4DX8A

Icap1 in complex with krit1 n-terminus
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
142
structure length
139
Chain Sequence
NNSDTCAEFRIKYVGAIEKLKLSGLEGPLDLINYIDVAQQDGKLPFVPPEEEFIMGVSKYGIKVSTSDQYDVLHRHALYLIIRMVCYDDGLGAGKSLLALKTTDASNEEYSLWVYQCNSLEQAQAICKVLSTAFDSVLT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding
molecule keywords Integrin beta-1-binding protein 1
publication title Mechanism for KRIT1 Release of ICAP1-Mediated Suppression of Integrin Activation.
pubmed doi rcsb
source organism Homo sapiens
total genus 32
structure length 139
sequence length 142
chains with identical sequence B, D, E
ec nomenclature
pdb deposition date 2012-02-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 4dx8A00
2CY4A 2W2XC 3PZDA 2J59M 1Y5OA 2D4QA 4MK0A 4HB0B 2LYDA 1GC7A 1X1GA 1SGHA 4HB3B 2K2UA 1TJ6A 1UNRA 1WG7A 4NSWA 4ZRKA 2YSZA 3AJ4A 2COFA 4P7IA 1MIZB 1MPHA 5KQ1A 1GC6A 3PG7A 1W1DA 3UZTA 3AU4A 2ROZB 2CAYA 4A6HA 2D9XA 1AQCA 2YS3A 3PEGA 4A5KA 1UNPA 2DYNA 2Z0PA 4C0AA 5JHGA 2LOZA 1DDVA 1ZC3B 2Z0QA 4HDOA 4MY6A 2COCA 3SNHA 4DXAB 1V5UA 2XQNM 1FHOA 2I1KA 4B6HA 5EFXA 3GYPA 2J0KA 2LG1A 2RLOA 4Y94A 4GPTB 1XD4A 3DXCA 2ELAA 3P7ZA 4GXBA 5CLQB 5FI1A 4F7GA 2RSGA 2M14A 4NY0A 1BTNA 1M7RA 3CXBB 3TFMA 3ML4A 3CIKA 1J19A 1MK9B 4HHVA 2GCLA 2J0JA 3N7CA 4F7UP 2H7EA 2D9VA 3HQCA 2EJ8A 1DDWA 3F5RA 4GMVA 5D3XA 1XODA 4KAXB 2HTHB 1XCGA 1WGQA 2M38A 2ROVA 1BTKA 3BINA 1P6SA 2LULA 3TVVA 4ZRJA 1P3RA 1OQNA 2EMTA 1QQGA 1NTYA 2R09A 3X23A 1NI2A 2P0HA 1OY2A 4GZUA 2D2QA 1XKEA 2H7DA 2L1CA 3AU5A 2D10A 5GOWB 1MK7B 3A98B 1NU2A 3MPXA 5D3YA 1H4RA 2Q13A 3HK0A 1EF1A 4HDQA 2DKPA 1UPQA 2YVCA 3KY9A 3FSSA 2RUKB 4HATB 1DYNA 3TO1A 1MKEA 2P0FA 1W1HA 1WJ1A 2UZSA 3KSYA 2D11A 2MKRA 4XWXA 5JLJB 1DROA 4F7HA 1FHXA 3M1IB 1Z87A 1ZSQA 5C79A 2JP2A 2MFQA 4HAXB 3PVLA 1ZM0A 3ODWA 2DX5A 3VIAA 1PLSA 2CRFA 4EMOA 1XX0A 2YT0A 2KGXB 2DHIA 2MDXA 2J0MA 3TCAA 1DDMA 1Q67A 2KUPA 4WSFA 3WYFB 4EJNA 5D27A 1PMSA 1WJMA 2QKMA 2EC1A 2N23A 3PVUA 4GN1A 3NSUA 3PP2A 1DBHA 1WVHA 3QWMA 5DIFB 3VOQA 4HAYB 5CLLB 4KHBB 3SUZA 5D3VA 1QC6A 2UVMA 2DN6A 1KZ7A 2IYBA 3ZVRA 2DX1A 4L6EA 5KQ4A 1E5WA 4H8SA 2DHJA 4K81A 2KCJA 1V61A 5C5BB 3ULBA 2DLWA 1V88A 2D9ZA 2DKQA 2YS1A 2Y8GA 2RGNB 3O96A 4KHAA 2G35A 4TYZA 4YL8A 1BWNA 3D8FA 2DHKA 3D8EA 2VRWB 1KZGA 1K5DB 4A6FB 1V89A 1K5GB 1BAKA 3IVFA 4TKNA 2Z0OA 1NTVA 4HAZB 5DHAB 3U7DA 1EGXA 4WVFB 1U27A 4Z2NA 5JHHA 3ULCA 2OTXA 2VKIA 2IFSA 1UNQA 1U5GA 3FEHA 3RCPA 1N3HA 3V5WA 1AWEA 3HW2B 1ZVRA 1XR0B 4EKUA 1X05A 2PZ1A 3P6AA 4A6FA 2W2XD 2MWNB 4HAUB 5J3TA 4MT7A 1I7AA 1WI1A 1UEFA 1TXDA 4GMXB 4DX90 3PVWA 4HAWB 1FHWA 2YT1A 3FM8C 1FGZA 4ZRIA 1U5DA 2ZPYA 2UZRA 1FGYA 2LOXA 2YS5A 2AEHA 2LKOA 1V5PA 3PSCA 4A6KA 2W2WA 4HB4B 5J3YA 1SHCA 4IOYX 5LOPB 2R0DA 4KHOA 2D9YA 2COAA 2ELBA 4PNKA 2GS0A 2X18A 2NZ8B 1WGUA 2OQBA 1I2HA 5HE3A 1MIXA 2D9WA 4YONA 1FOEA 4CYEA 3GYOA 2FJLA 1OMWA 1X11A 5HE0A 3BJIA 2N0YA 2GJYA 1GG3A 1LW3A 2I5FA 2Y8FA 3DXEA 1IRSA 2DYQA 3KRWA 3ZDTA 3ODXA 3SO6A 1RJ2A 1EAZA 2K2JA 1PFJA 4Z2MB 2HE7A 2L2IA 2DA0A 2P8VA 1U5FA 2YF0A 5DI9B 4DBBA 4K17A 2P0DA 3A8PA 4CHJA 1M7EA 4HB2B 5DHFB 3T06A 2CY5A 4KVGB 1H10A 5LONB 1V5MA 1RRPB 2DTCA 2I1JA 2K00A 2QKLA 3ODOA 3MDBC 4K2OA 1EVHA 4WJ7A 1TQZA 2ADZA 2YRYA 4HAVB 5C16A 2EMSA 3SV1A 1B55A 3DXDA 1X86A 5DH9B 1J0WA 5L81A 5J3QA 5C5BA 4DX8A 1X1FA 1KI1B 2AL6A 3QBVB 2VSZA 5D3WA 1FB8A 1U29A 3QIJA 4D0NB 3SYXA 3A8QA 1MAIA 3G9WA 1U5EA 4IFSA 5KCVA 4K2PA 3WA0A 5FI0A 2BCJA 4CHMA 5JP4A 2I5CA 1ZC4B 2GCJA 3LJUX 5C6RA 3D8DA 2RNRB 1W1GA 1P5TA 3KRXA 4PQ0A 1LB1A 3U8ZA 1Y19B 5HE2A 4BBKA 3F0WA 1UPRA 2V76A 3KZ1A 5HE1A 4IAPA 3OANA 2E2XA 3TW1A 2NMBA 2CODA 1ISNA 2RVBB 2DFKA 1FAOA 1U2BA 2Y7BA
chains in the Genus database with same CATH superfamily
2CY4A 2W2XC 3PZDA 3HIEA 2J59M 1Y5OA 2D4QA 4MK0A 4HB0B 2LYDA 1GC7A 1X1GA 1SGHA 4HB3B 2K2UA 1MI1A 1TJ6A 1UNRA 1WG7A 4NSWA 4ZRKA 2YSZA 3AJ4A 2COFA 4P7IA 1MIZB 1MPHA 5KQ1A 1GC6A 3PG7A 1W1DA 3UZTA 3AU4A 2ROZB 2Z13A 2CAYA 4A6HA 2D9XA 1AQCA 2YS3A 3PEGA 4A5KA 3B77A 1UNPA 2DYNA 3A58A 2Z0PA 4C0AA 5JHGA 2LOZA 1DDVA 1ZC3B 2Z0QA 4OSNA 4HDOA 4MY6A 2COCA 3SNHA 4DXAB 1V5UA 2XQNM 1FHOA 3OHMB 2I1KA 4CSQA 4B6HA 5EFXA 3GYPA 2J0KA 4DIXA 2LG1A 2RLOA 4Y94A 4GPTB 1XD4A 3DXCA 3NW8A 2ELAA 3P7ZA 4GXBA 5CLQB 5FI1A 4F7GA 2RSGA 2M14A 4QJ5B 4NY0A 1BTNA 1M7RA 3CXBB 3TFMA 3ML4A 3CIKA 1J19A 1MK9B 4HHVA 2GCLA 2J0JA 3N7CA 4F7UP 2H7EA 2D9VA 3HQCA 2EJ8A 1DDWA 3F5RA 4GMVA 5D3XA 1XODA 4KAXB 2HTHB 1XCGA 1WGQA 2M38A 2ROVA 1BTKA 3BINA 1P6SA 2LULA 3TVVA 4ZRJA 1P3RA 1OQNA 2EMTA 1QQGA 1NTYA 2R09A 3X23A 1NI2A 2P0HA 1OY2A 4GZUA 2D2QA 1XKEA 2H7DA 2L1CA 3AU5A 1ZYIA 2D10A 4OT1A 5GOWB 3NWDA 1MK7B 3A98B 1NU2A 3MPXA 5D3YA 4QJ4B 1H4RA 2Q13A 2ZKMX 3HK0A 1EF1A 4HDQA 2DKPA 1UPQA 2YVCA 3KY9A 3FSSA 2RUKB 4HATB 1DYNA 3TO1A 1MKEA 2P0FA 1W1HA 1WJ1A 2UZSA 3KSYA 2D11A 2MKRA 4XWXA 5JLJB 1DROA 4F7HA 1FHXA 3M1IB 1Z87A 1ZSQA 5C79A 2JP2A 2MFQA 4HAXB 3PVLA 2KIEA 1ZM0A 3ODWA 2DX5A 2RRFA 3VIAA 1PLSA 2CRFA 4EMOA 1XX0A 2YT0A 2KGXB 2DHIA 2MDXA 2J0MA 3TCAA 1DDMA 1Q67A 2KUPA 4WSFA 3WYFB 4EJNA 5D27A 1PMSA 1WJMA 2QKMA 2EC1A 2N23A 3PVUA 4GN1A 3NSUA 3PP2A 1DBHA 2KR0A 1WVHA 3QWMA 5DIFB 3VOQA 4HAYB 5CLLB 4KHBB 3SUZA 5D3VA 5IRSA 1QC6A 2UVMA 2DN6A 1KZ7A 2IYBA 3U12A 3ZVRA 2DX1A 4L6EA 5KQ4A 1E5WA 4D6WA 4H8SA 2DHJA 4K81A 2KCJA 1V61A 4GOUA 5C5BB 3ULBA 2DLWA 1V88A 2D9ZA 2Z59A 2DKQA 2YS1A 2Y8GA 2RGNB 3O96A 4KHAA 2G35A 2KIGA 4TYZA 4YL8A 1BWNA 3D8FA 2DHKA 3D8EA 2VRWB 1KZGA 1K5DB 4A6FB 1V89A 1K5GB 1BAKA 3IVFA 4TKNA 2Z0OA 1NTVA 4HAZB 5DHAB 3U7DA 1EGXA 4WVFB 1U27A 4Z2NA 5JHHA 3ULCA 3NWFA 2OTXA 2NBVA 2GUMA 2VKIA 2IFSA 1UNQA 1U5GA 3FEHA 3RCPA 2KUQA 1N3HA 3V5WA 1AWEA 3HW2B 1ZVRA 1XR0B 4EKUA 1X05A 2PZ1A 3P6AA 4A6FA 2W2XD 2MWNB 4HAUB 5J3TA 4MT7A 1I7AA 1WI1A 1UEFA 1TXDA 4GMXB 2FJUB 4DX90 3PVWA 4HAWB 1FHWA 2YT1A 3FM8C 1FGZA 4ZRIA 1U5DA 2ZPYA 2UZRA 1FGYA 2LOXA 2YS5A 3DCXA 2AEHA 2LKOA 1V5PA 3PSCA 4A6KA 2W2WA 4HB4B 5J3YA 1SHCA 4IOYX 5LOPB 2R0DA 4KHOA 2D9YA 2COAA 2ELBA 4PNKA 4L1RA 2GS0A 2X18A 2NZ8B 1WGUA 2OQBA 1I2HA 5HE3A 1MIXA 2D9WA 4YONA 1FOEA 4CYEA 3GYOA 2FJLA 1OMWA 2Z4DA 1X11A 5HE0A 5I2SA 3BJIA 2N0YA 2GJYA 1GG3A 1LW3A 2I5FA 2Y8FA 3DXEA 1IRSA 2DYQA 3KRWA 3ZDTA 2K8EA 3ODXA 3SO6A 1RJ2A 1EAZA 2K2JA 1PFJA 4Z2MB 2HE7A 2L2IA 2DA0A 2P8VA 1U5FA 2YF0A 5DI9B 4DBBA 4K17A 2P0DA 3A8PA 4CHJA 3HSAA 1M7EA 4HB2B 5DHFB 3T06A 2CY5A 2YT2A 4KVGB 1H10A 5LONB 1V5MA 1RRPB 2DTCA 2I1JA 4KHBA 2K00A 3NWAA 2QKLA 3ODOA 2R2YA 3MDBC 4K2OA 1EVHA 4WJ7A 1TQZA 2ADZA 2YRYA 4HAVB 5C16A 2EMSA 3SV1A 1B55A 3DXDA 1X86A 5DH9B 1J0WA 5L81A 5J3QA 5C5BA 4DX8A 1X1FA 5M4YB 1KI1B 2AL6A 3QBVB 2VSZA 5D3WA 1FB8A 1U29A 3QIJA 4D0NB 5LG4B 3SYXA 3A8QA 5I2MA 1MAIA 3G9WA 1U5EA 4IFSA 1T77A 5KCVA 4QXAB 4K2PA 3WA0A 5FI0A 2BCJA 4CHMA 5JP4A 2I5CA 1ZC4B 4HSIA 2GCJA 3LJUX 5C6RA 3D8DA 4GNKB 2RNRB 1W1GA 4QJ3B 1P5TA 3KRXA 4PQ0A 1LB1A 3U8ZA 1Y19B 5HE2A 4BBKA 3F0WA 2Z14A 1UPRA 2V76A 3KZ1A 5HE1A 2K49A 4IAPA 3OANA 2E2XA 3TW1A 2NMBA 2CODA 1ISNA 2RVBB 3FVCA 2DFKA 1FAOA 1U2BA 2Y7BA
chains in the Genus database with same CATH topology
2CY4A 2W2XC 3PZDA 2J59M 1Y5OA 2D4QA 4MK0A 4HB0B 2LYDA 1GC7A 1X1GA 1SGHA 4HB3B 2K2UA 1TJ6A 1UNRA 1WG7A 4NSWA 4ZRKA 2YSZA 3AJ4A 2COFA 4P7IA 1MIZB 1MPHA 5KQ1A 1GC6A 3PG7A 1W1DA 3UZTA 3AU4A 2ROZB 2CAYA 4A6HA 2D9XA 1AQCA 2YS3A 3PEGA 4A5KA 1UNPA 2DYNA 2Z0PA 4C0AA 5JHGA 2LOZA 1DDVA 1ZC3B 2Z0QA 4HDOA 4MY6A 2COCA 3SNHA 4DXAB 1V5UA 2XQNM 1FHOA 2I1KA 4B6HA 5EFXA 3GYPA 2J0KA 2LG1A 2RLOA 4Y94A 4GPTB 1XD4A 3DXCA 2ELAA 3P7ZA 4GXBA 5CLQB 5FI1A 4F7GA 2RSGA 2M14A 4NY0A 1BTNA 1M7RA 3CXBB 3TFMA 3ML4A 3CIKA 1J19A 1MK9B 4HHVA 2GCLA 2J0JA 3N7CA 4F7UP 2H7EA 2D9VA 3HQCA 2EJ8A 1DDWA 3F5RA 4GMVA 5D3XA 1XODA 4KAXB 2HTHB 1XCGA 1WGQA 2M38A 2ROVA 1BTKA 3BINA 1P6SA 2LULA 3TVVA 4ZRJA 1P3RA 1OQNA 2EMTA 1QQGA 1NTYA 2R09A 3X23A 1NI2A 2P0HA 1OY2A 4GZUA 2D2QA 1XKEA 2H7DA 2L1CA 3AU5A 2D10A 5GOWB 1MK7B 3A98B 1NU2A 3MPXA 5D3YA 1H4RA 2Q13A 3HK0A 1EF1A 4HDQA 2DKPA 1UPQA 2YVCA 3KY9A 3FSSA 2RUKB 4HATB 1DYNA 3TO1A 1MKEA 2P0FA 1W1HA 1WJ1A 2UZSA 3KSYA 2D11A 2MKRA 4XWXA 5JLJB 1DROA 4F7HA 1FHXA 3M1IB 1Z87A 1ZSQA 5C79A 2JP2A 2MFQA 4HAXB 3PVLA 1ZM0A 3ODWA 2DX5A 3VIAA 1PLSA 2CRFA 4EMOA 1XX0A 2YT0A 2KGXB 2DHIA 2MDXA 2J0MA 3TCAA 1DDMA 1Q67A 2KUPA 4WSFA 3WYFB 4EJNA 5D27A 1PMSA 1WJMA 2QKMA 2EC1A 2N23A 3PVUA 4GN1A 3NSUA 3PP2A 1DBHA 1WVHA 3QWMA 5DIFB 3VOQA 4HAYB 5CLLB 4KHBB 3SUZA 5D3VA 1QC6A 2UVMA 2DN6A 1KZ7A 2IYBA 3ZVRA 2DX1A 4L6EA 5KQ4A 1E5WA 4H8SA 2DHJA 4K81A 2KCJA 1V61A 5C5BB 3ULBA 2DLWA 1V88A 2D9ZA 2DKQA 2YS1A 2Y8GA 2RGNB 3O96A 4KHAA 2G35A 4TYZA 4YL8A 1BWNA 3D8FA 2DHKA 3D8EA 2VRWB 1KZGA 1K5DB 4A6FB 1V89A 1K5GB 1BAKA 3IVFA 4TKNA 2Z0OA 1NTVA 4HAZB 5DHAB 3U7DA 1EGXA 4WVFB 1U27A 4Z2NA 5JHHA 3ULCA 2OTXA 2VKIA 2IFSA 1UNQA 1U5GA 3FEHA 3RCPA 1N3HA 3V5WA 1AWEA 3HW2B 1ZVRA 1XR0B 4EKUA 1X05A 2PZ1A 3P6AA 4A6FA 2W2XD 2MWNB 4HAUB 5J3TA 4MT7A 1I7AA 1WI1A 1UEFA 1TXDA 4GMXB 4DX90 3PVWA 4HAWB 1FHWA 2YT1A 3FM8C 1FGZA 4ZRIA 1U5DA 2ZPYA 2UZRA 1FGYA 2LOXA 2YS5A 2AEHA 2LKOA 1V5PA 3PSCA 4A6KA 2W2WA 4HB4B 5J3YA 1SHCA 4IOYX 5LOPB 2R0DA 4KHOA 2D9YA 2COAA 2ELBA 4PNKA 2GS0A 2X18A 2NZ8B 1WGUA 2OQBA 1I2HA 5HE3A 1MIXA 2D9WA 4YONA 1FOEA 4CYEA 3GYOA 2FJLA 1OMWA 1X11A 5HE0A 3BJIA 2N0YA 2GJYA 1GG3A 1LW3A 2I5FA 2Y8FA 3DXEA 1IRSA 2DYQA 3KRWA 3ZDTA 3ODXA 3SO6A 1RJ2A 1EAZA 2K2JA 1PFJA 4Z2MB 2HE7A 2L2IA 2DA0A 2P8VA 1U5FA 2YF0A 5DI9B 4DBBA 4K17A 2P0DA 3A8PA 4CHJA 1M7EA 4HB2B 5DHFB 3T06A 2CY5A 4KVGB 1H10A 5LONB 1V5MA 1RRPB 2DTCA 2I1JA 2K00A 2QKLA 3ODOA 3MDBC 4K2OA 1EVHA 4WJ7A 1TQZA 2ADZA 2YRYA 4HAVB 5C16A 2EMSA 3SV1A 1B55A 3DXDA 1X86A 5DH9B 1J0WA 5L81A 5J3QA 5C5BA 4DX8A 1X1FA 1KI1B 2AL6A 3QBVB 2VSZA 5D3WA 1FB8A 1U29A 3QIJA 4D0NB 3SYXA 3A8QA 1MAIA 3G9WA 1U5EA 4IFSA 5KCVA 4K2PA 3WA0A 5FI0A 2BCJA 4CHMA 5JP4A 2I5CA 1ZC4B 2GCJA 3LJUX 5C6RA 3D8DA 2RNRB 1W1GA 1P5TA 3KRXA 4PQ0A 1LB1A 3U8ZA 1Y19B 5HE2A 4BBKA 3F0WA 1UPRA 2V76A 3KZ1A 5HE1A 4IAPA 3OANA 2E2XA 3TW1A 2NMBA 2CODA 1ISNA 2RVBB 2DFKA 1FAOA 1U2BA 2Y7BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CY4 A;  2W2X C;  3PZD A;  2J59 M;  1Y5O A;  2D4Q A;  4MK0 A;  4HB0 B;  2LYD A;  1GC7 A;  1X1G A;  1SGH A;  4HB3 B;  2K2U A;  1TJ6 A;  1UNR A;  1WG7 A;  4NSW A;  4ZRK A;  2YSZ A;  3AJ4 A;  2COF A;  4P7I A;  1MIZ B;  1MPH A;  5KQ1 A;  1GC6 A;  3PG7 A;  1W1D A;  3UZT A;  3AU4 A;  2ROZ B;  2CAY A;  4A6H A;  2D9X A;  1AQC A;  2YS3 A;  3PEG A;  4A5K A;  1UNP A;  2DYN A;  2Z0P A;  4C0A A;  5JHG A;  2LOZ A;  1DDV A;  1ZC3 B;  2Z0Q A;  4HDO A;  4MY6 A;  2COC A;  3SNH A;  4DXA B;  1V5U A;  2XQN M;  1FHO A;  2I1K A;  4B6H A;  5EFX A;  3GYP A;  2J0K A;  2LG1 A;  2RLO A;  4Y94 A;  4GPT B;  1XD4 A;  3DXC A;  2ELA A;  3P7Z A;  4GXB A;  5CLQ B;  5FI1 A;  4F7G A;  2RSG A;  2M14 A;  4NY0 A;  1BTN A;  1M7R A;  3CXB B;  3TFM A;  3ML4 A;  3CIK A;  1J19 A;  1MK9 B;  4HHV A;  2GCL A;  2J0J A;  3N7C A;  4F7U P;  2H7E A;  2D9V A;  3HQC A;  2EJ8 A;  1DDW A;  3F5R A;  4GMV A;  5D3X A;  1XOD A;  4KAX B;  2HTH B;  1XCG A;  1WGQ A;  2M38 A;  2ROV A;  1BTK A;  3BIN A;  1P6S A;  2LUL A;  3TVV A;  4ZRJ A;  1P3R A;  1OQN A;  2EMT A;  1QQG A;  1NTY A;  2R09 A;  3X23 A;  1NI2 A;  2P0H A;  1OY2 A;  4GZU A;  2D2Q A;  1XKE A;  2H7D A;  2L1C A;  3AU5 A;  2D10 A;  5GOW B;  1MK7 B;  3A98 B;  1NU2 A;  3MPX A;  5D3Y A;  1H4R A;  2Q13 A;  3HK0 A;  1EF1 A;  4HDQ A;  2DKP A;  1UPQ A;  2YVC A;  3KY9 A;  3FSS A;  2RUK B;  4HAT B;  1DYN A;  3TO1 A;  1MKE A;  2P0F A;  1W1H A;  1WJ1 A;  2UZS A;  3KSY A;  2D11 A;  2MKR A;  4XWX A;  5JLJ B;  1DRO A;  4F7H A;  1FHX A;  3M1I B;  1Z87 A;  1ZSQ A;  5C79 A;  2JP2 A;  2MFQ A;  4HAX B;  3PVL A;  1ZM0 A;  3ODW A;  2DX5 A;  3VIA A;  1PLS A;  2CRF A;  4EMO A;  1XX0 A;  2YT0 A;  2KGX B;  2DHI A;  2MDX A;  2J0M A;  3TCA A;  1DDM A;  1Q67 A;  2KUP A;  4WSF A;  3WYF B;  4EJN A;  5D27 A;  1PMS A;  1WJM A;  2QKM A;  2EC1 A;  2N23 A;  3PVU A;  4GN1 A;  3NSU A;  3PP2 A;  1DBH A;  1WVH A;  3QWM A;  5DIF B;  3VOQ A;  4HAY B;  5CLL B;  4KHB B;  3SUZ A;  5D3V A;  1QC6 A;  2UVM A;  2DN6 A;  1KZ7 A;  2IYB A;  3ZVR A;  2DX1 A;  4L6E A;  5KQ4 A;  1E5W A;  4H8S A;  2DHJ A;  4K81 A;  2KCJ A;  1V61 A;  5C5B B;  3ULB A;  2DLW A;  1V88 A;  2D9Z A;  2DKQ A;  2YS1 A;  2Y8G A;  2RGN B;  3O96 A;  4KHA A;  2G35 A;  4TYZ A;  4YL8 A;  1BWN A;  3D8F A;  2DHK A;  3D8E A;  2VRW B;  1KZG A;  1K5D B;  4A6F B;  1V89 A;  1K5G B;  1BAK A;  3IVF A;  4TKN A;  2Z0O A;  1NTV A;  4HAZ B;  5DHA B;  3U7D A;  1EGX A;  4WVF B;  1U27 A;  4Z2N A;  5JHH A;  3ULC A;  2OTX A;  2VKI A;  2IFS A;  1UNQ A;  1U5G A;  3FEH A;  3RCP A;  1N3H A;  3V5W A;  1AWE A;  3HW2 B;  1ZVR A;  1XR0 B;  4EKU A;  1X05 A;  2PZ1 A;  3P6A A;  4A6F A;  2W2X D;  2MWN B;  4HAU B;  5J3T A;  4MT7 A;  1I7A A;  1WI1 A;  1UEF A;  1TXD A;  4GMX B;  4DX9 0;  3PVW A;  4HAW B;  1FHW A;  2YT1 A;  3FM8 C;  1FGZ A;  4ZRI A;  1U5D A;  2ZPY A;  2UZR A;  1FGY A;  2LOX A;  2YS5 A;  2AEH A;  2LKO A;  1V5P A;  3PSC A;  4A6K A;  2W2W A;  4HB4 B;  5J3Y A;  1SHC A;  4IOY X;  5LOP B;  2R0D A;  4KHO A;  2D9Y A;  2COA A;  2ELB A;  4PNK A;  2GS0 A;  2X18 A;  2NZ8 B;  1WGU A;  2OQB A;  1I2H A;  5HE3 A;  1MIX A;  2D9W A;  4YON A;  1FOE A;  4CYE A;  3GYO A;  2FJL A;  1OMW A;  1X11 A;  5HE0 A;  3BJI A;  2N0Y A;  2GJY A;  1GG3 A;  1LW3 A;  2I5F A;  2Y8F A;  3DXE A;  1IRS A;  2DYQ A;  3KRW A;  3ZDT A;  3ODX A;  3SO6 A;  1RJ2 A;  1EAZ A;  2K2J A;  1PFJ A;  4Z2M B;  2HE7 A;  2L2I A;  2DA0 A;  2P8V A;  1U5F A;  2YF0 A;  5DI9 B;  4DBB A;  4K17 A;  2P0D A;  3A8P A;  4CHJ A;  1M7E A;  4HB2 B;  5DHF B;  3T06 A;  2CY5 A;  4KVG B;  1H10 A;  5LON B;  1V5M A;  1RRP B;  2DTC A;  2I1J A;  2K00 A;  2QKL A;  3ODO A;  3MDB C;  4K2O A;  1EVH A;  4WJ7 A;  1TQZ A;  2ADZ A;  2YRY A;  4HAV B;  5C16 A;  2EMS A;  3SV1 A;  1B55 A;  3DXD A;  1X86 A;  5DH9 B;  1J0W A;  5L81 A;  5J3Q A;  5C5B A;  4DX8 A;  1X1F A;  1KI1 B;  2AL6 A;  3QBV B;  2VSZ A;  5D3W A;  1FB8 A;  1U29 A;  3QIJ A;  4D0N B;  3SYX A;  3A8Q A;  1MAI A;  3G9W A;  1U5E A;  4IFS A;  5KCV A;  4K2P A;  3WA0 A;  5FI0 A;  2BCJ A;  4CHM A;  5JP4 A;  2I5C A;  1ZC4 B;  2GCJ A;  3LJU X;  5C6R A;  3D8D A;  2RNR B;  1W1G A;  1P5T A;  3KRX A;  4PQ0 A;  1LB1 A;  3U8Z A;  1Y19 B;  5HE2 A;  4BBK A;  3F0W A;  1UPR A;  2V76 A;  3KZ1 A;  5HE1 A;  4IAP A;  3OAN A;  2E2X A;  3TW1 A;  2NMB A;  2COD A;  1ISN A;  2RVB B;  2DFK A;  1FAO A;  1U2B A;  2Y7B A; 
#chains in the Genus database with same CATH topology
 2CY4 A;  2W2X C;  3PZD A;  3HIE A;  2J59 M;  1Y5O A;  2D4Q A;  4MK0 A;  4HB0 B;  2LYD A;  1GC7 A;  1X1G A;  1SGH A;  4HB3 B;  2K2U A;  1MI1 A;  1TJ6 A;  1UNR A;  1WG7 A;  4NSW A;  4ZRK A;  2YSZ A;  3AJ4 A;  2COF A;  4P7I A;  1MIZ B;  1MPH A;  5KQ1 A;  1GC6 A;  3PG7 A;  1W1D A;  3UZT A;  3AU4 A;  2ROZ B;  2Z13 A;  2CAY A;  4A6H A;  2D9X A;  1AQC A;  2YS3 A;  3PEG A;  4A5K A;  3B77 A;  1UNP A;  2DYN A;  3A58 A;  2Z0P A;  4C0A A;  5JHG A;  2LOZ A;  1DDV A;  1ZC3 B;  2Z0Q A;  4OSN A;  4HDO A;  4MY6 A;  2COC A;  3SNH A;  4DXA B;  1V5U A;  2XQN M;  1FHO A;  3OHM B;  2I1K A;  4CSQ A;  4B6H A;  5EFX A;  3GYP A;  2J0K A;  4DIX A;  2LG1 A;  2RLO A;  4Y94 A;  4GPT B;  1XD4 A;  3DXC A;  3NW8 A;  2ELA A;  3P7Z A;  4GXB A;  5CLQ B;  5FI1 A;  4F7G A;  2RSG A;  2M14 A;  4QJ5 B;  4NY0 A;  1BTN A;  1M7R A;  3CXB B;  3TFM A;  3ML4 A;  3CIK A;  1J19 A;  1MK9 B;  4HHV A;  2GCL A;  2J0J A;  3N7C A;  4F7U P;  2H7E A;  2D9V A;  3HQC A;  2EJ8 A;  1DDW A;  3F5R A;  4GMV A;  5D3X A;  1XOD A;  4KAX B;  2HTH B;  1XCG A;  1WGQ A;  2M38 A;  2ROV A;  1BTK A;  3BIN A;  1P6S A;  2LUL A;  3TVV A;  4ZRJ A;  1P3R A;  1OQN A;  2EMT A;  1QQG A;  1NTY A;  2R09 A;  3X23 A;  1NI2 A;  2P0H A;  1OY2 A;  4GZU A;  2D2Q A;  1XKE A;  2H7D A;  2L1C A;  3AU5 A;  1ZYI A;  2D10 A;  4OT1 A;  5GOW B;  3NWD A;  1MK7 B;  3A98 B;  1NU2 A;  3MPX A;  5D3Y A;  4QJ4 B;  1H4R A;  2Q13 A;  2ZKM X;  3HK0 A;  1EF1 A;  4HDQ A;  2DKP A;  1UPQ A;  2YVC A;  3KY9 A;  3FSS A;  2RUK B;  4HAT B;  1DYN A;  3TO1 A;  1MKE A;  2P0F A;  1W1H A;  1WJ1 A;  2UZS A;  3KSY A;  2D11 A;  2MKR A;  4XWX A;  5JLJ B;  1DRO A;  4F7H A;  1FHX A;  3M1I B;  1Z87 A;  1ZSQ A;  5C79 A;  2JP2 A;  2MFQ A;  4HAX B;  3PVL A;  2KIE A;  1ZM0 A;  3ODW A;  2DX5 A;  2RRF A;  3VIA A;  1PLS A;  2CRF A;  4EMO A;  1XX0 A;  2YT0 A;  2KGX B;  2DHI A;  2MDX A;  2J0M A;  3TCA A;  1DDM A;  1Q67 A;  2KUP A;  4WSF A;  3WYF B;  4EJN A;  5D27 A;  1PMS A;  1WJM A;  2QKM A;  2EC1 A;  2N23 A;  3PVU A;  4GN1 A;  3NSU A;  3PP2 A;  1DBH A;  2KR0 A;  1WVH A;  3QWM A;  5DIF B;  3VOQ A;  4HAY B;  5CLL B;  4KHB B;  3SUZ A;  5D3V A;  5IRS A;  1QC6 A;  2UVM A;  2DN6 A;  1KZ7 A;  2IYB A;  3U12 A;  3ZVR A;  2DX1 A;  4L6E A;  5KQ4 A;  1E5W A;  4D6W A;  4H8S A;  2DHJ A;  4K81 A;  2KCJ A;  1V61 A;  4GOU A;  5C5B B;  3ULB A;  2DLW A;  1V88 A;  2D9Z A;  2Z59 A;  2DKQ A;  2YS1 A;  2Y8G A;  2RGN B;  3O96 A;  4KHA A;  2G35 A;  2KIG A;  4TYZ A;  4YL8 A;  1BWN A;  3D8F A;  2DHK A;  3D8E A;  2VRW B;  1KZG A;  1K5D B;  4A6F B;  1V89 A;  1K5G B;  1BAK A;  3IVF A;  4TKN A;  2Z0O A;  1NTV A;  4HAZ B;  5DHA B;  3U7D A;  1EGX A;  4WVF B;  1U27 A;  4Z2N A;  5JHH A;  3ULC A;  3NWF A;  2OTX A;  2NBV A;  2GUM A;  2VKI A;  2IFS A;  1UNQ A;  1U5G A;  3FEH A;  3RCP A;  2KUQ A;  1N3H A;  3V5W A;  1AWE A;  3HW2 B;  1ZVR A;  1XR0 B;  4EKU A;  1X05 A;  2PZ1 A;  3P6A A;  4A6F A;  2W2X D;  2MWN B;  4HAU B;  5J3T A;  4MT7 A;  1I7A A;  1WI1 A;  1UEF A;  1TXD A;  4GMX B;  2FJU B;  4DX9 0;  3PVW A;  4HAW B;  1FHW A;  2YT1 A;  3FM8 C;  1FGZ A;  4ZRI A;  1U5D A;  2ZPY A;  2UZR A;  1FGY A;  2LOX A;  2YS5 A;  3DCX A;  2AEH A;  2LKO A;  1V5P A;  3PSC A;  4A6K A;  2W2W A;  4HB4 B;  5J3Y A;  1SHC A;  4IOY X;  5LOP B;  2R0D A;  4KHO A;  2D9Y A;  2COA A;  2ELB A;  4PNK A;  4L1R A;  2GS0 A;  2X18 A;  2NZ8 B;  1WGU A;  2OQB A;  1I2H A;  5HE3 A;  1MIX A;  2D9W A;  4YON A;  1FOE A;  4CYE A;  3GYO A;  2FJL A;  1OMW A;  2Z4D A;  1X11 A;  5HE0 A;  5I2S A;  3BJI A;  2N0Y A;  2GJY A;  1GG3 A;  1LW3 A;  2I5F A;  2Y8F A;  3DXE A;  1IRS A;  2DYQ A;  3KRW A;  3ZDT A;  2K8E A;  3ODX A;  3SO6 A;  1RJ2 A;  1EAZ A;  2K2J A;  1PFJ A;  4Z2M B;  2HE7 A;  2L2I A;  2DA0 A;  2P8V A;  1U5F A;  2YF0 A;  5DI9 B;  4DBB A;  4K17 A;  2P0D A;  3A8P A;  4CHJ A;  3HSA A;  1M7E A;  4HB2 B;  5DHF B;  3T06 A;  2CY5 A;  2YT2 A;  4KVG B;  1H10 A;  5LON B;  1V5M A;  1RRP B;  2DTC A;  2I1J A;  4KHB A;  2K00 A;  3NWA A;  2QKL A;  3ODO A;  2R2Y A;  3MDB C;  4K2O A;  1EVH A;  4WJ7 A;  1TQZ A;  2ADZ A;  2YRY A;  4HAV B;  5C16 A;  2EMS A;  3SV1 A;  1B55 A;  3DXD A;  1X86 A;  5DH9 B;  1J0W A;  5L81 A;  5J3Q A;  5C5B A;  4DX8 A;  1X1F A;  5M4Y B;  1KI1 B;  2AL6 A;  3QBV B;  2VSZ A;  5D3W A;  1FB8 A;  1U29 A;  3QIJ A;  4D0N B;  5LG4 B;  3SYX A;  3A8Q A;  5I2M A;  1MAI A;  3G9W A;  1U5E A;  4IFS A;  1T77 A;  5KCV A;  4QXA B;  4K2P A;  3WA0 A;  5FI0 A;  2BCJ A;  4CHM A;  5JP4 A;  2I5C A;  1ZC4 B;  4HSI A;  2GCJ A;  3LJU X;  5C6R A;  3D8D A;  4GNK B;  2RNR B;  1W1G A;  4QJ3 B;  1P5T A;  3KRX A;  4PQ0 A;  1LB1 A;  3U8Z A;  1Y19 B;  5HE2 A;  4BBK A;  3F0W A;  2Z14 A;  1UPR A;  2V76 A;  3KZ1 A;  5HE1 A;  2K49 A;  4IAP A;  3OAN A;  2E2X A;  3TW1 A;  2NMB A;  2COD A;  1ISN A;  2RVB B;  3FVC A;  2DFK A;  1FAO A;  1U2B A;  2Y7B A; 
#chains in the Genus database with same CATH homology
 2CY4 A;  2W2X C;  3PZD A;  2J59 M;  1Y5O A;  2D4Q A;  4MK0 A;  4HB0 B;  2LYD A;  1GC7 A;  1X1G A;  1SGH A;  4HB3 B;  2K2U A;  1TJ6 A;  1UNR A;  1WG7 A;  4NSW A;  4ZRK A;  2YSZ A;  3AJ4 A;  2COF A;  4P7I A;  1MIZ B;  1MPH A;  5KQ1 A;  1GC6 A;  3PG7 A;  1W1D A;  3UZT A;  3AU4 A;  2ROZ B;  2CAY A;  4A6H A;  2D9X A;  1AQC A;  2YS3 A;  3PEG A;  4A5K A;  1UNP A;  2DYN A;  2Z0P A;  4C0A A;  5JHG A;  2LOZ A;  1DDV A;  1ZC3 B;  2Z0Q A;  4HDO A;  4MY6 A;  2COC A;  3SNH A;  4DXA B;  1V5U A;  2XQN M;  1FHO A;  2I1K A;  4B6H A;  5EFX A;  3GYP A;  2J0K A;  2LG1 A;  2RLO A;  4Y94 A;  4GPT B;  1XD4 A;  3DXC A;  2ELA A;  3P7Z A;  4GXB A;  5CLQ B;  5FI1 A;  4F7G A;  2RSG A;  2M14 A;  4NY0 A;  1BTN A;  1M7R A;  3CXB B;  3TFM A;  3ML4 A;  3CIK A;  1J19 A;  1MK9 B;  4HHV A;  2GCL A;  2J0J A;  3N7C A;  4F7U P;  2H7E A;  2D9V A;  3HQC A;  2EJ8 A;  1DDW A;  3F5R A;  4GMV A;  5D3X A;  1XOD A;  4KAX B;  2HTH B;  1XCG A;  1WGQ A;  2M38 A;  2ROV A;  1BTK A;  3BIN A;  1P6S A;  2LUL A;  3TVV A;  4ZRJ A;  1P3R A;  1OQN A;  2EMT A;  1QQG A;  1NTY A;  2R09 A;  3X23 A;  1NI2 A;  2P0H A;  1OY2 A;  4GZU A;  2D2Q A;  1XKE A;  2H7D A;  2L1C A;  3AU5 A;  2D10 A;  5GOW B;  1MK7 B;  3A98 B;  1NU2 A;  3MPX A;  5D3Y A;  1H4R A;  2Q13 A;  3HK0 A;  1EF1 A;  4HDQ A;  2DKP A;  1UPQ A;  2YVC A;  3KY9 A;  3FSS A;  2RUK B;  4HAT B;  1DYN A;  3TO1 A;  1MKE A;  2P0F A;  1W1H A;  1WJ1 A;  2UZS A;  3KSY A;  2D11 A;  2MKR A;  4XWX A;  5JLJ B;  1DRO A;  4F7H A;  1FHX A;  3M1I B;  1Z87 A;  1ZSQ A;  5C79 A;  2JP2 A;  2MFQ A;  4HAX B;  3PVL A;  1ZM0 A;  3ODW A;  2DX5 A;  3VIA A;  1PLS A;  2CRF A;  4EMO A;  1XX0 A;  2YT0 A;  2KGX B;  2DHI A;  2MDX A;  2J0M A;  3TCA A;  1DDM A;  1Q67 A;  2KUP A;  4WSF A;  3WYF B;  4EJN A;  5D27 A;  1PMS A;  1WJM A;  2QKM A;  2EC1 A;  2N23 A;  3PVU A;  4GN1 A;  3NSU A;  3PP2 A;  1DBH A;  1WVH A;  3QWM A;  5DIF B;  3VOQ A;  4HAY B;  5CLL B;  4KHB B;  3SUZ A;  5D3V A;  1QC6 A;  2UVM A;  2DN6 A;  1KZ7 A;  2IYB A;  3ZVR A;  2DX1 A;  4L6E A;  5KQ4 A;  1E5W A;  4H8S A;  2DHJ A;  4K81 A;  2KCJ A;  1V61 A;  5C5B B;  3ULB A;  2DLW A;  1V88 A;  2D9Z A;  2DKQ A;  2YS1 A;  2Y8G A;  2RGN B;  3O96 A;  4KHA A;  2G35 A;  4TYZ A;  4YL8 A;  1BWN A;  3D8F A;  2DHK A;  3D8E A;  2VRW B;  1KZG A;  1K5D B;  4A6F B;  1V89 A;  1K5G B;  1BAK A;  3IVF A;  4TKN A;  2Z0O A;  1NTV A;  4HAZ B;  5DHA B;  3U7D A;  1EGX A;  4WVF B;  1U27 A;  4Z2N A;  5JHH A;  3ULC A;  2OTX A;  2VKI A;  2IFS A;  1UNQ A;  1U5G A;  3FEH A;  3RCP A;  1N3H A;  3V5W A;  1AWE A;  3HW2 B;  1ZVR A;  1XR0 B;  4EKU A;  1X05 A;  2PZ1 A;  3P6A A;  4A6F A;  2W2X D;  2MWN B;  4HAU B;  5J3T A;  4MT7 A;  1I7A A;  1WI1 A;  1UEF A;  1TXD A;  4GMX B;  4DX9 0;  3PVW A;  4HAW B;  1FHW A;  2YT1 A;  3FM8 C;  1FGZ A;  4ZRI A;  1U5D A;  2ZPY A;  2UZR A;  1FGY A;  2LOX A;  2YS5 A;  2AEH A;  2LKO A;  1V5P A;  3PSC A;  4A6K A;  2W2W A;  4HB4 B;  5J3Y A;  1SHC A;  4IOY X;  5LOP B;  2R0D A;  4KHO A;  2D9Y A;  2COA A;  2ELB A;  4PNK A;  2GS0 A;  2X18 A;  2NZ8 B;  1WGU A;  2OQB A;  1I2H A;  5HE3 A;  1MIX A;  2D9W A;  4YON A;  1FOE A;  4CYE A;  3GYO A;  2FJL A;  1OMW A;  1X11 A;  5HE0 A;  3BJI A;  2N0Y A;  2GJY A;  1GG3 A;  1LW3 A;  2I5F A;  2Y8F A;  3DXE A;  1IRS A;  2DYQ A;  3KRW A;  3ZDT A;  3ODX A;  3SO6 A;  1RJ2 A;  1EAZ A;  2K2J A;  1PFJ A;  4Z2M B;  2HE7 A;  2L2I A;  2DA0 A;  2P8V A;  1U5F A;  2YF0 A;  5DI9 B;  4DBB A;  4K17 A;  2P0D A;  3A8P A;  4CHJ A;  1M7E A;  4HB2 B;  5DHF B;  3T06 A;  2CY5 A;  4KVG B;  1H10 A;  5LON B;  1V5M A;  1RRP B;  2DTC A;  2I1J A;  2K00 A;  2QKL A;  3ODO A;  3MDB C;  4K2O A;  1EVH A;  4WJ7 A;  1TQZ A;  2ADZ A;  2YRY A;  4HAV B;  5C16 A;  2EMS A;  3SV1 A;  1B55 A;  3DXD A;  1X86 A;  5DH9 B;  1J0W A;  5L81 A;  5J3Q A;  5C5B A;  4DX8 A;  1X1F A;  1KI1 B;  2AL6 A;  3QBV B;  2VSZ A;  5D3W A;  1FB8 A;  1U29 A;  3QIJ A;  4D0N B;  3SYX A;  3A8Q A;  1MAI A;  3G9W A;  1U5E A;  4IFS A;  5KCV A;  4K2P A;  3WA0 A;  5FI0 A;  2BCJ A;  4CHM A;  5JP4 A;  2I5C A;  1ZC4 B;  2GCJ A;  3LJU X;  5C6R A;  3D8D A;  2RNR B;  1W1G A;  1P5T A;  3KRX A;  4PQ0 A;  1LB1 A;  3U8Z A;  1Y19 B;  5HE2 A;  4BBK A;  3F0W A;  1UPR A;  2V76 A;  3KZ1 A;  5HE1 A;  4IAP A;  3OAN A;  2E2X A;  3TW1 A;  2NMB A;  2COD A;  1ISN A;  2RVB B;  2DFK A;  1FAO A;  1U2B A;  2Y7B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...