1XR0B

Structural basis of snt ptb domain interactions with distinct neurotrophic receptors
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
129
structure length
129
Chain Sequence
MGSDTVPDNHRNKFKVINVDDDGNELGSGIMELTDTELILYTRKRDSVKWHYLCLRRYGYDSNLFSFESGRRCQTGQGIFAFKCARAEELFNMLQEIMQNNSINVVEEPVVERNNHQTELEVPRTPRTP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Basic fibroblast growth factor receptor 1
publication title Structural Basis of SNT PTB Domain Interactions with Distinct Neurotrophic Receptors
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein/growth factor receptor
total genus 14
structure length 129
sequence length 129
ec nomenclature
pdb deposition date 2004-10-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02174 IRS PTB domain (IRS-1 type)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 1xr0B01
2MWNB 3ULBA 1X05A 1TJ6A 2VKIA 4GXBA 2IYBA 2CODA 2ZPYA 5KCVA 1J0WA 3M1IB 5LONB 5J3QA 2DN6A 1BTNA 1P3RA 3F0WA 2VSZA 3KRWA 3RCPA 3KSYA 2I1JA 1Y19B 2HE7A 1E5WA 1W1HA 2BCJA 2D10A 2LYDA 4IFSA 1P5TA 3WA0A 4HAXB 1V61A 1I2HA 1DDWA 1MK7B 2DTCA 5EFXA 2XQNM 2K2UA 2YS1A 5D3WA 2P8VA 4D0NB 1WGUA 4HB2B 2YS5A 2Y8FA 2DYNA 3FEHA 3GYPA 4KHBB 3UZTA 1ZVRA 5JP4A 4DBBA 1FOEA 3F5RA 2D2QA 1I7AA 1RJ2A 4HB4B 1UNPA 2J0MA 2RSGA 4XWXA 1FGYA 4A6HA 2DX5A 1H4RA 1SHCA 4Y94A 3ZDTA 4DXAB 2ELBA 4BBKA 1UEFA 1Y5OA 1KI1B 4K2OA 2DFKA 1WI1A 2EMSA 3SNHA 2AEHA 5CLLB 2YS3A 4EJNA 4CHJA 1V89A 2P0DA 1SGHA 4MY6A 2D9WA 3IVFA 2GCJA 3PVUA 2PZ1A 2R0DA 3OANA 5C79A 1DBHA 4F7HA 2X18A 3ODOA 2YVCA 1EGXA 1ZC4B 1U5EA 2EMTA 3QIJA 5JLJB 3ZVRA 2Y8GA 4CYEA 1FGZA 2ADZA 2EJ8A 4Z2NA 3D8DA 3A98B 1AWEA 1LW3A 1GC6A 1GG3A 3TFMA 4ZRKA 4F7GA 2DA0A 1OQNA 2N0YA 3VIAA 3PVLA 4A5KA 1DYNA 2RGNB 4H8SA 1FB8A 3SO6A 3TVVA 5HE2A 1MAIA 3CXBB 4PNKA 2L1CA 1MK9B 2Z0OA 4PQ0A 2I1KA 5D3XA 4NSWA 1UNQA 1M7EA 2K00A 5FI0A 5D27A 2M38A 4KHAA 1TQZA 3T06A 4MT7A 2RLOA 2W2XC 3A8QA 3HK0A 2ROZB 4GMXB 5L81A 3DXCA 1M7RA 3FSSA 3D8FA 2NZ8B 2ELAA 1N3HA 1OMWA 3X23A 3PSCA 1B55A 5C16A 2LOXA 1NTYA 4HDQA 3ML4A 1UPQA 2D9YA 2P0FA 2DHKA 2GS0A 1QQGA 1NTVA 2MFQA 5C6RA 4EKUA 3PG7A 2K2JA 2H7EA 1OY2A 1ISNA 2COAA 4GPTB 5J3TA 1K5DB 2CRFA 4K2PA 4HATB 4KVGB 5LOPB 2YRYA 3BJIA 4CHMA 1W1GA 4YL8A 1IRSA 2D4QA 2N23A 1PFJA 1RRPB 1X1FA 2YT1A 4F7UP 4HAWB 1GC7A 4TKNA 3MPXA 2QKMA 2CY4A 2FJLA 3ODXA 2OQBA 2YF0A 1V5UA 2VRWB 3AU4A 3WYFB 1AQCA 3PZDA 1KZ7A 1U5FA 2JP2A 4K81A 1PMSA 2Q13A 4GMVA 1XD4A 3LJUX 2YSZA 2KUPA 3TO1A 1Z87A 2L2IA 1DDVA 1U29A 1BWNA 3O96A 1XODA 4IOYX 4HAUB 2DHIA 2HTHB 3P7ZA 3U7DA 4KAXB 2D9ZA 4HAVB 2COFA 1WJMA 2LKOA 1XX0A 1MIXA 4DX8A 3AJ4A 2R09A 2GCLA 2OTXA 2CAYA 5HE3A 1EVHA 4B6HA 2DHJA 2RNRB 1MKEA 5JHGA 1X1GA 2Z0QA 3ULCA 5FI1A 1Q67A 2COCA 5DIFB 5GOWB 2DLWA 4WSFA 1ZM0A 1BAKA 2KCJA 2EC1A 2MKRA 2D9XA 3PP2A 2P0HA 4KHOA 4ZRJA 2Y7BA 1UNRA 2D9VA 2Z0PA 2H7DA 2DX1A 1P6SA 2DYQA 3HQCA 5C5BB 1EAZA 2RUKB 5J3YA 2MDXA 2W2WA 3V5WA 1ZSQA 1FHXA 5CLQB 1TXDA 3MDBC 4EMOA 1XCGA 4ZRIA 1DDMA 3D8EA 1UPRA 4P7IA 4HDOA 5HE0A 1U2BA 2DKQA 3KRXA 1BTKA 3A8PA 4HAYB 4A6FB 4A6KA 2D11A 4YONA 3SUZA 3N7CA 4HB3B 1FHWA 3DXDA 3NSUA 1FAOA 2ROVA 2YT0A 1WVHA 3CIKA 5HE1A 1U5DA 1X86A 2W2XD 5C5BA 3QWMA 4DX90 1MIZB 2E2XA 3BINA 5DHAB 4HHVA 3GYOA 4L6EA 2V76A 1DROA 1WGQA 4K17A 5D3YA 2LULA 3PVWA 2AL6A 5DH9B 2LOZA 3VOQA 1U5GA 1V5MA 2UVMA 5KQ1A 1KZGA 1MPHA 1V5PA 1NU2A 2CY5A 1WJ1A 2LG1A 4A6FA 2UZRA 2I5FA 3G9WA 2I5CA 3PEGA 2NMBA 1EF1A 4WVFB 1FHOA 4HAZB 2IFSA 2J0KA 1U27A 4WJ7A 5JHHA 3KY9A 1ZC3B 1V88A 3AU5A 4HB0B 2QKLA 4GZUA 1K5GB 3HW2B 1H10A 3QBVB 5D3VA 1QC6A 1XKEA 3DXEA 1J19A 1W1DA 2RVBB 1NI2A 3P6AA 5DHFB 3TCAA 3FM8C 4C0AA 4TYZA 1PLSA 2J0JA 3U8ZA 1LB1A 2G35A 2M14A 4GN1A 2GJYA 4Z2MB 2DKPA 1XR0B 3SYXA 2UZSA 3KZ1A 1WG7A 3TW1A 3SV1A 2J59M 1X11A 2KGXB 5KQ4A 4MK0A 5DI9B 4NY0A 3ODWA 4IAPA
chains in the Genus database with same CATH superfamily
2MWNB 3ULBA 1X05A 1TJ6A 2VKIA 4GXBA 2IYBA 2CODA 2ZPYA 5KCVA 1J0WA 3M1IB 5LONB 5J3QA 2DN6A 1BTNA 1P3RA 2Z4DA 2KIGA 3F0WA 2VSZA 3KRWA 4OSNA 3RCPA 4DIXA 3KSYA 2I1JA 1Y19B 2HE7A 1E5WA 2KIEA 1W1HA 2BCJA 2D10A 2LYDA 4IFSA 1P5TA 3WA0A 4HAXB 1V61A 1I2HA 1DDWA 1MK7B 2DTCA 5EFXA 2XQNM 2K2UA 2YS1A 5D3WA 2P8VA 4D0NB 1WGUA 4HB2B 2YS5A 2Y8FA 4QJ5B 2DYNA 3FEHA 3GYPA 4KHBB 3UZTA 1ZVRA 5JP4A 5M4YB 4DBBA 2Z14A 1FOEA 3F5RA 2D2QA 1I7AA 1RJ2A 4HB4B 1UNPA 2J0MA 2RSGA 4XWXA 1FGYA 4A6HA 2DX5A 1H4RA 1SHCA 4Y94A 3ZDTA 4DXAB 2ELBA 4BBKA 1UEFA 1Y5OA 1KI1B 4K2OA 2DFKA 1WI1A 2EMSA 3SNHA 2AEHA 5CLLB 2YS3A 4EJNA 4CHJA 1V89A 2P0DA 1SGHA 4MY6A 2D9WA 3IVFA 2GCJA 3PVUA 2PZ1A 2R0DA 3OANA 5C79A 1DBHA 4KHBA 4F7HA 2X18A 3ODOA 4OT1A 2YVCA 1EGXA 5I2MA 1ZC4B 1U5EA 2EMTA 3QIJA 5JLJB 3ZVRA 2Y8GA 4CYEA 1FGZA 2ADZA 2EJ8A 4Z2NA 3D8DA 3A98B 2KR0A 1AWEA 1LW3A 2GUMA 1GC6A 1GG3A 3TFMA 4ZRKA 4F7GA 2DA0A 1OQNA 2N0YA 3VIAA 3PVLA 4A5KA 1DYNA 2RGNB 4H8SA 1FB8A 4L1RA 3SO6A 3TVVA 5HE2A 1MAIA 3CXBB 3B77A 2L1CA 4PNKA 1MK9B 2Z0OA 4PQ0A 2I1KA 5D3XA 4NSWA 1UNQA 1M7EA 2K00A 5FI0A 5D27A 2M38A 4KHAA 1TQZA 3T06A 4MT7A 3NWDA 2RLOA 2W2XC 3A8QA 3HK0A 2ROZB 4GMXB 5L81A 3DXCA 1M7RA 3FSSA 3NWFA 3NWAA 4HSIA 3D8FA 2NZ8B 2ELAA 1N3HA 1OMWA 3X23A 3PSCA 1B55A 5C16A 2LOXA 1NTYA 4HDQA 3ML4A 1UPQA 2D9YA 2P0FA 2DHKA 2GS0A 1QQGA 1NTVA 2MFQA 5C6RA 4EKUA 3PG7A 2K2JA 2H7EA 1OY2A 1ISNA 4GNKB 2COAA 4GPTB 5J3TA 1K5DB 2CRFA 4K2PA 4HATB 3A58A 4KVGB 5LOPB 5I2SA 2YRYA 3BJIA 4CHMA 1W1GA 1ZYIA 4YL8A 1IRSA 2D4QA 2N23A 1PFJA 1RRPB 3FVCA 1X1FA 2YT1A 2ZKMX 4F7UP 4HAWB 1GC7A 4TKNA 3MPXA 2QKMA 4D6WA 2CY4A 2FJLA 3ODXA 2OQBA 2YF0A 1V5UA 2VRWB 3AU4A 3WYFB 3HIEA 1AQCA 3PZDA 1KZ7A 1U5FA 2JP2A 4K81A 1PMSA 2Q13A 4GMVA 1XD4A 3LJUX 3OHMB 4CSQA 2YSZA 2KUPA 3TO1A 1Z87A 2L2IA 1DDVA 1U29A 4QXAB 1BWNA 3O96A 1XODA 4IOYX 4HAUB 2Z59A 2DHIA 2HTHB 3P7ZA 3U7DA 4KAXB 2D9ZA 4HAVB 2COFA 1WJMA 2LKOA 1XX0A 1MIXA 4DX8A 3AJ4A 2R09A 2GCLA 2OTXA 2CAYA 5HE3A 1EVHA 4B6HA 2DHJA 2YT2A 2RNRB 1MKEA 2RRFA 5JHGA 1X1GA 2Z0QA 3ULCA 5FI1A 1Q67A 2COCA 5DIFB 5GOWB 2DLWA 4WSFA 1ZM0A 4GOUA 1BAKA 2KCJA 2EC1A 2MKRA 2D9XA 2FJUB 3PP2A 2P0HA 4KHOA 4ZRJA 2Y7BA 1UNRA 2D9VA 2Z0PA 2H7DA 2DX1A 1P6SA 2DYQA 3HQCA 5C5BB 1EAZA 2RUKB 5J3YA 2MDXA 2W2WA 3V5WA 1ZSQA 1FHXA 5CLQB 1TXDA 3MDBC 4EMOA 1XCGA 4QJ4B 4ZRIA 1DDMA 3D8EA 1UPRA 4P7IA 4HDOA 5HE0A 1U2BA 2DKQA 2NBVA 1T77A 3NW8A 1BTKA 3KRXA 3A8PA 4HAYB 4A6FB 4A6KA 2D11A 4YONA 5IRSA 3SUZA 3N7CA 4HB3B 1FHWA 3DXDA 3NSUA 1FAOA 2ROVA 2YT0A 1WVHA 3CIKA 2R2YA 5HE1A 1U5DA 1X86A 2W2XD 5C5BA 3QWMA 4DX90 1MIZB 5LG4B 2E2XA 3BINA 5DHAB 4HHVA 3GYOA 4L6EA 2V76A 1DROA 1WGQA 4K17A 5D3YA 2LULA 3PVWA 2AL6A 4QJ3B 2Z13A 5DH9B 2LOZA 3VOQA 1U5GA 1V5MA 2UVMA 5KQ1A 1KZGA 1MPHA 1V5PA 1NU2A 2CY5A 1WJ1A 2LG1A 4A6FA 2UZRA 2I5FA 3G9WA 2I5CA 3PEGA 2NMBA 1EF1A 4WVFB 1FHOA 4HAZB 2IFSA 2J0KA 1U27A 4WJ7A 5JHHA 2KUQA 3KY9A 1ZC3B 1V88A 3HSAA 3AU5A 4HB0B 2QKLA 4GZUA 1K5GB 3HW2B 1H10A 3QBVB 2K49A 5D3VA 1QC6A 1XKEA 3DXEA 1J19A 1W1DA 2RVBB 1NI2A 3P6AA 5DHFB 3TCAA 3FM8C 4C0AA 4TYZA 1PLSA 2J0JA 3U8ZA 1LB1A 1MI1A 2G35A 2M14A 4GN1A 2K8EA 2GJYA 4Z2MB 2DKPA 1XR0B 3SYXA 2UZSA 3KZ1A 1WG7A 3TW1A 3SV1A 3DCXA 2J59M 1X11A 2KGXB 3U12A 5KQ4A 4MK0A 5DI9B 4NY0A 3ODWA 4IAPA
chains in the Genus database with same CATH topology
2MWNB 3ULBA 1X05A 1TJ6A 2VKIA 4GXBA 2IYBA 2CODA 2ZPYA 5KCVA 1J0WA 3M1IB 5LONB 5J3QA 2DN6A 1BTNA 1P3RA 3F0WA 2VSZA 3KRWA 3RCPA 3KSYA 2I1JA 1Y19B 2HE7A 1E5WA 1W1HA 2BCJA 2D10A 2LYDA 4IFSA 1P5TA 3WA0A 4HAXB 1V61A 1I2HA 1DDWA 1MK7B 2DTCA 5EFXA 2XQNM 2K2UA 2YS1A 5D3WA 2P8VA 4D0NB 1WGUA 4HB2B 2YS5A 2Y8FA 2DYNA 3FEHA 3GYPA 4KHBB 3UZTA 1ZVRA 5JP4A 4DBBA 1FOEA 3F5RA 2D2QA 1I7AA 1RJ2A 4HB4B 1UNPA 2J0MA 2RSGA 4XWXA 1FGYA 4A6HA 2DX5A 1H4RA 1SHCA 4Y94A 3ZDTA 4DXAB 2ELBA 4BBKA 1UEFA 1Y5OA 1KI1B 4K2OA 2DFKA 1WI1A 2EMSA 3SNHA 2AEHA 5CLLB 2YS3A 4EJNA 4CHJA 1V89A 2P0DA 1SGHA 4MY6A 2D9WA 3IVFA 2GCJA 3PVUA 2PZ1A 2R0DA 3OANA 5C79A 1DBHA 4F7HA 2X18A 3ODOA 2YVCA 1EGXA 1ZC4B 1U5EA 2EMTA 3QIJA 5JLJB 3ZVRA 2Y8GA 4CYEA 1FGZA 2ADZA 2EJ8A 4Z2NA 3D8DA 3A98B 1AWEA 1LW3A 1GC6A 1GG3A 3TFMA 4ZRKA 4F7GA 2DA0A 1OQNA 2N0YA 3VIAA 3PVLA 4A5KA 1DYNA 2RGNB 4H8SA 1FB8A 3SO6A 3TVVA 5HE2A 1MAIA 3CXBB 4PNKA 2L1CA 1MK9B 2Z0OA 4PQ0A 2I1KA 5D3XA 4NSWA 1UNQA 1M7EA 2K00A 5FI0A 5D27A 2M38A 4KHAA 1TQZA 3T06A 4MT7A 2RLOA 2W2XC 3A8QA 3HK0A 2ROZB 4GMXB 5L81A 3DXCA 1M7RA 3FSSA 3D8FA 2NZ8B 2ELAA 1N3HA 1OMWA 3X23A 3PSCA 1B55A 5C16A 2LOXA 1NTYA 4HDQA 3ML4A 1UPQA 2D9YA 2P0FA 2DHKA 2GS0A 1QQGA 1NTVA 2MFQA 5C6RA 4EKUA 3PG7A 2K2JA 2H7EA 1OY2A 1ISNA 2COAA 4GPTB 5J3TA 1K5DB 2CRFA 4K2PA 4HATB 4KVGB 5LOPB 2YRYA 3BJIA 4CHMA 1W1GA 4YL8A 1IRSA 2D4QA 2N23A 1PFJA 1RRPB 1X1FA 2YT1A 4F7UP 4HAWB 1GC7A 4TKNA 3MPXA 2QKMA 2CY4A 2FJLA 3ODXA 2OQBA 2YF0A 1V5UA 2VRWB 3AU4A 3WYFB 1AQCA 3PZDA 1KZ7A 1U5FA 2JP2A 4K81A 1PMSA 2Q13A 4GMVA 1XD4A 3LJUX 2YSZA 2KUPA 3TO1A 1Z87A 2L2IA 1DDVA 1U29A 1BWNA 3O96A 1XODA 4IOYX 4HAUB 2DHIA 2HTHB 3P7ZA 3U7DA 4KAXB 2D9ZA 4HAVB 2COFA 1WJMA 2LKOA 1XX0A 1MIXA 4DX8A 3AJ4A 2R09A 2GCLA 2OTXA 2CAYA 5HE3A 1EVHA 4B6HA 2DHJA 2RNRB 1MKEA 5JHGA 1X1GA 2Z0QA 3ULCA 5FI1A 1Q67A 2COCA 5DIFB 5GOWB 2DLWA 4WSFA 1ZM0A 1BAKA 2KCJA 2EC1A 2MKRA 2D9XA 3PP2A 2P0HA 4KHOA 4ZRJA 2Y7BA 1UNRA 2D9VA 2Z0PA 2H7DA 2DX1A 1P6SA 2DYQA 3HQCA 5C5BB 1EAZA 2RUKB 5J3YA 2MDXA 2W2WA 3V5WA 1ZSQA 1FHXA 5CLQB 1TXDA 3MDBC 4EMOA 1XCGA 4ZRIA 1DDMA 3D8EA 1UPRA 4P7IA 4HDOA 5HE0A 1U2BA 2DKQA 3KRXA 1BTKA 3A8PA 4HAYB 4A6FB 4A6KA 2D11A 4YONA 3SUZA 3N7CA 4HB3B 1FHWA 3DXDA 3NSUA 1FAOA 2ROVA 2YT0A 1WVHA 3CIKA 5HE1A 1U5DA 1X86A 2W2XD 5C5BA 3QWMA 4DX90 1MIZB 2E2XA 3BINA 5DHAB 4HHVA 3GYOA 4L6EA 2V76A 1DROA 1WGQA 4K17A 5D3YA 2LULA 3PVWA 2AL6A 5DH9B 2LOZA 3VOQA 1U5GA 1V5MA 2UVMA 5KQ1A 1KZGA 1MPHA 1V5PA 1NU2A 2CY5A 1WJ1A 2LG1A 4A6FA 2UZRA 2I5FA 3G9WA 2I5CA 3PEGA 2NMBA 1EF1A 4WVFB 1FHOA 4HAZB 2IFSA 2J0KA 1U27A 4WJ7A 5JHHA 3KY9A 1ZC3B 1V88A 3AU5A 4HB0B 2QKLA 4GZUA 1K5GB 3HW2B 1H10A 3QBVB 5D3VA 1QC6A 1XKEA 3DXEA 1J19A 1W1DA 2RVBB 1NI2A 3P6AA 5DHFB 3TCAA 3FM8C 4C0AA 4TYZA 1PLSA 2J0JA 3U8ZA 1LB1A 2G35A 2M14A 4GN1A 2GJYA 4Z2MB 2DKPA 1XR0B 3SYXA 2UZSA 3KZ1A 1WG7A 3TW1A 3SV1A 2J59M 1X11A 2KGXB 5KQ4A 4MK0A 5DI9B 4NY0A 3ODWA 4IAPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MWN B;  3ULB A;  1X05 A;  1TJ6 A;  2VKI A;  4GXB A;  2IYB A;  2COD A;  2ZPY A;  5KCV A;  1J0W A;  3M1I B;  5LON B;  5J3Q A;  2DN6 A;  1BTN A;  1P3R A;  3F0W A;  2VSZ A;  3KRW A;  3RCP A;  3KSY A;  2I1J A;  1Y19 B;  2HE7 A;  1E5W A;  1W1H A;  2BCJ A;  2D10 A;  2LYD A;  4IFS A;  1P5T A;  3WA0 A;  4HAX B;  1V61 A;  1I2H A;  1DDW A;  1MK7 B;  2DTC A;  5EFX A;  2XQN M;  2K2U A;  2YS1 A;  5D3W A;  2P8V A;  4D0N B;  1WGU A;  4HB2 B;  2YS5 A;  2Y8F A;  2DYN A;  3FEH A;  3GYP A;  4KHB B;  3UZT A;  1ZVR A;  5JP4 A;  4DBB A;  1FOE A;  3F5R A;  2D2Q A;  1I7A A;  1RJ2 A;  4HB4 B;  1UNP A;  2J0M A;  2RSG A;  4XWX A;  1FGY A;  4A6H A;  2DX5 A;  1H4R A;  1SHC A;  4Y94 A;  3ZDT A;  4DXA B;  2ELB A;  4BBK A;  1UEF A;  1Y5O A;  1KI1 B;  4K2O A;  2DFK A;  1WI1 A;  2EMS A;  3SNH A;  2AEH A;  5CLL B;  2YS3 A;  4EJN A;  4CHJ A;  1V89 A;  2P0D A;  1SGH A;  4MY6 A;  2D9W A;  3IVF A;  2GCJ A;  3PVU A;  2PZ1 A;  2R0D A;  3OAN A;  5C79 A;  1DBH A;  4F7H A;  2X18 A;  3ODO A;  2YVC A;  1EGX A;  1ZC4 B;  1U5E A;  2EMT A;  3QIJ A;  5JLJ B;  3ZVR A;  2Y8G A;  4CYE A;  1FGZ A;  2ADZ A;  2EJ8 A;  4Z2N A;  3D8D A;  3A98 B;  1AWE A;  1LW3 A;  1GC6 A;  1GG3 A;  3TFM A;  4ZRK A;  4F7G A;  2DA0 A;  1OQN A;  2N0Y A;  3VIA A;  3PVL A;  4A5K A;  1DYN A;  2RGN B;  4H8S A;  1FB8 A;  3SO6 A;  3TVV A;  5HE2 A;  1MAI A;  3CXB B;  4PNK A;  2L1C A;  1MK9 B;  2Z0O A;  4PQ0 A;  2I1K A;  5D3X A;  4NSW A;  1UNQ A;  1M7E A;  2K00 A;  5FI0 A;  5D27 A;  2M38 A;  4KHA A;  1TQZ A;  3T06 A;  4MT7 A;  2RLO A;  2W2X C;  3A8Q A;  3HK0 A;  2ROZ B;  4GMX B;  5L81 A;  3DXC A;  1M7R A;  3FSS A;  3D8F A;  2NZ8 B;  2ELA A;  1N3H A;  1OMW A;  3X23 A;  3PSC A;  1B55 A;  5C16 A;  2LOX A;  1NTY A;  4HDQ A;  3ML4 A;  1UPQ A;  2D9Y A;  2P0F A;  2DHK A;  2GS0 A;  1QQG A;  1NTV A;  2MFQ A;  5C6R A;  4EKU A;  3PG7 A;  2K2J A;  2H7E A;  1OY2 A;  1ISN A;  2COA A;  4GPT B;  5J3T A;  1K5D B;  2CRF A;  4K2P A;  4HAT B;  4KVG B;  5LOP B;  2YRY A;  3BJI A;  4CHM A;  1W1G A;  4YL8 A;  1IRS A;  2D4Q A;  2N23 A;  1PFJ A;  1RRP B;  1X1F A;  2YT1 A;  4F7U P;  4HAW B;  1GC7 A;  4TKN A;  3MPX A;  2QKM A;  2CY4 A;  2FJL A;  3ODX A;  2OQB A;  2YF0 A;  1V5U A;  2VRW B;  3AU4 A;  3WYF B;  1AQC A;  3PZD A;  1KZ7 A;  1U5F A;  2JP2 A;  4K81 A;  1PMS A;  2Q13 A;  4GMV A;  1XD4 A;  3LJU X;  2YSZ A;  2KUP A;  3TO1 A;  1Z87 A;  2L2I A;  1DDV A;  1U29 A;  1BWN A;  3O96 A;  1XOD A;  4IOY X;  4HAU B;  2DHI A;  2HTH B;  3P7Z A;  3U7D A;  4KAX B;  2D9Z A;  4HAV B;  2COF A;  1WJM A;  2LKO A;  1XX0 A;  1MIX A;  4DX8 A;  3AJ4 A;  2R09 A;  2GCL A;  2OTX A;  2CAY A;  5HE3 A;  1EVH A;  4B6H A;  2DHJ A;  2RNR B;  1MKE A;  5JHG A;  1X1G A;  2Z0Q A;  3ULC A;  5FI1 A;  1Q67 A;  2COC A;  5DIF B;  5GOW B;  2DLW A;  4WSF A;  1ZM0 A;  1BAK A;  2KCJ A;  2EC1 A;  2MKR A;  2D9X A;  3PP2 A;  2P0H A;  4KHO A;  4ZRJ A;  2Y7B A;  1UNR A;  2D9V A;  2Z0P A;  2H7D A;  2DX1 A;  1P6S A;  2DYQ A;  3HQC A;  5C5B B;  1EAZ A;  2RUK B;  5J3Y A;  2MDX A;  2W2W A;  3V5W A;  1ZSQ A;  1FHX A;  5CLQ B;  1TXD A;  3MDB C;  4EMO A;  1XCG A;  4ZRI A;  1DDM A;  3D8E A;  1UPR A;  4P7I A;  4HDO A;  5HE0 A;  1U2B A;  2DKQ A;  3KRX A;  1BTK A;  3A8P A;  4HAY B;  4A6F B;  4A6K A;  2D11 A;  4YON A;  3SUZ A;  3N7C A;  4HB3 B;  1FHW A;  3DXD A;  3NSU A;  1FAO A;  2ROV A;  2YT0 A;  1WVH A;  3CIK A;  5HE1 A;  1U5D A;  1X86 A;  2W2X D;  5C5B A;  3QWM A;  4DX9 0;  1MIZ B;  2E2X A;  3BIN A;  5DHA B;  4HHV A;  3GYO A;  4L6E A;  2V76 A;  1DRO A;  1WGQ A;  4K17 A;  5D3Y A;  2LUL A;  3PVW A;  2AL6 A;  5DH9 B;  2LOZ A;  3VOQ A;  1U5G A;  1V5M A;  2UVM A;  5KQ1 A;  1KZG A;  1MPH A;  1V5P A;  1NU2 A;  2CY5 A;  1WJ1 A;  2LG1 A;  4A6F A;  2UZR A;  2I5F A;  3G9W A;  2I5C A;  3PEG A;  2NMB A;  1EF1 A;  4WVF B;  1FHO A;  4HAZ B;  2IFS A;  2J0K A;  1U27 A;  4WJ7 A;  5JHH A;  3KY9 A;  1ZC3 B;  1V88 A;  3AU5 A;  4HB0 B;  2QKL A;  4GZU A;  1K5G B;  3HW2 B;  1H10 A;  3QBV B;  5D3V A;  1QC6 A;  1XKE A;  3DXE A;  1J19 A;  1W1D A;  2RVB B;  1NI2 A;  3P6A A;  5DHF B;  3TCA A;  3FM8 C;  4C0A A;  4TYZ A;  1PLS A;  2J0J A;  3U8Z A;  1LB1 A;  2G35 A;  2M14 A;  4GN1 A;  2GJY A;  4Z2M B;  2DKP A;  1XR0 B;  3SYX A;  2UZS A;  3KZ1 A;  1WG7 A;  3TW1 A;  3SV1 A;  2J59 M;  1X11 A;  2KGX B;  5KQ4 A;  4MK0 A;  5DI9 B;  4NY0 A;  3ODW A;  4IAP A; 
#chains in the Genus database with same CATH topology
 2MWN B;  3ULB A;  1X05 A;  1TJ6 A;  2VKI A;  4GXB A;  2IYB A;  2COD A;  2ZPY A;  5KCV A;  1J0W A;  3M1I B;  5LON B;  5J3Q A;  2DN6 A;  1BTN A;  1P3R A;  2Z4D A;  2KIG A;  3F0W A;  2VSZ A;  3KRW A;  4OSN A;  3RCP A;  4DIX A;  3KSY A;  2I1J A;  1Y19 B;  2HE7 A;  1E5W A;  2KIE A;  1W1H A;  2BCJ A;  2D10 A;  2LYD A;  4IFS A;  1P5T A;  3WA0 A;  4HAX B;  1V61 A;  1I2H A;  1DDW A;  1MK7 B;  2DTC A;  5EFX A;  2XQN M;  2K2U A;  2YS1 A;  5D3W A;  2P8V A;  4D0N B;  1WGU A;  4HB2 B;  2YS5 A;  2Y8F A;  4QJ5 B;  2DYN A;  3FEH A;  3GYP A;  4KHB B;  3UZT A;  1ZVR A;  5JP4 A;  5M4Y B;  4DBB A;  2Z14 A;  1FOE A;  3F5R A;  2D2Q A;  1I7A A;  1RJ2 A;  4HB4 B;  1UNP A;  2J0M A;  2RSG A;  4XWX A;  1FGY A;  4A6H A;  2DX5 A;  1H4R A;  1SHC A;  4Y94 A;  3ZDT A;  4DXA B;  2ELB A;  4BBK A;  1UEF A;  1Y5O A;  1KI1 B;  4K2O A;  2DFK A;  1WI1 A;  2EMS A;  3SNH A;  2AEH A;  5CLL B;  2YS3 A;  4EJN A;  4CHJ A;  1V89 A;  2P0D A;  1SGH A;  4MY6 A;  2D9W A;  3IVF A;  2GCJ A;  3PVU A;  2PZ1 A;  2R0D A;  3OAN A;  5C79 A;  1DBH A;  4KHB A;  4F7H A;  2X18 A;  3ODO A;  4OT1 A;  2YVC A;  1EGX A;  5I2M A;  1ZC4 B;  1U5E A;  2EMT A;  3QIJ A;  5JLJ B;  3ZVR A;  2Y8G A;  4CYE A;  1FGZ A;  2ADZ A;  2EJ8 A;  4Z2N A;  3D8D A;  3A98 B;  2KR0 A;  1AWE A;  1LW3 A;  2GUM A;  1GC6 A;  1GG3 A;  3TFM A;  4ZRK A;  4F7G A;  2DA0 A;  1OQN A;  2N0Y A;  3VIA A;  3PVL A;  4A5K A;  1DYN A;  2RGN B;  4H8S A;  1FB8 A;  4L1R A;  3SO6 A;  3TVV A;  5HE2 A;  1MAI A;  3CXB B;  3B77 A;  2L1C A;  4PNK A;  1MK9 B;  2Z0O A;  4PQ0 A;  2I1K A;  5D3X A;  4NSW A;  1UNQ A;  1M7E A;  2K00 A;  5FI0 A;  5D27 A;  2M38 A;  4KHA A;  1TQZ A;  3T06 A;  4MT7 A;  3NWD A;  2RLO A;  2W2X C;  3A8Q A;  3HK0 A;  2ROZ B;  4GMX B;  5L81 A;  3DXC A;  1M7R A;  3FSS A;  3NWF A;  3NWA A;  4HSI A;  3D8F A;  2NZ8 B;  2ELA A;  1N3H A;  1OMW A;  3X23 A;  3PSC A;  1B55 A;  5C16 A;  2LOX A;  1NTY A;  4HDQ A;  3ML4 A;  1UPQ A;  2D9Y A;  2P0F A;  2DHK A;  2GS0 A;  1QQG A;  1NTV A;  2MFQ A;  5C6R A;  4EKU A;  3PG7 A;  2K2J A;  2H7E A;  1OY2 A;  1ISN A;  4GNK B;  2COA A;  4GPT B;  5J3T A;  1K5D B;  2CRF A;  4K2P A;  4HAT B;  3A58 A;  4KVG B;  5LOP B;  5I2S A;  2YRY A;  3BJI A;  4CHM A;  1W1G A;  1ZYI A;  4YL8 A;  1IRS A;  2D4Q A;  2N23 A;  1PFJ A;  1RRP B;  3FVC A;  1X1F A;  2YT1 A;  2ZKM X;  4F7U P;  4HAW B;  1GC7 A;  4TKN A;  3MPX A;  2QKM A;  4D6W A;  2CY4 A;  2FJL A;  3ODX A;  2OQB A;  2YF0 A;  1V5U A;  2VRW B;  3AU4 A;  3WYF B;  3HIE A;  1AQC A;  3PZD A;  1KZ7 A;  1U5F A;  2JP2 A;  4K81 A;  1PMS A;  2Q13 A;  4GMV A;  1XD4 A;  3LJU X;  3OHM B;  4CSQ A;  2YSZ A;  2KUP A;  3TO1 A;  1Z87 A;  2L2I A;  1DDV A;  1U29 A;  4QXA B;  1BWN A;  3O96 A;  1XOD A;  4IOY X;  4HAU B;  2Z59 A;  2DHI A;  2HTH B;  3P7Z A;  3U7D A;  4KAX B;  2D9Z A;  4HAV B;  2COF A;  1WJM A;  2LKO A;  1XX0 A;  1MIX A;  4DX8 A;  3AJ4 A;  2R09 A;  2GCL A;  2OTX A;  2CAY A;  5HE3 A;  1EVH A;  4B6H A;  2DHJ A;  2YT2 A;  2RNR B;  1MKE A;  2RRF A;  5JHG A;  1X1G A;  2Z0Q A;  3ULC A;  5FI1 A;  1Q67 A;  2COC A;  5DIF B;  5GOW B;  2DLW A;  4WSF A;  1ZM0 A;  4GOU A;  1BAK A;  2KCJ A;  2EC1 A;  2MKR A;  2D9X A;  2FJU B;  3PP2 A;  2P0H A;  4KHO A;  4ZRJ A;  2Y7B A;  1UNR A;  2D9V A;  2Z0P A;  2H7D A;  2DX1 A;  1P6S A;  2DYQ A;  3HQC A;  5C5B B;  1EAZ A;  2RUK B;  5J3Y A;  2MDX A;  2W2W A;  3V5W A;  1ZSQ A;  1FHX A;  5CLQ B;  1TXD A;  3MDB C;  4EMO A;  1XCG A;  4QJ4 B;  4ZRI A;  1DDM A;  3D8E A;  1UPR A;  4P7I A;  4HDO A;  5HE0 A;  1U2B A;  2DKQ A;  2NBV A;  1T77 A;  3NW8 A;  1BTK A;  3KRX A;  3A8P A;  4HAY B;  4A6F B;  4A6K A;  2D11 A;  4YON A;  5IRS A;  3SUZ A;  3N7C A;  4HB3 B;  1FHW A;  3DXD A;  3NSU A;  1FAO A;  2ROV A;  2YT0 A;  1WVH A;  3CIK A;  2R2Y A;  5HE1 A;  1U5D A;  1X86 A;  2W2X D;  5C5B A;  3QWM A;  4DX9 0;  1MIZ B;  5LG4 B;  2E2X A;  3BIN A;  5DHA B;  4HHV A;  3GYO A;  4L6E A;  2V76 A;  1DRO A;  1WGQ A;  4K17 A;  5D3Y A;  2LUL A;  3PVW A;  2AL6 A;  4QJ3 B;  2Z13 A;  5DH9 B;  2LOZ A;  3VOQ A;  1U5G A;  1V5M A;  2UVM A;  5KQ1 A;  1KZG A;  1MPH A;  1V5P A;  1NU2 A;  2CY5 A;  1WJ1 A;  2LG1 A;  4A6F A;  2UZR A;  2I5F A;  3G9W A;  2I5C A;  3PEG A;  2NMB A;  1EF1 A;  4WVF B;  1FHO A;  4HAZ B;  2IFS A;  2J0K A;  1U27 A;  4WJ7 A;  5JHH A;  2KUQ A;  3KY9 A;  1ZC3 B;  1V88 A;  3HSA A;  3AU5 A;  4HB0 B;  2QKL A;  4GZU A;  1K5G B;  3HW2 B;  1H10 A;  3QBV B;  2K49 A;  5D3V A;  1QC6 A;  1XKE A;  3DXE A;  1J19 A;  1W1D A;  2RVB B;  1NI2 A;  3P6A A;  5DHF B;  3TCA A;  3FM8 C;  4C0A A;  4TYZ A;  1PLS A;  2J0J A;  3U8Z A;  1LB1 A;  1MI1 A;  2G35 A;  2M14 A;  4GN1 A;  2K8E A;  2GJY A;  4Z2M B;  2DKP A;  1XR0 B;  3SYX A;  2UZS A;  3KZ1 A;  1WG7 A;  3TW1 A;  3SV1 A;  3DCX A;  2J59 M;  1X11 A;  2KGX B;  3U12 A;  5KQ4 A;  4MK0 A;  5DI9 B;  4NY0 A;  3ODW A;  4IAP A; 
#chains in the Genus database with same CATH homology
 2MWN B;  3ULB A;  1X05 A;  1TJ6 A;  2VKI A;  4GXB A;  2IYB A;  2COD A;  2ZPY A;  5KCV A;  1J0W A;  3M1I B;  5LON B;  5J3Q A;  2DN6 A;  1BTN A;  1P3R A;  3F0W A;  2VSZ A;  3KRW A;  3RCP A;  3KSY A;  2I1J A;  1Y19 B;  2HE7 A;  1E5W A;  1W1H A;  2BCJ A;  2D10 A;  2LYD A;  4IFS A;  1P5T A;  3WA0 A;  4HAX B;  1V61 A;  1I2H A;  1DDW A;  1MK7 B;  2DTC A;  5EFX A;  2XQN M;  2K2U A;  2YS1 A;  5D3W A;  2P8V A;  4D0N B;  1WGU A;  4HB2 B;  2YS5 A;  2Y8F A;  2DYN A;  3FEH A;  3GYP A;  4KHB B;  3UZT A;  1ZVR A;  5JP4 A;  4DBB A;  1FOE A;  3F5R A;  2D2Q A;  1I7A A;  1RJ2 A;  4HB4 B;  1UNP A;  2J0M A;  2RSG A;  4XWX A;  1FGY A;  4A6H A;  2DX5 A;  1H4R A;  1SHC A;  4Y94 A;  3ZDT A;  4DXA B;  2ELB A;  4BBK A;  1UEF A;  1Y5O A;  1KI1 B;  4K2O A;  2DFK A;  1WI1 A;  2EMS A;  3SNH A;  2AEH A;  5CLL B;  2YS3 A;  4EJN A;  4CHJ A;  1V89 A;  2P0D A;  1SGH A;  4MY6 A;  2D9W A;  3IVF A;  2GCJ A;  3PVU A;  2PZ1 A;  2R0D A;  3OAN A;  5C79 A;  1DBH A;  4F7H A;  2X18 A;  3ODO A;  2YVC A;  1EGX A;  1ZC4 B;  1U5E A;  2EMT A;  3QIJ A;  5JLJ B;  3ZVR A;  2Y8G A;  4CYE A;  1FGZ A;  2ADZ A;  2EJ8 A;  4Z2N A;  3D8D A;  3A98 B;  1AWE A;  1LW3 A;  1GC6 A;  1GG3 A;  3TFM A;  4ZRK A;  4F7G A;  2DA0 A;  1OQN A;  2N0Y A;  3VIA A;  3PVL A;  4A5K A;  1DYN A;  2RGN B;  4H8S A;  1FB8 A;  3SO6 A;  3TVV A;  5HE2 A;  1MAI A;  3CXB B;  4PNK A;  2L1C A;  1MK9 B;  2Z0O A;  4PQ0 A;  2I1K A;  5D3X A;  4NSW A;  1UNQ A;  1M7E A;  2K00 A;  5FI0 A;  5D27 A;  2M38 A;  4KHA A;  1TQZ A;  3T06 A;  4MT7 A;  2RLO A;  2W2X C;  3A8Q A;  3HK0 A;  2ROZ B;  4GMX B;  5L81 A;  3DXC A;  1M7R A;  3FSS A;  3D8F A;  2NZ8 B;  2ELA A;  1N3H A;  1OMW A;  3X23 A;  3PSC A;  1B55 A;  5C16 A;  2LOX A;  1NTY A;  4HDQ A;  3ML4 A;  1UPQ A;  2D9Y A;  2P0F A;  2DHK A;  2GS0 A;  1QQG A;  1NTV A;  2MFQ A;  5C6R A;  4EKU A;  3PG7 A;  2K2J A;  2H7E A;  1OY2 A;  1ISN A;  2COA A;  4GPT B;  5J3T A;  1K5D B;  2CRF A;  4K2P A;  4HAT B;  4KVG B;  5LOP B;  2YRY A;  3BJI A;  4CHM A;  1W1G A;  4YL8 A;  1IRS A;  2D4Q A;  2N23 A;  1PFJ A;  1RRP B;  1X1F A;  2YT1 A;  4F7U P;  4HAW B;  1GC7 A;  4TKN A;  3MPX A;  2QKM A;  2CY4 A;  2FJL A;  3ODX A;  2OQB A;  2YF0 A;  1V5U A;  2VRW B;  3AU4 A;  3WYF B;  1AQC A;  3PZD A;  1KZ7 A;  1U5F A;  2JP2 A;  4K81 A;  1PMS A;  2Q13 A;  4GMV A;  1XD4 A;  3LJU X;  2YSZ A;  2KUP A;  3TO1 A;  1Z87 A;  2L2I A;  1DDV A;  1U29 A;  1BWN A;  3O96 A;  1XOD A;  4IOY X;  4HAU B;  2DHI A;  2HTH B;  3P7Z A;  3U7D A;  4KAX B;  2D9Z A;  4HAV B;  2COF A;  1WJM A;  2LKO A;  1XX0 A;  1MIX A;  4DX8 A;  3AJ4 A;  2R09 A;  2GCL A;  2OTX A;  2CAY A;  5HE3 A;  1EVH A;  4B6H A;  2DHJ A;  2RNR B;  1MKE A;  5JHG A;  1X1G A;  2Z0Q A;  3ULC A;  5FI1 A;  1Q67 A;  2COC A;  5DIF B;  5GOW B;  2DLW A;  4WSF A;  1ZM0 A;  1BAK A;  2KCJ A;  2EC1 A;  2MKR A;  2D9X A;  3PP2 A;  2P0H A;  4KHO A;  4ZRJ A;  2Y7B A;  1UNR A;  2D9V A;  2Z0P A;  2H7D A;  2DX1 A;  1P6S A;  2DYQ A;  3HQC A;  5C5B B;  1EAZ A;  2RUK B;  5J3Y A;  2MDX A;  2W2W A;  3V5W A;  1ZSQ A;  1FHX A;  5CLQ B;  1TXD A;  3MDB C;  4EMO A;  1XCG A;  4ZRI A;  1DDM A;  3D8E A;  1UPR A;  4P7I A;  4HDO A;  5HE0 A;  1U2B A;  2DKQ A;  3KRX A;  1BTK A;  3A8P A;  4HAY B;  4A6F B;  4A6K A;  2D11 A;  4YON A;  3SUZ A;  3N7C A;  4HB3 B;  1FHW A;  3DXD A;  3NSU A;  1FAO A;  2ROV A;  2YT0 A;  1WVH A;  3CIK A;  5HE1 A;  1U5D A;  1X86 A;  2W2X D;  5C5B A;  3QWM A;  4DX9 0;  1MIZ B;  2E2X A;  3BIN A;  5DHA B;  4HHV A;  3GYO A;  4L6E A;  2V76 A;  1DRO A;  1WGQ A;  4K17 A;  5D3Y A;  2LUL A;  3PVW A;  2AL6 A;  5DH9 B;  2LOZ A;  3VOQ A;  1U5G A;  1V5M A;  2UVM A;  5KQ1 A;  1KZG A;  1MPH A;  1V5P A;  1NU2 A;  2CY5 A;  1WJ1 A;  2LG1 A;  4A6F A;  2UZR A;  2I5F A;  3G9W A;  2I5C A;  3PEG A;  2NMB A;  1EF1 A;  4WVF B;  1FHO A;  4HAZ B;  2IFS A;  2J0K A;  1U27 A;  4WJ7 A;  5JHH A;  3KY9 A;  1ZC3 B;  1V88 A;  3AU5 A;  4HB0 B;  2QKL A;  4GZU A;  1K5G B;  3HW2 B;  1H10 A;  3QBV B;  5D3V A;  1QC6 A;  1XKE A;  3DXE A;  1J19 A;  1W1D A;  2RVB B;  1NI2 A;  3P6A A;  5DHF B;  3TCA A;  3FM8 C;  4C0A A;  4TYZ A;  1PLS A;  2J0J A;  3U8Z A;  1LB1 A;  2G35 A;  2M14 A;  4GN1 A;  2GJY A;  4Z2M B;  2DKP A;  1XR0 B;  3SYX A;  2UZS A;  3KZ1 A;  1WG7 A;  3TW1 A;  3SV1 A;  2J59 M;  1X11 A;  2KGX B;  5KQ4 A;  4MK0 A;  5DI9 B;  4NY0 A;  3ODW A;  4IAP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...