1XR0B

Structural basis of snt ptb domain interactions with distinct neurotrophic receptors
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
129
structure length
129
Chain Sequence
MGSDTVPDNHRNKFKVINVDDDGNELGSGIMELTDTELILYTRKRDSVKWHYLCLRRYGYDSNLFSFESGRRCQTGQGIFAFKCARAEELFNMLQEIMQNNSINVVEEPVVERNNHQTELEVPRTPRTP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein/growth factor receptor
molecule keywords Basic fibroblast growth factor receptor 1
publication title Structural Basis of SNT PTB Domain Interactions with Distinct Neurotrophic Receptors
pubmed doi rcsb
source organism Homo sapiens
total genus 14
structure length 129
sequence length 129
ec nomenclature
pdb deposition date 2004-10-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02174 IRS PTB domain (IRS-1 type)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 1xr0B01
2RNRB 1BWNA 3LJUX 3VIAA 2LOXA 4A5KA 3PEGA 4K81A 2R09A 2J0KA 1U29A 4MK0A 2D9VA 2FJLA 1UPQA 2HE7A 2ELAA 2EJ8A 2AL6A 3U8ZA 2VSZA 3DXCA 5C5BA 3FM8C 3KY9A 3MPXA 2ELBA 3NSUA 1FGZA 1PLSA 2EC1A 2D11A 2KUPA 4DX8A 3G9WA 5FI0A 2DN6A 2R0DA 5D3XA 5HE2A 2COAA 4GZUA 3PG7A 2Z0QA 1FHXA 3DXDA 3BINA 1K5GB 5KQ1A 4DXAB 4K17A 2JP2A 2MKRA 5L81A 1MKEA 2Y7BA 5J3YA 1IRSA 4HB0B 4MT7A 1V5PA 1QC6A 4CHJA 1NI2A 1WJ1A 5C6RA 4KHBB 5JHHA 2YS1A 1P5TA 4WJ7A 1AWEA 1ZSQA 2Y8GA 1X86A 3FEHA 3QWMA 1E5WA 1EF1A 3P7ZA 2D9YA 4HB2B 1EGXA 1FB8A 1OQNA 4HAYB 1XR0B 1FGYA 4TKNA 1I7AA 5J3TA 4HAWB 5CLQB 4YONA 3ODWA 1DYNA 2Y8FA 2OTXA 5D3VA 1GG3A 2LULA 3M1IB 1MIZB 2ADZA 3ML4A 3CIKA 3T06A 2J59M 1DDWA 2W2WA 1U2BA 1H4RA 2GCJA 3UZTA 1NTYA 2NZ8B 2K2JA 1ISNA 4H8SA 1TXDA 1Y19B 1RJ2A 1X05A 2D4QA 2IFSA 2RLOA 3KSYA 4HB4B 5C5BB 4Z2MB 1WGUA 1PMSA 2DTCA 2GS0A 2YT1A 2M14A 2DKPA 3CXBB 4PNKA 4A6HA 3TFMA 2DKQA 2Z0PA 4HAUB 1M7EA 1U5GA 2BCJA 5JHGA 2CODA 2RUKB 1BAKA 4HDOA 3WA0A 2P0FA 1FAOA 5C79A 3ULCA 1V5UA 1NU2A 1H10A 3F5RA 2DX1A 1U5FA 1V5MA 3SO6A 2D9ZA 1ZVRA 4GXBA 5DHAB 5EFXA 4EJNA 2COFA 2EMTA 2M38A 2VRWB 1GC6A 3VOQA 4KVGB 2P0HA 3MDBC 1XKEA 3N7CA 2K00A 4KHOA 2J0JA 2MFQA 2YS3A 3DXEA 3ZDTA 1LW3A 1BTKA 3PVWA 3ODOA 2X18A 1WVHA 1FOEA 3PP2A 4HAZB 2H7EA 1UEFA 2E2XA 2W2XC 2I1JA 2UZRA 5D3YA 4ZRKA 5J3QA 4KHAA 4GPTB 3O96A 3SUZA 2DLWA 1EAZA 4A6KA 1XX0A 2YVCA 1KZGA 4L6EA 3GYOA 4MY6A 2DHKA 3V5WA 3ZVRA 4NSWA 5DIFB 3BJIA 2XQNM 2I5FA 1LB1A 2EMSA 3AJ4A 3D8FA 2NMBA 1U5DA 1NTVA 1TQZA 3QIJA 4IOYX 1DDVA 4HB3B 3HQCA 2ROVA 3D8DA 1UNRA 5DI9B 5CLLB 2QKLA 2N23A 1MAIA 1W1GA 2DYNA 1UNQA 2W2XD 1WJMA 2I1KA 3SV1A 5HE0A 3WYFB 4B6HA 2P0DA 4GMVA 2OQBA 1ZC4B 2YRYA 1N3HA 2I5CA 4P7IA 4TYZA 2IYBA 2DHJA 3HK0A 2LOZA 1UPRA 2YF0A 1WI1A 4K2OA 2V76A 4Y94A 3OANA 2LG1A 1U5EA 4F7UP 1U27A 3X23A 1P6SA 5LOPB 1Q67A 5D27A 5FI1A 2GCLA 1DDMA 2CRFA 3PZDA 1BTNA 5D3WA 3KRWA 3SNHA 3F0WA 1K5DB 2YT0A 1DBHA 2RVBB 5C16A 4WSFA 4HAVB 2DHIA 3TCAA 2K2UA 1OMWA 2DX5A 1J0WA 2ZPYA 1W1DA 1SGHA 4NY0A 2Q13A 4DX90 4HDQA 3RCPA 1V88A 5HE3A 2YSZA 5JP4A 5HE1A 3PSCA 5KCVA 1SHCA 5LONB 2LYDA 2QKMA 3TO1A 1XODA 2RSGA 1FHOA 2DA0A 2KGXB 4XWXA 3AU4A 4HATB 2HTHB 1EVHA 2VKIA 4ZRIA 3U7DA 5DH9B 2RGNB 1XCGA 1DROA 1MIXA 2CY5A 1ZM0A 4CHMA 1ZC3B 1X11A 1Z87A 3TVVA 4ZRJA 1OY2A 4GN1A 1WGQA 2COCA 1WG7A 2H7DA 4DBBA 2L2IA 4EKUA 1B55A 2L1CA 2GJYA 1AQCA 4C0AA 2D9WA 4Z2NA 3GYPA 3D8EA 4PQ0A 2D9XA 1X1FA 4F7HA 3PVUA 1GC7A 2CY4A 3ULBA 4GMXB 2AEHA 2Z0OA 2LKOA 4KAXB 4WVFB 4IFSA 1I2HA 1MK7B 4IAPA 1UNPA 1FHWA 5KQ4A 3AU5A 1PFJA 3P6AA 4BBKA 3A8PA 2YS5A 1M7RA 5JLJB 1J19A 2DYQA 2J0MA 4A6FB 1MK9B 4YL8A 4D0NB 2G35A 5GOWB 2UZSA 1TJ6A 1X1GA 1KI1B 3QBVB 4K2PA 3IVFA 2MDXA 5DHFB 3SYXA 2D2QA 2DFKA 4HAXB 2PZ1A 1QQGA 3HW2B 3KZ1A 1V61A 1MPHA 3PVLA 3A98B 3ODXA 1RRPB 1V89A 3TW1A 1P3RA 2CAYA 4CYEA 2MWNB 1Y5OA 2UVMA 2ROZB 2N0YA 1W1HA 4HHVA 3FSSA 3KRXA 2KCJA 1XD4A 2P8VA 4A6FA 3A8QA 1KZ7A 4EMOA 2D10A 4F7GA
chains in the Genus database with same CATH superfamily
2RNRB 3OHMB 1BWNA 3LJUX 3VIAA 2LOXA 4A5KA 3PEGA 4K81A 2R09A 2J0KA 3U12A 1U29A 4MK0A 2KR0A 2D9VA 2FJLA 1UPQA 2HE7A 2ELAA 2EJ8A 2AL6A 3U8ZA 2VSZA 3DXCA 5C5BA 3FM8C 3KY9A 3MPXA 2ELBA 3NSUA 1FGZA 1PLSA 4QJ4B 2EC1A 2D11A 2KUPA 2NBVA 4DX8A 3G9WA 5FI0A 2DN6A 2R0DA 5D3XA 5HE2A 2COAA 4GZUA 3PG7A 2Z0QA 1FHXA 3DXDA 3BINA 1K5GB 3NW8A 5KQ1A 4DXAB 4K17A 2JP2A 2MKRA 5L81A 4OT1A 1MKEA 2Y7BA 5J3YA 1IRSA 4HB0B 4MT7A 1V5PA 1QC6A 4CHJA 1NI2A 1WJ1A 5C6RA 4KHBB 5JHHA 2YS1A 1P5TA 4WJ7A 1AWEA 1ZSQA 2Y8GA 4QJ5B 1X86A 3FEHA 3QWMA 1E5WA 1EF1A 3P7ZA 2D9YA 4HB2B 1EGXA 1FB8A 1OQNA 1T77A 4HAYB 1XR0B 1FGYA 4TKNA 1I7AA 5J3TA 4HAWB 5CLQB 4YONA 3ODWA 1DYNA 2Y8FA 2FJUB 2OTXA 5D3VA 1GG3A 2LULA 3M1IB 1MIZB 2ADZA 3ML4A 3CIKA 2R2YA 4CSQA 3T06A 2J59M 1DDWA 2W2WA 2ZKMX 1U2BA 1H4RA 4D6WA 2GCJA 3UZTA 1NTYA 2NZ8B 2K2JA 1ISNA 4H8SA 1TXDA 1Y19B 1RJ2A 1X05A 2K8EA 2D4QA 2YT2A 2IFSA 2RLOA 3KSYA 4HB4B 5C5BB 4Z2MB 1WGUA 1PMSA 2RRFA 2DTCA 2GS0A 2YT1A 4L1RA 2M14A 2DKPA 3CXBB 4PNKA 4A6HA 3TFMA 2DKQA 2Z0PA 2KIGA 4OSNA 4HAUB 1M7EA 1U5GA 2BCJA 5JHGA 2CODA 2RUKB 1BAKA 4HDOA 3WA0A 2P0FA 1FAOA 5C79A 3ULCA 1V5UA 1NU2A 1H10A 3F5RA 2DX1A 1U5FA 1V5MA 3SO6A 2D9ZA 1ZVRA 4GXBA 5DHAB 5EFXA 4EJNA 2COFA 2EMTA 2M38A 4QXAB 2VRWB 2KIEA 1GC6A 3VOQA 4KVGB 2P0HA 3MDBC 1XKEA 3N7CA 2K00A 4KHOA 2J0JA 2MFQA 2YS3A 3DXEA 3ZDTA 1LW3A 4DIXA 1BTKA 3PVWA 3ODOA 2X18A 1WVHA 1FOEA 3PP2A 4HAZB 2H7EA 1UEFA 2E2XA 2W2XC 4GOUA 2I1JA 2UZRA 5D3YA 4ZRKA 5J3QA 4KHAA 4GPTB 3NWAA 3O96A 3SUZA 2DLWA 5M4YB 1EAZA 4A6KA 1XX0A 2YVCA 1KZGA 4L6EA 3GYOA 4MY6A 2DHKA 3V5WA 2KUQA 3ZVRA 4NSWA 5DIFB 3BJIA 2XQNM 2I5FA 1LB1A 2EMSA 3AJ4A 3D8FA 2NMBA 1U5DA 1NTVA 1TQZA 3QIJA 4IOYX 1DDVA 4HB3B 3HQCA 2ROVA 3D8DA 1UNRA 5DI9B 4HSIA 5CLLB 2QKLA 2N23A 1MAIA 1W1GA 2DYNA 1UNQA 2W2XD 1WJMA 2I1KA 3SV1A 5HE0A 3WYFB 4B6HA 2P0DA 4GMVA 2OQBA 1ZC4B 2YRYA 1N3HA 2I5CA 2Z4DA 4P7IA 4TYZA 2IYBA 2DHJA 3HK0A 2LOZA 3NWDA 1UPRA 2YF0A 3HSAA 1WI1A 4K2OA 2V76A 4Y94A 3OANA 2LG1A 1U5EA 4F7UP 1U27A 3X23A 1ZYIA 1P6SA 5LOPB 1Q67A 5D27A 5FI1A 2GCLA 1DDMA 2CRFA 3PZDA 1BTNA 5D3WA 4QJ3B 3KRWA 3B77A 3SNHA 3F0WA 1K5DB 2YT0A 1DBHA 2RVBB 5C16A 4WSFA 4HAVB 2DHIA 3TCAA 2K2UA 1OMWA 2DX5A 1J0WA 2ZPYA 1W1DA 1SGHA 4NY0A 2Q13A 4DX90 4HDQA 3RCPA 1V88A 5HE3A 2YSZA 5JP4A 4GNKB 2Z14A 3PSCA 5HE1A 5KCVA 1SHCA 5LONB 2LYDA 2QKMA 3TO1A 2Z59A 1XODA 2GUMA 2RSGA 3HIEA 1FHOA 2DA0A 2KGXB 4XWXA 3AU4A 4HATB 2HTHB 1EVHA 2VKIA 4ZRIA 3U7DA 5DH9B 2RGNB 1XCGA 1DROA 1MIXA 2CY5A 1ZM0A 4CHMA 1ZC3B 1X11A 3FVCA 1Z87A 2Z13A 3TVVA 4ZRJA 1OY2A 4GN1A 1WGQA 2COCA 1WG7A 2H7DA 1MI1A 4DBBA 2L2IA 4EKUA 1B55A 2L1CA 2GJYA 1AQCA 4C0AA 2D9WA 4Z2NA 3GYPA 3D8EA 4PQ0A 2D9XA 1X1FA 4F7HA 3PVUA 1GC7A 2CY4A 3ULBA 4GMXB 2AEHA 2Z0OA 2LKOA 4KAXB 4WVFB 4IFSA 1I2HA 1MK7B 4IAPA 1UNPA 1FHWA 5KQ4A 3AU5A 1PFJA 3P6AA 4BBKA 3A8PA 2YS5A 5I2MA 1M7RA 5JLJB 1J19A 2DYQA 2J0MA 4KHBA 4A6FB 1MK9B 4YL8A 4D0NB 2G35A 5GOWB 2UZSA 1TJ6A 1X1GA 1KI1B 3QBVB 4K2PA 3IVFA 2MDXA 5DHFB 3SYXA 2D2QA 2DFKA 4HAXB 2PZ1A 1QQGA 3HW2B 3KZ1A 1V61A 1MPHA 3PVLA 3A98B 3ODXA 1RRPB 5I2SA 1V89A 3NWFA 3TW1A 1P3RA 2CAYA 4CYEA 3DCXA 2MWNB 1Y5OA 5LG4B 2UVMA 2ROZB 2N0YA 1W1HA 4HHVA 3FSSA 3KRXA 3A58A 2KCJA 1XD4A 2P8VA 5IRSA 4A6FA 2K49A 3A8QA 1KZ7A 4EMOA 2D10A 4F7GA
chains in the Genus database with same CATH topology
2RNRB 1BWNA 3LJUX 3VIAA 2LOXA 4A5KA 3PEGA 4K81A 2R09A 2J0KA 1U29A 4MK0A 2D9VA 2FJLA 1UPQA 2HE7A 2ELAA 2EJ8A 2AL6A 3U8ZA 2VSZA 3DXCA 5C5BA 3FM8C 3KY9A 3MPXA 2ELBA 3NSUA 1FGZA 1PLSA 2EC1A 2D11A 2KUPA 4DX8A 3G9WA 5FI0A 2DN6A 2R0DA 5D3XA 5HE2A 2COAA 4GZUA 3PG7A 2Z0QA 1FHXA 3DXDA 3BINA 1K5GB 5KQ1A 4DXAB 4K17A 2JP2A 2MKRA 5L81A 1MKEA 2Y7BA 5J3YA 1IRSA 4HB0B 4MT7A 1V5PA 1QC6A 4CHJA 1NI2A 1WJ1A 5C6RA 4KHBB 5JHHA 2YS1A 1P5TA 4WJ7A 1AWEA 1ZSQA 2Y8GA 1X86A 3FEHA 3QWMA 1E5WA 1EF1A 3P7ZA 2D9YA 4HB2B 1EGXA 1FB8A 1OQNA 4HAYB 1XR0B 1FGYA 4TKNA 1I7AA 5J3TA 4HAWB 5CLQB 4YONA 3ODWA 1DYNA 2Y8FA 2OTXA 5D3VA 1GG3A 2LULA 3M1IB 1MIZB 2ADZA 3ML4A 3CIKA 3T06A 2J59M 1DDWA 2W2WA 1U2BA 1H4RA 2GCJA 3UZTA 1NTYA 2NZ8B 2K2JA 1ISNA 4H8SA 1TXDA 1Y19B 1RJ2A 1X05A 2D4QA 2IFSA 2RLOA 3KSYA 4HB4B 5C5BB 4Z2MB 1WGUA 1PMSA 2DTCA 2GS0A 2YT1A 2M14A 2DKPA 3CXBB 4PNKA 4A6HA 3TFMA 2DKQA 2Z0PA 4HAUB 1M7EA 1U5GA 2BCJA 5JHGA 2CODA 2RUKB 1BAKA 4HDOA 3WA0A 2P0FA 1FAOA 5C79A 3ULCA 1V5UA 1NU2A 1H10A 3F5RA 2DX1A 1U5FA 1V5MA 3SO6A 2D9ZA 1ZVRA 4GXBA 5DHAB 5EFXA 4EJNA 2COFA 2EMTA 2M38A 2VRWB 1GC6A 3VOQA 4KVGB 2P0HA 3MDBC 1XKEA 3N7CA 2K00A 4KHOA 2J0JA 2MFQA 2YS3A 3DXEA 3ZDTA 1LW3A 1BTKA 3PVWA 3ODOA 2X18A 1WVHA 1FOEA 3PP2A 4HAZB 2H7EA 1UEFA 2E2XA 2W2XC 2I1JA 2UZRA 5D3YA 4ZRKA 5J3QA 4KHAA 4GPTB 3O96A 3SUZA 2DLWA 1EAZA 4A6KA 1XX0A 2YVCA 1KZGA 4L6EA 3GYOA 4MY6A 2DHKA 3V5WA 3ZVRA 4NSWA 5DIFB 3BJIA 2XQNM 2I5FA 1LB1A 2EMSA 3AJ4A 3D8FA 2NMBA 1U5DA 1NTVA 1TQZA 3QIJA 4IOYX 1DDVA 4HB3B 3HQCA 2ROVA 3D8DA 1UNRA 5DI9B 5CLLB 2QKLA 2N23A 1MAIA 1W1GA 2DYNA 1UNQA 2W2XD 1WJMA 2I1KA 3SV1A 5HE0A 3WYFB 4B6HA 2P0DA 4GMVA 2OQBA 1ZC4B 2YRYA 1N3HA 2I5CA 4P7IA 4TYZA 2IYBA 2DHJA 3HK0A 2LOZA 1UPRA 2YF0A 1WI1A 4K2OA 2V76A 4Y94A 3OANA 2LG1A 1U5EA 4F7UP 1U27A 3X23A 1P6SA 5LOPB 1Q67A 5D27A 5FI1A 2GCLA 1DDMA 2CRFA 3PZDA 1BTNA 5D3WA 3KRWA 3SNHA 3F0WA 1K5DB 2YT0A 1DBHA 2RVBB 5C16A 4WSFA 4HAVB 2DHIA 3TCAA 2K2UA 1OMWA 2DX5A 1J0WA 2ZPYA 1W1DA 1SGHA 4NY0A 2Q13A 4DX90 4HDQA 3RCPA 1V88A 5HE3A 2YSZA 5JP4A 5HE1A 3PSCA 5KCVA 1SHCA 5LONB 2LYDA 2QKMA 3TO1A 1XODA 2RSGA 1FHOA 2DA0A 2KGXB 4XWXA 3AU4A 4HATB 2HTHB 1EVHA 2VKIA 4ZRIA 3U7DA 5DH9B 2RGNB 1XCGA 1DROA 1MIXA 2CY5A 1ZM0A 4CHMA 1ZC3B 1X11A 1Z87A 3TVVA 4ZRJA 1OY2A 4GN1A 1WGQA 2COCA 1WG7A 2H7DA 4DBBA 2L2IA 4EKUA 1B55A 2L1CA 2GJYA 1AQCA 4C0AA 2D9WA 4Z2NA 3GYPA 3D8EA 4PQ0A 2D9XA 1X1FA 4F7HA 3PVUA 1GC7A 2CY4A 3ULBA 4GMXB 2AEHA 2Z0OA 2LKOA 4KAXB 4WVFB 4IFSA 1I2HA 1MK7B 4IAPA 1UNPA 1FHWA 5KQ4A 3AU5A 1PFJA 3P6AA 4BBKA 3A8PA 2YS5A 1M7RA 5JLJB 1J19A 2DYQA 2J0MA 4A6FB 1MK9B 4YL8A 4D0NB 2G35A 5GOWB 2UZSA 1TJ6A 1X1GA 1KI1B 3QBVB 4K2PA 3IVFA 2MDXA 5DHFB 3SYXA 2D2QA 2DFKA 4HAXB 2PZ1A 1QQGA 3HW2B 3KZ1A 1V61A 1MPHA 3PVLA 3A98B 3ODXA 1RRPB 1V89A 3TW1A 1P3RA 2CAYA 4CYEA 2MWNB 1Y5OA 2UVMA 2ROZB 2N0YA 1W1HA 4HHVA 3FSSA 3KRXA 2KCJA 1XD4A 2P8VA 4A6FA 3A8QA 1KZ7A 4EMOA 2D10A 4F7GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RNR B;  1BWN A;  3LJU X;  3VIA A;  2LOX A;  4A5K A;  3PEG A;  4K81 A;  2R09 A;  2J0K A;  1U29 A;  4MK0 A;  2D9V A;  2FJL A;  1UPQ A;  2HE7 A;  2ELA A;  2EJ8 A;  2AL6 A;  3U8Z A;  2VSZ A;  3DXC A;  5C5B A;  3FM8 C;  3KY9 A;  3MPX A;  2ELB A;  3NSU A;  1FGZ A;  1PLS A;  2EC1 A;  2D11 A;  2KUP A;  4DX8 A;  3G9W A;  5FI0 A;  2DN6 A;  2R0D A;  5D3X A;  5HE2 A;  2COA A;  4GZU A;  3PG7 A;  2Z0Q A;  1FHX A;  3DXD A;  3BIN A;  1K5G B;  5KQ1 A;  4DXA B;  4K17 A;  2JP2 A;  2MKR A;  5L81 A;  1MKE A;  2Y7B A;  5J3Y A;  1IRS A;  4HB0 B;  4MT7 A;  1V5P A;  1QC6 A;  4CHJ A;  1NI2 A;  1WJ1 A;  5C6R A;  4KHB B;  5JHH A;  2YS1 A;  1P5T A;  4WJ7 A;  1AWE A;  1ZSQ A;  2Y8G A;  1X86 A;  3FEH A;  3QWM A;  1E5W A;  1EF1 A;  3P7Z A;  2D9Y A;  4HB2 B;  1EGX A;  1FB8 A;  1OQN A;  4HAY B;  1XR0 B;  1FGY A;  4TKN A;  1I7A A;  5J3T A;  4HAW B;  5CLQ B;  4YON A;  3ODW A;  1DYN A;  2Y8F A;  2OTX A;  5D3V A;  1GG3 A;  2LUL A;  3M1I B;  1MIZ B;  2ADZ A;  3ML4 A;  3CIK A;  3T06 A;  2J59 M;  1DDW A;  2W2W A;  1U2B A;  1H4R A;  2GCJ A;  3UZT A;  1NTY A;  2NZ8 B;  2K2J A;  1ISN A;  4H8S A;  1TXD A;  1Y19 B;  1RJ2 A;  1X05 A;  2D4Q A;  2IFS A;  2RLO A;  3KSY A;  4HB4 B;  5C5B B;  4Z2M B;  1WGU A;  1PMS A;  2DTC A;  2GS0 A;  2YT1 A;  2M14 A;  2DKP A;  3CXB B;  4PNK A;  4A6H A;  3TFM A;  2DKQ A;  2Z0P A;  4HAU B;  1M7E A;  1U5G A;  2BCJ A;  5JHG A;  2COD A;  2RUK B;  1BAK A;  4HDO A;  3WA0 A;  2P0F A;  1FAO A;  5C79 A;  3ULC A;  1V5U A;  1NU2 A;  1H10 A;  3F5R A;  2DX1 A;  1U5F A;  1V5M A;  3SO6 A;  2D9Z A;  1ZVR A;  4GXB A;  5DHA B;  5EFX A;  4EJN A;  2COF A;  2EMT A;  2M38 A;  2VRW B;  1GC6 A;  3VOQ A;  4KVG B;  2P0H A;  3MDB C;  1XKE A;  3N7C A;  2K00 A;  4KHO A;  2J0J A;  2MFQ A;  2YS3 A;  3DXE A;  3ZDT A;  1LW3 A;  1BTK A;  3PVW A;  3ODO A;  2X18 A;  1WVH A;  1FOE A;  3PP2 A;  4HAZ B;  2H7E A;  1UEF A;  2E2X A;  2W2X C;  2I1J A;  2UZR A;  5D3Y A;  4ZRK A;  5J3Q A;  4KHA A;  4GPT B;  3O96 A;  3SUZ A;  2DLW A;  1EAZ A;  4A6K A;  1XX0 A;  2YVC A;  1KZG A;  4L6E A;  3GYO A;  4MY6 A;  2DHK A;  3V5W A;  3ZVR A;  4NSW A;  5DIF B;  3BJI A;  2XQN M;  2I5F A;  1LB1 A;  2EMS A;  3AJ4 A;  3D8F A;  2NMB A;  1U5D A;  1NTV A;  1TQZ A;  3QIJ A;  4IOY X;  1DDV A;  4HB3 B;  3HQC A;  2ROV A;  3D8D A;  1UNR A;  5DI9 B;  5CLL B;  2QKL A;  2N23 A;  1MAI A;  1W1G A;  2DYN A;  1UNQ A;  2W2X D;  1WJM A;  2I1K A;  3SV1 A;  5HE0 A;  3WYF B;  4B6H A;  2P0D A;  4GMV A;  2OQB A;  1ZC4 B;  2YRY A;  1N3H A;  2I5C A;  4P7I A;  4TYZ A;  2IYB A;  2DHJ A;  3HK0 A;  2LOZ A;  1UPR A;  2YF0 A;  1WI1 A;  4K2O A;  2V76 A;  4Y94 A;  3OAN A;  2LG1 A;  1U5E A;  4F7U P;  1U27 A;  3X23 A;  1P6S A;  5LOP B;  1Q67 A;  5D27 A;  5FI1 A;  2GCL A;  1DDM A;  2CRF A;  3PZD A;  1BTN A;  5D3W A;  3KRW A;  3SNH A;  3F0W A;  1K5D B;  2YT0 A;  1DBH A;  2RVB B;  5C16 A;  4WSF A;  4HAV B;  2DHI A;  3TCA A;  2K2U A;  1OMW A;  2DX5 A;  1J0W A;  2ZPY A;  1W1D A;  1SGH A;  4NY0 A;  2Q13 A;  4DX9 0;  4HDQ A;  3RCP A;  1V88 A;  5HE3 A;  2YSZ A;  5JP4 A;  5HE1 A;  3PSC A;  5KCV A;  1SHC A;  5LON B;  2LYD A;  2QKM A;  3TO1 A;  1XOD A;  2RSG A;  1FHO A;  2DA0 A;  2KGX B;  4XWX A;  3AU4 A;  4HAT B;  2HTH B;  1EVH A;  2VKI A;  4ZRI A;  3U7D A;  5DH9 B;  2RGN B;  1XCG A;  1DRO A;  1MIX A;  2CY5 A;  1ZM0 A;  4CHM A;  1ZC3 B;  1X11 A;  1Z87 A;  3TVV A;  4ZRJ A;  1OY2 A;  4GN1 A;  1WGQ A;  2COC A;  1WG7 A;  2H7D A;  4DBB A;  2L2I A;  4EKU A;  1B55 A;  2L1C A;  2GJY A;  1AQC A;  4C0A A;  2D9W A;  4Z2N A;  3GYP A;  3D8E A;  4PQ0 A;  2D9X A;  1X1F A;  4F7H A;  3PVU A;  1GC7 A;  2CY4 A;  3ULB A;  4GMX B;  2AEH A;  2Z0O A;  2LKO A;  4KAX B;  4WVF B;  4IFS A;  1I2H A;  1MK7 B;  4IAP A;  1UNP A;  1FHW A;  5KQ4 A;  3AU5 A;  1PFJ A;  3P6A A;  4BBK A;  3A8P A;  2YS5 A;  1M7R A;  5JLJ B;  1J19 A;  2DYQ A;  2J0M A;  4A6F B;  1MK9 B;  4YL8 A;  4D0N B;  2G35 A;  5GOW B;  2UZS A;  1TJ6 A;  1X1G A;  1KI1 B;  3QBV B;  4K2P A;  3IVF A;  2MDX A;  5DHF B;  3SYX A;  2D2Q A;  2DFK A;  4HAX B;  2PZ1 A;  1QQG A;  3HW2 B;  3KZ1 A;  1V61 A;  1MPH A;  3PVL A;  3A98 B;  3ODX A;  1RRP B;  1V89 A;  3TW1 A;  1P3R A;  2CAY A;  4CYE A;  2MWN B;  1Y5O A;  2UVM A;  2ROZ B;  2N0Y A;  1W1H A;  4HHV A;  3FSS A;  3KRX A;  2KCJ A;  1XD4 A;  2P8V A;  4A6F A;  3A8Q A;  1KZ7 A;  4EMO A;  2D10 A;  4F7G A; 
#chains in the Genus database with same CATH topology
 2RNR B;  3OHM B;  1BWN A;  3LJU X;  3VIA A;  2LOX A;  4A5K A;  3PEG A;  4K81 A;  2R09 A;  2J0K A;  3U12 A;  1U29 A;  4MK0 A;  2KR0 A;  2D9V A;  2FJL A;  1UPQ A;  2HE7 A;  2ELA A;  2EJ8 A;  2AL6 A;  3U8Z A;  2VSZ A;  3DXC A;  5C5B A;  3FM8 C;  3KY9 A;  3MPX A;  2ELB A;  3NSU A;  1FGZ A;  1PLS A;  4QJ4 B;  2EC1 A;  2D11 A;  2KUP A;  2NBV A;  4DX8 A;  3G9W A;  5FI0 A;  2DN6 A;  2R0D A;  5D3X A;  5HE2 A;  2COA A;  4GZU A;  3PG7 A;  2Z0Q A;  1FHX A;  3DXD A;  3BIN A;  1K5G B;  3NW8 A;  5KQ1 A;  4DXA B;  4K17 A;  2JP2 A;  2MKR A;  5L81 A;  4OT1 A;  1MKE A;  2Y7B A;  5J3Y A;  1IRS A;  4HB0 B;  4MT7 A;  1V5P A;  1QC6 A;  4CHJ A;  1NI2 A;  1WJ1 A;  5C6R A;  4KHB B;  5JHH A;  2YS1 A;  1P5T A;  4WJ7 A;  1AWE A;  1ZSQ A;  2Y8G A;  4QJ5 B;  1X86 A;  3FEH A;  3QWM A;  1E5W A;  1EF1 A;  3P7Z A;  2D9Y A;  4HB2 B;  1EGX A;  1FB8 A;  1OQN A;  1T77 A;  4HAY B;  1XR0 B;  1FGY A;  4TKN A;  1I7A A;  5J3T A;  4HAW B;  5CLQ B;  4YON A;  3ODW A;  1DYN A;  2Y8F A;  2FJU B;  2OTX A;  5D3V A;  1GG3 A;  2LUL A;  3M1I B;  1MIZ B;  2ADZ A;  3ML4 A;  3CIK A;  2R2Y A;  4CSQ A;  3T06 A;  2J59 M;  1DDW A;  2W2W A;  2ZKM X;  1U2B A;  1H4R A;  4D6W A;  2GCJ A;  3UZT A;  1NTY A;  2NZ8 B;  2K2J A;  1ISN A;  4H8S A;  1TXD A;  1Y19 B;  1RJ2 A;  1X05 A;  2K8E A;  2D4Q A;  2YT2 A;  2IFS A;  2RLO A;  3KSY A;  4HB4 B;  5C5B B;  4Z2M B;  1WGU A;  1PMS A;  2RRF A;  2DTC A;  2GS0 A;  2YT1 A;  4L1R A;  2M14 A;  2DKP A;  3CXB B;  4PNK A;  4A6H A;  3TFM A;  2DKQ A;  2Z0P A;  2KIG A;  4OSN A;  4HAU B;  1M7E A;  1U5G A;  2BCJ A;  5JHG A;  2COD A;  2RUK B;  1BAK A;  4HDO A;  3WA0 A;  2P0F A;  1FAO A;  5C79 A;  3ULC A;  1V5U A;  1NU2 A;  1H10 A;  3F5R A;  2DX1 A;  1U5F A;  1V5M A;  3SO6 A;  2D9Z A;  1ZVR A;  4GXB A;  5DHA B;  5EFX A;  4EJN A;  2COF A;  2EMT A;  2M38 A;  4QXA B;  2VRW B;  2KIE A;  1GC6 A;  3VOQ A;  4KVG B;  2P0H A;  3MDB C;  1XKE A;  3N7C A;  2K00 A;  4KHO A;  2J0J A;  2MFQ A;  2YS3 A;  3DXE A;  3ZDT A;  1LW3 A;  4DIX A;  1BTK A;  3PVW A;  3ODO A;  2X18 A;  1WVH A;  1FOE A;  3PP2 A;  4HAZ B;  2H7E A;  1UEF A;  2E2X A;  2W2X C;  4GOU A;  2I1J A;  2UZR A;  5D3Y A;  4ZRK A;  5J3Q A;  4KHA A;  4GPT B;  3NWA A;  3O96 A;  3SUZ A;  2DLW A;  5M4Y B;  1EAZ A;  4A6K A;  1XX0 A;  2YVC A;  1KZG A;  4L6E A;  3GYO A;  4MY6 A;  2DHK A;  3V5W A;  2KUQ A;  3ZVR A;  4NSW A;  5DIF B;  3BJI A;  2XQN M;  2I5F A;  1LB1 A;  2EMS A;  3AJ4 A;  3D8F A;  2NMB A;  1U5D A;  1NTV A;  1TQZ A;  3QIJ A;  4IOY X;  1DDV A;  4HB3 B;  3HQC A;  2ROV A;  3D8D A;  1UNR A;  5DI9 B;  4HSI A;  5CLL B;  2QKL A;  2N23 A;  1MAI A;  1W1G A;  2DYN A;  1UNQ A;  2W2X D;  1WJM A;  2I1K A;  3SV1 A;  5HE0 A;  3WYF B;  4B6H A;  2P0D A;  4GMV A;  2OQB A;  1ZC4 B;  2YRY A;  1N3H A;  2I5C A;  2Z4D A;  4P7I A;  4TYZ A;  2IYB A;  2DHJ A;  3HK0 A;  2LOZ A;  3NWD A;  1UPR A;  2YF0 A;  3HSA A;  1WI1 A;  4K2O A;  2V76 A;  4Y94 A;  3OAN A;  2LG1 A;  1U5E A;  4F7U P;  1U27 A;  3X23 A;  1ZYI A;  1P6S A;  5LOP B;  1Q67 A;  5D27 A;  5FI1 A;  2GCL A;  1DDM A;  2CRF A;  3PZD A;  1BTN A;  5D3W A;  4QJ3 B;  3KRW A;  3B77 A;  3SNH A;  3F0W A;  1K5D B;  2YT0 A;  1DBH A;  2RVB B;  5C16 A;  4WSF A;  4HAV B;  2DHI A;  3TCA A;  2K2U A;  1OMW A;  2DX5 A;  1J0W A;  2ZPY A;  1W1D A;  1SGH A;  4NY0 A;  2Q13 A;  4DX9 0;  4HDQ A;  3RCP A;  1V88 A;  5HE3 A;  2YSZ A;  5JP4 A;  4GNK B;  2Z14 A;  3PSC A;  5HE1 A;  5KCV A;  1SHC A;  5LON B;  2LYD A;  2QKM A;  3TO1 A;  2Z59 A;  1XOD A;  2GUM A;  2RSG A;  3HIE A;  1FHO A;  2DA0 A;  2KGX B;  4XWX A;  3AU4 A;  4HAT B;  2HTH B;  1EVH A;  2VKI A;  4ZRI A;  3U7D A;  5DH9 B;  2RGN B;  1XCG A;  1DRO A;  1MIX A;  2CY5 A;  1ZM0 A;  4CHM A;  1ZC3 B;  1X11 A;  3FVC A;  1Z87 A;  2Z13 A;  3TVV A;  4ZRJ A;  1OY2 A;  4GN1 A;  1WGQ A;  2COC A;  1WG7 A;  2H7D A;  1MI1 A;  4DBB A;  2L2I A;  4EKU A;  1B55 A;  2L1C A;  2GJY A;  1AQC A;  4C0A A;  2D9W A;  4Z2N A;  3GYP A;  3D8E A;  4PQ0 A;  2D9X A;  1X1F A;  4F7H A;  3PVU A;  1GC7 A;  2CY4 A;  3ULB A;  4GMX B;  2AEH A;  2Z0O A;  2LKO A;  4KAX B;  4WVF B;  4IFS A;  1I2H A;  1MK7 B;  4IAP A;  1UNP A;  1FHW A;  5KQ4 A;  3AU5 A;  1PFJ A;  3P6A A;  4BBK A;  3A8P A;  2YS5 A;  5I2M A;  1M7R A;  5JLJ B;  1J19 A;  2DYQ A;  2J0M A;  4KHB A;  4A6F B;  1MK9 B;  4YL8 A;  4D0N B;  2G35 A;  5GOW B;  2UZS A;  1TJ6 A;  1X1G A;  1KI1 B;  3QBV B;  4K2P A;  3IVF A;  2MDX A;  5DHF B;  3SYX A;  2D2Q A;  2DFK A;  4HAX B;  2PZ1 A;  1QQG A;  3HW2 B;  3KZ1 A;  1V61 A;  1MPH A;  3PVL A;  3A98 B;  3ODX A;  1RRP B;  5I2S A;  1V89 A;  3NWF A;  3TW1 A;  1P3R A;  2CAY A;  4CYE A;  3DCX A;  2MWN B;  1Y5O A;  5LG4 B;  2UVM A;  2ROZ B;  2N0Y A;  1W1H A;  4HHV A;  3FSS A;  3KRX A;  3A58 A;  2KCJ A;  1XD4 A;  2P8V A;  5IRS A;  4A6F A;  2K49 A;  3A8Q A;  1KZ7 A;  4EMO A;  2D10 A;  4F7G A; 
#chains in the Genus database with same CATH homology
 2RNR B;  1BWN A;  3LJU X;  3VIA A;  2LOX A;  4A5K A;  3PEG A;  4K81 A;  2R09 A;  2J0K A;  1U29 A;  4MK0 A;  2D9V A;  2FJL A;  1UPQ A;  2HE7 A;  2ELA A;  2EJ8 A;  2AL6 A;  3U8Z A;  2VSZ A;  3DXC A;  5C5B A;  3FM8 C;  3KY9 A;  3MPX A;  2ELB A;  3NSU A;  1FGZ A;  1PLS A;  2EC1 A;  2D11 A;  2KUP A;  4DX8 A;  3G9W A;  5FI0 A;  2DN6 A;  2R0D A;  5D3X A;  5HE2 A;  2COA A;  4GZU A;  3PG7 A;  2Z0Q A;  1FHX A;  3DXD A;  3BIN A;  1K5G B;  5KQ1 A;  4DXA B;  4K17 A;  2JP2 A;  2MKR A;  5L81 A;  1MKE A;  2Y7B A;  5J3Y A;  1IRS A;  4HB0 B;  4MT7 A;  1V5P A;  1QC6 A;  4CHJ A;  1NI2 A;  1WJ1 A;  5C6R A;  4KHB B;  5JHH A;  2YS1 A;  1P5T A;  4WJ7 A;  1AWE A;  1ZSQ A;  2Y8G A;  1X86 A;  3FEH A;  3QWM A;  1E5W A;  1EF1 A;  3P7Z A;  2D9Y A;  4HB2 B;  1EGX A;  1FB8 A;  1OQN A;  4HAY B;  1XR0 B;  1FGY A;  4TKN A;  1I7A A;  5J3T A;  4HAW B;  5CLQ B;  4YON A;  3ODW A;  1DYN A;  2Y8F A;  2OTX A;  5D3V A;  1GG3 A;  2LUL A;  3M1I B;  1MIZ B;  2ADZ A;  3ML4 A;  3CIK A;  3T06 A;  2J59 M;  1DDW A;  2W2W A;  1U2B A;  1H4R A;  2GCJ A;  3UZT A;  1NTY A;  2NZ8 B;  2K2J A;  1ISN A;  4H8S A;  1TXD A;  1Y19 B;  1RJ2 A;  1X05 A;  2D4Q A;  2IFS A;  2RLO A;  3KSY A;  4HB4 B;  5C5B B;  4Z2M B;  1WGU A;  1PMS A;  2DTC A;  2GS0 A;  2YT1 A;  2M14 A;  2DKP A;  3CXB B;  4PNK A;  4A6H A;  3TFM A;  2DKQ A;  2Z0P A;  4HAU B;  1M7E A;  1U5G A;  2BCJ A;  5JHG A;  2COD A;  2RUK B;  1BAK A;  4HDO A;  3WA0 A;  2P0F A;  1FAO A;  5C79 A;  3ULC A;  1V5U A;  1NU2 A;  1H10 A;  3F5R A;  2DX1 A;  1U5F A;  1V5M A;  3SO6 A;  2D9Z A;  1ZVR A;  4GXB A;  5DHA B;  5EFX A;  4EJN A;  2COF A;  2EMT A;  2M38 A;  2VRW B;  1GC6 A;  3VOQ A;  4KVG B;  2P0H A;  3MDB C;  1XKE A;  3N7C A;  2K00 A;  4KHO A;  2J0J A;  2MFQ A;  2YS3 A;  3DXE A;  3ZDT A;  1LW3 A;  1BTK A;  3PVW A;  3ODO A;  2X18 A;  1WVH A;  1FOE A;  3PP2 A;  4HAZ B;  2H7E A;  1UEF A;  2E2X A;  2W2X C;  2I1J A;  2UZR A;  5D3Y A;  4ZRK A;  5J3Q A;  4KHA A;  4GPT B;  3O96 A;  3SUZ A;  2DLW A;  1EAZ A;  4A6K A;  1XX0 A;  2YVC A;  1KZG A;  4L6E A;  3GYO A;  4MY6 A;  2DHK A;  3V5W A;  3ZVR A;  4NSW A;  5DIF B;  3BJI A;  2XQN M;  2I5F A;  1LB1 A;  2EMS A;  3AJ4 A;  3D8F A;  2NMB A;  1U5D A;  1NTV A;  1TQZ A;  3QIJ A;  4IOY X;  1DDV A;  4HB3 B;  3HQC A;  2ROV A;  3D8D A;  1UNR A;  5DI9 B;  5CLL B;  2QKL A;  2N23 A;  1MAI A;  1W1G A;  2DYN A;  1UNQ A;  2W2X D;  1WJM A;  2I1K A;  3SV1 A;  5HE0 A;  3WYF B;  4B6H A;  2P0D A;  4GMV A;  2OQB A;  1ZC4 B;  2YRY A;  1N3H A;  2I5C A;  4P7I A;  4TYZ A;  2IYB A;  2DHJ A;  3HK0 A;  2LOZ A;  1UPR A;  2YF0 A;  1WI1 A;  4K2O A;  2V76 A;  4Y94 A;  3OAN A;  2LG1 A;  1U5E A;  4F7U P;  1U27 A;  3X23 A;  1P6S A;  5LOP B;  1Q67 A;  5D27 A;  5FI1 A;  2GCL A;  1DDM A;  2CRF A;  3PZD A;  1BTN A;  5D3W A;  3KRW A;  3SNH A;  3F0W A;  1K5D B;  2YT0 A;  1DBH A;  2RVB B;  5C16 A;  4WSF A;  4HAV B;  2DHI A;  3TCA A;  2K2U A;  1OMW A;  2DX5 A;  1J0W A;  2ZPY A;  1W1D A;  1SGH A;  4NY0 A;  2Q13 A;  4DX9 0;  4HDQ A;  3RCP A;  1V88 A;  5HE3 A;  2YSZ A;  5JP4 A;  5HE1 A;  3PSC A;  5KCV A;  1SHC A;  5LON B;  2LYD A;  2QKM A;  3TO1 A;  1XOD A;  2RSG A;  1FHO A;  2DA0 A;  2KGX B;  4XWX A;  3AU4 A;  4HAT B;  2HTH B;  1EVH A;  2VKI A;  4ZRI A;  3U7D A;  5DH9 B;  2RGN B;  1XCG A;  1DRO A;  1MIX A;  2CY5 A;  1ZM0 A;  4CHM A;  1ZC3 B;  1X11 A;  1Z87 A;  3TVV A;  4ZRJ A;  1OY2 A;  4GN1 A;  1WGQ A;  2COC A;  1WG7 A;  2H7D A;  4DBB A;  2L2I A;  4EKU A;  1B55 A;  2L1C A;  2GJY A;  1AQC A;  4C0A A;  2D9W A;  4Z2N A;  3GYP A;  3D8E A;  4PQ0 A;  2D9X A;  1X1F A;  4F7H A;  3PVU A;  1GC7 A;  2CY4 A;  3ULB A;  4GMX B;  2AEH A;  2Z0O A;  2LKO A;  4KAX B;  4WVF B;  4IFS A;  1I2H A;  1MK7 B;  4IAP A;  1UNP A;  1FHW A;  5KQ4 A;  3AU5 A;  1PFJ A;  3P6A A;  4BBK A;  3A8P A;  2YS5 A;  1M7R A;  5JLJ B;  1J19 A;  2DYQ A;  2J0M A;  4A6F B;  1MK9 B;  4YL8 A;  4D0N B;  2G35 A;  5GOW B;  2UZS A;  1TJ6 A;  1X1G A;  1KI1 B;  3QBV B;  4K2P A;  3IVF A;  2MDX A;  5DHF B;  3SYX A;  2D2Q A;  2DFK A;  4HAX B;  2PZ1 A;  1QQG A;  3HW2 B;  3KZ1 A;  1V61 A;  1MPH A;  3PVL A;  3A98 B;  3ODX A;  1RRP B;  1V89 A;  3TW1 A;  1P3R A;  2CAY A;  4CYE A;  2MWN B;  1Y5O A;  2UVM A;  2ROZ B;  2N0Y A;  1W1H A;  4HHV A;  3FSS A;  3KRX A;  2KCJ A;  1XD4 A;  2P8V A;  4A6F A;  3A8Q A;  1KZ7 A;  4EMO A;  2D10 A;  4F7G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...