1XR0B

Structural basis of snt ptb domain interactions with distinct neurotrophic receptors
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
129
structure length
129
Chain Sequence
MGSDTVPDNHRNKFKVINVDDDGNELGSGIMELTDTELILYTRKRDSVKWHYLCLRRYGYDSNLFSFESGRRCQTGQGIFAFKCARAEELFNMLQEIMQNNSINVVEEPVVERNNHQTELEVPRTPRTP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis of SNT PTB Domain Interactions with Distinct Neurotrophic Receptors
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein/growth factor receptor
molecule keywords Basic fibroblast growth factor receptor 1
total genus 14
structure length 129
sequence length 129
ec nomenclature
pdb deposition date 2004-10-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02174 IRS PTB domain (IRS-1 type)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 1xr0B01
4P7IA 4GZUA 2CODA 2DA0A 1NI2A 2L2IA 2FJLA 5DI9B 2D9YA 2K00A 1NU2A 2ZPYA 1DROA 3PZDA 3PG7A 5DHFB 2ADZA 5LOPB 5LONB 1FGYA 2N0YA 3AU4A 2YS1A 1WGUA 3LJUX 1OQNA 1W1HA 3SUZA 1GG3A 2I5CA 2RNRB 1QC6A 2COCA 2RSGA 1WJ1A 1FAOA 2ELAA 1IRSA 3G9WA 3PEGA 1TQZA 4B6HA 2K2UA 2GS0A 2QKLA 2D2QA 2RUKB 4HDOA 2V76A 1XCGA 1B55A 3P7ZA 2M14A 2D9WA 5D3XA 4KHBB 4HATB 3KRXA 2KGXB 1WI1A 4PQ0A 4K17A 1FGZA 2COAA 3U7DA 4K2OA 4EKUA 4HHVA 5C16A 3M1IB 5HE2A 2H7DA 5D3WA 2G35A 1U5EA 3HQCA 2P8VA 1MIXA 2NMBA 1AWEA 3SYXA 4IOYX 1EGXA 4GMVA 2M38A 2L1CA 4CHJA 2ROVA 3TW1A 2OQBA 4A6FA 5CLLB 1U5DA 1MPHA 2AL6A 1TXDA 4WVFB 2CRFA 2R0DA 5L81A 2UZRA 4HB0B 4C0AA 1J0WA 2BCJA 4HAZB 4BBKA 1X1FA 1BWNA 4CHMA 1KI1B 2LG1A 5D27A 2KUPA 1DBHA 2D9VA 4GPTB 2DHKA 2Y8FA 2CAYA 3DXEA 1OY2A 3D8DA 3ZVRA 3KSYA 1Q67A 2DTCA 3VOQA 2X18A 4TYZA 2DX5A 5D3YA 2RLOA 3N7CA 1H4RA 3HW2B 4F7HA 1V5PA 1FB8A 3RCPA 3X23A 1WVHA 2LOZA 2J0JA 2P0FA 1UPQA 1UNPA 2XQNM 1MAIA 1SHCA 1FHXA 3QIJA 5D3VA 1V61A 2LOXA 2D4QA 3WA0A 4HB2B 3WYFB 4MT7A 3V5WA 1FOEA 1RJ2A 4HB4B 3TO1A 5DHAB 4YL8A 5JHGA 2YVCA 1X11A 1UEFA 1MKEA 1P6SA 4IAPA 3AU5A 1EVHA 3TVVA 2J59M 1P3RA 4WSFA 2CY4A 4YONA 1QQGA 5JLJB 2D9XA 5J3QA 1NTYA 2D10A 3ULCA 3ODWA 5HE3A 1M7RA 4K2PA 3D8FA 2IYBA 4KHAA 2YT1A 4A6FB 1BTKA 2DYNA 2EJ8A 1FHOA 5JP4A 2ROZB 4MK0A 1DDMA 2R09A 2DLWA 1P5TA 1MIZB 2DN6A 4GXBA 5HE1A 3OANA 2RVBB 5C6RA 1RRPB 3F0WA 2KCJA 4KHOA 1V88A 3VIAA 1UNQA 1PMSA 1ISNA 2DYQA 5FI1A 3TCAA 1ZM0A 5HE0A 3NSUA 2I5FA 4Z2MB 4NY0A 2ELBA 2H7EA 3IVFA 3U8ZA 3PVWA 3MDBC 3SO6A 1X86A 2Z0PA 4DX90 2YSZA 3PVLA 1BTNA 4DXAB 3AJ4A 2I1JA 1E5WA 1K5GB 3D8EA 2P0HA 5KCVA 3UZTA 4CYEA 2DHIA 2I1KA 4ZRIA 2DX1A 4HAYB 4DX8A 4D0NB 4MY6A 3MPXA 1J19A 1K5DB 1Y19B 2W2XC 1Z87A 1V89A 2RGNB 1Y5OA 2DFKA 4EMOA 3FEHA 2EC1A 2YF0A 4ZRKA 2YRYA 5GOWB 3PP2A 2IFSA 1M7EA 2W2XD 1XODA 1ZC3B 2MDXA 5EFXA 1WG7A 5C5BB 1X05A 5FI0A 1H10A 4HB3B 5DIFB 2N23A 4L6EA 3A8QA 3DXDA 1SGHA 1KZ7A 2OTXA 1TJ6A 3ML4A 2EMTA 3A98B 4KAXB 1NTVA 4A5KA 1GC7A 4A6KA 1UPRA 3ZDTA 2AEHA 2MKRA 2Q13A 3KRWA 1PLSA 5J3YA 2P0DA 1EAZA 4GMXB 2COFA 3SNHA 3F5RA 2EMSA 1WGQA 2DKPA 1XR0B 1XKEA 2NZ8B 1U5GA 4H8SA 1V5MA 2MFQA 1V5UA 2Z0OA 2Z0QA 3HK0A 3O96A 4TKNA 3BJIA 4HAUB 4HAVB 4ZRJA 1U2BA 3TFMA 3CIKA 1ZVRA 2MWNB 1WJMA 1UNRA 4K81A 1FHWA 1ZC4B 2GCLA 2LYDA 5JHHA 4PNKA 1LB1A 1ZSQA 1I7AA 3CXBB 4Z2NA 1DDVA 5C79A 1OMWA 1W1DA 2JP2A 1AQCA 3FSSA 4HAWB 3KZ1A 1XD4A 2GCJA 2K2JA 4Y94A 4F7UP 5KQ1A 3ODOA 2UVMA 2E2XA 4HDQA 5KQ4A 1DDWA 1KZGA 3ODXA 2HE7A 2YS3A 4HAXB 5DH9B 1DYNA 1BAKA 1U5FA 3P6AA 2QKMA 1MK7B 1EF1A 2VRWB 3QBVB 2YS5A 1U27A 3KY9A 3T06A 3BINA 3SV1A 1X1GA 2J0MA 2GJYA 2UZSA 2J0KA 5CLQB 2LULA 2DHJA 3GYPA 1XX0A 1LW3A 4NSWA 2HTHB 2PZ1A 2Y7BA 1MK9B 4KVGB 5C5BA 1GC6A 4GN1A 4XWXA 1N3HA 2YT0A 3ULBA 1I2HA 2W2WA 3A8PA 4WJ7A 4IFSA 2VKIA 2LKOA 5J3TA 3PSCA 2D11A 4EJNA 3GYOA 2VSZA 2Y8GA 3DXCA 4DBBA 2CY5A 1U29A 2D9ZA 2DKQA 4F7GA 4A6HA 1PFJA 3PVUA 1W1GA 3FM8C 3QWMA
chains in the Genus database with same CATH superfamily
4P7IA 4GZUA 2CODA 2DA0A 1NI2A 2L2IA 2FJLA 5DI9B 2D9YA 2K00A 1NU2A 2ZPYA 1DROA 3PZDA 3PG7A 5DHFB 2ADZA 5LOPB 5LONB 1FGYA 2N0YA 3AU4A 2YS1A 1WGUA 3LJUX 1OQNA 1W1HA 3SUZA 1GG3A 3NWAA 2I5CA 2RNRB 1QC6A 2COCA 2RSGA 1MI1A 1WJ1A 1FAOA 2ELAA 1IRSA 3G9WA 3PEGA 1TQZA 3NWDA 4B6HA 2K2UA 2GS0A 4OSNA 2QKLA 2D2QA 2RUKB 4HDOA 2V76A 1XCGA 1B55A 3P7ZA 2M14A 3OHMB 2D9WA 5D3XA 4KHBB 4HATB 3KRXA 2KGXB 1WI1A 4PQ0A 4K17A 1FGZA 2COAA 3U7DA 2K49A 4K2OA 4EKUA 2FJUB 4HHVA 5C16A 3M1IB 5HE2A 2H7DA 5D3WA 2G35A 1U5EA 3HQCA 2P8VA 1MIXA 2NMBA 1AWEA 3SYXA 4IOYX 2RRFA 4GMVA 1EGXA 2M38A 4DIXA 2L1CA 4CHJA 2ROVA 3TW1A 2OQBA 4A6FA 5CLLB 1U5DA 1MPHA 2AL6A 1TXDA 4WVFB 2CRFA 2R0DA 5L81A 2UZRA 3HIEA 4HB0B 2Z4DA 4C0AA 1J0WA 2BCJA 4HAZB 4BBKA 1X1FA 1BWNA 4CHMA 1KI1B 2LG1A 5D27A 2KUPA 1DBHA 2D9VA 4QXAB 4GPTB 2DHKA 2Y8FA 2CAYA 3DXEA 1OY2A 3D8DA 3ZVRA 3KSYA 1Q67A 2DTCA 3VOQA 2X18A 4TYZA 2DX5A 3A58A 5D3YA 5LG4B 2RLOA 3N7CA 1H4RA 3HW2B 4F7HA 1V5PA 1FB8A 3RCPA 3X23A 1WVHA 2LOZA 2J0JA 2P0FA 3U12A 1UPQA 1UNPA 2XQNM 1MAIA 1SHCA 1FHXA 3QIJA 5D3VA 1V61A 2LOXA 2D4QA 3WA0A 4HB2B 3WYFB 4MT7A 3V5WA 1FOEA 1RJ2A 4HB4B 3TO1A 5DHAB 3NW8A 4YL8A 5JHGA 2YVCA 1X11A 1UEFA 1MKEA 1P6SA 4IAPA 3AU5A 1EVHA 3TVVA 2J59M 2NBVA 1P3RA 4WSFA 2CY4A 4GNKB 4YONA 1QQGA 5JLJB 2D9XA 5J3QA 1NTYA 2D10A 3ULCA 3ODWA 5HE3A 4KHBA 1M7RA 4K2PA 3D8FA 2IYBA 4KHAA 2YT1A 4A6FB 5I2SA 1BTKA 2DYNA 2EJ8A 1FHOA 5JP4A 2ROZB 4MK0A 1DDMA 1ZYIA 2R09A 2DLWA 1P5TA 1MIZB 2DN6A 4GXBA 5HE1A 3OANA 2RVBB 5C6RA 1RRPB 3F0WA 2KCJA 4KHOA 3B77A 1V88A 3VIAA 1UNQA 1PMSA 1ISNA 2DYQA 5FI1A 3TCAA 1ZM0A 5HE0A 3NSUA 2I5FA 4Z2MB 2Z13A 4NY0A 2ELBA 2H7EA 3IVFA 3U8ZA 3PVWA 3MDBC 3SO6A 1X86A 2Z0PA 4DX90 2YSZA 3PVLA 5I2MA 1BTNA 3HSAA 4DXAB 3AJ4A 2I1JA 2R2YA 1E5WA 1K5GB 3D8EA 2ZKMX 2P0HA 5KCVA 3UZTA 4CYEA 4CSQA 2DHIA 2I1KA 4L1RA 4ZRIA 2DX1A 4HAYB 4DX8A 4D0NB 4MY6A 3MPXA 4QJ4B 1J19A 1K5DB 1Y19B 2W2XC 1Z87A 1V89A 2RGNB 1Y5OA 2DFKA 4EMOA 3FEHA 2EC1A 2YF0A 4OT1A 4ZRKA 2YRYA 4D6WA 5GOWB 3PP2A 4QJ5B 2IFSA 1M7EA 2W2XD 1XODA 1ZC3B 2MDXA 5EFXA 1WG7A 5C5BB 1X05A 5FI0A 1H10A 4HB3B 5DIFB 3DCXA 2N23A 4L6EA 3A8QA 3DXDA 1SGHA 1KZ7A 2OTXA 1TJ6A 3ML4A 2EMTA 3A98B 4KAXB 1NTVA 4A5KA 1GC7A 4A6KA 1UPRA 3ZDTA 2AEHA 2MKRA 2Q13A 3KRWA 4GOUA 2YT2A 1PLSA 5J3YA 2P0DA 1EAZA 4GMXB 2COFA 3SNHA 3F5RA 2EMSA 1WGQA 2DKPA 1XR0B 1XKEA 2NZ8B 1U5GA 2KR0A 4H8SA 1V5MA 2MFQA 1V5UA 2Z0OA 2Z59A 2Z0QA 3HK0A 3O96A 4TKNA 3BJIA 2GUMA 4HAUB 4HAVB 4ZRJA 1U2BA 3TFMA 3CIKA 1ZVRA 2MWNB 1WJMA 1UNRA 4K81A 1FHWA 1ZC4B 2KIEA 2GCLA 2LYDA 5JHHA 4PNKA 1LB1A 1ZSQA 1I7AA 4QJ3B 3CXBB 4Z2NA 1DDVA 5C79A 1OMWA 1W1DA 2JP2A 1AQCA 3FSSA 4HAWB 3NWFA 3KZ1A 1XD4A 2GCJA 2K2JA 4Y94A 3FVCA 4F7UP 5KQ1A 4HSIA 3ODOA 2UVMA 2E2XA 4HDQA 5KQ4A 1DDWA 1KZGA 3ODXA 1T77A 2HE7A 2K8EA 2YS3A 4HAXB 5DH9B 1DYNA 1BAKA 1U5FA 3P6AA 2QKMA 1MK7B 2Z14A 1EF1A 2VRWB 3QBVB 2YS5A 1U27A 3KY9A 2KUQA 3T06A 3BINA 3SV1A 1X1GA 2J0MA 2GJYA 5IRSA 2UZSA 2J0KA 5CLQB 2LULA 2DHJA 3GYPA 1XX0A 1LW3A 4NSWA 2HTHB 2PZ1A 2Y7BA 1MK9B 4KVGB 5C5BA 1GC6A 4GN1A 4XWXA 1N3HA 2YT0A 3ULBA 1I2HA 2KIGA 2W2WA 3A8PA 4WJ7A 4IFSA 2VKIA 2LKOA 5J3TA 3PSCA 2D11A 4EJNA 3GYOA 2VSZA 2Y8GA 3DXCA 4DBBA 2CY5A 1U29A 2D9ZA 2DKQA 5M4YB 4F7GA 4A6HA 1PFJA 3PVUA 1W1GA 3FM8C 3QWMA
chains in the Genus database with same CATH topology
4P7IA 4GZUA 2CODA 2DA0A 1NI2A 2L2IA 2FJLA 5DI9B 2D9YA 2K00A 1NU2A 2ZPYA 1DROA 3PZDA 3PG7A 5DHFB 2ADZA 5LOPB 5LONB 1FGYA 2N0YA 3AU4A 2YS1A 1WGUA 3LJUX 1OQNA 1W1HA 3SUZA 1GG3A 2I5CA 2RNRB 1QC6A 2COCA 2RSGA 1WJ1A 1FAOA 2ELAA 1IRSA 3G9WA 3PEGA 1TQZA 4B6HA 2K2UA 2GS0A 2QKLA 2D2QA 2RUKB 4HDOA 2V76A 1XCGA 1B55A 3P7ZA 2M14A 2D9WA 5D3XA 4KHBB 4HATB 3KRXA 2KGXB 1WI1A 4PQ0A 4K17A 1FGZA 2COAA 3U7DA 4K2OA 4EKUA 4HHVA 5C16A 3M1IB 5HE2A 2H7DA 5D3WA 2G35A 1U5EA 3HQCA 2P8VA 1MIXA 2NMBA 1AWEA 3SYXA 4IOYX 1EGXA 4GMVA 2M38A 2L1CA 4CHJA 2ROVA 3TW1A 2OQBA 4A6FA 5CLLB 1U5DA 1MPHA 2AL6A 1TXDA 4WVFB 2CRFA 2R0DA 5L81A 2UZRA 4HB0B 4C0AA 1J0WA 2BCJA 4HAZB 4BBKA 1X1FA 1BWNA 4CHMA 1KI1B 2LG1A 5D27A 2KUPA 1DBHA 2D9VA 4GPTB 2DHKA 2Y8FA 2CAYA 3DXEA 1OY2A 3D8DA 3ZVRA 3KSYA 1Q67A 2DTCA 3VOQA 2X18A 4TYZA 2DX5A 5D3YA 2RLOA 3N7CA 1H4RA 3HW2B 4F7HA 1V5PA 1FB8A 3RCPA 3X23A 1WVHA 2LOZA 2J0JA 2P0FA 1UPQA 1UNPA 2XQNM 1MAIA 1SHCA 1FHXA 3QIJA 5D3VA 1V61A 2LOXA 2D4QA 3WA0A 4HB2B 3WYFB 4MT7A 3V5WA 1FOEA 1RJ2A 4HB4B 3TO1A 5DHAB 4YL8A 5JHGA 2YVCA 1X11A 1UEFA 1MKEA 1P6SA 4IAPA 3AU5A 1EVHA 3TVVA 2J59M 1P3RA 4WSFA 2CY4A 4YONA 1QQGA 5JLJB 2D9XA 5J3QA 1NTYA 2D10A 3ULCA 3ODWA 5HE3A 1M7RA 4K2PA 3D8FA 2IYBA 4KHAA 2YT1A 4A6FB 1BTKA 2DYNA 2EJ8A 1FHOA 5JP4A 2ROZB 4MK0A 1DDMA 2R09A 2DLWA 1P5TA 1MIZB 2DN6A 4GXBA 5HE1A 3OANA 2RVBB 5C6RA 1RRPB 3F0WA 2KCJA 4KHOA 1V88A 3VIAA 1UNQA 1PMSA 1ISNA 2DYQA 5FI1A 3TCAA 1ZM0A 5HE0A 3NSUA 2I5FA 4Z2MB 4NY0A 2ELBA 2H7EA 3IVFA 3U8ZA 3PVWA 3MDBC 3SO6A 1X86A 2Z0PA 4DX90 2YSZA 3PVLA 1BTNA 4DXAB 3AJ4A 2I1JA 1E5WA 1K5GB 3D8EA 2P0HA 5KCVA 3UZTA 4CYEA 2DHIA 2I1KA 4ZRIA 2DX1A 4HAYB 4DX8A 4D0NB 4MY6A 3MPXA 1J19A 1K5DB 1Y19B 2W2XC 1Z87A 1V89A 2RGNB 1Y5OA 2DFKA 4EMOA 3FEHA 2EC1A 2YF0A 4ZRKA 2YRYA 5GOWB 3PP2A 2IFSA 1M7EA 2W2XD 1XODA 1ZC3B 2MDXA 5EFXA 1WG7A 5C5BB 1X05A 5FI0A 1H10A 4HB3B 5DIFB 2N23A 4L6EA 3A8QA 3DXDA 1SGHA 1KZ7A 2OTXA 1TJ6A 3ML4A 2EMTA 3A98B 4KAXB 1NTVA 4A5KA 1GC7A 4A6KA 1UPRA 3ZDTA 2AEHA 2MKRA 2Q13A 3KRWA 1PLSA 5J3YA 2P0DA 1EAZA 4GMXB 2COFA 3SNHA 3F5RA 2EMSA 1WGQA 2DKPA 1XR0B 1XKEA 2NZ8B 1U5GA 4H8SA 1V5MA 2MFQA 1V5UA 2Z0OA 2Z0QA 3HK0A 3O96A 4TKNA 3BJIA 4HAUB 4HAVB 4ZRJA 1U2BA 3TFMA 3CIKA 1ZVRA 2MWNB 1WJMA 1UNRA 4K81A 1FHWA 1ZC4B 2GCLA 2LYDA 5JHHA 4PNKA 1LB1A 1ZSQA 1I7AA 3CXBB 4Z2NA 1DDVA 5C79A 1OMWA 1W1DA 2JP2A 1AQCA 3FSSA 4HAWB 3KZ1A 1XD4A 2GCJA 2K2JA 4Y94A 4F7UP 5KQ1A 3ODOA 2UVMA 2E2XA 4HDQA 5KQ4A 1DDWA 1KZGA 3ODXA 2HE7A 2YS3A 4HAXB 5DH9B 1DYNA 1BAKA 1U5FA 3P6AA 2QKMA 1MK7B 1EF1A 2VRWB 3QBVB 2YS5A 1U27A 3KY9A 3T06A 3BINA 3SV1A 1X1GA 2J0MA 2GJYA 2UZSA 2J0KA 5CLQB 2LULA 2DHJA 3GYPA 1XX0A 1LW3A 4NSWA 2HTHB 2PZ1A 2Y7BA 1MK9B 4KVGB 5C5BA 1GC6A 4GN1A 4XWXA 1N3HA 2YT0A 3ULBA 1I2HA 2W2WA 3A8PA 4WJ7A 4IFSA 2VKIA 2LKOA 5J3TA 3PSCA 2D11A 4EJNA 3GYOA 2VSZA 2Y8GA 3DXCA 4DBBA 2CY5A 1U29A 2D9ZA 2DKQA 4F7GA 4A6HA 1PFJA 3PVUA 1W1GA 3FM8C 3QWMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4P7I A;  4GZU A;  2COD A;  2DA0 A;  1NI2 A;  2L2I A;  2FJL A;  5DI9 B;  2D9Y A;  2K00 A;  1NU2 A;  2ZPY A;  1DRO A;  3PZD A;  3PG7 A;  5DHF B;  2ADZ A;  5LOP B;  5LON B;  1FGY A;  2N0Y A;  3AU4 A;  2YS1 A;  1WGU A;  3LJU X;  1OQN A;  1W1H A;  3SUZ A;  1GG3 A;  2I5C A;  2RNR B;  1QC6 A;  2COC A;  2RSG A;  1WJ1 A;  1FAO A;  2ELA A;  1IRS A;  3G9W A;  3PEG A;  1TQZ A;  4B6H A;  2K2U A;  2GS0 A;  2QKL A;  2D2Q A;  2RUK B;  4HDO A;  2V76 A;  1XCG A;  1B55 A;  3P7Z A;  2M14 A;  2D9W A;  5D3X A;  4KHB B;  4HAT B;  3KRX A;  2KGX B;  1WI1 A;  4PQ0 A;  4K17 A;  1FGZ A;  2COA A;  3U7D A;  4K2O A;  4EKU A;  4HHV A;  5C16 A;  3M1I B;  5HE2 A;  2H7D A;  5D3W A;  2G35 A;  1U5E A;  3HQC A;  2P8V A;  1MIX A;  2NMB A;  1AWE A;  3SYX A;  4IOY X;  1EGX A;  4GMV A;  2M38 A;  2L1C A;  4CHJ A;  2ROV A;  3TW1 A;  2OQB A;  4A6F A;  5CLL B;  1U5D A;  1MPH A;  2AL6 A;  1TXD A;  4WVF B;  2CRF A;  2R0D A;  5L81 A;  2UZR A;  4HB0 B;  4C0A A;  1J0W A;  2BCJ A;  4HAZ B;  4BBK A;  1X1F A;  1BWN A;  4CHM A;  1KI1 B;  2LG1 A;  5D27 A;  2KUP A;  1DBH A;  2D9V A;  4GPT B;  2DHK A;  2Y8F A;  2CAY A;  3DXE A;  1OY2 A;  3D8D A;  3ZVR A;  3KSY A;  1Q67 A;  2DTC A;  3VOQ A;  2X18 A;  4TYZ A;  2DX5 A;  5D3Y A;  2RLO A;  3N7C A;  1H4R A;  3HW2 B;  4F7H A;  1V5P A;  1FB8 A;  3RCP A;  3X23 A;  1WVH A;  2LOZ A;  2J0J A;  2P0F A;  1UPQ A;  1UNP A;  2XQN M;  1MAI A;  1SHC A;  1FHX A;  3QIJ A;  5D3V A;  1V61 A;  2LOX A;  2D4Q A;  3WA0 A;  4HB2 B;  3WYF B;  4MT7 A;  3V5W A;  1FOE A;  1RJ2 A;  4HB4 B;  3TO1 A;  5DHA B;  4YL8 A;  5JHG A;  2YVC A;  1X11 A;  1UEF A;  1MKE A;  1P6S A;  4IAP A;  3AU5 A;  1EVH A;  3TVV A;  2J59 M;  1P3R A;  4WSF A;  2CY4 A;  4YON A;  1QQG A;  5JLJ B;  2D9X A;  5J3Q A;  1NTY A;  2D10 A;  3ULC A;  3ODW A;  5HE3 A;  1M7R A;  4K2P A;  3D8F A;  2IYB A;  4KHA A;  2YT1 A;  4A6F B;  1BTK A;  2DYN A;  2EJ8 A;  1FHO A;  5JP4 A;  2ROZ B;  4MK0 A;  1DDM A;  2R09 A;  2DLW A;  1P5T A;  1MIZ B;  2DN6 A;  4GXB A;  5HE1 A;  3OAN A;  2RVB B;  5C6R A;  1RRP B;  3F0W A;  2KCJ A;  4KHO A;  1V88 A;  3VIA A;  1UNQ A;  1PMS A;  1ISN A;  2DYQ A;  5FI1 A;  3TCA A;  1ZM0 A;  5HE0 A;  3NSU A;  2I5F A;  4Z2M B;  4NY0 A;  2ELB A;  2H7E A;  3IVF A;  3U8Z A;  3PVW A;  3MDB C;  3SO6 A;  1X86 A;  2Z0P A;  4DX9 0;  2YSZ A;  3PVL A;  1BTN A;  4DXA B;  3AJ4 A;  2I1J A;  1E5W A;  1K5G B;  3D8E A;  2P0H A;  5KCV A;  3UZT A;  4CYE A;  2DHI A;  2I1K A;  4ZRI A;  2DX1 A;  4HAY B;  4DX8 A;  4D0N B;  4MY6 A;  3MPX A;  1J19 A;  1K5D B;  1Y19 B;  2W2X C;  1Z87 A;  1V89 A;  2RGN B;  1Y5O A;  2DFK A;  4EMO A;  3FEH A;  2EC1 A;  2YF0 A;  4ZRK A;  2YRY A;  5GOW B;  3PP2 A;  2IFS A;  1M7E A;  2W2X D;  1XOD A;  1ZC3 B;  2MDX A;  5EFX A;  1WG7 A;  5C5B B;  1X05 A;  5FI0 A;  1H10 A;  4HB3 B;  5DIF B;  2N23 A;  4L6E A;  3A8Q A;  3DXD A;  1SGH A;  1KZ7 A;  2OTX A;  1TJ6 A;  3ML4 A;  2EMT A;  3A98 B;  4KAX B;  1NTV A;  4A5K A;  1GC7 A;  4A6K A;  1UPR A;  3ZDT A;  2AEH A;  2MKR A;  2Q13 A;  3KRW A;  1PLS A;  5J3Y A;  2P0D A;  1EAZ A;  4GMX B;  2COF A;  3SNH A;  3F5R A;  2EMS A;  1WGQ A;  2DKP A;  1XR0 B;  1XKE A;  2NZ8 B;  1U5G A;  4H8S A;  1V5M A;  2MFQ A;  1V5U A;  2Z0O A;  2Z0Q A;  3HK0 A;  3O96 A;  4TKN A;  3BJI A;  4HAU B;  4HAV B;  4ZRJ A;  1U2B A;  3TFM A;  3CIK A;  1ZVR A;  2MWN B;  1WJM A;  1UNR A;  4K81 A;  1FHW A;  1ZC4 B;  2GCL A;  2LYD A;  5JHH A;  4PNK A;  1LB1 A;  1ZSQ A;  1I7A A;  3CXB B;  4Z2N A;  1DDV A;  5C79 A;  1OMW A;  1W1D A;  2JP2 A;  1AQC A;  3FSS A;  4HAW B;  3KZ1 A;  1XD4 A;  2GCJ A;  2K2J A;  4Y94 A;  4F7U P;  5KQ1 A;  3ODO A;  2UVM A;  2E2X A;  4HDQ A;  5KQ4 A;  1DDW A;  1KZG A;  3ODX A;  2HE7 A;  2YS3 A;  4HAX B;  5DH9 B;  1DYN A;  1BAK A;  1U5F A;  3P6A A;  2QKM A;  1MK7 B;  1EF1 A;  2VRW B;  3QBV B;  2YS5 A;  1U27 A;  3KY9 A;  3T06 A;  3BIN A;  3SV1 A;  1X1G A;  2J0M A;  2GJY A;  2UZS A;  2J0K A;  5CLQ B;  2LUL A;  2DHJ A;  3GYP A;  1XX0 A;  1LW3 A;  4NSW A;  2HTH B;  2PZ1 A;  2Y7B A;  1MK9 B;  4KVG B;  5C5B A;  1GC6 A;  4GN1 A;  4XWX A;  1N3H A;  2YT0 A;  3ULB A;  1I2H A;  2W2W A;  3A8P A;  4WJ7 A;  4IFS A;  2VKI A;  2LKO A;  5J3T A;  3PSC A;  2D11 A;  4EJN A;  3GYO A;  2VSZ A;  2Y8G A;  3DXC A;  4DBB A;  2CY5 A;  1U29 A;  2D9Z A;  2DKQ A;  4F7G A;  4A6H A;  1PFJ A;  3PVU A;  1W1G A;  3FM8 C;  3QWM A; 
#chains in the Genus database with same CATH topology
 4P7I A;  4GZU A;  2COD A;  2DA0 A;  1NI2 A;  2L2I A;  2FJL A;  5DI9 B;  2D9Y A;  2K00 A;  1NU2 A;  2ZPY A;  1DRO A;  3PZD A;  3PG7 A;  5DHF B;  2ADZ A;  5LOP B;  5LON B;  1FGY A;  2N0Y A;  3AU4 A;  2YS1 A;  1WGU A;  3LJU X;  1OQN A;  1W1H A;  3SUZ A;  1GG3 A;  3NWA A;  2I5C A;  2RNR B;  1QC6 A;  2COC A;  2RSG A;  1MI1 A;  1WJ1 A;  1FAO A;  2ELA A;  1IRS A;  3G9W A;  3PEG A;  1TQZ A;  3NWD A;  4B6H A;  2K2U A;  2GS0 A;  4OSN A;  2QKL A;  2D2Q A;  2RUK B;  4HDO A;  2V76 A;  1XCG A;  1B55 A;  3P7Z A;  2M14 A;  3OHM B;  2D9W A;  5D3X A;  4KHB B;  4HAT B;  3KRX A;  2KGX B;  1WI1 A;  4PQ0 A;  4K17 A;  1FGZ A;  2COA A;  3U7D A;  2K49 A;  4K2O A;  4EKU A;  2FJU B;  4HHV A;  5C16 A;  3M1I B;  5HE2 A;  2H7D A;  5D3W A;  2G35 A;  1U5E A;  3HQC A;  2P8V A;  1MIX A;  2NMB A;  1AWE A;  3SYX A;  4IOY X;  2RRF A;  4GMV A;  1EGX A;  2M38 A;  4DIX A;  2L1C A;  4CHJ A;  2ROV A;  3TW1 A;  2OQB A;  4A6F A;  5CLL B;  1U5D A;  1MPH A;  2AL6 A;  1TXD A;  4WVF B;  2CRF A;  2R0D A;  5L81 A;  2UZR A;  3HIE A;  4HB0 B;  2Z4D A;  4C0A A;  1J0W A;  2BCJ A;  4HAZ B;  4BBK A;  1X1F A;  1BWN A;  4CHM A;  1KI1 B;  2LG1 A;  5D27 A;  2KUP A;  1DBH A;  2D9V A;  4QXA B;  4GPT B;  2DHK A;  2Y8F A;  2CAY A;  3DXE A;  1OY2 A;  3D8D A;  3ZVR A;  3KSY A;  1Q67 A;  2DTC A;  3VOQ A;  2X18 A;  4TYZ A;  2DX5 A;  3A58 A;  5D3Y A;  5LG4 B;  2RLO A;  3N7C A;  1H4R A;  3HW2 B;  4F7H A;  1V5P A;  1FB8 A;  3RCP A;  3X23 A;  1WVH A;  2LOZ A;  2J0J A;  2P0F A;  3U12 A;  1UPQ A;  1UNP A;  2XQN M;  1MAI A;  1SHC A;  1FHX A;  3QIJ A;  5D3V A;  1V61 A;  2LOX A;  2D4Q A;  3WA0 A;  4HB2 B;  3WYF B;  4MT7 A;  3V5W A;  1FOE A;  1RJ2 A;  4HB4 B;  3TO1 A;  5DHA B;  3NW8 A;  4YL8 A;  5JHG A;  2YVC A;  1X11 A;  1UEF A;  1MKE A;  1P6S A;  4IAP A;  3AU5 A;  1EVH A;  3TVV A;  2J59 M;  2NBV A;  1P3R A;  4WSF A;  2CY4 A;  4GNK B;  4YON A;  1QQG A;  5JLJ B;  2D9X A;  5J3Q A;  1NTY A;  2D10 A;  3ULC A;  3ODW A;  5HE3 A;  4KHB A;  1M7R A;  4K2P A;  3D8F A;  2IYB A;  4KHA A;  2YT1 A;  4A6F B;  5I2S A;  1BTK A;  2DYN A;  2EJ8 A;  1FHO A;  5JP4 A;  2ROZ B;  4MK0 A;  1DDM A;  1ZYI A;  2R09 A;  2DLW A;  1P5T A;  1MIZ B;  2DN6 A;  4GXB A;  5HE1 A;  3OAN A;  2RVB B;  5C6R A;  1RRP B;  3F0W A;  2KCJ A;  4KHO A;  3B77 A;  1V88 A;  3VIA A;  1UNQ A;  1PMS A;  1ISN A;  2DYQ A;  5FI1 A;  3TCA A;  1ZM0 A;  5HE0 A;  3NSU A;  2I5F A;  4Z2M B;  2Z13 A;  4NY0 A;  2ELB A;  2H7E A;  3IVF A;  3U8Z A;  3PVW A;  3MDB C;  3SO6 A;  1X86 A;  2Z0P A;  4DX9 0;  2YSZ A;  3PVL A;  5I2M A;  1BTN A;  3HSA A;  4DXA B;  3AJ4 A;  2I1J A;  2R2Y A;  1E5W A;  1K5G B;  3D8E A;  2ZKM X;  2P0H A;  5KCV A;  3UZT A;  4CYE A;  4CSQ A;  2DHI A;  2I1K A;  4L1R A;  4ZRI A;  2DX1 A;  4HAY B;  4DX8 A;  4D0N B;  4MY6 A;  3MPX A;  4QJ4 B;  1J19 A;  1K5D B;  1Y19 B;  2W2X C;  1Z87 A;  1V89 A;  2RGN B;  1Y5O A;  2DFK A;  4EMO A;  3FEH A;  2EC1 A;  2YF0 A;  4OT1 A;  4ZRK A;  2YRY A;  4D6W A;  5GOW B;  3PP2 A;  4QJ5 B;  2IFS A;  1M7E A;  2W2X D;  1XOD A;  1ZC3 B;  2MDX A;  5EFX A;  1WG7 A;  5C5B B;  1X05 A;  5FI0 A;  1H10 A;  4HB3 B;  5DIF B;  3DCX A;  2N23 A;  4L6E A;  3A8Q A;  3DXD A;  1SGH A;  1KZ7 A;  2OTX A;  1TJ6 A;  3ML4 A;  2EMT A;  3A98 B;  4KAX B;  1NTV A;  4A5K A;  1GC7 A;  4A6K A;  1UPR A;  3ZDT A;  2AEH A;  2MKR A;  2Q13 A;  3KRW A;  4GOU A;  2YT2 A;  1PLS A;  5J3Y A;  2P0D A;  1EAZ A;  4GMX B;  2COF A;  3SNH A;  3F5R A;  2EMS A;  1WGQ A;  2DKP A;  1XR0 B;  1XKE A;  2NZ8 B;  1U5G A;  2KR0 A;  4H8S A;  1V5M A;  2MFQ A;  1V5U A;  2Z0O A;  2Z59 A;  2Z0Q A;  3HK0 A;  3O96 A;  4TKN A;  3BJI A;  2GUM A;  4HAU B;  4HAV B;  4ZRJ A;  1U2B A;  3TFM A;  3CIK A;  1ZVR A;  2MWN B;  1WJM A;  1UNR A;  4K81 A;  1FHW A;  1ZC4 B;  2KIE A;  2GCL A;  2LYD A;  5JHH A;  4PNK A;  1LB1 A;  1ZSQ A;  1I7A A;  4QJ3 B;  3CXB B;  4Z2N A;  1DDV A;  5C79 A;  1OMW A;  1W1D A;  2JP2 A;  1AQC A;  3FSS A;  4HAW B;  3NWF A;  3KZ1 A;  1XD4 A;  2GCJ A;  2K2J A;  4Y94 A;  3FVC A;  4F7U P;  5KQ1 A;  4HSI A;  3ODO A;  2UVM A;  2E2X A;  4HDQ A;  5KQ4 A;  1DDW A;  1KZG A;  3ODX A;  1T77 A;  2HE7 A;  2K8E A;  2YS3 A;  4HAX B;  5DH9 B;  1DYN A;  1BAK A;  1U5F A;  3P6A A;  2QKM A;  1MK7 B;  2Z14 A;  1EF1 A;  2VRW B;  3QBV B;  2YS5 A;  1U27 A;  3KY9 A;  2KUQ A;  3T06 A;  3BIN A;  3SV1 A;  1X1G A;  2J0M A;  2GJY A;  5IRS A;  2UZS A;  2J0K A;  5CLQ B;  2LUL A;  2DHJ A;  3GYP A;  1XX0 A;  1LW3 A;  4NSW A;  2HTH B;  2PZ1 A;  2Y7B A;  1MK9 B;  4KVG B;  5C5B A;  1GC6 A;  4GN1 A;  4XWX A;  1N3H A;  2YT0 A;  3ULB A;  1I2H A;  2KIG A;  2W2W A;  3A8P A;  4WJ7 A;  4IFS A;  2VKI A;  2LKO A;  5J3T A;  3PSC A;  2D11 A;  4EJN A;  3GYO A;  2VSZ A;  2Y8G A;  3DXC A;  4DBB A;  2CY5 A;  1U29 A;  2D9Z A;  2DKQ A;  5M4Y B;  4F7G A;  4A6H A;  1PFJ A;  3PVU A;  1W1G A;  3FM8 C;  3QWM A; 
#chains in the Genus database with same CATH homology
 4P7I A;  4GZU A;  2COD A;  2DA0 A;  1NI2 A;  2L2I A;  2FJL A;  5DI9 B;  2D9Y A;  2K00 A;  1NU2 A;  2ZPY A;  1DRO A;  3PZD A;  3PG7 A;  5DHF B;  2ADZ A;  5LOP B;  5LON B;  1FGY A;  2N0Y A;  3AU4 A;  2YS1 A;  1WGU A;  3LJU X;  1OQN A;  1W1H A;  3SUZ A;  1GG3 A;  2I5C A;  2RNR B;  1QC6 A;  2COC A;  2RSG A;  1WJ1 A;  1FAO A;  2ELA A;  1IRS A;  3G9W A;  3PEG A;  1TQZ A;  4B6H A;  2K2U A;  2GS0 A;  2QKL A;  2D2Q A;  2RUK B;  4HDO A;  2V76 A;  1XCG A;  1B55 A;  3P7Z A;  2M14 A;  2D9W A;  5D3X A;  4KHB B;  4HAT B;  3KRX A;  2KGX B;  1WI1 A;  4PQ0 A;  4K17 A;  1FGZ A;  2COA A;  3U7D A;  4K2O A;  4EKU A;  4HHV A;  5C16 A;  3M1I B;  5HE2 A;  2H7D A;  5D3W A;  2G35 A;  1U5E A;  3HQC A;  2P8V A;  1MIX A;  2NMB A;  1AWE A;  3SYX A;  4IOY X;  1EGX A;  4GMV A;  2M38 A;  2L1C A;  4CHJ A;  2ROV A;  3TW1 A;  2OQB A;  4A6F A;  5CLL B;  1U5D A;  1MPH A;  2AL6 A;  1TXD A;  4WVF B;  2CRF A;  2R0D A;  5L81 A;  2UZR A;  4HB0 B;  4C0A A;  1J0W A;  2BCJ A;  4HAZ B;  4BBK A;  1X1F A;  1BWN A;  4CHM A;  1KI1 B;  2LG1 A;  5D27 A;  2KUP A;  1DBH A;  2D9V A;  4GPT B;  2DHK A;  2Y8F A;  2CAY A;  3DXE A;  1OY2 A;  3D8D A;  3ZVR A;  3KSY A;  1Q67 A;  2DTC A;  3VOQ A;  2X18 A;  4TYZ A;  2DX5 A;  5D3Y A;  2RLO A;  3N7C A;  1H4R A;  3HW2 B;  4F7H A;  1V5P A;  1FB8 A;  3RCP A;  3X23 A;  1WVH A;  2LOZ A;  2J0J A;  2P0F A;  1UPQ A;  1UNP A;  2XQN M;  1MAI A;  1SHC A;  1FHX A;  3QIJ A;  5D3V A;  1V61 A;  2LOX A;  2D4Q A;  3WA0 A;  4HB2 B;  3WYF B;  4MT7 A;  3V5W A;  1FOE A;  1RJ2 A;  4HB4 B;  3TO1 A;  5DHA B;  4YL8 A;  5JHG A;  2YVC A;  1X11 A;  1UEF A;  1MKE A;  1P6S A;  4IAP A;  3AU5 A;  1EVH A;  3TVV A;  2J59 M;  1P3R A;  4WSF A;  2CY4 A;  4YON A;  1QQG A;  5JLJ B;  2D9X A;  5J3Q A;  1NTY A;  2D10 A;  3ULC A;  3ODW A;  5HE3 A;  1M7R A;  4K2P A;  3D8F A;  2IYB A;  4KHA A;  2YT1 A;  4A6F B;  1BTK A;  2DYN A;  2EJ8 A;  1FHO A;  5JP4 A;  2ROZ B;  4MK0 A;  1DDM A;  2R09 A;  2DLW A;  1P5T A;  1MIZ B;  2DN6 A;  4GXB A;  5HE1 A;  3OAN A;  2RVB B;  5C6R A;  1RRP B;  3F0W A;  2KCJ A;  4KHO A;  1V88 A;  3VIA A;  1UNQ A;  1PMS A;  1ISN A;  2DYQ A;  5FI1 A;  3TCA A;  1ZM0 A;  5HE0 A;  3NSU A;  2I5F A;  4Z2M B;  4NY0 A;  2ELB A;  2H7E A;  3IVF A;  3U8Z A;  3PVW A;  3MDB C;  3SO6 A;  1X86 A;  2Z0P A;  4DX9 0;  2YSZ A;  3PVL A;  1BTN A;  4DXA B;  3AJ4 A;  2I1J A;  1E5W A;  1K5G B;  3D8E A;  2P0H A;  5KCV A;  3UZT A;  4CYE A;  2DHI A;  2I1K A;  4ZRI A;  2DX1 A;  4HAY B;  4DX8 A;  4D0N B;  4MY6 A;  3MPX A;  1J19 A;  1K5D B;  1Y19 B;  2W2X C;  1Z87 A;  1V89 A;  2RGN B;  1Y5O A;  2DFK A;  4EMO A;  3FEH A;  2EC1 A;  2YF0 A;  4ZRK A;  2YRY A;  5GOW B;  3PP2 A;  2IFS A;  1M7E A;  2W2X D;  1XOD A;  1ZC3 B;  2MDX A;  5EFX A;  1WG7 A;  5C5B B;  1X05 A;  5FI0 A;  1H10 A;  4HB3 B;  5DIF B;  2N23 A;  4L6E A;  3A8Q A;  3DXD A;  1SGH A;  1KZ7 A;  2OTX A;  1TJ6 A;  3ML4 A;  2EMT A;  3A98 B;  4KAX B;  1NTV A;  4A5K A;  1GC7 A;  4A6K A;  1UPR A;  3ZDT A;  2AEH A;  2MKR A;  2Q13 A;  3KRW A;  1PLS A;  5J3Y A;  2P0D A;  1EAZ A;  4GMX B;  2COF A;  3SNH A;  3F5R A;  2EMS A;  1WGQ A;  2DKP A;  1XR0 B;  1XKE A;  2NZ8 B;  1U5G A;  4H8S A;  1V5M A;  2MFQ A;  1V5U A;  2Z0O A;  2Z0Q A;  3HK0 A;  3O96 A;  4TKN A;  3BJI A;  4HAU B;  4HAV B;  4ZRJ A;  1U2B A;  3TFM A;  3CIK A;  1ZVR A;  2MWN B;  1WJM A;  1UNR A;  4K81 A;  1FHW A;  1ZC4 B;  2GCL A;  2LYD A;  5JHH A;  4PNK A;  1LB1 A;  1ZSQ A;  1I7A A;  3CXB B;  4Z2N A;  1DDV A;  5C79 A;  1OMW A;  1W1D A;  2JP2 A;  1AQC A;  3FSS A;  4HAW B;  3KZ1 A;  1XD4 A;  2GCJ A;  2K2J A;  4Y94 A;  4F7U P;  5KQ1 A;  3ODO A;  2UVM A;  2E2X A;  4HDQ A;  5KQ4 A;  1DDW A;  1KZG A;  3ODX A;  2HE7 A;  2YS3 A;  4HAX B;  5DH9 B;  1DYN A;  1BAK A;  1U5F A;  3P6A A;  2QKM A;  1MK7 B;  1EF1 A;  2VRW B;  3QBV B;  2YS5 A;  1U27 A;  3KY9 A;  3T06 A;  3BIN A;  3SV1 A;  1X1G A;  2J0M A;  2GJY A;  2UZS A;  2J0K A;  5CLQ B;  2LUL A;  2DHJ A;  3GYP A;  1XX0 A;  1LW3 A;  4NSW A;  2HTH B;  2PZ1 A;  2Y7B A;  1MK9 B;  4KVG B;  5C5B A;  1GC6 A;  4GN1 A;  4XWX A;  1N3H A;  2YT0 A;  3ULB A;  1I2H A;  2W2W A;  3A8P A;  4WJ7 A;  4IFS A;  2VKI A;  2LKO A;  5J3T A;  3PSC A;  2D11 A;  4EJN A;  3GYO A;  2VSZ A;  2Y8G A;  3DXC A;  4DBB A;  2CY5 A;  1U29 A;  2D9Z A;  2DKQ A;  4F7G A;  4A6H A;  1PFJ A;  3PVU A;  1W1G A;  3FM8 C;  3QWM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...