1TQZA

Solution structure of necap1 protein
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
133
structure length
133
Chain Sequence
MAAELEYESVLCVKPDVSVYRIPPRASNRGYRASDWKLDQPDWTGRLRITSKGKIAYIKLEDKVSGELFAQAPVEQYPGIAVETVTDSSRYFVIRIQDGTGRSAFIGIGFTDRGDAFDFNVSLQDHFKWVKQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of NECAP1 protein
rcsb
source organism Mus musculus
molecule tags Endocytosis/exocytosis
molecule keywords NECAP1
total genus 14
structure length 133
sequence length 133
ec nomenclature
pdb deposition date 2004-06-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 1tqzA01
1Y19B 3VOQA 1DDMA 1XODA 1Y5OA 4A5KA 1WG7A 5D27A 3TO1A 1RRPB 1W1GA 3KRXA 1SHCA 5C5BB 1SGHA 1U5FA 4ZRJA 2R09A 2AL6A 4A6KA 4HB3B 1NI2A 5FI1A 2VKIA 2LG1A 4Z2NA 4EKUA 2BCJA 2I5FA 1X86A 2ROVA 2QKLA 3PP2A 1I2HA 4HAYB 3V5WA 4WSFA 3TW1A 4KVGB 3DXDA 4GPTB 4TYZA 2J0JA 3N7CA 1P5TA 2D9VA 4DX8A 5CLQB 5D3YA 2J0KA 2D2QA 2P0HA 4PNKA 2D10A 2VRWB 3ODWA 1P3RA 2CODA 4HATB 5DIFB 3FEHA 3D8FA 3ODOA 4A6HA 2N23A 4NSWA 1FB8A 1X05A 3SNHA 4HB2B 1U27A 4WVFB 2CY4A 3GYOA 4K17A 2N0YA 2M38A 4F7HA 4HAWB 2DYQA 3AJ4A 2H7EA 3P6AA 4WJ7A 2QKMA 1B55A 2CAYA 5DH9B 1FGZA 2H7DA 1FHOA 3PVLA 4DXAB 3TFMA 1UNPA 1WGUA 1NTVA 1DBHA 3PZDA 2RGNB 1EAZA 1TXDA 2MFQA 2LOZA 5J3YA 1UNQA 2ELAA 2KGXB 4GZUA 3BINA 3QBVB 2Z0OA 2RVBB 2D9XA 2DLWA 1RJ2A 3PG7A 2JP2A 3TCAA 5JLJB 1WI1A 2V76A 3SYXA 3SO6A 1MK9B 2ELBA 1UEFA 5JP4A 5KCVA 5C5BA 2MWNB 1XCGA 1OQNA 1V5PA 5D3VA 4KHAA 3TVVA 2Q13A 3QWMA 1EF1A 1Z87A 5JHHA 4YL8A 1XX0A 2LYDA 4TKNA 5HE1A 1GC6A 1H10A 1U2BA 1KZ7A 1XKEA 3PEGA 1M7EA 3WYFB 2DHJA 5L81A 1J19A 3ML4A 4HHVA 3U8ZA 3KZ1A 5C16A 5C79A 2W2XD 3HW2B 4F7GA 4F7UP 3ZVRA 3ZDTA 1FOEA 2LKOA 2Y8GA 3WA0A 2MKRA 4EMOA 2YSZA 3SV1A 2DX5A 1V5MA 4BBKA 1LW3A 3M1IB 4P7IA 1GC7A 4ZRKA 5HE2A 2K00A 3DXEA 5KQ1A 2G35A 4K2OA 1WJ1A 3PVWA 1W1HA 2W2WA 1M7RA 4HB4B 2X18A 3O96A 1BTKA 3NSUA 5CLLB 1PMSA 4GMVA 4PQ0A 3FM8C 4C0AA 2FJLA 2Y7BA 1U5EA 1V61A 1MK7B 2I1KA 1DDWA 1ZC4B 1MPHA 2Z0PA 1NU2A 2DN6A 3VIAA 1UNRA 4HAZB 2DHKA 3X23A 3SUZA 3F5RA 3HK0A 2J59M 4HB0B 1DYNA 2DFKA 1P6SA 1FAOA 2EMSA 2I1JA 2P0FA 4A6FB 1EGXA 2GJYA 5D3WA 2AEHA 3D8EA 4MK0A 2OQBA 1PLSA 4D0NB 1FHXA 2NZ8B 5C6RA 1V89A 2YF0A 1ISNA 1PFJA 2ROZB 4XWXA 3F0WA 2D9ZA 2EMTA 3KRWA 4HAVB 4A6FA 1BWNA 1N3HA 2DKQA 1LB1A 1X11A 1ZSQA 2Y8FA 5LOPB 3G9WA 1WJMA 2W2XC 2YRYA 1U5GA 2GS0A 3LJUX 2NMBA 3CXBB 2ZPYA 1MIXA 4MT7A 1XD4A 2MDXA 2YS1A 4ZRIA 1WVHA 2DHIA 2YS3A 4GXBA 2RSGA 4KHBB 4K2PA 1DROA 1E5WA 3ULCA 2IYBA 4HAUB 1H4RA 2GCLA 1BTNA 2LULA 3ODXA 2IFSA 4B6HA 1X1GA 1QC6A 4YONA 2GCJA 2M14A 3P7ZA 5DI9B 4Y94A 4IOYX 3QIJA 4EJNA 2COCA 2UZRA 5J3TA 3AU5A 2YT0A 2P8VA 1V88A 2COFA 2YS5A 2CRFA 4CYEA 3KSYA 1NTYA 1WGQA 5KQ4A 3UZTA 1OMWA 4HAXB 2DA0A 1AQCA 2VSZA 3KY9A 5HE3A 2CY5A 4HDQA 1FGYA 1TQZA 3A8QA 2I5CA 4H8SA 1K5GB 3U7DA 2L2IA 2DYNA 2D9YA 4K81A 2DKPA 2D4QA 1ZVRA 4GMXB 2D11A 2UZSA 1W1DA 1U5DA 4Z2MB 5J3QA 1X1FA 4KAXB 4L6EA 2KCJA 2OTXA 4KHOA 4IAPA 4HDOA 1MKEA 2HTHB 2YVCA 2R0DA 1TJ6A 3A98B 1BAKA 2PZ1A 1U29A 3DXCA 4GN1A 3AU4A 2K2JA 5HE0A 1DDVA 4DX90 1MIZB 5D3XA 2DTCA 1KI1B 1MAIA 5GOWB 1V5UA 2ADZA 3MDBC 1UPQA 2K2UA 5DHAB 1ZC3B 2KUPA 3A8PA 2RLOA 1XR0B 2LOXA 4CHMA 4CHJA 4NY0A 2RUKB 2RNRB 3IVFA 1I7AA 3D8DA 3OANA 4MY6A 2UVMA 5EFXA 2EC1A 3CIKA 2COAA 2HE7A 1OY2A 3ULBA 1EVHA 2L1CA 5FI0A 3FSSA 1K5DB 2DX1A 1GG3A 3PVUA 3RCPA 1IRSA 2J0MA 3T06A 5JHGA 4DBBA 1UPRA 3HQCA 3GYPA 2Z0QA 1AWEA 2E2XA 1FHWA 4IFSA 2P0DA 1KZGA 5LONB 5DHFB 2D9WA 2XQNM 1Q67A 1QQGA 3MPXA 2YT1A 3BJIA 1ZM0A 2EJ8A 3PSCA 1J0WA
chains in the Genus database with same CATH superfamily
1Y19B 3VOQA 1DDMA 1XODA 1Y5OA 1T77A 4A5KA 1WG7A 5D27A 4OT1A 3TO1A 1RRPB 1W1GA 3KRXA 1SHCA 3HIEA 5C5BB 1SGHA 1U5FA 4ZRJA 2R09A 2K49A 2AL6A 4A6KA 4HB3B 1NI2A 5FI1A 2VKIA 2LG1A 4Z2NA 4EKUA 2BCJA 2Z13A 2I5FA 3A58A 5IRSA 1X86A 2K8EA 4L1RA 2Z4DA 2ROVA 2QKLA 3PP2A 1I2HA 4HAYB 3V5WA 4WSFA 3TW1A 2YT2A 4KVGB 3DXDA 4GPTB 4TYZA 2J0JA 3N7CA 1P5TA 2D9VA 4DX8A 5CLQB 5D3YA 2J0KA 2D2QA 2P0HA 4PNKA 2D10A 3DCXA 2VRWB 3ODWA 1P3RA 2CODA 4HSIA 4HATB 5DIFB 3FEHA 3D8FA 2KIGA 3ODOA 4A6HA 2N23A 5LG4B 4NSWA 3NW8A 1FB8A 1X05A 3SNHA 4HB2B 1U27A 4WVFB 2CY4A 3GYOA 4K17A 2N0YA 2M38A 4F7HA 4HAWB 2DYQA 3AJ4A 2H7EA 3P6AA 4D6WA 4WJ7A 2QKMA 1B55A 2CAYA 5I2SA 5DH9B 1FGZA 2H7DA 1FHOA 1MI1A 3PVLA 3B77A 4DXAB 3TFMA 1UNPA 2KUQA 1WGUA 1NTVA 1DBHA 3PZDA 2RGNB 1EAZA 1TXDA 2MFQA 2LOZA 5J3YA 1UNQA 2ELAA 2KGXB 4GZUA 3BINA 3QBVB 2Z0OA 2RVBB 2D9XA 2DLWA 1RJ2A 3PG7A 2JP2A 4GNKB 3TCAA 5JLJB 1WI1A 2V76A 4KHBA 3HSAA 3SYXA 3SO6A 1MK9B 2ELBA 1UEFA 5JP4A 5KCVA 5C5BA 2MWNB 1XCGA 1OQNA 1V5PA 5D3VA 4KHAA 3TVVA 2Q13A 3QWMA 1EF1A 1Z87A 2GUMA 5JHHA 4YL8A 1XX0A 2LYDA 4TKNA 5HE1A 3FVCA 1GC6A 1H10A 1U2BA 1KZ7A 1XKEA 3PEGA 1M7EA 3WYFB 2DHJA 5L81A 1J19A 3ML4A 4HHVA 3U8ZA 3KZ1A 5C16A 5C79A 2W2XD 3HW2B 4F7GA 4F7UP 3NWAA 3ZVRA 3ZDTA 1FOEA 2LKOA 2Y8GA 3NWFA 3WA0A 2MKRA 5M4YB 4DIXA 4EMOA 2YSZA 3SV1A 2DX5A 1V5MA 4BBKA 1LW3A 3M1IB 4P7IA 1GC7A 4ZRKA 5HE2A 3NWDA 4QJ4B 2K00A 3DXEA 5KQ1A 2G35A 4K2OA 1WJ1A 3PVWA 1W1HA 2W2WA 1M7RA 4HB4B 2X18A 3O96A 1BTKA 3NSUA 5CLLB 1PMSA 4GMVA 4PQ0A 3FM8C 4C0AA 2FJLA 2Y7BA 1U5EA 1V61A 1MK7B 2I1KA 1DDWA 1ZC4B 1MPHA 2Z0PA 1NU2A 2DN6A 3VIAA 1UNRA 4HAZB 2DHKA 3X23A 3SUZA 3F5RA 3HK0A 2J59M 4HB0B 1DYNA 2DFKA 1P6SA 1FAOA 2EMSA 2I1JA 2KIEA 2P0FA 4A6FB 1EGXA 2GJYA 5D3WA 4QJ5B 2AEHA 3D8EA 4MK0A 2OQBA 1PLSA 4D0NB 1FHXA 2NZ8B 5C6RA 1V89A 2YF0A 1ISNA 1PFJA 2ROZB 4XWXA 3F0WA 2D9ZA 2EMTA 3KRWA 4HAVB 4A6FA 1BWNA 1N3HA 2DKQA 1LB1A 1X11A 1ZSQA 2Y8FA 5LOPB 3G9WA 1WJMA 2W2XC 2YRYA 1U5GA 2GS0A 3LJUX 2NMBA 3CXBB 2ZPYA 1MIXA 4MT7A 1XD4A 2MDXA 2YS1A 4ZRIA 1WVHA 2DHIA 2YS3A 2RRFA 2Z59A 4GXBA 2RSGA 4KHBB 4GOUA 4K2PA 4QJ3B 1DROA 1E5WA 3ULCA 2IYBA 4HAUB 1H4RA 2GCLA 1BTNA 2LULA 3ODXA 2IFSA 4B6HA 1X1GA 1QC6A 4YONA 2GCJA 2M14A 3P7ZA 5DI9B 4Y94A 4IOYX 3QIJA 4EJNA 2COCA 3OHMB 2UZRA 5J3TA 3AU5A 2YT0A 2P8VA 1V88A 2COFA 2YS5A 2CRFA 4CYEA 3KSYA 1NTYA 1WGQA 5KQ4A 3UZTA 1OMWA 4HAXB 2DA0A 1AQCA 2VSZA 3KY9A 4OSNA 5HE3A 2CY5A 4HDQA 1FGYA 1TQZA 3A8QA 2FJUB 2I5CA 4H8SA 1K5GB 3U7DA 2L2IA 2DYNA 2D9YA 2DKPA 4K81A 2D4QA 1ZVRA 2R2YA 2D11A 4GMXB 2UZSA 1W1DA 1U5DA 4Z2MB 5J3QA 1X1FA 4QXAB 4KAXB 4L6EA 2KCJA 2OTXA 4KHOA 1ZYIA 4IAPA 2NBVA 4HDOA 1MKEA 2HTHB 2YVCA 2R0DA 1TJ6A 3A98B 1BAKA 4CSQA 2PZ1A 1U29A 3DXCA 4GN1A 3AU4A 2K2JA 5HE0A 1DDVA 4DX90 1MIZB 5D3XA 2Z14A 2DTCA 1KI1B 1MAIA 5GOWB 2KR0A 5I2MA 1V5UA 2ADZA 3MDBC 1UPQA 2K2UA 5DHAB 1ZC3B 2KUPA 3A8PA 2RLOA 1XR0B 2LOXA 4CHMA 4CHJA 4NY0A 2RUKB 2RNRB 3IVFA 1I7AA 3D8DA 3OANA 4MY6A 2UVMA 5EFXA 2EC1A 3CIKA 2COAA 2ZKMX 2HE7A 1OY2A 3ULBA 1EVHA 2L1CA 5FI0A 3FSSA 1K5DB 2DX1A 1GG3A 3PVUA 3RCPA 1IRSA 2J0MA 3T06A 5JHGA 4DBBA 3U12A 1UPRA 3HQCA 3GYPA 2Z0QA 1AWEA 2E2XA 1FHWA 4IFSA 2P0DA 1KZGA 5LONB 5DHFB 2D9WA 2XQNM 1Q67A 1QQGA 3MPXA 2YT1A 3BJIA 1ZM0A 2EJ8A 3PSCA 1J0WA
chains in the Genus database with same CATH topology
1Y19B 3VOQA 1DDMA 1XODA 1Y5OA 4A5KA 1WG7A 5D27A 3TO1A 1RRPB 1W1GA 3KRXA 1SHCA 5C5BB 1SGHA 1U5FA 4ZRJA 2R09A 2AL6A 4A6KA 4HB3B 1NI2A 5FI1A 2VKIA 2LG1A 4Z2NA 4EKUA 2BCJA 2I5FA 1X86A 2ROVA 2QKLA 3PP2A 1I2HA 4HAYB 3V5WA 4WSFA 3TW1A 4KVGB 3DXDA 4GPTB 4TYZA 2J0JA 3N7CA 1P5TA 2D9VA 4DX8A 5CLQB 5D3YA 2J0KA 2D2QA 2P0HA 4PNKA 2D10A 2VRWB 3ODWA 1P3RA 2CODA 4HATB 5DIFB 3FEHA 3D8FA 3ODOA 4A6HA 2N23A 4NSWA 1FB8A 1X05A 3SNHA 4HB2B 1U27A 4WVFB 2CY4A 3GYOA 4K17A 2N0YA 2M38A 4F7HA 4HAWB 2DYQA 3AJ4A 2H7EA 3P6AA 4WJ7A 2QKMA 1B55A 2CAYA 5DH9B 1FGZA 2H7DA 1FHOA 3PVLA 4DXAB 3TFMA 1UNPA 1WGUA 1NTVA 1DBHA 3PZDA 2RGNB 1EAZA 1TXDA 2MFQA 2LOZA 5J3YA 1UNQA 2ELAA 2KGXB 4GZUA 3BINA 3QBVB 2Z0OA 2RVBB 2D9XA 2DLWA 1RJ2A 3PG7A 2JP2A 3TCAA 5JLJB 1WI1A 2V76A 3SYXA 3SO6A 1MK9B 2ELBA 1UEFA 5JP4A 5KCVA 5C5BA 2MWNB 1XCGA 1OQNA 1V5PA 5D3VA 4KHAA 3TVVA 2Q13A 3QWMA 1EF1A 1Z87A 5JHHA 4YL8A 1XX0A 2LYDA 4TKNA 5HE1A 1GC6A 1H10A 1U2BA 1KZ7A 1XKEA 3PEGA 1M7EA 3WYFB 2DHJA 5L81A 1J19A 3ML4A 4HHVA 3U8ZA 3KZ1A 5C16A 5C79A 2W2XD 3HW2B 4F7GA 4F7UP 3ZVRA 3ZDTA 1FOEA 2LKOA 2Y8GA 3WA0A 2MKRA 4EMOA 2YSZA 3SV1A 2DX5A 1V5MA 4BBKA 1LW3A 3M1IB 4P7IA 1GC7A 4ZRKA 5HE2A 2K00A 3DXEA 5KQ1A 2G35A 4K2OA 1WJ1A 3PVWA 1W1HA 2W2WA 1M7RA 4HB4B 2X18A 3O96A 1BTKA 3NSUA 5CLLB 1PMSA 4GMVA 4PQ0A 3FM8C 4C0AA 2FJLA 2Y7BA 1U5EA 1V61A 1MK7B 2I1KA 1DDWA 1ZC4B 1MPHA 2Z0PA 1NU2A 2DN6A 3VIAA 1UNRA 4HAZB 2DHKA 3X23A 3SUZA 3F5RA 3HK0A 2J59M 4HB0B 1DYNA 2DFKA 1P6SA 1FAOA 2EMSA 2I1JA 2P0FA 4A6FB 1EGXA 2GJYA 5D3WA 2AEHA 3D8EA 4MK0A 2OQBA 1PLSA 4D0NB 1FHXA 2NZ8B 5C6RA 1V89A 2YF0A 1ISNA 1PFJA 2ROZB 4XWXA 3F0WA 2D9ZA 2EMTA 3KRWA 4HAVB 4A6FA 1BWNA 1N3HA 2DKQA 1LB1A 1X11A 1ZSQA 2Y8FA 5LOPB 3G9WA 1WJMA 2W2XC 2YRYA 1U5GA 2GS0A 3LJUX 2NMBA 3CXBB 2ZPYA 1MIXA 4MT7A 1XD4A 2MDXA 2YS1A 4ZRIA 1WVHA 2DHIA 2YS3A 4GXBA 2RSGA 4KHBB 4K2PA 1DROA 1E5WA 3ULCA 2IYBA 4HAUB 1H4RA 2GCLA 1BTNA 2LULA 3ODXA 2IFSA 4B6HA 1X1GA 1QC6A 4YONA 2GCJA 2M14A 3P7ZA 5DI9B 4Y94A 4IOYX 3QIJA 4EJNA 2COCA 2UZRA 5J3TA 3AU5A 2YT0A 2P8VA 1V88A 2COFA 2YS5A 2CRFA 4CYEA 3KSYA 1NTYA 1WGQA 5KQ4A 3UZTA 1OMWA 4HAXB 2DA0A 1AQCA 2VSZA 3KY9A 5HE3A 2CY5A 4HDQA 1FGYA 1TQZA 3A8QA 2I5CA 4H8SA 1K5GB 3U7DA 2L2IA 2DYNA 2D9YA 4K81A 2DKPA 2D4QA 1ZVRA 4GMXB 2D11A 2UZSA 1W1DA 1U5DA 4Z2MB 5J3QA 1X1FA 4KAXB 4L6EA 2KCJA 2OTXA 4KHOA 4IAPA 4HDOA 1MKEA 2HTHB 2YVCA 2R0DA 1TJ6A 3A98B 1BAKA 2PZ1A 1U29A 3DXCA 4GN1A 3AU4A 2K2JA 5HE0A 1DDVA 4DX90 1MIZB 5D3XA 2DTCA 1KI1B 1MAIA 5GOWB 1V5UA 2ADZA 3MDBC 1UPQA 2K2UA 5DHAB 1ZC3B 2KUPA 3A8PA 2RLOA 1XR0B 2LOXA 4CHMA 4CHJA 4NY0A 2RUKB 2RNRB 3IVFA 1I7AA 3D8DA 3OANA 4MY6A 2UVMA 5EFXA 2EC1A 3CIKA 2COAA 2HE7A 1OY2A 3ULBA 1EVHA 2L1CA 5FI0A 3FSSA 1K5DB 2DX1A 1GG3A 3PVUA 3RCPA 1IRSA 2J0MA 3T06A 5JHGA 4DBBA 1UPRA 3HQCA 3GYPA 2Z0QA 1AWEA 2E2XA 1FHWA 4IFSA 2P0DA 1KZGA 5LONB 5DHFB 2D9WA 2XQNM 1Q67A 1QQGA 3MPXA 2YT1A 3BJIA 1ZM0A 2EJ8A 3PSCA 1J0WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Y19 B;  3VOQ A;  1DDM A;  1XOD A;  1Y5O A;  4A5K A;  1WG7 A;  5D27 A;  3TO1 A;  1RRP B;  1W1G A;  3KRX A;  1SHC A;  5C5B B;  1SGH A;  1U5F A;  4ZRJ A;  2R09 A;  2AL6 A;  4A6K A;  4HB3 B;  1NI2 A;  5FI1 A;  2VKI A;  2LG1 A;  4Z2N A;  4EKU A;  2BCJ A;  2I5F A;  1X86 A;  2ROV A;  2QKL A;  3PP2 A;  1I2H A;  4HAY B;  3V5W A;  4WSF A;  3TW1 A;  4KVG B;  3DXD A;  4GPT B;  4TYZ A;  2J0J A;  3N7C A;  1P5T A;  2D9V A;  4DX8 A;  5CLQ B;  5D3Y A;  2J0K A;  2D2Q A;  2P0H A;  4PNK A;  2D10 A;  2VRW B;  3ODW A;  1P3R A;  2COD A;  4HAT B;  5DIF B;  3FEH A;  3D8F A;  3ODO A;  4A6H A;  2N23 A;  4NSW A;  1FB8 A;  1X05 A;  3SNH A;  4HB2 B;  1U27 A;  4WVF B;  2CY4 A;  3GYO A;  4K17 A;  2N0Y A;  2M38 A;  4F7H A;  4HAW B;  2DYQ A;  3AJ4 A;  2H7E A;  3P6A A;  4WJ7 A;  2QKM A;  1B55 A;  2CAY A;  5DH9 B;  1FGZ A;  2H7D A;  1FHO A;  3PVL A;  4DXA B;  3TFM A;  1UNP A;  1WGU A;  1NTV A;  1DBH A;  3PZD A;  2RGN B;  1EAZ A;  1TXD A;  2MFQ A;  2LOZ A;  5J3Y A;  1UNQ A;  2ELA A;  2KGX B;  4GZU A;  3BIN A;  3QBV B;  2Z0O A;  2RVB B;  2D9X A;  2DLW A;  1RJ2 A;  3PG7 A;  2JP2 A;  3TCA A;  5JLJ B;  1WI1 A;  2V76 A;  3SYX A;  3SO6 A;  1MK9 B;  2ELB A;  1UEF A;  5JP4 A;  5KCV A;  5C5B A;  2MWN B;  1XCG A;  1OQN A;  1V5P A;  5D3V A;  4KHA A;  3TVV A;  2Q13 A;  3QWM A;  1EF1 A;  1Z87 A;  5JHH A;  4YL8 A;  1XX0 A;  2LYD A;  4TKN A;  5HE1 A;  1GC6 A;  1H10 A;  1U2B A;  1KZ7 A;  1XKE A;  3PEG A;  1M7E A;  3WYF B;  2DHJ A;  5L81 A;  1J19 A;  3ML4 A;  4HHV A;  3U8Z A;  3KZ1 A;  5C16 A;  5C79 A;  2W2X D;  3HW2 B;  4F7G A;  4F7U P;  3ZVR A;  3ZDT A;  1FOE A;  2LKO A;  2Y8G A;  3WA0 A;  2MKR A;  4EMO A;  2YSZ A;  3SV1 A;  2DX5 A;  1V5M A;  4BBK A;  1LW3 A;  3M1I B;  4P7I A;  1GC7 A;  4ZRK A;  5HE2 A;  2K00 A;  3DXE A;  5KQ1 A;  2G35 A;  4K2O A;  1WJ1 A;  3PVW A;  1W1H A;  2W2W A;  1M7R A;  4HB4 B;  2X18 A;  3O96 A;  1BTK A;  3NSU A;  5CLL B;  1PMS A;  4GMV A;  4PQ0 A;  3FM8 C;  4C0A A;  2FJL A;  2Y7B A;  1U5E A;  1V61 A;  1MK7 B;  2I1K A;  1DDW A;  1ZC4 B;  1MPH A;  2Z0P A;  1NU2 A;  2DN6 A;  3VIA A;  1UNR A;  4HAZ B;  2DHK A;  3X23 A;  3SUZ A;  3F5R A;  3HK0 A;  2J59 M;  4HB0 B;  1DYN A;  2DFK A;  1P6S A;  1FAO A;  2EMS A;  2I1J A;  2P0F A;  4A6F B;  1EGX A;  2GJY A;  5D3W A;  2AEH A;  3D8E A;  4MK0 A;  2OQB A;  1PLS A;  4D0N B;  1FHX A;  2NZ8 B;  5C6R A;  1V89 A;  2YF0 A;  1ISN A;  1PFJ A;  2ROZ B;  4XWX A;  3F0W A;  2D9Z A;  2EMT A;  3KRW A;  4HAV B;  4A6F A;  1BWN A;  1N3H A;  2DKQ A;  1LB1 A;  1X11 A;  1ZSQ A;  2Y8F A;  5LOP B;  3G9W A;  1WJM A;  2W2X C;  2YRY A;  1U5G A;  2GS0 A;  3LJU X;  2NMB A;  3CXB B;  2ZPY A;  1MIX A;  4MT7 A;  1XD4 A;  2MDX A;  2YS1 A;  4ZRI A;  1WVH A;  2DHI A;  2YS3 A;  4GXB A;  2RSG A;  4KHB B;  4K2P A;  1DRO A;  1E5W A;  3ULC A;  2IYB A;  4HAU B;  1H4R A;  2GCL A;  1BTN A;  2LUL A;  3ODX A;  2IFS A;  4B6H A;  1X1G A;  1QC6 A;  4YON A;  2GCJ A;  2M14 A;  3P7Z A;  5DI9 B;  4Y94 A;  4IOY X;  3QIJ A;  4EJN A;  2COC A;  2UZR A;  5J3T A;  3AU5 A;  2YT0 A;  2P8V A;  1V88 A;  2COF A;  2YS5 A;  2CRF A;  4CYE A;  3KSY A;  1NTY A;  1WGQ A;  5KQ4 A;  3UZT A;  1OMW A;  4HAX B;  2DA0 A;  1AQC A;  2VSZ A;  3KY9 A;  5HE3 A;  2CY5 A;  4HDQ A;  1FGY A;  1TQZ A;  3A8Q A;  2I5C A;  4H8S A;  1K5G B;  3U7D A;  2L2I A;  2DYN A;  2D9Y A;  4K81 A;  2DKP A;  2D4Q A;  1ZVR A;  4GMX B;  2D11 A;  2UZS A;  1W1D A;  1U5D A;  4Z2M B;  5J3Q A;  1X1F A;  4KAX B;  4L6E A;  2KCJ A;  2OTX A;  4KHO A;  4IAP A;  4HDO A;  1MKE A;  2HTH B;  2YVC A;  2R0D A;  1TJ6 A;  3A98 B;  1BAK A;  2PZ1 A;  1U29 A;  3DXC A;  4GN1 A;  3AU4 A;  2K2J A;  5HE0 A;  1DDV A;  4DX9 0;  1MIZ B;  5D3X A;  2DTC A;  1KI1 B;  1MAI A;  5GOW B;  1V5U A;  2ADZ A;  3MDB C;  1UPQ A;  2K2U A;  5DHA B;  1ZC3 B;  2KUP A;  3A8P A;  2RLO A;  1XR0 B;  2LOX A;  4CHM A;  4CHJ A;  4NY0 A;  2RUK B;  2RNR B;  3IVF A;  1I7A A;  3D8D A;  3OAN A;  4MY6 A;  2UVM A;  5EFX A;  2EC1 A;  3CIK A;  2COA A;  2HE7 A;  1OY2 A;  3ULB A;  1EVH A;  2L1C A;  5FI0 A;  3FSS A;  1K5D B;  2DX1 A;  1GG3 A;  3PVU A;  3RCP A;  1IRS A;  2J0M A;  3T06 A;  5JHG A;  4DBB A;  1UPR A;  3HQC A;  3GYP A;  2Z0Q A;  1AWE A;  2E2X A;  1FHW A;  4IFS A;  2P0D A;  1KZG A;  5LON B;  5DHF B;  2D9W A;  2XQN M;  1Q67 A;  1QQG A;  3MPX A;  2YT1 A;  3BJI A;  1ZM0 A;  2EJ8 A;  3PSC A;  1J0W A; 
#chains in the Genus database with same CATH topology
 1Y19 B;  3VOQ A;  1DDM A;  1XOD A;  1Y5O A;  1T77 A;  4A5K A;  1WG7 A;  5D27 A;  4OT1 A;  3TO1 A;  1RRP B;  1W1G A;  3KRX A;  1SHC A;  3HIE A;  5C5B B;  1SGH A;  1U5F A;  4ZRJ A;  2R09 A;  2K49 A;  2AL6 A;  4A6K A;  4HB3 B;  1NI2 A;  5FI1 A;  2VKI A;  2LG1 A;  4Z2N A;  4EKU A;  2BCJ A;  2Z13 A;  2I5F A;  3A58 A;  5IRS A;  1X86 A;  2K8E A;  4L1R A;  2Z4D A;  2ROV A;  2QKL A;  3PP2 A;  1I2H A;  4HAY B;  3V5W A;  4WSF A;  3TW1 A;  2YT2 A;  4KVG B;  3DXD A;  4GPT B;  4TYZ A;  2J0J A;  3N7C A;  1P5T A;  2D9V A;  4DX8 A;  5CLQ B;  5D3Y A;  2J0K A;  2D2Q A;  2P0H A;  4PNK A;  2D10 A;  3DCX A;  2VRW B;  3ODW A;  1P3R A;  2COD A;  4HSI A;  4HAT B;  5DIF B;  3FEH A;  3D8F A;  2KIG A;  3ODO A;  4A6H A;  2N23 A;  5LG4 B;  4NSW A;  3NW8 A;  1FB8 A;  1X05 A;  3SNH A;  4HB2 B;  1U27 A;  4WVF B;  2CY4 A;  3GYO A;  4K17 A;  2N0Y A;  2M38 A;  4F7H A;  4HAW B;  2DYQ A;  3AJ4 A;  2H7E A;  3P6A A;  4D6W A;  4WJ7 A;  2QKM A;  1B55 A;  2CAY A;  5I2S A;  5DH9 B;  1FGZ A;  2H7D A;  1FHO A;  1MI1 A;  3PVL A;  3B77 A;  4DXA B;  3TFM A;  1UNP A;  2KUQ A;  1WGU A;  1NTV A;  1DBH A;  3PZD A;  2RGN B;  1EAZ A;  1TXD A;  2MFQ A;  2LOZ A;  5J3Y A;  1UNQ A;  2ELA A;  2KGX B;  4GZU A;  3BIN A;  3QBV B;  2Z0O A;  2RVB B;  2D9X A;  2DLW A;  1RJ2 A;  3PG7 A;  2JP2 A;  4GNK B;  3TCA A;  5JLJ B;  1WI1 A;  2V76 A;  4KHB A;  3HSA A;  3SYX A;  3SO6 A;  1MK9 B;  2ELB A;  1UEF A;  5JP4 A;  5KCV A;  5C5B A;  2MWN B;  1XCG A;  1OQN A;  1V5P A;  5D3V A;  4KHA A;  3TVV A;  2Q13 A;  3QWM A;  1EF1 A;  1Z87 A;  2GUM A;  5JHH A;  4YL8 A;  1XX0 A;  2LYD A;  4TKN A;  5HE1 A;  3FVC A;  1GC6 A;  1H10 A;  1U2B A;  1KZ7 A;  1XKE A;  3PEG A;  1M7E A;  3WYF B;  2DHJ A;  5L81 A;  1J19 A;  3ML4 A;  4HHV A;  3U8Z A;  3KZ1 A;  5C16 A;  5C79 A;  2W2X D;  3HW2 B;  4F7G A;  4F7U P;  3NWA A;  3ZVR A;  3ZDT A;  1FOE A;  2LKO A;  2Y8G A;  3NWF A;  3WA0 A;  2MKR A;  5M4Y B;  4DIX A;  4EMO A;  2YSZ A;  3SV1 A;  2DX5 A;  1V5M A;  4BBK A;  1LW3 A;  3M1I B;  4P7I A;  1GC7 A;  4ZRK A;  5HE2 A;  3NWD A;  4QJ4 B;  2K00 A;  3DXE A;  5KQ1 A;  2G35 A;  4K2O A;  1WJ1 A;  3PVW A;  1W1H A;  2W2W A;  1M7R A;  4HB4 B;  2X18 A;  3O96 A;  1BTK A;  3NSU A;  5CLL B;  1PMS A;  4GMV A;  4PQ0 A;  3FM8 C;  4C0A A;  2FJL A;  2Y7B A;  1U5E A;  1V61 A;  1MK7 B;  2I1K A;  1DDW A;  1ZC4 B;  1MPH A;  2Z0P A;  1NU2 A;  2DN6 A;  3VIA A;  1UNR A;  4HAZ B;  2DHK A;  3X23 A;  3SUZ A;  3F5R A;  3HK0 A;  2J59 M;  4HB0 B;  1DYN A;  2DFK A;  1P6S A;  1FAO A;  2EMS A;  2I1J A;  2KIE A;  2P0F A;  4A6F B;  1EGX A;  2GJY A;  5D3W A;  4QJ5 B;  2AEH A;  3D8E A;  4MK0 A;  2OQB A;  1PLS A;  4D0N B;  1FHX A;  2NZ8 B;  5C6R A;  1V89 A;  2YF0 A;  1ISN A;  1PFJ A;  2ROZ B;  4XWX A;  3F0W A;  2D9Z A;  2EMT A;  3KRW A;  4HAV B;  4A6F A;  1BWN A;  1N3H A;  2DKQ A;  1LB1 A;  1X11 A;  1ZSQ A;  2Y8F A;  5LOP B;  3G9W A;  1WJM A;  2W2X C;  2YRY A;  1U5G A;  2GS0 A;  3LJU X;  2NMB A;  3CXB B;  2ZPY A;  1MIX A;  4MT7 A;  1XD4 A;  2MDX A;  2YS1 A;  4ZRI A;  1WVH A;  2DHI A;  2YS3 A;  2RRF A;  2Z59 A;  4GXB A;  2RSG A;  4KHB B;  4GOU A;  4K2P A;  4QJ3 B;  1DRO A;  1E5W A;  3ULC A;  2IYB A;  4HAU B;  1H4R A;  2GCL A;  1BTN A;  2LUL A;  3ODX A;  2IFS A;  4B6H A;  1X1G A;  1QC6 A;  4YON A;  2GCJ A;  2M14 A;  3P7Z A;  5DI9 B;  4Y94 A;  4IOY X;  3QIJ A;  4EJN A;  2COC A;  3OHM B;  2UZR A;  5J3T A;  3AU5 A;  2YT0 A;  2P8V A;  1V88 A;  2COF A;  2YS5 A;  2CRF A;  4CYE A;  3KSY A;  1NTY A;  1WGQ A;  5KQ4 A;  3UZT A;  1OMW A;  4HAX B;  2DA0 A;  1AQC A;  2VSZ A;  3KY9 A;  4OSN A;  5HE3 A;  2CY5 A;  4HDQ A;  1FGY A;  1TQZ A;  3A8Q A;  2FJU B;  2I5C A;  4H8S A;  1K5G B;  3U7D A;  2L2I A;  2DYN A;  2D9Y A;  2DKP A;  4K81 A;  2D4Q A;  1ZVR A;  2R2Y A;  2D11 A;  4GMX B;  2UZS A;  1W1D A;  1U5D A;  4Z2M B;  5J3Q A;  1X1F A;  4QXA B;  4KAX B;  4L6E A;  2KCJ A;  2OTX A;  4KHO A;  1ZYI A;  4IAP A;  2NBV A;  4HDO A;  1MKE A;  2HTH B;  2YVC A;  2R0D A;  1TJ6 A;  3A98 B;  1BAK A;  4CSQ A;  2PZ1 A;  1U29 A;  3DXC A;  4GN1 A;  3AU4 A;  2K2J A;  5HE0 A;  1DDV A;  4DX9 0;  1MIZ B;  5D3X A;  2Z14 A;  2DTC A;  1KI1 B;  1MAI A;  5GOW B;  2KR0 A;  5I2M A;  1V5U A;  2ADZ A;  3MDB C;  1UPQ A;  2K2U A;  5DHA B;  1ZC3 B;  2KUP A;  3A8P A;  2RLO A;  1XR0 B;  2LOX A;  4CHM A;  4CHJ A;  4NY0 A;  2RUK B;  2RNR B;  3IVF A;  1I7A A;  3D8D A;  3OAN A;  4MY6 A;  2UVM A;  5EFX A;  2EC1 A;  3CIK A;  2COA A;  2ZKM X;  2HE7 A;  1OY2 A;  3ULB A;  1EVH A;  2L1C A;  5FI0 A;  3FSS A;  1K5D B;  2DX1 A;  1GG3 A;  3PVU A;  3RCP A;  1IRS A;  2J0M A;  3T06 A;  5JHG A;  4DBB A;  3U12 A;  1UPR A;  3HQC A;  3GYP A;  2Z0Q A;  1AWE A;  2E2X A;  1FHW A;  4IFS A;  2P0D A;  1KZG A;  5LON B;  5DHF B;  2D9W A;  2XQN M;  1Q67 A;  1QQG A;  3MPX A;  2YT1 A;  3BJI A;  1ZM0 A;  2EJ8 A;  3PSC A;  1J0W A; 
#chains in the Genus database with same CATH homology
 1Y19 B;  3VOQ A;  1DDM A;  1XOD A;  1Y5O A;  4A5K A;  1WG7 A;  5D27 A;  3TO1 A;  1RRP B;  1W1G A;  3KRX A;  1SHC A;  5C5B B;  1SGH A;  1U5F A;  4ZRJ A;  2R09 A;  2AL6 A;  4A6K A;  4HB3 B;  1NI2 A;  5FI1 A;  2VKI A;  2LG1 A;  4Z2N A;  4EKU A;  2BCJ A;  2I5F A;  1X86 A;  2ROV A;  2QKL A;  3PP2 A;  1I2H A;  4HAY B;  3V5W A;  4WSF A;  3TW1 A;  4KVG B;  3DXD A;  4GPT B;  4TYZ A;  2J0J A;  3N7C A;  1P5T A;  2D9V A;  4DX8 A;  5CLQ B;  5D3Y A;  2J0K A;  2D2Q A;  2P0H A;  4PNK A;  2D10 A;  2VRW B;  3ODW A;  1P3R A;  2COD A;  4HAT B;  5DIF B;  3FEH A;  3D8F A;  3ODO A;  4A6H A;  2N23 A;  4NSW A;  1FB8 A;  1X05 A;  3SNH A;  4HB2 B;  1U27 A;  4WVF B;  2CY4 A;  3GYO A;  4K17 A;  2N0Y A;  2M38 A;  4F7H A;  4HAW B;  2DYQ A;  3AJ4 A;  2H7E A;  3P6A A;  4WJ7 A;  2QKM A;  1B55 A;  2CAY A;  5DH9 B;  1FGZ A;  2H7D A;  1FHO A;  3PVL A;  4DXA B;  3TFM A;  1UNP A;  1WGU A;  1NTV A;  1DBH A;  3PZD A;  2RGN B;  1EAZ A;  1TXD A;  2MFQ A;  2LOZ A;  5J3Y A;  1UNQ A;  2ELA A;  2KGX B;  4GZU A;  3BIN A;  3QBV B;  2Z0O A;  2RVB B;  2D9X A;  2DLW A;  1RJ2 A;  3PG7 A;  2JP2 A;  3TCA A;  5JLJ B;  1WI1 A;  2V76 A;  3SYX A;  3SO6 A;  1MK9 B;  2ELB A;  1UEF A;  5JP4 A;  5KCV A;  5C5B A;  2MWN B;  1XCG A;  1OQN A;  1V5P A;  5D3V A;  4KHA A;  3TVV A;  2Q13 A;  3QWM A;  1EF1 A;  1Z87 A;  5JHH A;  4YL8 A;  1XX0 A;  2LYD A;  4TKN A;  5HE1 A;  1GC6 A;  1H10 A;  1U2B A;  1KZ7 A;  1XKE A;  3PEG A;  1M7E A;  3WYF B;  2DHJ A;  5L81 A;  1J19 A;  3ML4 A;  4HHV A;  3U8Z A;  3KZ1 A;  5C16 A;  5C79 A;  2W2X D;  3HW2 B;  4F7G A;  4F7U P;  3ZVR A;  3ZDT A;  1FOE A;  2LKO A;  2Y8G A;  3WA0 A;  2MKR A;  4EMO A;  2YSZ A;  3SV1 A;  2DX5 A;  1V5M A;  4BBK A;  1LW3 A;  3M1I B;  4P7I A;  1GC7 A;  4ZRK A;  5HE2 A;  2K00 A;  3DXE A;  5KQ1 A;  2G35 A;  4K2O A;  1WJ1 A;  3PVW A;  1W1H A;  2W2W A;  1M7R A;  4HB4 B;  2X18 A;  3O96 A;  1BTK A;  3NSU A;  5CLL B;  1PMS A;  4GMV A;  4PQ0 A;  3FM8 C;  4C0A A;  2FJL A;  2Y7B A;  1U5E A;  1V61 A;  1MK7 B;  2I1K A;  1DDW A;  1ZC4 B;  1MPH A;  2Z0P A;  1NU2 A;  2DN6 A;  3VIA A;  1UNR A;  4HAZ B;  2DHK A;  3X23 A;  3SUZ A;  3F5R A;  3HK0 A;  2J59 M;  4HB0 B;  1DYN A;  2DFK A;  1P6S A;  1FAO A;  2EMS A;  2I1J A;  2P0F A;  4A6F B;  1EGX A;  2GJY A;  5D3W A;  2AEH A;  3D8E A;  4MK0 A;  2OQB A;  1PLS A;  4D0N B;  1FHX A;  2NZ8 B;  5C6R A;  1V89 A;  2YF0 A;  1ISN A;  1PFJ A;  2ROZ B;  4XWX A;  3F0W A;  2D9Z A;  2EMT A;  3KRW A;  4HAV B;  4A6F A;  1BWN A;  1N3H A;  2DKQ A;  1LB1 A;  1X11 A;  1ZSQ A;  2Y8F A;  5LOP B;  3G9W A;  1WJM A;  2W2X C;  2YRY A;  1U5G A;  2GS0 A;  3LJU X;  2NMB A;  3CXB B;  2ZPY A;  1MIX A;  4MT7 A;  1XD4 A;  2MDX A;  2YS1 A;  4ZRI A;  1WVH A;  2DHI A;  2YS3 A;  4GXB A;  2RSG A;  4KHB B;  4K2P A;  1DRO A;  1E5W A;  3ULC A;  2IYB A;  4HAU B;  1H4R A;  2GCL A;  1BTN A;  2LUL A;  3ODX A;  2IFS A;  4B6H A;  1X1G A;  1QC6 A;  4YON A;  2GCJ A;  2M14 A;  3P7Z A;  5DI9 B;  4Y94 A;  4IOY X;  3QIJ A;  4EJN A;  2COC A;  2UZR A;  5J3T A;  3AU5 A;  2YT0 A;  2P8V A;  1V88 A;  2COF A;  2YS5 A;  2CRF A;  4CYE A;  3KSY A;  1NTY A;  1WGQ A;  5KQ4 A;  3UZT A;  1OMW A;  4HAX B;  2DA0 A;  1AQC A;  2VSZ A;  3KY9 A;  5HE3 A;  2CY5 A;  4HDQ A;  1FGY A;  1TQZ A;  3A8Q A;  2I5C A;  4H8S A;  1K5G B;  3U7D A;  2L2I A;  2DYN A;  2D9Y A;  4K81 A;  2DKP A;  2D4Q A;  1ZVR A;  4GMX B;  2D11 A;  2UZS A;  1W1D A;  1U5D A;  4Z2M B;  5J3Q A;  1X1F A;  4KAX B;  4L6E A;  2KCJ A;  2OTX A;  4KHO A;  4IAP A;  4HDO A;  1MKE A;  2HTH B;  2YVC A;  2R0D A;  1TJ6 A;  3A98 B;  1BAK A;  2PZ1 A;  1U29 A;  3DXC A;  4GN1 A;  3AU4 A;  2K2J A;  5HE0 A;  1DDV A;  4DX9 0;  1MIZ B;  5D3X A;  2DTC A;  1KI1 B;  1MAI A;  5GOW B;  1V5U A;  2ADZ A;  3MDB C;  1UPQ A;  2K2U A;  5DHA B;  1ZC3 B;  2KUP A;  3A8P A;  2RLO A;  1XR0 B;  2LOX A;  4CHM A;  4CHJ A;  4NY0 A;  2RUK B;  2RNR B;  3IVF A;  1I7A A;  3D8D A;  3OAN A;  4MY6 A;  2UVM A;  5EFX A;  2EC1 A;  3CIK A;  2COA A;  2HE7 A;  1OY2 A;  3ULB A;  1EVH A;  2L1C A;  5FI0 A;  3FSS A;  1K5D B;  2DX1 A;  1GG3 A;  3PVU A;  3RCP A;  1IRS A;  2J0M A;  3T06 A;  5JHG A;  4DBB A;  1UPR A;  3HQC A;  3GYP A;  2Z0Q A;  1AWE A;  2E2X A;  1FHW A;  4IFS A;  2P0D A;  1KZG A;  5LON B;  5DHF B;  2D9W A;  2XQN M;  1Q67 A;  1QQG A;  3MPX A;  2YT1 A;  3BJI A;  1ZM0 A;  2EJ8 A;  3PSC A;  1J0W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...