1XR0B

Structural basis of snt ptb domain interactions with distinct neurotrophic receptors
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
129
structure length
129
Chain Sequence
b'MGSDTVPDNHRNKFKVINVDDDGNELGSGIMELTDTELILYTRKRDSVKWHYLCLRRYGYDSNLFSFESGRRCQTGQGIFAFKCARAEELFNMLQEIMQNNSINVVEEPVVERNNHQTELEVPRTPRTP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Basic fibroblast growth factor receptor 1
publication title Structural Basis of SNT PTB Domain Interactions with Distinct Neurotrophic Receptors
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein/growth factor receptor
total genus 14
structure length 129
sequence length 129
ec nomenclature
pdb deposition date 2004-10-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02174 IRS PTB domain (IRS-1 type)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 1xr0B01
3TW1A 4MY6A 2J0KA 5CLQB 2LOXA 1MAIA 2IFSA 1U5FA 2P8VA 2GCLA 4IOYX 4B6HA 3KZ1A 2I5CA 5FI0A 3UZTA 1FGZA 2Z0OA 1DDWA 2UZRA 3CXBB 3A8QA 1X1GA 4Y94A 5L81A 4ZRIA 2AEHA 4HDQA 5DIFB 3A8PA 4CHJA 3NSUA 2M38A 4HHVA 3AJ4A 1WGUA 4ZRJA 1FHXA 1WGQA 2EMTA 4H8SA 1ZSQA 1U27A 2K2JA 2K2UA 1DBHA 3D8EA 2NZ8B 4GMXB 2R0DA 2D9XA 1FHOA 3BJIA 3CIKA 1BTKA 1X11A 2Z0PA 5JHHA 2OTXA 2DX5A 1X86A 2X18A 1XCGA 2PZ1A 1UPQA 1WJ1A 2FJLA 4IFSA 4NSWA 1FAOA 1U29A 3M1IB 1XD4A 5J3QA 1K5DB 1W1GA 4L6EA 2VSZA 2ELAA 3KRXA 4K17A 2NMBA 3SUZA 1DYNA 3N7CA 4HAYB 1KZGA 1P3RA 4ZRKA 1V89A 5JHGA 3QIJA 5JP4A 2YS5A 1TQZA 2DN6A 4EKUA 4D0NB 1FOEA 5C6RA 5CLLB 2YT1A 4HB4B 2Y7BA 3WA0A 2D9WA 4F7GA 1LW3A 2DLWA 1UNQA 3G9WA 2OQBA 3GYPA 2KGXB 2RVBB 1EF1A 1UNPA 1MPHA 3HQCA 3WYFB 3FM8C 2LOZA 4EJNA 1FHWA 4Z2NA 2K00A 2D2QA 2N23A 1P5TA 2RSGA 4IAPA 2DTCA 5GOWB 2D10A 1MK7B 1OMWA 1NTYA 2GCJA 2HE7A 1W1DA 1K5GB 1Y19B 3LJUX 2BCJA 2Y8GA 2COFA 1V5MA 1J0WA 2V76A 2YVCA 2P0DA 1OY2A 5LOPB 2Q13A 3KRWA 1QC6A 2CY4A 3IVFA 1ISNA 1KI1B 5D3VA 1PFJA 2JP2A 3D8FA 2R09A 4HB3B 2DA0A 2MFQA 2GS0A 2HTHB 5D3XA 1MK9B 1XX0A 3TO1A 2RLOA 4PQ0A 5J3YA 4C0AA 2DHIA 1UNRA 4KVGB 2N0YA 2Z0QA 1ZC3B 2DKPA 3A98B 1V61A 1RRPB 1P6SA 3TFMA 4F7HA 3ZVRA 4F7UP 2MWNB 4TKNA 1IRSA 2XQNM 4NY0A 1UPRA 3ZDTA 5DI9B 2KUPA 2J0MA 2CODA 1GG3A 4PNKA 2H7EA 3P7ZA 4GPTB 3DXEA 4WVFB 3F0WA 4HAZB 2KCJA 4GN1A 2L2IA 3DXCA 2E2XA 4DX8A 2COCA 5D3YA 1J19A 2DHKA 4XWXA 4YL8A 1FGYA 1Z87A 1XODA 5C5BB 3FEHA 3X23A 3RCPA 2RUKB 1PLSA 3VOQA 1XR0B 1V5UA 4GMVA 2YRYA 5FI1A 3SV1A 2M14A 4KHAA 1I2HA 2DYNA 4HB2B 3TVVA 1U2BA 1BWNA 1BTNA 2UZSA 3PP2A 2L1CA 1SHCA 4HB0B 1RJ2A 2EC1A 2CAYA 3DXDA 2J0JA 1NI2A 1Q67A 2D4QA 4EMOA 4K2OA 5KCVA 2VRWB 2W2XD 1Y5OA 2DKQA 4KHOA 5D3WA 4YONA 3AU5A 3QWMA 3PVUA 3SYXA 2DYQA 2QKLA 1V88A 4MT7A 4A6KA 4A5KA 3ULBA 2D9ZA 5EFXA 4P7IA 2COAA 2H7DA 4A6HA 3O96A 4Z2MB 3HW2B 1LB1A 3PSCA 5C16A 2ROZB 1BAKA 4WSFA 2I5FA 2ADZA 2ROVA 3OANA 5HE0A 1ZVRA 4K2PA 2P0HA 4HDOA 3U7DA 1NTVA 2DFKA 2VKIA 3P6AA 5J3TA 3PEGA 2LULA 1MIZB 2MKRA 2GJYA 1WI1A 3ULCA 3SNHA 2Y8FA 3V5WA 3TCAA 4DBBA 1V5PA 3MDBC 3VIAA 3ML4A 2YSZA 2MDXA 1PMSA 3QBVB 2ZPYA 5D27A 1MKEA 5C5BA 1M7RA 2CY5A 2QKMA 4K81A 2YT0A 1I7AA 2AL6A 5HE2A 2LYDA 2YS1A 3AU4A 3ODOA 1ZC4B 4HAVB 5C79A 1B55A 2D11A 4A6FA 2LG1A 3ODWA 5KQ1A 1U5DA 1E5WA 1XKEA 3SO6A 1OQNA 2CRFA 3HK0A 1X05A 2DX1A 1QQGA 4A6FB 4CHMA 1M7EA 5LONB 2UVMA 2D9VA 3U8ZA 2YS3A 3D8DA 3ODXA 3PVWA 1SGHA 2EJ8A 3FSSA 2RGNB 2IYBA 2ELBA 1W1HA 5HE1A 1UEFA 2EMSA 1EVHA 2J59M 4KHBB 1DROA 1EGXA 4DX90 4CYEA 3KSYA 1N3HA 5DH9B 4BBKA 4DXAB 4GXBA 4HAUB 1X1FA 1KZ7A 4MK0A 3MPXA 1U5EA 1DDVA 1GC7A 4GZUA 1FB8A 2W2XC 1ZM0A 1TXDA 2I1KA 1MIXA 3F5RA 1GC6A 4HAXB 2D9YA 1WG7A 5HE3A 1WVHA 2LKOA 1U5GA 3PVLA 5JLJB 5DHAB 3BINA 2G35A 1TJ6A 4HAWB 3PG7A 1AWEA 5DHFB 1EAZA 2P0FA 3KY9A 2DHJA 3PZDA 3GYOA 2RNRB 3T06A 1H10A 4WJ7A 1AQCA 2YF0A 2I1JA 5KQ4A 4TYZA 1NU2A 2W2WA 1DDMA 1H4RA 4HATB 4KAXB 1WJMA
chains in the Genus database with same CATH superfamily
2KIGA 3TW1A 4MY6A 4QJ5B 2J0KA 5CLQB 2LOXA 1MAIA 2IFSA 1U5FA 2P8VA 2GCLA 4IOYX 4B6HA 3KZ1A 5I2SA 2I5CA 5FI0A 3UZTA 1FGZA 4OSNA 2Z0OA 1DDWA 2UZRA 3CXBB 3A8QA 1X1GA 4Y94A 5L81A 4ZRIA 2AEHA 4HDQA 5DIFB 3A8PA 4CHJA 3NSUA 2M38A 4HHVA 3NWDA 3AJ4A 1WGUA 4ZRJA 1FHXA 3NW8A 1WGQA 2EMTA 4H8SA 1ZSQA 1U27A 2K2JA 2Z13A 2K2UA 1DBHA 3D8EA 2NZ8B 4GMXB 2R0DA 2D9XA 1FHOA 3BJIA 3CIKA 1BTKA 1X11A 2Z0PA 4D6WA 5JHHA 2OTXA 2DX5A 1X86A 2Z14A 2X18A 1XCGA 2PZ1A 1UPQA 1WJ1A 2FJLA 4IFSA 4NSWA 1FAOA 1U29A 3M1IB 1XD4A 5J3QA 1K5DB 1W1GA 4L6EA 2VSZA 2ELAA 3KRXA 4K17A 2NMBA 3SUZA 5M4YB 1DYNA 3N7CA 4HAYB 1KZGA 1P3RA 4ZRKA 1V89A 5JHGA 3QIJA 5JP4A 4GNKB 2YS5A 1TQZA 2DN6A 4EKUA 4D0NB 1FOEA 5C6RA 5CLLB 2K49A 2YT1A 4HB4B 2Y7BA 3WA0A 2D9WA 4F7GA 1LW3A 2DLWA 1UNQA 4HSIA 3G9WA 2OQBA 3GYPA 2KGXB 2RVBB 1EF1A 1UNPA 3U12A 1MPHA 3HQCA 3WYFB 3FM8C 2LOZA 4EJNA 1FHWA 4Z2NA 2K00A 2D2QA 2N23A 1P5TA 2RSGA 4IAPA 2DTCA 5GOWB 2D10A 1MK7B 1OMWA 2KIEA 1NTYA 2GCJA 2HE7A 1W1DA 1K5GB 1Y19B 3LJUX 2BCJA 2Y8GA 2COFA 1V5MA 1J0WA 2V76A 1MI1A 2YVCA 2P0DA 1OY2A 5LOPB 2Q13A 3KRWA 1QC6A 1T77A 2CY4A 3IVFA 1ISNA 1KI1B 5D3VA 1PFJA 2JP2A 3D8FA 2R09A 4HB3B 2DA0A 2MFQA 3NWAA 2GS0A 2HTHB 5D3XA 1MK9B 1XX0A 3TO1A 2RLOA 4PQ0A 5J3YA 4C0AA 2DHIA 1UNRA 4KVGB 2N0YA 2Z0QA 2K8EA 1ZC3B 2DKPA 3A98B 1V61A 1RRPB 1P6SA 3TFMA 4F7HA 2ZKMX 3ZVRA 4F7UP 4QJ4B 2MWNB 4TKNA 1IRSA 2XQNM 4NY0A 1UPRA 3ZDTA 5DI9B 2KUPA 2J0MA 2CODA 1GG3A 2Z4DA 2H7EA 4PNKA 3P7ZA 2GUMA 4GPTB 3DXEA 4WVFB 3F0WA 4HAZB 2KCJA 4GN1A 2L2IA 3DXCA 2E2XA 4DX8A 2KUQA 2COCA 5D3YA 1J19A 4GOUA 2DHKA 4XWXA 4YL8A 1FGYA 1Z87A 1XODA 5C5BB 3FEHA 3X23A 3RCPA 2RUKB 1PLSA 3VOQA 1XR0B 1V5UA 4GMVA 2YRYA 5FI1A 5LG4B 3SV1A 2M14A 4KHAA 1I2HA 2DYNA 4HB2B 3TVVA 3FVCA 1U2BA 1BWNA 1BTNA 2UZSA 3PP2A 2L1CA 1SHCA 4HB0B 2NBVA 1RJ2A 2EC1A 2CAYA 3DXDA 5IRSA 2J0JA 2RRFA 1NI2A 1Q67A 2D4QA 4EMOA 4K2OA 5KCVA 2VRWB 2W2XD 1Y5OA 3B77A 2DKQA 4KHOA 5D3WA 4YONA 3AU5A 3QWMA 2FJUB 3PVUA 3SYXA 2DYQA 2QKLA 1V88A 4MT7A 4A6KA 4A5KA 3ULBA 2D9ZA 5EFXA 4P7IA 2COAA 2H7DA 4A6HA 4QJ3B 4QXAB 3O96A 3HSAA 4Z2MB 3HW2B 1LB1A 3PSCA 2Z59A 5C16A 2ROZB 3NWFA 1BAKA 4WSFA 2I5FA 2ADZA 2ROVA 3OANA 5HE0A 1ZVRA 4K2PA 2P0HA 4HDOA 3U7DA 1NTVA 2DFKA 2VKIA 3P6AA 5J3TA 3PEGA 2LULA 1MIZB 2MKRA 2GJYA 1WI1A 3ULCA 3SNHA 2Y8FA 3V5WA 3TCAA 4DBBA 1V5PA 3MDBC 3VIAA 3ML4A 2YSZA 2MDXA 1PMSA 3QBVB 2ZPYA 5D27A 1MKEA 5C5BA 1M7RA 2KR0A 2CY5A 2QKMA 4K81A 2YT0A 1I7AA 2AL6A 3HIEA 5HE2A 2LYDA 2YS1A 3AU4A 3ODOA 1ZC4B 4HAVB 5C79A 1B55A 2D11A 4A6FA 2LG1A 3ODWA 5KQ1A 1U5DA 1E5WA 1XKEA 3SO6A 2R2YA 1OQNA 2CRFA 3OHMB 3HK0A 4OT1A 1X05A 2DX1A 1QQGA 4KHBA 4A6FB 4CHMA 1M7EA 5LONB 2UVMA 2D9VA 3U8ZA 2YS3A 3D8DA 3ODXA 3PVWA 1SGHA 2EJ8A 3FSSA 2RGNB 3DCXA 2IYBA 2ELBA 1W1HA 5HE1A 1UEFA 2EMSA 1EVHA 2J59M 4KHBB 1DROA 1EGXA 4DX90 4CYEA 3KSYA 1N3HA 5DH9B 4BBKA 4DXAB 4GXBA 4HAUB 1X1FA 1KZ7A 4MK0A 3MPXA 1U5EA 1DDVA 1GC7A 4GZUA 1FB8A 2W2XC 1ZM0A 1TXDA 2I1KA 2YT2A 1MIXA 3F5RA 1GC6A 4HAXB 2D9YA 1WG7A 5HE3A 1WVHA 2LKOA 1U5GA 3PVLA 4CSQA 5JLJB 5DHAB 3BINA 2G35A 1TJ6A 4HAWB 3PG7A 1ZYIA 1AWEA 5DHFB 1EAZA 2P0FA 3KY9A 2DHJA 3PZDA 4DIXA 3GYOA 2RNRB 3T06A 1H10A 4WJ7A 1AQCA 2YF0A 2I1JA 5I2MA 5KQ4A 4TYZA 1NU2A 3A58A 2W2WA 1DDMA 4L1RA 1H4RA 4HATB 4KAXB 1WJMA
chains in the Genus database with same CATH topology
3TW1A 4MY6A 2J0KA 5CLQB 2LOXA 1MAIA 2IFSA 1U5FA 2P8VA 2GCLA 4IOYX 4B6HA 3KZ1A 2I5CA 5FI0A 3UZTA 1FGZA 2Z0OA 1DDWA 2UZRA 3CXBB 3A8QA 1X1GA 4Y94A 5L81A 4ZRIA 2AEHA 4HDQA 5DIFB 3A8PA 4CHJA 3NSUA 2M38A 4HHVA 3AJ4A 1WGUA 4ZRJA 1FHXA 1WGQA 2EMTA 4H8SA 1ZSQA 1U27A 2K2JA 2K2UA 1DBHA 3D8EA 2NZ8B 4GMXB 2R0DA 2D9XA 1FHOA 3BJIA 3CIKA 1BTKA 1X11A 2Z0PA 5JHHA 2OTXA 2DX5A 1X86A 2X18A 1XCGA 2PZ1A 1UPQA 1WJ1A 2FJLA 4IFSA 4NSWA 1FAOA 1U29A 3M1IB 1XD4A 5J3QA 1K5DB 1W1GA 4L6EA 2VSZA 2ELAA 3KRXA 4K17A 2NMBA 3SUZA 1DYNA 3N7CA 4HAYB 1KZGA 1P3RA 4ZRKA 1V89A 5JHGA 3QIJA 5JP4A 2YS5A 1TQZA 2DN6A 4EKUA 4D0NB 1FOEA 5C6RA 5CLLB 2YT1A 4HB4B 2Y7BA 3WA0A 2D9WA 4F7GA 1LW3A 2DLWA 1UNQA 3G9WA 2OQBA 3GYPA 2KGXB 2RVBB 1EF1A 1UNPA 1MPHA 3HQCA 3WYFB 3FM8C 2LOZA 4EJNA 1FHWA 4Z2NA 2K00A 2D2QA 2N23A 1P5TA 2RSGA 4IAPA 2DTCA 5GOWB 2D10A 1MK7B 1OMWA 1NTYA 2GCJA 2HE7A 1W1DA 1K5GB 1Y19B 3LJUX 2BCJA 2Y8GA 2COFA 1V5MA 1J0WA 2V76A 2YVCA 2P0DA 1OY2A 5LOPB 2Q13A 3KRWA 1QC6A 2CY4A 3IVFA 1ISNA 1KI1B 5D3VA 1PFJA 2JP2A 3D8FA 2R09A 4HB3B 2DA0A 2MFQA 2GS0A 2HTHB 5D3XA 1MK9B 1XX0A 3TO1A 2RLOA 4PQ0A 5J3YA 4C0AA 2DHIA 1UNRA 4KVGB 2N0YA 2Z0QA 1ZC3B 2DKPA 3A98B 1V61A 1RRPB 1P6SA 3TFMA 4F7HA 3ZVRA 4F7UP 2MWNB 4TKNA 1IRSA 2XQNM 4NY0A 1UPRA 3ZDTA 5DI9B 2KUPA 2J0MA 2CODA 1GG3A 4PNKA 2H7EA 3P7ZA 4GPTB 3DXEA 4WVFB 3F0WA 4HAZB 2KCJA 4GN1A 2L2IA 3DXCA 2E2XA 4DX8A 2COCA 5D3YA 1J19A 2DHKA 4XWXA 4YL8A 1FGYA 1Z87A 1XODA 5C5BB 3FEHA 3X23A 3RCPA 2RUKB 1PLSA 3VOQA 1XR0B 1V5UA 4GMVA 2YRYA 5FI1A 3SV1A 2M14A 4KHAA 1I2HA 2DYNA 4HB2B 3TVVA 1U2BA 1BWNA 1BTNA 2UZSA 3PP2A 2L1CA 1SHCA 4HB0B 1RJ2A 2EC1A 2CAYA 3DXDA 2J0JA 1NI2A 1Q67A 2D4QA 4EMOA 4K2OA 5KCVA 2VRWB 2W2XD 1Y5OA 2DKQA 4KHOA 5D3WA 4YONA 3AU5A 3QWMA 3PVUA 3SYXA 2DYQA 2QKLA 1V88A 4MT7A 4A6KA 4A5KA 3ULBA 2D9ZA 5EFXA 4P7IA 2COAA 2H7DA 4A6HA 3O96A 4Z2MB 3HW2B 1LB1A 3PSCA 5C16A 2ROZB 1BAKA 4WSFA 2I5FA 2ADZA 2ROVA 3OANA 5HE0A 1ZVRA 4K2PA 2P0HA 4HDOA 3U7DA 1NTVA 2DFKA 2VKIA 3P6AA 5J3TA 3PEGA 2LULA 1MIZB 2MKRA 2GJYA 1WI1A 3ULCA 3SNHA 2Y8FA 3V5WA 3TCAA 4DBBA 1V5PA 3MDBC 3VIAA 3ML4A 2YSZA 2MDXA 1PMSA 3QBVB 2ZPYA 5D27A 1MKEA 5C5BA 1M7RA 2CY5A 2QKMA 4K81A 2YT0A 1I7AA 2AL6A 5HE2A 2LYDA 2YS1A 3AU4A 3ODOA 1ZC4B 4HAVB 5C79A 1B55A 2D11A 4A6FA 2LG1A 3ODWA 5KQ1A 1U5DA 1E5WA 1XKEA 3SO6A 1OQNA 2CRFA 3HK0A 1X05A 2DX1A 1QQGA 4A6FB 4CHMA 1M7EA 5LONB 2UVMA 2D9VA 3U8ZA 2YS3A 3D8DA 3ODXA 3PVWA 1SGHA 2EJ8A 3FSSA 2RGNB 2IYBA 2ELBA 1W1HA 5HE1A 1UEFA 2EMSA 1EVHA 2J59M 4KHBB 1DROA 1EGXA 4DX90 4CYEA 3KSYA 1N3HA 5DH9B 4BBKA 4DXAB 4GXBA 4HAUB 1X1FA 1KZ7A 4MK0A 3MPXA 1U5EA 1DDVA 1GC7A 4GZUA 1FB8A 2W2XC 1ZM0A 1TXDA 2I1KA 1MIXA 3F5RA 1GC6A 4HAXB 2D9YA 1WG7A 5HE3A 1WVHA 2LKOA 1U5GA 3PVLA 5JLJB 5DHAB 3BINA 2G35A 1TJ6A 4HAWB 3PG7A 1AWEA 5DHFB 1EAZA 2P0FA 3KY9A 2DHJA 3PZDA 3GYOA 2RNRB 3T06A 1H10A 4WJ7A 1AQCA 2YF0A 2I1JA 5KQ4A 4TYZA 1NU2A 2W2WA 1DDMA 1H4RA 4HATB 4KAXB 1WJMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TW1 A;  4MY6 A;  2J0K A;  5CLQ B;  2LOX A;  1MAI A;  2IFS A;  1U5F A;  2P8V A;  2GCL A;  4IOY X;  4B6H A;  3KZ1 A;  2I5C A;  5FI0 A;  3UZT A;  1FGZ A;  2Z0O A;  1DDW A;  2UZR A;  3CXB B;  3A8Q A;  1X1G A;  4Y94 A;  5L81 A;  4ZRI A;  2AEH A;  4HDQ A;  5DIF B;  3A8P A;  4CHJ A;  3NSU A;  2M38 A;  4HHV A;  3AJ4 A;  1WGU A;  4ZRJ A;  1FHX A;  1WGQ A;  2EMT A;  4H8S A;  1ZSQ A;  1U27 A;  2K2J A;  2K2U A;  1DBH A;  3D8E A;  2NZ8 B;  4GMX B;  2R0D A;  2D9X A;  1FHO A;  3BJI A;  3CIK A;  1BTK A;  1X11 A;  2Z0P A;  5JHH A;  2OTX A;  2DX5 A;  1X86 A;  2X18 A;  1XCG A;  2PZ1 A;  1UPQ A;  1WJ1 A;  2FJL A;  4IFS A;  4NSW A;  1FAO A;  1U29 A;  3M1I B;  1XD4 A;  5J3Q A;  1K5D B;  1W1G A;  4L6E A;  2VSZ A;  2ELA A;  3KRX A;  4K17 A;  2NMB A;  3SUZ A;  1DYN A;  3N7C A;  4HAY B;  1KZG A;  1P3R A;  4ZRK A;  1V89 A;  5JHG A;  3QIJ A;  5JP4 A;  2YS5 A;  1TQZ A;  2DN6 A;  4EKU A;  4D0N B;  1FOE A;  5C6R A;  5CLL B;  2YT1 A;  4HB4 B;  2Y7B A;  3WA0 A;  2D9W A;  4F7G A;  1LW3 A;  2DLW A;  1UNQ A;  3G9W A;  2OQB A;  3GYP A;  2KGX B;  2RVB B;  1EF1 A;  1UNP A;  1MPH A;  3HQC A;  3WYF B;  3FM8 C;  2LOZ A;  4EJN A;  1FHW A;  4Z2N A;  2K00 A;  2D2Q A;  2N23 A;  1P5T A;  2RSG A;  4IAP A;  2DTC A;  5GOW B;  2D10 A;  1MK7 B;  1OMW A;  1NTY A;  2GCJ A;  2HE7 A;  1W1D A;  1K5G B;  1Y19 B;  3LJU X;  2BCJ A;  2Y8G A;  2COF A;  1V5M A;  1J0W A;  2V76 A;  2YVC A;  2P0D A;  1OY2 A;  5LOP B;  2Q13 A;  3KRW A;  1QC6 A;  2CY4 A;  3IVF A;  1ISN A;  1KI1 B;  5D3V A;  1PFJ A;  2JP2 A;  3D8F A;  2R09 A;  4HB3 B;  2DA0 A;  2MFQ A;  2GS0 A;  2HTH B;  5D3X A;  1MK9 B;  1XX0 A;  3TO1 A;  2RLO A;  4PQ0 A;  5J3Y A;  4C0A A;  2DHI A;  1UNR A;  4KVG B;  2N0Y A;  2Z0Q A;  1ZC3 B;  2DKP A;  3A98 B;  1V61 A;  1RRP B;  1P6S A;  3TFM A;  4F7H A;  3ZVR A;  4F7U P;  2MWN B;  4TKN A;  1IRS A;  2XQN M;  4NY0 A;  1UPR A;  3ZDT A;  5DI9 B;  2KUP A;  2J0M A;  2COD A;  1GG3 A;  4PNK A;  2H7E A;  3P7Z A;  4GPT B;  3DXE A;  4WVF B;  3F0W A;  4HAZ B;  2KCJ A;  4GN1 A;  2L2I A;  3DXC A;  2E2X A;  4DX8 A;  2COC A;  5D3Y A;  1J19 A;  2DHK A;  4XWX A;  4YL8 A;  1FGY A;  1Z87 A;  1XOD A;  5C5B B;  3FEH A;  3X23 A;  3RCP A;  2RUK B;  1PLS A;  3VOQ A;  1XR0 B;  1V5U A;  4GMV A;  2YRY A;  5FI1 A;  3SV1 A;  2M14 A;  4KHA A;  1I2H A;  2DYN A;  4HB2 B;  3TVV A;  1U2B A;  1BWN A;  1BTN A;  2UZS A;  3PP2 A;  2L1C A;  1SHC A;  4HB0 B;  1RJ2 A;  2EC1 A;  2CAY A;  3DXD A;  2J0J A;  1NI2 A;  1Q67 A;  2D4Q A;  4EMO A;  4K2O A;  5KCV A;  2VRW B;  2W2X D;  1Y5O A;  2DKQ A;  4KHO A;  5D3W A;  4YON A;  3AU5 A;  3QWM A;  3PVU A;  3SYX A;  2DYQ A;  2QKL A;  1V88 A;  4MT7 A;  4A6K A;  4A5K A;  3ULB A;  2D9Z A;  5EFX A;  4P7I A;  2COA A;  2H7D A;  4A6H A;  3O96 A;  4Z2M B;  3HW2 B;  1LB1 A;  3PSC A;  5C16 A;  2ROZ B;  1BAK A;  4WSF A;  2I5F A;  2ADZ A;  2ROV A;  3OAN A;  5HE0 A;  1ZVR A;  4K2P A;  2P0H A;  4HDO A;  3U7D A;  1NTV A;  2DFK A;  2VKI A;  3P6A A;  5J3T A;  3PEG A;  2LUL A;  1MIZ B;  2MKR A;  2GJY A;  1WI1 A;  3ULC A;  3SNH A;  2Y8F A;  3V5W A;  3TCA A;  4DBB A;  1V5P A;  3MDB C;  3VIA A;  3ML4 A;  2YSZ A;  2MDX A;  1PMS A;  3QBV B;  2ZPY A;  5D27 A;  1MKE A;  5C5B A;  1M7R A;  2CY5 A;  2QKM A;  4K81 A;  2YT0 A;  1I7A A;  2AL6 A;  5HE2 A;  2LYD A;  2YS1 A;  3AU4 A;  3ODO A;  1ZC4 B;  4HAV B;  5C79 A;  1B55 A;  2D11 A;  4A6F A;  2LG1 A;  3ODW A;  5KQ1 A;  1U5D A;  1E5W A;  1XKE A;  3SO6 A;  1OQN A;  2CRF A;  3HK0 A;  1X05 A;  2DX1 A;  1QQG A;  4A6F B;  4CHM A;  1M7E A;  5LON B;  2UVM A;  2D9V A;  3U8Z A;  2YS3 A;  3D8D A;  3ODX A;  3PVW A;  1SGH A;  2EJ8 A;  3FSS A;  2RGN B;  2IYB A;  2ELB A;  1W1H A;  5HE1 A;  1UEF A;  2EMS A;  1EVH A;  2J59 M;  4KHB B;  1DRO A;  1EGX A;  4DX9 0;  4CYE A;  3KSY A;  1N3H A;  5DH9 B;  4BBK A;  4DXA B;  4GXB A;  4HAU B;  1X1F A;  1KZ7 A;  4MK0 A;  3MPX A;  1U5E A;  1DDV A;  1GC7 A;  4GZU A;  1FB8 A;  2W2X C;  1ZM0 A;  1TXD A;  2I1K A;  1MIX A;  3F5R A;  1GC6 A;  4HAX B;  2D9Y A;  1WG7 A;  5HE3 A;  1WVH A;  2LKO A;  1U5G A;  3PVL A;  5JLJ B;  5DHA B;  3BIN A;  2G35 A;  1TJ6 A;  4HAW B;  3PG7 A;  1AWE A;  5DHF B;  1EAZ A;  2P0F A;  3KY9 A;  2DHJ A;  3PZD A;  3GYO A;  2RNR B;  3T06 A;  1H10 A;  4WJ7 A;  1AQC A;  2YF0 A;  2I1J A;  5KQ4 A;  4TYZ A;  1NU2 A;  2W2W A;  1DDM A;  1H4R A;  4HAT B;  4KAX B;  1WJM A; 
#chains in the Genus database with same CATH topology
 2KIG A;  3TW1 A;  4MY6 A;  4QJ5 B;  2J0K A;  5CLQ B;  2LOX A;  1MAI A;  2IFS A;  1U5F A;  2P8V A;  2GCL A;  4IOY X;  4B6H A;  3KZ1 A;  5I2S A;  2I5C A;  5FI0 A;  3UZT A;  1FGZ A;  4OSN A;  2Z0O A;  1DDW A;  2UZR A;  3CXB B;  3A8Q A;  1X1G A;  4Y94 A;  5L81 A;  4ZRI A;  2AEH A;  4HDQ A;  5DIF B;  3A8P A;  4CHJ A;  3NSU A;  2M38 A;  4HHV A;  3NWD A;  3AJ4 A;  1WGU A;  4ZRJ A;  1FHX A;  3NW8 A;  1WGQ A;  2EMT A;  4H8S A;  1ZSQ A;  1U27 A;  2K2J A;  2Z13 A;  2K2U A;  1DBH A;  3D8E A;  2NZ8 B;  4GMX B;  2R0D A;  2D9X A;  1FHO A;  3BJI A;  3CIK A;  1BTK A;  1X11 A;  2Z0P A;  4D6W A;  5JHH A;  2OTX A;  2DX5 A;  1X86 A;  2Z14 A;  2X18 A;  1XCG A;  2PZ1 A;  1UPQ A;  1WJ1 A;  2FJL A;  4IFS A;  4NSW A;  1FAO A;  1U29 A;  3M1I B;  1XD4 A;  5J3Q A;  1K5D B;  1W1G A;  4L6E A;  2VSZ A;  2ELA A;  3KRX A;  4K17 A;  2NMB A;  3SUZ A;  5M4Y B;  1DYN A;  3N7C A;  4HAY B;  1KZG A;  1P3R A;  4ZRK A;  1V89 A;  5JHG A;  3QIJ A;  5JP4 A;  4GNK B;  2YS5 A;  1TQZ A;  2DN6 A;  4EKU A;  4D0N B;  1FOE A;  5C6R A;  5CLL B;  2K49 A;  2YT1 A;  4HB4 B;  2Y7B A;  3WA0 A;  2D9W A;  4F7G A;  1LW3 A;  2DLW A;  1UNQ A;  4HSI A;  3G9W A;  2OQB A;  3GYP A;  2KGX B;  2RVB B;  1EF1 A;  1UNP A;  3U12 A;  1MPH A;  3HQC A;  3WYF B;  3FM8 C;  2LOZ A;  4EJN A;  1FHW A;  4Z2N A;  2K00 A;  2D2Q A;  2N23 A;  1P5T A;  2RSG A;  4IAP A;  2DTC A;  5GOW B;  2D10 A;  1MK7 B;  1OMW A;  2KIE A;  1NTY A;  2GCJ A;  2HE7 A;  1W1D A;  1K5G B;  1Y19 B;  3LJU X;  2BCJ A;  2Y8G A;  2COF A;  1V5M A;  1J0W A;  2V76 A;  1MI1 A;  2YVC A;  2P0D A;  1OY2 A;  5LOP B;  2Q13 A;  3KRW A;  1QC6 A;  1T77 A;  2CY4 A;  3IVF A;  1ISN A;  1KI1 B;  5D3V A;  1PFJ A;  2JP2 A;  3D8F A;  2R09 A;  4HB3 B;  2DA0 A;  2MFQ A;  3NWA A;  2GS0 A;  2HTH B;  5D3X A;  1MK9 B;  1XX0 A;  3TO1 A;  2RLO A;  4PQ0 A;  5J3Y A;  4C0A A;  2DHI A;  1UNR A;  4KVG B;  2N0Y A;  2Z0Q A;  2K8E A;  1ZC3 B;  2DKP A;  3A98 B;  1V61 A;  1RRP B;  1P6S A;  3TFM A;  4F7H A;  2ZKM X;  3ZVR A;  4F7U P;  4QJ4 B;  2MWN B;  4TKN A;  1IRS A;  2XQN M;  4NY0 A;  1UPR A;  3ZDT A;  5DI9 B;  2KUP A;  2J0M A;  2COD A;  1GG3 A;  2Z4D A;  2H7E A;  4PNK A;  3P7Z A;  2GUM A;  4GPT B;  3DXE A;  4WVF B;  3F0W A;  4HAZ B;  2KCJ A;  4GN1 A;  2L2I A;  3DXC A;  2E2X A;  4DX8 A;  2KUQ A;  2COC A;  5D3Y A;  1J19 A;  4GOU A;  2DHK A;  4XWX A;  4YL8 A;  1FGY A;  1Z87 A;  1XOD A;  5C5B B;  3FEH A;  3X23 A;  3RCP A;  2RUK B;  1PLS A;  3VOQ A;  1XR0 B;  1V5U A;  4GMV A;  2YRY A;  5FI1 A;  5LG4 B;  3SV1 A;  2M14 A;  4KHA A;  1I2H A;  2DYN A;  4HB2 B;  3TVV A;  3FVC A;  1U2B A;  1BWN A;  1BTN A;  2UZS A;  3PP2 A;  2L1C A;  1SHC A;  4HB0 B;  2NBV A;  1RJ2 A;  2EC1 A;  2CAY A;  3DXD A;  5IRS A;  2J0J A;  2RRF A;  1NI2 A;  1Q67 A;  2D4Q A;  4EMO A;  4K2O A;  5KCV A;  2VRW B;  2W2X D;  1Y5O A;  3B77 A;  2DKQ A;  4KHO A;  5D3W A;  4YON A;  3AU5 A;  3QWM A;  2FJU B;  3PVU A;  3SYX A;  2DYQ A;  2QKL A;  1V88 A;  4MT7 A;  4A6K A;  4A5K A;  3ULB A;  2D9Z A;  5EFX A;  4P7I A;  2COA A;  2H7D A;  4A6H A;  4QJ3 B;  4QXA B;  3O96 A;  3HSA A;  4Z2M B;  3HW2 B;  1LB1 A;  3PSC A;  2Z59 A;  5C16 A;  2ROZ B;  3NWF A;  1BAK A;  4WSF A;  2I5F A;  2ADZ A;  2ROV A;  3OAN A;  5HE0 A;  1ZVR A;  4K2P A;  2P0H A;  4HDO A;  3U7D A;  1NTV A;  2DFK A;  2VKI A;  3P6A A;  5J3T A;  3PEG A;  2LUL A;  1MIZ B;  2MKR A;  2GJY A;  1WI1 A;  3ULC A;  3SNH A;  2Y8F A;  3V5W A;  3TCA A;  4DBB A;  1V5P A;  3MDB C;  3VIA A;  3ML4 A;  2YSZ A;  2MDX A;  1PMS A;  3QBV B;  2ZPY A;  5D27 A;  1MKE A;  5C5B A;  1M7R A;  2KR0 A;  2CY5 A;  2QKM A;  4K81 A;  2YT0 A;  1I7A A;  2AL6 A;  3HIE A;  5HE2 A;  2LYD A;  2YS1 A;  3AU4 A;  3ODO A;  1ZC4 B;  4HAV B;  5C79 A;  1B55 A;  2D11 A;  4A6F A;  2LG1 A;  3ODW A;  5KQ1 A;  1U5D A;  1E5W A;  1XKE A;  3SO6 A;  2R2Y A;  1OQN A;  2CRF A;  3OHM B;  3HK0 A;  4OT1 A;  1X05 A;  2DX1 A;  1QQG A;  4KHB A;  4A6F B;  4CHM A;  1M7E A;  5LON B;  2UVM A;  2D9V A;  3U8Z A;  2YS3 A;  3D8D A;  3ODX A;  3PVW A;  1SGH A;  2EJ8 A;  3FSS A;  2RGN B;  3DCX A;  2IYB A;  2ELB A;  1W1H A;  5HE1 A;  1UEF A;  2EMS A;  1EVH A;  2J59 M;  4KHB B;  1DRO A;  1EGX A;  4DX9 0;  4CYE A;  3KSY A;  1N3H A;  5DH9 B;  4BBK A;  4DXA B;  4GXB A;  4HAU B;  1X1F A;  1KZ7 A;  4MK0 A;  3MPX A;  1U5E A;  1DDV A;  1GC7 A;  4GZU A;  1FB8 A;  2W2X C;  1ZM0 A;  1TXD A;  2I1K A;  2YT2 A;  1MIX A;  3F5R A;  1GC6 A;  4HAX B;  2D9Y A;  1WG7 A;  5HE3 A;  1WVH A;  2LKO A;  1U5G A;  3PVL A;  4CSQ A;  5JLJ B;  5DHA B;  3BIN A;  2G35 A;  1TJ6 A;  4HAW B;  3PG7 A;  1ZYI A;  1AWE A;  5DHF B;  1EAZ A;  2P0F A;  3KY9 A;  2DHJ A;  3PZD A;  4DIX A;  3GYO A;  2RNR B;  3T06 A;  1H10 A;  4WJ7 A;  1AQC A;  2YF0 A;  2I1J A;  5I2M A;  5KQ4 A;  4TYZ A;  1NU2 A;  3A58 A;  2W2W A;  1DDM A;  4L1R A;  1H4R A;  4HAT B;  4KAX B;  1WJM A; 
#chains in the Genus database with same CATH homology
 3TW1 A;  4MY6 A;  2J0K A;  5CLQ B;  2LOX A;  1MAI A;  2IFS A;  1U5F A;  2P8V A;  2GCL A;  4IOY X;  4B6H A;  3KZ1 A;  2I5C A;  5FI0 A;  3UZT A;  1FGZ A;  2Z0O A;  1DDW A;  2UZR A;  3CXB B;  3A8Q A;  1X1G A;  4Y94 A;  5L81 A;  4ZRI A;  2AEH A;  4HDQ A;  5DIF B;  3A8P A;  4CHJ A;  3NSU A;  2M38 A;  4HHV A;  3AJ4 A;  1WGU A;  4ZRJ A;  1FHX A;  1WGQ A;  2EMT A;  4H8S A;  1ZSQ A;  1U27 A;  2K2J A;  2K2U A;  1DBH A;  3D8E A;  2NZ8 B;  4GMX B;  2R0D A;  2D9X A;  1FHO A;  3BJI A;  3CIK A;  1BTK A;  1X11 A;  2Z0P A;  5JHH A;  2OTX A;  2DX5 A;  1X86 A;  2X18 A;  1XCG A;  2PZ1 A;  1UPQ A;  1WJ1 A;  2FJL A;  4IFS A;  4NSW A;  1FAO A;  1U29 A;  3M1I B;  1XD4 A;  5J3Q A;  1K5D B;  1W1G A;  4L6E A;  2VSZ A;  2ELA A;  3KRX A;  4K17 A;  2NMB A;  3SUZ A;  1DYN A;  3N7C A;  4HAY B;  1KZG A;  1P3R A;  4ZRK A;  1V89 A;  5JHG A;  3QIJ A;  5JP4 A;  2YS5 A;  1TQZ A;  2DN6 A;  4EKU A;  4D0N B;  1FOE A;  5C6R A;  5CLL B;  2YT1 A;  4HB4 B;  2Y7B A;  3WA0 A;  2D9W A;  4F7G A;  1LW3 A;  2DLW A;  1UNQ A;  3G9W A;  2OQB A;  3GYP A;  2KGX B;  2RVB B;  1EF1 A;  1UNP A;  1MPH A;  3HQC A;  3WYF B;  3FM8 C;  2LOZ A;  4EJN A;  1FHW A;  4Z2N A;  2K00 A;  2D2Q A;  2N23 A;  1P5T A;  2RSG A;  4IAP A;  2DTC A;  5GOW B;  2D10 A;  1MK7 B;  1OMW A;  1NTY A;  2GCJ A;  2HE7 A;  1W1D A;  1K5G B;  1Y19 B;  3LJU X;  2BCJ A;  2Y8G A;  2COF A;  1V5M A;  1J0W A;  2V76 A;  2YVC A;  2P0D A;  1OY2 A;  5LOP B;  2Q13 A;  3KRW A;  1QC6 A;  2CY4 A;  3IVF A;  1ISN A;  1KI1 B;  5D3V A;  1PFJ A;  2JP2 A;  3D8F A;  2R09 A;  4HB3 B;  2DA0 A;  2MFQ A;  2GS0 A;  2HTH B;  5D3X A;  1MK9 B;  1XX0 A;  3TO1 A;  2RLO A;  4PQ0 A;  5J3Y A;  4C0A A;  2DHI A;  1UNR A;  4KVG B;  2N0Y A;  2Z0Q A;  1ZC3 B;  2DKP A;  3A98 B;  1V61 A;  1RRP B;  1P6S A;  3TFM A;  4F7H A;  3ZVR A;  4F7U P;  2MWN B;  4TKN A;  1IRS A;  2XQN M;  4NY0 A;  1UPR A;  3ZDT A;  5DI9 B;  2KUP A;  2J0M A;  2COD A;  1GG3 A;  4PNK A;  2H7E A;  3P7Z A;  4GPT B;  3DXE A;  4WVF B;  3F0W A;  4HAZ B;  2KCJ A;  4GN1 A;  2L2I A;  3DXC A;  2E2X A;  4DX8 A;  2COC A;  5D3Y A;  1J19 A;  2DHK A;  4XWX A;  4YL8 A;  1FGY A;  1Z87 A;  1XOD A;  5C5B B;  3FEH A;  3X23 A;  3RCP A;  2RUK B;  1PLS A;  3VOQ A;  1XR0 B;  1V5U A;  4GMV A;  2YRY A;  5FI1 A;  3SV1 A;  2M14 A;  4KHA A;  1I2H A;  2DYN A;  4HB2 B;  3TVV A;  1U2B A;  1BWN A;  1BTN A;  2UZS A;  3PP2 A;  2L1C A;  1SHC A;  4HB0 B;  1RJ2 A;  2EC1 A;  2CAY A;  3DXD A;  2J0J A;  1NI2 A;  1Q67 A;  2D4Q A;  4EMO A;  4K2O A;  5KCV A;  2VRW B;  2W2X D;  1Y5O A;  2DKQ A;  4KHO A;  5D3W A;  4YON A;  3AU5 A;  3QWM A;  3PVU A;  3SYX A;  2DYQ A;  2QKL A;  1V88 A;  4MT7 A;  4A6K A;  4A5K A;  3ULB A;  2D9Z A;  5EFX A;  4P7I A;  2COA A;  2H7D A;  4A6H A;  3O96 A;  4Z2M B;  3HW2 B;  1LB1 A;  3PSC A;  5C16 A;  2ROZ B;  1BAK A;  4WSF A;  2I5F A;  2ADZ A;  2ROV A;  3OAN A;  5HE0 A;  1ZVR A;  4K2P A;  2P0H A;  4HDO A;  3U7D A;  1NTV A;  2DFK A;  2VKI A;  3P6A A;  5J3T A;  3PEG A;  2LUL A;  1MIZ B;  2MKR A;  2GJY A;  1WI1 A;  3ULC A;  3SNH A;  2Y8F A;  3V5W A;  3TCA A;  4DBB A;  1V5P A;  3MDB C;  3VIA A;  3ML4 A;  2YSZ A;  2MDX A;  1PMS A;  3QBV B;  2ZPY A;  5D27 A;  1MKE A;  5C5B A;  1M7R A;  2CY5 A;  2QKM A;  4K81 A;  2YT0 A;  1I7A A;  2AL6 A;  5HE2 A;  2LYD A;  2YS1 A;  3AU4 A;  3ODO A;  1ZC4 B;  4HAV B;  5C79 A;  1B55 A;  2D11 A;  4A6F A;  2LG1 A;  3ODW A;  5KQ1 A;  1U5D A;  1E5W A;  1XKE A;  3SO6 A;  1OQN A;  2CRF A;  3HK0 A;  1X05 A;  2DX1 A;  1QQG A;  4A6F B;  4CHM A;  1M7E A;  5LON B;  2UVM A;  2D9V A;  3U8Z A;  2YS3 A;  3D8D A;  3ODX A;  3PVW A;  1SGH A;  2EJ8 A;  3FSS A;  2RGN B;  2IYB A;  2ELB A;  1W1H A;  5HE1 A;  1UEF A;  2EMS A;  1EVH A;  2J59 M;  4KHB B;  1DRO A;  1EGX A;  4DX9 0;  4CYE A;  3KSY A;  1N3H A;  5DH9 B;  4BBK A;  4DXA B;  4GXB A;  4HAU B;  1X1F A;  1KZ7 A;  4MK0 A;  3MPX A;  1U5E A;  1DDV A;  1GC7 A;  4GZU A;  1FB8 A;  2W2X C;  1ZM0 A;  1TXD A;  2I1K A;  1MIX A;  3F5R A;  1GC6 A;  4HAX B;  2D9Y A;  1WG7 A;  5HE3 A;  1WVH A;  2LKO A;  1U5G A;  3PVL A;  5JLJ B;  5DHA B;  3BIN A;  2G35 A;  1TJ6 A;  4HAW B;  3PG7 A;  1AWE A;  5DHF B;  1EAZ A;  2P0F A;  3KY9 A;  2DHJ A;  3PZD A;  3GYO A;  2RNR B;  3T06 A;  1H10 A;  4WJ7 A;  1AQC A;  2YF0 A;  2I1J A;  5KQ4 A;  4TYZ A;  1NU2 A;  2W2W A;  1DDM A;  1H4R A;  4HAT B;  4KAX B;  1WJM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...