Y7B A;  2YS3 A;  2LG1 A;  4A6K A;  2KGX B;  2DN6 A;  3FSS A;  4GZU A;  2KCJ A;  2EMS A;  1OMW A;  4H8S A;  4K81 A;  1ZM0 A;  2YT1 A;  2D9Y A;  2I5C A;  4MT7 A;  2D9X A;  4EKU A;  3KSY A;  4HAU B;  2V76 A;  3A8Q A;  4HB3 B;  2J59 M;  4L6E A;  2OQB A;  3SO6 A;  3KY9 A;  3PVW A;  2COA A;  1EVH A;  4K2P A;  4HDO A;  1TJ6 A;  2M14 A;  2P0F A;  1FGY A;  1U2B A;  1TXD A;  2ELA A;  5DH9 B;  2YF0 A;  3HQC A;  5D3V A;  1AWE A;  5C5B A;  1MK9 B;  1EGX A;  1NTV A;  4GPT B;  3CXB B;  4DXA B;  3AU5 A;  4A6H A;  5KQ4 A;  3D8D A;  4MK0 A;  2DHK A;  5D3Y A;  1P6S A;  3PZD A;  2IFS A;  1MPH A;  4HB4 B;  3QIJ A;  2I1K A;  4HAX B;  1V5P A;  2QKL A;  1SHC A;  5CLL B;  2NMB A;  1Z87 A;  4C0A A;  1SGH A;  2E2X A;  4GMV A;  1XKE A;  2DX1 A;  5KQ1 A;  2BCJ A;  2LUL A;  4BBK A;  2GJY A;  1FHW A;  1WGQ A;  2CY4 A;  3F0W A;  3VOQ A;  3MDB C;  2MKR A;  2ELB A;  2CRF A;  1KI1 B;  2DFK A;  2CAY A;  4CHM A;  4XWX A;  4A6F B;  2EJ8 A;  1XX0 A;  3SYX A;  2AEH A;  2R0D A;  5JHH A;  3G9W A;  1FB8 A;  4NY0 A;  1V61 A;  1ISN A;  4D0N B;  3PVL A;  3P6A A;  3BIN A;  2COD A;  3BJI A;  4ZRK A;  1U5E A;  3FEH A;  2D9Z A;  1ZVR A;  1AQC A;  2W2X C;  4WJ7 A;  2N0Y A;  5J3T A;  1WG7 A;  3PG7 A;  4KHO A;  5HE1 A;  1PFJ A;  1DBH A;  1X86 A;  3GYP A;  3TO1 A;  2N23 A;  2J0J A;  2DKP A;  3D8E A;  1H4R A;  3P7Z A;  2GS0 A;  2AL6 A;  1UNR A;  2D9W A;  3RCP A;  4WVF B;  1P3R A;  5D27 A;  3SNH A;  1P5T A;  2COC A;  2HTH B;  1DRO A;  3D8F A;  1GG3 A;  4HAZ B;  1V89 A;  2ROZ B;  2P0D A;  4ZRJ A;  3ULC A;  5J3Q A;  2GCJ A;  4KVG B;  1OQN A;  1H10 A;  2M38 A;  2P0H A; 
#chains in the Genus database with same CATH topology
 3QWM A;  3TCA A;  3NWD A;  1B55 A;  2J0K A;  2Y8G A;  1QC6 A;  2K00 A;  2RSG A;  3TFM A;  3HSA A;  1MI1 A;  1MAI A;  2FJL A;  2MDX A;  4HB0 B;  4YON A;  5L81 A;  1W1G A;  3HIE A;  1T77 A;  2MFQ A;  3OAN A;  4PNK A;  3NWF A;  3MPX A;  3ODW A;  2RLO A;  4MY6 A;  1W1D A;  1LW3 A;  1BTK A;  1WVH A;  2NZ8 B;  4F7U P;  1U29 A;  2JP2 A;  3ULB A;  1GC7 A;  5EFX A;  1NTY A;  1I7A A;  2KUP A;  1E5W A;  4OSN A;  5C79 A;  3CIK A;  4IFS A;  4K2O A;  4TYZ A;  5C5B B;  2P8V A;  3M1I B;  4DX8 A;  1J19 A;  3O96 A;  2ZKM X;  3UZT A;  1DDW A;  2VSZ A;  4D6W A;  2H7D A;  4DIX A;  4IOY X;  1WJ1 A;  4NSW A;  5FI1 A;  4F7H A;  1FAO A;  1UPQ A;  2DYN A;  4P7I A;  3U7D A;  3ZVR A;  1X05 A;  1Q67 A;  3A98 B;  1DDV A;  3NW8 A;  1WGU A;  1UNQ A;  1V88 A;  1I2H A;  2RUK B;  2GUM A;  4EJN A;  5JHG A;  5DHA B;  4HHV A;  4CHJ A;  4KHB A;  4GN1 A;  1V5U A;  3HW2 B;  2W2W A;  3WA0 A;  4EMO A;  2DX5 A;  3ODX A;  2KR0 A;  1MIZ B;  4QJ4 B;  1FOE A;  3ODO A;  5CLQ B;  2UVM A;  2J0M A;  3T06 A;  2Y8F A;  3WYF B;  2Q13 A;  2YS1 A;  2Z4D A;  2VKI A;  1K5D B;  3ML4 A;  1J0W A;  2L1C A;  3PEG A;  2ADZ A;  4A6F A;  5I2S A;  4QJ3 B;  2K2J A;  4GXB A;  3GYO A;  2COF A;  3QBV B;  1NU2 A;  2KUQ A;  2YRY A;  5C16 A;  4HAW B;  4A5K A;  4ZRI A;  2LYD A;  1Y19 B;  1K5G B;  2DHI A;  5GOW B;  1EF1 A;  2YVC A;  4B6H A;  5HE3 A;  2EMT A;  2LKO A;  2QKM A;  1M7E A;  4CSQ A;  1OY2 A;  1FGZ A;  1QQG A;  1N3H A;  1M7R A;  5C6R A;  4PQ0 A;  1GC6 A;  2L2I A;  3A8P A;  5LON B;  3AJ4 A;  2MWN B;  2RGN B;  3DCX A;  2EC1 A;  4OT1 A;  2R2Y A;  2K2U A;  5LOP B;  2K8E A;  3VIA A;  5FI0 A;  1PMS A;  2I1J A;  1KZ7 A;  2IYB A;  3KRW A;  2LOX A;  4KAX B;  4K17 A;  1KZG A;  4TKN A;  4HAT B;  5KCV A;  5JP4 A;  2D4Q A;  3KRX A;  5I2M A;  2DYQ A;  4WSF A;  1XR0 B;  1XD4 A;  3NWA A;  1U5G A;  5DHF B;  4YL8 A;  1U5D A;  3AU4 A;  4HAY B;  4L1R A;  2Z59 A;  3OHM B;  2ROV A;  2RRF A;  2I5F A;  1U5F A;  1ZSQ A;  2Z13 A;  4Z2M B;  2YSZ A;  2UZS A;  3HK0 A;  1FHO A;  3PVU A;  1MKE A;  2D10 A;  5DI9 B;  1BWN A;  1U27 A;  3B77 A;  1WI1 A;  2YT2 A;  1LB1 A;  1Y5O A;  2HE7 A;  1PLS A;  2CY5 A;  2Z0P A;  3TVV A;  3KZ1 A;  2DHJ A;  2KIE A;  2RNR B;  5D3W A;  4KHA A;  3IVF A;  4DBB A;  2LOZ A;  1BTN A;  1NI2 A;  3DXD A;  1IRS A;  5LG4 B;  3ZDT A;  4Z2N A;  4F7G A;  5HE0 A;  1UPR A;  1WJM A;  3SV1 A;  3U8Z A;  2FJU B;  3FVC A;  1MK7 B;  2YS5 A;  2XQN M;  2D11 A;  4QXA B;  4KHB B;  3SUZ A;  5IRS A;  2PZ1 A;  1BAK A;  2YT0 A;  1TQZ A;  2NBV A;  1XCG A;  1X1G A;  2W2X D;  3N7C A;  2Z0O A;  3V5W A;  2ZPY A;  1MIX A;  2DA0 A;  3LJU X;  3DXE A;  4DX9 0;  2GCL A;  3F5R A;  2D9V A;  5D3X A;  4HDQ A;  2VRW B;  1DDM A;  2RVB B;  3DXC A;  1X1F A;  1DYN A;  2DTC A;  3NSU A;  5DIF B;  1XOD A;  2D2Q A;  3A58 A;  4GMX B;  1UNP A;  3X23 A;  2DLW A;  2DKQ A;  2X18 A;  2OTX A;  3TW1 A;  4CYE A;  4GNK B;  4HSI A;  1RRP B;  3PP2 A;  5HE2 A;  4Y94 A;  4HB2 B;  1W1H A;  3PSC A;  1V5M A;  4IAP A;  2R09 A;  1ZC4 B;  2K49 A;  2Z0Q A;  1RJ2 A;  1EAZ A;  2H7E A;  5M4Y B;  5J3Y A;  5JLJ B;  1UEF A;  2UZR A;  2G35 A;  1FHX A;  4HAV B;  1ZC3 B;  1X11 A;  3FM8 C;  2Y7B A;  2YS3 A;  2LG1 A;  4A6K A;  2KGX B;  2DN6 A;  3FSS A;  4GZU A;  2KCJ A;  2Z14 A;  2EMS A;  1OMW A;  4H8S A;  4K81 A;  1ZM0 A;  2YT1 A;  2D9Y A;  2I5C A;  4MT7 A;  2D9X A;  4EKU A;  3KSY A;  4HAU B;  2V76 A;  3A8Q A;  4HB3 B;  2J59 M;  4L6E A;  2OQB A;  3SO6 A;  3KY9 A;  3PVW A;  2COA A;  1EVH A;  4K2P A;  4HDO A;  1TJ6 A;  2M14 A;  2P0F A;  1FGY A;  1U2B A;  1TXD A;  2ELA A;  5DH9 B;  2YF0 A;  3HQC A;  5D3V A;  1AWE A;  5C5B A;  1MK9 B;  4GOU A;  1EGX A;  1NTV A;  4GPT B;  3CXB B;  4DXA B;  3AU5 A;  4A6H A;  5KQ4 A;  3D8D A;  4MK0 A;  2DHK A;  5D3Y A;  1P6S A;  3PZD A;  2IFS A;  1MPH A;  4HB4 B;  3QIJ A;  2I1K A;  4HAX B;  1V5P A;  2QKL A;  1SHC A;  5CLL B;  2NMB A;  1Z87 A;  4QJ5 B;  4C0A A;  1SGH A;  2E2X A;  4GMV A;  1XKE A;  2DX1 A;  5KQ1 A;  2BCJ A;  2LUL A;  4BBK A;  2GJY A;  1FHW A;  1WGQ A;  2CY4 A;  3F0W A;  3VOQ A;  3U12 A;  3MDB C;  2MKR A;  2ELB A;  2CRF A;  1KI1 B;  2DFK A;  2CAY A;  4CHM A;  4XWX A;  4A6F B;  2EJ8 A;  1XX0 A;  3SYX A;  2AEH A;  2KIG A;  2R0D A;  5JHH A;  3G9W A;  1FB8 A;  4NY0 A;  1V61 A;  1ISN A;  4D0N B;  1ZYI A;  3PVL A;  3P6A A;  3BIN A;  2COD A;  3BJI A;  4ZRK A;  1U5E A;  3FEH A;  2D9Z A;  1ZVR A;  1AQC A;  2W2X C;  4WJ7 A;  2N0Y A;  5J3T A;  1WG7 A;  3PG7 A;  4KHO A;  5HE1 A;  1PFJ A;  1DBH A;  1X86 A;  3GYP A;  3TO1 A;  2N23 A;  2J0J A;  2DKP A;  3D8E A;  1H4R A;  3P7Z A;  2GS0 A;  2AL6 A;  1UNR A;  2D9W A;  3RCP A;  4WVF B;  1P3R A;  5D27 A;  3SNH A;  1P5T A;  2COC A;  2HTH B;  1DRO A;  3D8F A;  1GG3 A;  4HAZ B;  1V89 A;  2ROZ B;  2P0D A;  4ZRJ A;  3ULC A;  5J3Q A;  2GCJ A;  4KVG B;  1OQN A;  1H10 A;  2M38 A;  2P0H A; 
#chains in the Genus database with same CATH homology
 3QWM A;  3TCA A;  1B55 A;  2J0K A;  2Y8G A;  1QC6 A;  2K00 A;  2RSG A;  3TFM A;  1MAI A;  2FJL A;  2MDX A;  4HB0 B;  4YON A;  5L81 A;  1W1G A;  2MFQ A;  3OAN A;  4PNK A;  3MPX A;  3ODW A;  2RLO A;  4MY6 A;  1W1D A;  1LW3 A;  1BTK A;  1WVH A;  2NZ8 B;  4F7U P;  1U29 A;  2JP2 A;  3ULB A;  1GC7 A;  5EFX A;  1NTY A;  1I7A A;  2KUP A;  1E5W A;  5C79 A;  3CIK A;  4IFS A;  4K2O A;  4TYZ A;  5C5B B;  2P8V A;  3M1I B;  4DX8 A;  1J19 A;  3O96 A;  3UZT A;  1DDW A;  2VSZ A;  2H7D A;  4IOY X;  1WJ1 A;  4NSW A;  5FI1 A;  4F7H A;  1FAO A;  1UPQ A;  2DYN A;  4P7I A;  3U7D A;  3ZVR A;  1X05 A;  1Q67 A;  3A98 B;  1DDV A;  1WGU A;  1UNQ A;  1V88 A;  1I2H A;  2RUK B;  4EJN A;  5JHG A;  5DHA B;  4HHV A;  4CHJ A;  4GN1 A;  1V5U A;  3HW2 B;  2W2W A;  3WA0 A;  4EMO A;  2DX5 A;  3ODX A;  1MIZ B;  1FOE A;  3ODO A;  5CLQ B;  2UVM A;  2J0M A;  3T06 A;  2Y8F A;  3WYF B;  2Q13 A;  2YS1 A;  2VKI A;  1K5D B;  3ML4 A;  1J0W A;  2L1C A;  3PEG A;  2ADZ A;  4A6F A;  2K2J A;  4GXB A;  3GYO A;  2COF A;  3QBV B;  1NU2 A;  2YRY A;  5C16 A;  4HAW B;  4A5K A;  4ZRI A;  2LYD A;  1Y19 B;  1K5G B;  2DHI A;  5GOW B;  1EF1 A;  2YVC A;  4B6H A;  5HE3 A;  2EMT A;  2LKO A;  2QKM A;  1M7E A;  1OY2 A;  1FGZ A;  1QQG A;  1N3H A;  1M7R A;  5C6R A;  4PQ0 A;  1GC6 A;  2L2I A;  3A8P A;  5LON B;  3AJ4 A;  2MWN B;  2RGN B;  2EC1 A;  2K2U A;  5LOP B;  3VIA A;  5FI0 A;  1PMS A;  2I1J A;  1KZ7 A;  2IYB A;  3KRW A;  2LOX A;  4KAX B;  4K17 A;  1KZG A;  4TKN A;  4HAT B;  5KCV A;  5JP4 A;  2D4Q A;  3KRX A;  2DYQ A;  4WSF A;  1XR0 B;  1XD4 A;  1U5G A;  5DHF B;  4YL8 A;  1U5D A;  3AU4 A;  4HAY B;  2ROV A;  2I5F A;  1U5F A;  1ZSQ A;  4Z2M B;  2YSZ A;  2UZS A;  3HK0 A;  1FHO A;  3PVU A;  1MKE A;  2D10 A;  5DI9 B;  1BWN A;  1U27 A;  1WI1 A;  1LB1 A;  1Y5O A;  2HE7 A;  1PLS A;  2CY5 A;  2Z0P A;  3TVV A;  3KZ1 A;  2DHJ A;  2RNR B;  5D3W A;  4KHA A;  3IVF A;  4DBB A;  2LOZ A;  1BTN A;  1NI2 A;  3DXD A;  1IRS A;  3ZDT A;  4Z2N A;  4F7G A;  5HE0 A;  1UPR A;  1WJM A;  3SV1 A;  3U8Z A;  1MK7 B;  2YS5 A;  2XQN M;  2D11 A;  4KHB B;  3SUZ A;  1BAK A;  2PZ1 A;  2YT0 A;  1TQZ A;  1XCG A;  1X1G A;  2W2X D;  3N7C A;  2Z0O A;  3V5W A;  2ZPY A;  1MIX A;  2DA0 A;  3LJU X;  3DXE A;  4DX9 0;  2GCL A;  3F5R A;  2D9V A;  5D3X A;  4HDQ A;  2VRW B;  1DDM A;  2RVB B;  3DXC A;  1X1F A;  1DYN A;  2DTC A;  3NSU A;  5DIF B;  1XOD A;  2D2Q A;  4GMX B;  3X23 A;  1UNP A;  2DLW A;  2DKQ A;  2X18 A;  2OTX A;  3TW1 A;  4CYE A;  1RRP B;  3PP2 A;  5HE2 A;  4Y94 A;  4HB2 B;  1W1H A;  3PSC A;  1V5M A;  4IAP A;  2R09 A;  1ZC4 B;  2Z0Q A;  1RJ2 A;  1EAZ A;  2H7E A;  5J3Y A;  5JLJ B;  1UEF A;  2UZR A;  2G35 A;  1FHX A;  4HAV B;  1ZC3 B;  1X11 A;  3FM8 C;  2Y7B A;  2YS3 A;  2LG1 A;  4A6K A;  2KGX B;  2DN6 A;  3FSS A;  4GZU A;  2KCJ A;  2EMS A;  1OMW A;  4H8S A;  4K81 A;  1ZM0 A;  2YT1 A;  2D9Y A;  2I5C A;  4MT7 A;  2D9X A;  4EKU A;  3KSY A;  4HAU B;  2V76 A;  3A8Q A;  4HB3 B;  2J59 M;  4L6E A;  2OQB A;  3SO6 A;  3KY9 A;  3PVW A;  2COA A;  1EVH A;  4K2P A;  4HDO A;  1TJ6 A;  2M14 A;  2P0F A;  1FGY A;  1U2B A;  1TXD A;  2ELA A;  5DH9 B;  2YF0 A;  3HQC A;  5D3V A;  1AWE A;  5C5B A;  1MK9 B;  1EGX A;  1NTV A;  4GPT B;  3CXB B;  4DXA B;  3AU5 A;  4A6H A;  5KQ4 A;  3D8D A;  4MK0 A;  2DHK A;  5D3Y A;  1P6S A;  3PZD A;  2IFS A;  1MPH A;  4HB4 B;  3QIJ A;  2I1K A;  4HAX B;  1V5P A;  2QKL A;  1SHC A;  5CLL B;  2NMB A;  1Z87 A;  4C0A A;  1SGH A;  2E2X A;  4GMV A;  1XKE A;  2DX1 A;  5KQ1 A;  2BCJ A;  2LUL A;  4BBK A;  2GJY A;  1FHW A;  1WGQ A;  2CY4 A;  3F0W A;  3VOQ A;  3MDB C;  2MKR A;  2ELB A;  2CRF A;  1KI1 B;  2DFK A;  2CAY A;  4CHM A;  4XWX A;  4A6F B;  2EJ8 A;  1XX0 A;  3SYX A;  2AEH A;  2R0D A;  5JHH A;  3G9W A;  1FB8 A;  4NY0 A;  1V61 A;  1ISN A;  4D0N B;  3PVL A;  3P6A A;  3BIN A;  2COD A;  3BJI A;  4ZRK A;  1U5E A;  3FEH A;  2D9Z A;  1ZVR A;  1AQC A;  2W2X C;  4WJ7 A;  2N0Y A;  5J3T A;  1WG7 A;  3PG7 A;  4KHO A;  5HE1 A;  1PFJ A;  1DBH A;  1X86 A;  3GYP A;  3TO1 A;  2N23 A;  2J0J A;  2DKP A;  3D8E A;  1H4R A;  3P7Z A;  2GS0 A;  2AL6 A;  1UNR A;  2D9W A;  3RCP A;  4WVF B;  1P3R A;  5D27 A;  3SNH A;  1P5T A;  2COC A;  2HTH B;  1DRO A;  3D8F A;  1GG3 A;  4HAZ B;  1V89 A;  2ROZ B;  2P0D A;  4ZRJ A;  3ULC A;  5J3Q A;  2GCJ A;  4KVG B;  1OQN A;  1H10 A;  2M38 A;  2P0H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...