1TQZA

Solution structure of necap1 protein
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
133
structure length
133
Chain Sequence
MAAELEYESVLCVKPDVSVYRIPPRASNRGYRASDWKLDQPDWTGRLRITSKGKIAYIKLEDKVSGELFAQAPVEQYPGIAVETVTDSSRYFVIRIQDGTGRSAFIGIGFTDRGDAFDFNVSLQDHFKWVKQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of NECAP1 protein
rcsb
source organism Mus musculus
molecule tags Endocytosis/exocytosis
molecule keywords NECAP1
total genus 14
structure length 133
sequence length 133
ec nomenclature
pdb deposition date 2004-06-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 1tqzA01
4MK0A 3PP2A 1XODA 2K2UA 3TO1A 1U29A 1UNQA 2EMSA 4GXBA 2M38A 1MPHA 3AJ4A 2Z0PA 1ZM0A 3HK0A 3KZ1A 3PSCA 2DKQA 2HTHB 2YS5A 2D9XA 3ODXA 2I1JA 1DYNA 2CY4A 2GJYA 1I7AA 2NZ8B 4GN1A 5KQ1A 1GG3A 1Y5OA 2YSZA 1WI1A 1NU2A 3D8DA 4IAPA 5LONB 2AEHA 2D11A 2YT1A 2CODA 2Q13A 2YF0A 4GZUA 4KHOA 4Z2MB 4Z2NA 1MK9B 2RUKB 3KRXA 1DDVA 1N3HA 1AWEA 2J0JA 1FHXA 1ZC3B 1WGQA 1RJ2A 2ADZA 1KZ7A 4CHMA 2M14A 1GC7A 2YRYA 2DX5A 1V5MA 1MKEA 1DBHA 2D9YA 2P0HA 3KY9A 1WVHA 4HAZB 1BTNA 2VRWB 1V61A 2DHKA 5DHFB 5D27A 4F7GA 4K2OA 3QBVB 4A6FA 5HE3A 3QIJA 2FJLA 2I1KA 3BJIA 4ZRJA 4NY0A 4KHAA 1UNRA 2UZRA 5LOPB 4K17A 5FI0A 1MIZB 3SO6A 1XR0B 1U5DA 3G9WA 1IRSA 1MAIA 2CAYA 4HDQA 2X18A 3D8FA 1XKEA 3F0WA 3SYXA 2D2QA 2D10A 2H7EA 1EGXA 2RGNB 5EFXA 3PG7A 5CLLB 2PZ1A 2EMTA 4A5KA 2RLOA 1MIXA 2I5FA 3PVWA 4HATB 1QQGA 2MKRA 2W2XD 4K81A 2ROZB 1OQNA 2ZPYA 4HAWB 4H8SA 4F7HA 5C5BA 2DHJA 1Q67A 1P3RA 1FAOA 2GS0A 4HAXB 1LB1A 1KZGA 4TKNA 3ZDTA 3SUZA 4HAYB 2EJ8A 1RRPB 2EC1A 1DDMA 1W1GA 4ZRIA 3SV1A 1SHCA 4KAXB 1UNPA 3HW2B 1W1HA 1OY2A 5JHGA 5JLJB 2IYBA 1K5GB 1XX0A 4HAUB 2E2XA 3CIKA 4YL8A 2LOXA 1FGYA 1ZC4B 3ODWA 1XCGA 2Y7BA 2YT0A 1BTKA 2BCJA 4L6EA 1TQZA 2DLWA 2KCJA 1DROA 2VSZA 1NTVA 3SNHA 3O96A 1J19A 3D8EA 2LYDA 1V89A 4GPTB 2GCJA 2N23A 2UVMA 3PZDA 2GCLA 1X05A 2DTCA 5KCVA 1FHOA 3FM8C 2HE7A 2YS1A 2NMBA 3T06A 1ZVRA 1U27A 4IOYX 4C0AA 5HE2A 1U5EA 3ZVRA 1WJMA 2ROVA 2V76A 1WGUA 1Y19B 4HHVA 1BWNA 4A6FB 3LJUX 1NTYA 2D9WA 5DHAB 3WYFB 4EKUA 1SGHA 1V88A 3PVLA 1MK7B 3MPXA 1I2HA 3GYPA 1Z87A 3DXEA 3FEHA 3NSUA 5JP4A 3ML4A 4EJNA 3A8PA 4HB0B 1NI2A 1EVHA 4GMVA 3WA0A 3PVUA 4DXAB 1QC6A 1AQCA 3PEGA 4YONA 5DIFB 2XQNM 1B55A 3HQCA 1WG7A 3VIAA 2Z0QA 2Y8FA 2L1CA 2ELBA 3TFMA 4NSWA 2RNRB 5DH9B 5D3XA 2L2IA 3U7DA 1X11A 1OMWA 3ODOA 5C6RA 5KQ4A 2J59M 4KVGB 1X1GA 3N7CA 4A6HA 4CYEA 4P7IA 1V5PA 5J3QA 1UPQA 1M7EA 2AL6A 2P0DA 2DKPA 2COAA 2VKIA 5J3YA 1FB8A 3ULBA 2COFA 1U5FA 2N0YA 1EF1A 2YS3A 4WVFB 4D0NB 5DI9B 5C79A 1X86A 1FOEA 2J0KA 3KRWA 4WSFA 4DX8A 3FSSA 2LKOA 2J0MA 3OANA 5L81A 4DX90 1UEFA 3U8ZA 4WJ7A 2KGXB 3X23A 2CRFA 2P8VA 2DYNA 2QKLA 3A98B 2RVBB 2Z0OA 3QWMA 3ULCA 2DYQA 2W2XC 2DHIA 1EAZA 3M1IB 3RCPA 1M7RA 3IVFA 4ZRKA 3UZTA 1TJ6A 2ELAA 1UPRA 2DFKA 4BBKA 2CY5A 4F7UP 1LW3A 1W1DA 2RSGA 2H7DA 4PQ0A 4PNKA 1J0WA 3GYOA 1GC6A 2G35A 1DDWA 2K2JA 4Y94A 1K5DB 1XD4A 5D3VA 1FHWA 1PFJA 2P0FA 2MFQA 4K2PA 1TXDA 2DA0A 4HAVB 3DXDA 3VOQA 2D9VA 1P5TA 5C16A 2QKMA 3A8QA 4MT7A 1BAKA 2OQBA 5FI1A 4KHBB 5J3TA 4GMXB 4HB2B 4DBBA 1FGZA 4EMOA 2D4QA 5JHHA 3F5RA 3AU4A 2I5CA 5C5BB 2K00A 1E5WA 5HE0A 2R0DA 2DN6A 5GOWB 2IFSA 3V5WA 4HB3B 1U2BA 3TW1A 2OTXA 4MY6A 1KI1B 2DX1A 2KUPA 2LOZA 2MDXA 2LULA 2UZSA 3P6AA 1X1FA 4HB4B 4CHJA 2JP2A 4B6HA 1ZSQA 2R09A 3KSYA 4XWXA 4IFSA 3AU5A 3TCAA 1PMSA 4TYZA 5D3YA 2MWNB 3TVVA 3CXBB 1H4RA 2Y8GA 1H10A 1ISNA 3MDBC 3P7ZA 2D9ZA 1WJ1A 1U5GA 1V5UA 4A6KA 3DXCA 5HE1A 2COCA 2LG1A 5D3WA 2W2WA 1PLSA 4HDOA 5CLQB 3BINA 1P6SA 2YVCA
chains in the Genus database with same CATH superfamily
1ZYIA 4MK0A 3PP2A 1XODA 2K2UA 2ZKMX 3TO1A 1U29A 1UNQA 2EMSA 4GXBA 2M38A 1MPHA 3AJ4A 2Z0PA 1ZM0A 3HK0A 3KZ1A 3PSCA 2DKQA 2HTHB 2YS5A 2D9XA 3ODXA 2I1JA 1DYNA 2CY4A 2GJYA 3NWAA 1I7AA 2NZ8B 4GN1A 5KQ1A 1GG3A 1Y5OA 2YSZA 4GOUA 1WI1A 1NU2A 3D8DA 4IAPA 5LONB 2AEHA 4QXAB 2D11A 2YT1A 2CODA 2Q13A 2YF0A 4GZUA 4KHOA 4Z2MB 4Z2NA 1MK9B 2RUKB 3KRXA 1DDVA 1N3HA 1AWEA 2J0JA 1FHXA 1ZC3B 1WGQA 3HSAA 1RJ2A 2ADZA 1KZ7A 2KIEA 4CHMA 2M14A 1GC7A 2YRYA 2DX5A 1V5MA 1MKEA 2NBVA 1DBHA 2D9YA 2P0HA 3KY9A 1WVHA 4HAZB 1BTNA 2VRWB 1V61A 2DHKA 5DHFB 5D27A 4F7GA 4K2OA 3QBVB 4A6FA 5HE3A 3QIJA 2FJLA 2I1KA 3BJIA 2FJUB 4ZRJA 4NY0A 4KHAA 1UNRA 2UZRA 5LOPB 4K17A 5FI0A 1MIZB 3SO6A 1XR0B 1U5DA 3G9WA 1IRSA 1MAIA 2CAYA 4HDQA 2X18A 3D8FA 1XKEA 3F0WA 3SYXA 2D2QA 2D10A 2H7EA 1EGXA 2RGNB 5EFXA 3PG7A 5CLLB 2PZ1A 2EMTA 4A5KA 3OHMB 2RLOA 1MIXA 2I5FA 3PVWA 4HATB 1QQGA 2MKRA 2W2XD 4K81A 2ROZB 3NWDA 3A58A 1OQNA 2ZPYA 4HAWB 4H8SA 4QJ3B 4F7HA 5C5BA 2DHJA 1Q67A 1P3RA 1FAOA 2GS0A 4HAXB 4D6WA 1LB1A 1KZGA 4TKNA 3ZDTA 5LG4B 3SUZA 4HAYB 2EJ8A 2Z4DA 1RRPB 2EC1A 1DDMA 1W1GA 4ZRIA 3SV1A 1SHCA 4KAXB 1UNPA 3HW2B 1W1HA 1OY2A 5JHGA 5JLJB 2IYBA 1K5GB 1XX0A 4HAUB 2E2XA 3CIKA 4YL8A 2LOXA 1FGYA 1ZC4B 3ODWA 1XCGA 2Y7BA 2YT0A 1BTKA 2BCJA 2KIGA 4L6EA 1TQZA 2DLWA 2KCJA 1DROA 2VSZA 1NTVA 3SNHA 3O96A 1J19A 3D8EA 3HIEA 3NWFA 2LYDA 1V89A 4GPTB 2GCJA 2N23A 2UVMA 3PZDA 2GCLA 1X05A 2DTCA 4L1RA 5KCVA 1FHOA 2K8EA 3FM8C 2HE7A 2YS1A 2NMBA 3T06A 1ZVRA 1U27A 4IOYX 4C0AA 5HE2A 1U5EA 3ZVRA 1WJMA 2ROVA 2V76A 1WGUA 1Y19B 4DIXA 4HHVA 1BWNA 4A6FB 3LJUX 1NTYA 2D9WA 2YT2A 5I2MA 5DHAB 3WYFB 4EKUA 1SGHA 1V88A 3PVLA 1MK7B 3MPXA 1I2HA 3GYPA 1Z87A 2R2YA 3DXEA 3FEHA 3NW8A 3NSUA 3B77A 5JP4A 3ML4A 4EJNA 3A8PA 4HB0B 1NI2A 1EVHA 4GMVA 3WA0A 4GNKB 3PVUA 4DXAB 5I2SA 1QC6A 3FVCA 1AQCA 3PEGA 4YONA 5DIFB 2XQNM 1B55A 3HQCA 3U12A 1WG7A 3VIAA 2Z0QA 2Y8FA 2L1CA 2ELBA 3TFMA 4NSWA 2RNRB 5DH9B 5D3XA 2L2IA 3U7DA 1X11A 1OMWA 3ODOA 5C6RA 5KQ4A 2J59M 4KVGB 3N7CA 1X1GA 4A6HA 4CYEA 4QJ4B 5IRSA 4P7IA 1V5PA 4CSQA 5J3QA 1UPQA 1M7EA 2AL6A 2P0DA 2DKPA 2COAA 2VKIA 5J3YA 1FB8A 3ULBA 2COFA 1U5FA 2N0YA 1EF1A 2YS3A 4WVFB 4D0NB 5DI9B 5C79A 1X86A 1FOEA 2J0KA 3KRWA 4WSFA 4DX8A 2RRFA 4KHBA 3FSSA 2LKOA 2J0MA 3OANA 5L81A 4DX90 1UEFA 3U8ZA 4WJ7A 2KGXB 3X23A 2CRFA 2P8VA 2DYNA 2QKLA 3A98B 2RVBB 2Z0OA 3QWMA 3ULCA 2DYQA 2W2XC 2DHIA 1EAZA 3M1IB 2GUMA 3RCPA 1M7RA 3IVFA 4ZRKA 3UZTA 1TJ6A 2ELAA 1UPRA 2DFKA 4BBKA 2CY5A 4F7UP 1LW3A 1MI1A 1W1DA 2RSGA 2H7DA 4PQ0A 2Z59A 1J0WA 4PNKA 5M4YB 3GYOA 1GC6A 2G35A 1DDWA 3DCXA 2K2JA 4Y94A 1K5DB 1XD4A 5D3VA 1FHWA 1PFJA 2P0FA 2MFQA 4K2PA 1TXDA 2DA0A 4HAVB 2Z14A 3DXDA 3VOQA 2D9VA 1T77A 1P5TA 4OSNA 5C16A 2QKMA 3A8QA 4MT7A 1BAKA 2OQBA 5FI1A 4KHBB 5J3TA 4GMXB 4HB2B 4DBBA 1FGZA 4EMOA 2D4QA 5JHHA 3F5RA 3AU4A 2I5CA 5C5BB 2K00A 1E5WA 5HE0A 2R0DA 2DN6A 2K49A 2Z13A 2IFSA 5GOWB 3V5WA 4HB3B 1U2BA 3TW1A 2KUQA 2OTXA 4MY6A 1KI1B 2DX1A 2KR0A 2KUPA 2LOZA 2MDXA 2LULA 2UZSA 3P6AA 1X1FA 4HB4B 4CHJA 4QJ5B 2JP2A 4B6HA 1ZSQA 2R09A 3KSYA 4XWXA 4IFSA 3AU5A 3TCAA 1PMSA 4TYZA 5D3YA 2MWNB 3TVVA 3CXBB 1H4RA 4OT1A 2Y8GA 1H10A 1ISNA 3MDBC 3P7ZA 2D9ZA 1WJ1A 1U5GA 1V5UA 4A6KA 3DXCA 5HE1A 2COCA 2LG1A 5D3WA 4HSIA 2W2WA 1PLSA 4HDOA 5CLQB 3BINA 1P6SA 2YVCA
chains in the Genus database with same CATH topology
4MK0A 3PP2A 1XODA 2K2UA 3TO1A 1U29A 1UNQA 2EMSA 4GXBA 2M38A 1MPHA 3AJ4A 2Z0PA 1ZM0A 3HK0A 3KZ1A 3PSCA 2DKQA 2HTHB 2YS5A 2D9XA 3ODXA 2I1JA 1DYNA 2CY4A 2GJYA 1I7AA 2NZ8B 4GN1A 5KQ1A 1GG3A 1Y5OA 2YSZA 1WI1A 1NU2A 3D8DA 4IAPA 5LONB 2AEHA 2D11A 2YT1A 2CODA 2Q13A 2YF0A 4GZUA 4KHOA 4Z2MB 4Z2NA 1MK9B 2RUKB 3KRXA 1DDVA 1N3HA 1AWEA 2J0JA 1FHXA 1ZC3B 1WGQA 1RJ2A 2ADZA 1KZ7A 4CHMA 2M14A 1GC7A 2YRYA 2DX5A 1V5MA 1MKEA 1DBHA 2D9YA 2P0HA 3KY9A 1WVHA 4HAZB 1BTNA 2VRWB 1V61A 2DHKA 5DHFB 5D27A 4F7GA 4K2OA 3QBVB 4A6FA 5HE3A 3QIJA 2FJLA 2I1KA 3BJIA 4ZRJA 4NY0A 4KHAA 1UNRA 2UZRA 5LOPB 4K17A 5FI0A 1MIZB 3SO6A 1XR0B 1U5DA 3G9WA 1IRSA 1MAIA 2CAYA 4HDQA 2X18A 3D8FA 1XKEA 3F0WA 3SYXA 2D2QA 2D10A 2H7EA 1EGXA 2RGNB 5EFXA 3PG7A 5CLLB 2PZ1A 2EMTA 4A5KA 2RLOA 1MIXA 2I5FA 3PVWA 4HATB 1QQGA 2MKRA 2W2XD 4K81A 2ROZB 1OQNA 2ZPYA 4HAWB 4H8SA 4F7HA 5C5BA 2DHJA 1Q67A 1P3RA 1FAOA 2GS0A 4HAXB 1LB1A 1KZGA 4TKNA 3ZDTA 3SUZA 4HAYB 2EJ8A 1RRPB 2EC1A 1DDMA 1W1GA 4ZRIA 3SV1A 1SHCA 4KAXB 1UNPA 3HW2B 1W1HA 1OY2A 5JHGA 5JLJB 2IYBA 1K5GB 1XX0A 4HAUB 2E2XA 3CIKA 4YL8A 2LOXA 1FGYA 1ZC4B 3ODWA 1XCGA 2Y7BA 2YT0A 1BTKA 2BCJA 4L6EA 1TQZA 2DLWA 2KCJA 1DROA 2VSZA 1NTVA 3SNHA 3O96A 1J19A 3D8EA 2LYDA 1V89A 4GPTB 2GCJA 2N23A 2UVMA 3PZDA 2GCLA 1X05A 2DTCA 5KCVA 1FHOA 3FM8C 2HE7A 2YS1A 2NMBA 3T06A 1ZVRA 1U27A 4IOYX 4C0AA 5HE2A 1U5EA 3ZVRA 1WJMA 2ROVA 2V76A 1WGUA 1Y19B 4HHVA 1BWNA 4A6FB 3LJUX 1NTYA 2D9WA 5DHAB 3WYFB 4EKUA 1SGHA 1V88A 3PVLA 1MK7B 3MPXA 1I2HA 3GYPA 1Z87A 3DXEA 3FEHA 3NSUA 5JP4A 3ML4A 4EJNA 3A8PA 4HB0B 1NI2A 1EVHA 4GMVA 3WA0A 3PVUA 4DXAB 1QC6A 1AQCA 3PEGA 4YONA 5DIFB 2XQNM 1B55A 3HQCA 1WG7A 3VIAA 2Z0QA 2Y8FA 2L1CA 2ELBA 3TFMA 4NSWA 2RNRB 5DH9B 5D3XA 2L2IA 3U7DA 1X11A 1OMWA 3ODOA 5C6RA 5KQ4A 2J59M 4KVGB 1X1GA 3N7CA 4A6HA 4CYEA 4P7IA 1V5PA 5J3QA 1UPQA 1M7EA 2AL6A 2P0DA 2DKPA 2COAA 2VKIA 5J3YA 1FB8A 3ULBA 2COFA 1U5FA 2N0YA 1EF1A 2YS3A 4WVFB 4D0NB 5DI9B 5C79A 1X86A 1FOEA 2J0KA 3KRWA 4WSFA 4DX8A 3FSSA 2LKOA 2J0MA 3OANA 5L81A 4DX90 1UEFA 3U8ZA 4WJ7A 2KGXB 3X23A 2CRFA 2P8VA 2DYNA 2QKLA 3A98B 2RVBB 2Z0OA 3QWMA 3ULCA 2DYQA 2W2XC 2DHIA 1EAZA 3M1IB 3RCPA 1M7RA 3IVFA 4ZRKA 3UZTA 1TJ6A 2ELAA 1UPRA 2DFKA 4BBKA 2CY5A 4F7UP 1LW3A 1W1DA 2RSGA 2H7DA 4PQ0A 4PNKA 1J0WA 3GYOA 1GC6A 2G35A 1DDWA 2K2JA 4Y94A 1K5DB 1XD4A 5D3VA 1FHWA 1PFJA 2P0FA 2MFQA 4K2PA 1TXDA 2DA0A 4HAVB 3DXDA 3VOQA 2D9VA 1P5TA 5C16A 2QKMA 3A8QA 4MT7A 1BAKA 2OQBA 5FI1A 4KHBB 5J3TA 4GMXB 4HB2B 4DBBA 1FGZA 4EMOA 2D4QA 5JHHA 3F5RA 3AU4A 2I5CA 5C5BB 2K00A 1E5WA 5HE0A 2R0DA 2DN6A 5GOWB 2IFSA 3V5WA 4HB3B 1U2BA 3TW1A 2OTXA 4MY6A 1KI1B 2DX1A 2KUPA 2LOZA 2MDXA 2LULA 2UZSA 3P6AA 1X1FA 4HB4B 4CHJA 2JP2A 4B6HA 1ZSQA 2R09A 3KSYA 4XWXA 4IFSA 3AU5A 3TCAA 1PMSA 4TYZA 5D3YA 2MWNB 3TVVA 3CXBB 1H4RA 2Y8GA 1H10A 1ISNA 3MDBC 3P7ZA 2D9ZA 1WJ1A 1U5GA 1V5UA 4A6KA 3DXCA 5HE1A 2COCA 2LG1A 5D3WA 2W2WA 1PLSA 4HDOA 5CLQB 3BINA 1P6SA 2YVCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MK0 A;  3PP2 A;  1XOD A;  2K2U A;  3TO1 A;  1U29 A;  1UNQ A;  2EMS A;  4GXB A;  2M38 A;  1MPH A;  3AJ4 A;  2Z0P A;  1ZM0 A;  3HK0 A;  3KZ1 A;  3PSC A;  2DKQ A;  2HTH B;  2YS5 A;  2D9X A;  3ODX A;  2I1J A;  1DYN A;  2CY4 A;  2GJY A;  1I7A A;  2NZ8 B;  4GN1 A;  5KQ1 A;  1GG3 A;  1Y5O A;  2YSZ A;  1WI1 A;  1NU2 A;  3D8D A;  4IAP A;  5LON B;  2AEH A;  2D11 A;  2YT1 A;  2COD A;  2Q13 A;  2YF0 A;  4GZU A;  4KHO A;  4Z2M B;  4Z2N A;  1MK9 B;  2RUK B;  3KRX A;  1DDV A;  1N3H A;  1AWE A;  2J0J A;  1FHX A;  1ZC3 B;  1WGQ A;  1RJ2 A;  2ADZ A;  1KZ7 A;  4CHM A;  2M14 A;  1GC7 A;  2YRY A;  2DX5 A;  1V5M A;  1MKE A;  1DBH A;  2D9Y A;  2P0H A;  3KY9 A;  1WVH A;  4HAZ B;  1BTN A;  2VRW B;  1V61 A;  2DHK A;  5DHF B;  5D27 A;  4F7G A;  4K2O A;  3QBV B;  4A6F A;  5HE3 A;  3QIJ A;  2FJL A;  2I1K A;  3BJI A;  4ZRJ A;  4NY0 A;  4KHA A;  1UNR A;  2UZR A;  5LOP B;  4K17 A;  5FI0 A;  1MIZ B;  3SO6 A;  1XR0 B;  1U5D A;  3G9W A;  1IRS A;  1MAI A;  2CAY A;  4HDQ A;  2X18 A;  3D8F A;  1XKE A;  3F0W A;  3SYX A;  2D2Q A;  2D10 A;  2H7E A;  1EGX A;  2RGN B;  5EFX A;  3PG7 A;  5CLL B;  2PZ1 A;  2EMT A;  4A5K A;  2RLO A;  1MIX A;  2I5F A;  3PVW A;  4HAT B;  1QQG A;  2MKR A;  2W2X D;  4K81 A;  2ROZ B;  1OQN A;  2ZPY A;  4HAW B;  4H8S A;  4F7H A;  5C5B A;  2DHJ A;  1Q67 A;  1P3R A;  1FAO A;  2GS0 A;  4HAX B;  1LB1 A;  1KZG A;  4TKN A;  3ZDT A;  3SUZ A;  4HAY B;  2EJ8 A;  1RRP B;  2EC1 A;  1DDM A;  1W1G A;  4ZRI A;  3SV1 A;  1SHC A;  4KAX B;  1UNP A;  3HW2 B;  1W1H A;  1OY2 A;  5JHG A;  5JLJ B;  2IYB A;  1K5G B;  1XX0 A;  4HAU B;  2E2X A;  3CIK A;  4YL8 A;  2LOX A;  1FGY A;  1ZC4 B;  3ODW A;  1XCG A;  2Y7B A;  2YT0 A;  1BTK A;  2BCJ A;  4L6E A;  1TQZ A;  2DLW A;  2KCJ A;  1DRO A;  2VSZ A;  1NTV A;  3SNH A;  3O96 A;  1J19 A;  3D8E A;  2LYD A;  1V89 A;  4GPT B;  2GCJ A;  2N23 A;  2UVM A;  3PZD A;  2GCL A;  1X05 A;  2DTC A;  5KCV A;  1FHO A;  3FM8 C;  2HE7 A;  2YS1 A;  2NMB A;  3T06 A;  1ZVR A;  1U27 A;  4IOY X;  4C0A A;  5HE2 A;  1U5E A;  3ZVR A;  1WJM A;  2ROV A;  2V76 A;  1WGU A;  1Y19 B;  4HHV A;  1BWN A;  4A6F B;  3LJU X;  1NTY A;  2D9W A;  5DHA B;  3WYF B;  4EKU A;  1SGH A;  1V88 A;  3PVL A;  1MK7 B;  3MPX A;  1I2H A;  3GYP A;  1Z87 A;  3DXE A;  3FEH A;  3NSU A;  5JP4 A;  3ML4 A;  4EJN A;  3A8P A;  4HB0 B;  1NI2 A;  1EVH A;  4GMV A;  3WA0 A;  3PVU A;  4DXA B;  1QC6 A;  1AQC A;  3PEG A;  4YON A;  5DIF B;  2XQN M;  1B55 A;  3HQC A;  1WG7 A;  3VIA A;  2Z0Q A;  2Y8F A;  2L1C A;  2ELB A;  3TFM A;  4NSW A;  2RNR B;  5DH9 B;  5D3X A;  2L2I A;  3U7D A;  1X11 A;  1OMW A;  3ODO A;  5C6R A;  5KQ4 A;  2J59 M;  4KVG B;  1X1G A;  3N7C A;  4A6H A;  4CYE A;  4P7I A;  1V5P A;  5J3Q A;  1UPQ A;  1M7E A;  2AL6 A;  2P0D A;  2DKP A;  2COA A;  2VKI A;  5J3Y A;  1FB8 A;  3ULB A;  2COF A;  1U5F A;  2N0Y A;  1EF1 A;  2YS3 A;  4WVF B;  4D0N B;  5DI9 B;  5C79 A;  1X86 A;  1FOE A;  2J0K A;  3KRW A;  4WSF A;  4DX8 A;  3FSS A;  2LKO A;  2J0M A;  3OAN A;  5L81 A;  4DX9 0;  1UEF A;  3U8Z A;  4WJ7 A;  2KGX B;  3X23 A;  2CRF A;  2P8V A;  2DYN A;  2QKL A;  3A98 B;  2RVB B;  2Z0O A;  3QWM A;  3ULC A;  2DYQ A;  2W2X C;  2DHI A;  1EAZ A;  3M1I B;  3RCP A;  1M7R A;  3IVF A;  4ZRK A;  3UZT A;  1TJ6 A;  2ELA A;  1UPR A;  2DFK A;  4BBK A;  2CY5 A;  4F7U P;  1LW3 A;  1W1D A;  2RSG A;  2H7D A;  4PQ0 A;  4PNK A;  1J0W A;  3GYO A;  1GC6 A;  2G35 A;  1DDW A;  2K2J A;  4Y94 A;  1K5D B;  1XD4 A;  5D3V A;  1FHW A;  1PFJ A;  2P0F A;  2MFQ A;  4K2P A;  1TXD A;  2DA0 A;  4HAV B;  3DXD A;  3VOQ A;  2D9V A;  1P5T A;  5C16 A;  2QKM A;  3A8Q A;  4MT7 A;  1BAK A;  2OQB A;  5FI1 A;  4KHB B;  5J3T A;  4GMX B;  4HB2 B;  4DBB A;  1FGZ A;  4EMO A;  2D4Q A;  5JHH A;  3F5R A;  3AU4 A;  2I5C A;  5C5B B;  2K00 A;  1E5W A;  5HE0 A;  2R0D A;  2DN6 A;  5GOW B;  2IFS A;  3V5W A;  4HB3 B;  1U2B A;  3TW1 A;  2OTX A;  4MY6 A;  1KI1 B;  2DX1 A;  2KUP A;  2LOZ A;  2MDX A;  2LUL A;  2UZS A;  3P6A A;  1X1F A;  4HB4 B;  4CHJ A;  2JP2 A;  4B6H A;  1ZSQ A;  2R09 A;  3KSY A;  4XWX A;  4IFS A;  3AU5 A;  3TCA A;  1PMS A;  4TYZ A;  5D3Y A;  2MWN B;  3TVV A;  3CXB B;  1H4R A;  2Y8G A;  1H10 A;  1ISN A;  3MDB C;  3P7Z A;  2D9Z A;  1WJ1 A;  1U5G A;  1V5U A;  4A6K A;  3DXC A;  5HE1 A;  2COC A;  2LG1 A;  5D3W A;  2W2W A;  1PLS A;  4HDO A;  5CLQ B;  3BIN A;  1P6S A;  2YVC A; 
#chains in the Genus database with same CATH topology
 1ZYI A;  4MK0 A;  3PP2 A;  1XOD A;  2K2U A;  2ZKM X;  3TO1 A;  1U29 A;  1UNQ A;  2EMS A;  4GXB A;  2M38 A;  1MPH A;  3AJ4 A;  2Z0P A;  1ZM0 A;  3HK0 A;  3KZ1 A;  3PSC A;  2DKQ A;  2HTH B;  2YS5 A;  2D9X A;  3ODX A;  2I1J A;  1DYN A;  2CY4 A;  2GJY A;  3NWA A;  1I7A A;  2NZ8 B;  4GN1 A;  5KQ1 A;  1GG3 A;  1Y5O A;  2YSZ A;  4GOU A;  1WI1 A;  1NU2 A;  3D8D A;  4IAP A;  5LON B;  2AEH A;  4QXA B;  2D11 A;  2YT1 A;  2COD A;  2Q13 A;  2YF0 A;  4GZU A;  4KHO A;  4Z2M B;  4Z2N A;  1MK9 B;  2RUK B;  3KRX A;  1DDV A;  1N3H A;  1AWE A;  2J0J A;  1FHX A;  1ZC3 B;  1WGQ A;  3HSA A;  1RJ2 A;  2ADZ A;  1KZ7 A;  2KIE A;  4CHM A;  2M14 A;  1GC7 A;  2YRY A;  2DX5 A;  1V5M A;  1MKE A;  2NBV A;  1DBH A;  2D9Y A;  2P0H A;  3KY9 A;  1WVH A;  4HAZ B;  1BTN A;  2VRW B;  1V61 A;  2DHK A;  5DHF B;  5D27 A;  4F7G A;  4K2O A;  3QBV B;  4A6F A;  5HE3 A;  3QIJ A;  2FJL A;  2I1K A;  3BJI A;  2FJU B;  4ZRJ A;  4NY0 A;  4KHA A;  1UNR A;  2UZR A;  5LOP B;  4K17 A;  5FI0 A;  1MIZ B;  3SO6 A;  1XR0 B;  1U5D A;  3G9W A;  1IRS A;  1MAI A;  2CAY A;  4HDQ A;  2X18 A;  3D8F A;  1XKE A;  3F0W A;  3SYX A;  2D2Q A;  2D10 A;  2H7E A;  1EGX A;  2RGN B;  5EFX A;  3PG7 A;  5CLL B;  2PZ1 A;  2EMT A;  4A5K A;  3OHM B;  2RLO A;  1MIX A;  2I5F A;  3PVW A;  4HAT B;  1QQG A;  2MKR A;  2W2X D;  4K81 A;  2ROZ B;  3NWD A;  3A58 A;  1OQN A;  2ZPY A;  4HAW B;  4H8S A;  4QJ3 B;  4F7H A;  5C5B A;  2DHJ A;  1Q67 A;  1P3R A;  1FAO A;  2GS0 A;  4HAX B;  4D6W A;  1LB1 A;  1KZG A;  4TKN A;  3ZDT A;  5LG4 B;  3SUZ A;  4HAY B;  2EJ8 A;  2Z4D A;  1RRP B;  2EC1 A;  1DDM A;  1W1G A;  4ZRI A;  3SV1 A;  1SHC A;  4KAX B;  1UNP A;  3HW2 B;  1W1H A;  1OY2 A;  5JHG A;  5JLJ B;  2IYB A;  1K5G B;  1XX0 A;  4HAU B;  2E2X A;  3CIK A;  4YL8 A;  2LOX A;  1FGY A;  1ZC4 B;  3ODW A;  1XCG A;  2Y7B A;  2YT0 A;  1BTK A;  2BCJ A;  2KIG A;  4L6E A;  1TQZ A;  2DLW A;  2KCJ A;  1DRO A;  2VSZ A;  1NTV A;  3SNH A;  3O96 A;  1J19 A;  3D8E A;  3HIE A;  3NWF A;  2LYD A;  1V89 A;  4GPT B;  2GCJ A;  2N23 A;  2UVM A;  3PZD A;  2GCL A;  1X05 A;  2DTC A;  4L1R A;  5KCV A;  1FHO A;  2K8E A;  3FM8 C;  2HE7 A;  2YS1 A;  2NMB A;  3T06 A;  1ZVR A;  1U27 A;  4IOY X;  4C0A A;  5HE2 A;  1U5E A;  3ZVR A;  1WJM A;  2ROV A;  2V76 A;  1WGU A;  1Y19 B;  4DIX A;  4HHV A;  1BWN A;  4A6F B;  3LJU X;  1NTY A;  2D9W A;  2YT2 A;  5I2M A;  5DHA B;  3WYF B;  4EKU A;  1SGH A;  1V88 A;  3PVL A;  1MK7 B;  3MPX A;  1I2H A;  3GYP A;  1Z87 A;  2R2Y A;  3DXE A;  3FEH A;  3NW8 A;  3NSU A;  3B77 A;  5JP4 A;  3ML4 A;  4EJN A;  3A8P A;  4HB0 B;  1NI2 A;  1EVH A;  4GMV A;  3WA0 A;  4GNK B;  3PVU A;  4DXA B;  5I2S A;  1QC6 A;  3FVC A;  1AQC A;  3PEG A;  4YON A;  5DIF B;  2XQN M;  1B55 A;  3HQC A;  3U12 A;  1WG7 A;  3VIA A;  2Z0Q A;  2Y8F A;  2L1C A;  2ELB A;  3TFM A;  4NSW A;  2RNR B;  5DH9 B;  5D3X A;  2L2I A;  3U7D A;  1X11 A;  1OMW A;  3ODO A;  5C6R A;  5KQ4 A;  2J59 M;  4KVG B;  3N7C A;  1X1G A;  4A6H A;  4CYE A;  4QJ4 B;  5IRS A;  4P7I A;  1V5P A;  4CSQ A;  5J3Q A;  1UPQ A;  1M7E A;  2AL6 A;  2P0D A;  2DKP A;  2COA A;  2VKI A;  5J3Y A;  1FB8 A;  3ULB A;  2COF A;  1U5F A;  2N0Y A;  1EF1 A;  2YS3 A;  4WVF B;  4D0N B;  5DI9 B;  5C79 A;  1X86 A;  1FOE A;  2J0K A;  3KRW A;  4WSF A;  4DX8 A;  2RRF A;  4KHB A;  3FSS A;  2LKO A;  2J0M A;  3OAN A;  5L81 A;  4DX9 0;  1UEF A;  3U8Z A;  4WJ7 A;  2KGX B;  3X23 A;  2CRF A;  2P8V A;  2DYN A;  2QKL A;  3A98 B;  2RVB B;  2Z0O A;  3QWM A;  3ULC A;  2DYQ A;  2W2X C;  2DHI A;  1EAZ A;  3M1I B;  2GUM A;  3RCP A;  1M7R A;  3IVF A;  4ZRK A;  3UZT A;  1TJ6 A;  2ELA A;  1UPR A;  2DFK A;  4BBK A;  2CY5 A;  4F7U P;  1LW3 A;  1MI1 A;  1W1D A;  2RSG A;  2H7D A;  4PQ0 A;  2Z59 A;  1J0W A;  4PNK A;  5M4Y B;  3GYO A;  1GC6 A;  2G35 A;  1DDW A;  3DCX A;  2K2J A;  4Y94 A;  1K5D B;  1XD4 A;  5D3V A;  1FHW A;  1PFJ A;  2P0F A;  2MFQ A;  4K2P A;  1TXD A;  2DA0 A;  4HAV B;  2Z14 A;  3DXD A;  3VOQ A;  2D9V A;  1T77 A;  1P5T A;  4OSN A;  5C16 A;  2QKM A;  3A8Q A;  4MT7 A;  1BAK A;  2OQB A;  5FI1 A;  4KHB B;  5J3T A;  4GMX B;  4HB2 B;  4DBB A;  1FGZ A;  4EMO A;  2D4Q A;  5JHH A;  3F5R A;  3AU4 A;  2I5C A;  5C5B B;  2K00 A;  1E5W A;  5HE0 A;  2R0D A;  2DN6 A;  2K49 A;  2Z13 A;  2IFS A;  5GOW B;  3V5W A;  4HB3 B;  1U2B A;  3TW1 A;  2KUQ A;  2OTX A;  4MY6 A;  1KI1 B;  2DX1 A;  2KR0 A;  2KUP A;  2LOZ A;  2MDX A;  2LUL A;  2UZS A;  3P6A A;  1X1F A;  4HB4 B;  4CHJ A;  4QJ5 B;  2JP2 A;  4B6H A;  1ZSQ A;  2R09 A;  3KSY A;  4XWX A;  4IFS A;  3AU5 A;  3TCA A;  1PMS A;  4TYZ A;  5D3Y A;  2MWN B;  3TVV A;  3CXB B;  1H4R A;  4OT1 A;  2Y8G A;  1H10 A;  1ISN A;  3MDB C;  3P7Z A;  2D9Z A;  1WJ1 A;  1U5G A;  1V5U A;  4A6K A;  3DXC A;  5HE1 A;  2COC A;  2LG1 A;  5D3W A;  4HSI A;  2W2W A;  1PLS A;  4HDO A;  5CLQ B;  3BIN A;  1P6S A;  2YVC A; 
#chains in the Genus database with same CATH homology
 4MK0 A;  3PP2 A;  1XOD A;  2K2U A;  3TO1 A;  1U29 A;  1UNQ A;  2EMS A;  4GXB A;  2M38 A;  1MPH A;  3AJ4 A;  2Z0P A;  1ZM0 A;  3HK0 A;  3KZ1 A;  3PSC A;  2DKQ A;  2HTH B;  2YS5 A;  2D9X A;  3ODX A;  2I1J A;  1DYN A;  2CY4 A;  2GJY A;  1I7A A;  2NZ8 B;  4GN1 A;  5KQ1 A;  1GG3 A;  1Y5O A;  2YSZ A;  1WI1 A;  1NU2 A;  3D8D A;  4IAP A;  5LON B;  2AEH A;  2D11 A;  2YT1 A;  2COD A;  2Q13 A;  2YF0 A;  4GZU A;  4KHO A;  4Z2M B;  4Z2N A;  1MK9 B;  2RUK B;  3KRX A;  1DDV A;  1N3H A;  1AWE A;  2J0J A;  1FHX A;  1ZC3 B;  1WGQ A;  1RJ2 A;  2ADZ A;  1KZ7 A;  4CHM A;  2M14 A;  1GC7 A;  2YRY A;  2DX5 A;  1V5M A;  1MKE A;  1DBH A;  2D9Y A;  2P0H A;  3KY9 A;  1WVH A;  4HAZ B;  1BTN A;  2VRW B;  1V61 A;  2DHK A;  5DHF B;  5D27 A;  4F7G A;  4K2O A;  3QBV B;  4A6F A;  5HE3 A;  3QIJ A;  2FJL A;  2I1K A;  3BJI A;  4ZRJ A;  4NY0 A;  4KHA A;  1UNR A;  2UZR A;  5LOP B;  4K17 A;  5FI0 A;  1MIZ B;  3SO6 A;  1XR0 B;  1U5D A;  3G9W A;  1IRS A;  1MAI A;  2CAY A;  4HDQ A;  2X18 A;  3D8F A;  1XKE A;  3F0W A;  3SYX A;  2D2Q A;  2D10 A;  2H7E A;  1EGX A;  2RGN B;  5EFX A;  3PG7 A;  5CLL B;  2PZ1 A;  2EMT A;  4A5K A;  2RLO A;  1MIX A;  2I5F A;  3PVW A;  4HAT B;  1QQG A;  2MKR A;  2W2X D;  4K81 A;  2ROZ B;  1OQN A;  2ZPY A;  4HAW B;  4H8S A;  4F7H A;  5C5B A;  2DHJ A;  1Q67 A;  1P3R A;  1FAO A;  2GS0 A;  4HAX B;  1LB1 A;  1KZG A;  4TKN A;  3ZDT A;  3SUZ A;  4HAY B;  2EJ8 A;  1RRP B;  2EC1 A;  1DDM A;  1W1G A;  4ZRI A;  3SV1 A;  1SHC A;  4KAX B;  1UNP A;  3HW2 B;  1W1H A;  1OY2 A;  5JHG A;  5JLJ B;  2IYB A;  1K5G B;  1XX0 A;  4HAU B;  2E2X A;  3CIK A;  4YL8 A;  2LOX A;  1FGY A;  1ZC4 B;  3ODW A;  1XCG A;  2Y7B A;  2YT0 A;  1BTK A;  2BCJ A;  4L6E A;  1TQZ A;  2DLW A;  2KCJ A;  1DRO A;  2VSZ A;  1NTV A;  3SNH A;  3O96 A;  1J19 A;  3D8E A;  2LYD A;  1V89 A;  4GPT B;  2GCJ A;  2N23 A;  2UVM A;  3PZD A;  2GCL A;  1X05 A;  2DTC A;  5KCV A;  1FHO A;  3FM8 C;  2HE7 A;  2YS1 A;  2NMB A;  3T06 A;  1ZVR A;  1U27 A;  4IOY X;  4C0A A;  5HE2 A;  1U5E A;  3ZVR A;  1WJM A;  2ROV A;  2V76 A;  1WGU A;  1Y19 B;  4HHV A;  1BWN A;  4A6F B;  3LJU X;  1NTY A;  2D9W A;  5DHA B;  3WYF B;  4EKU A;  1SGH A;  1V88 A;  3PVL A;  1MK7 B;  3MPX A;  1I2H A;  3GYP A;  1Z87 A;  3DXE A;  3FEH A;  3NSU A;  5JP4 A;  3ML4 A;  4EJN A;  3A8P A;  4HB0 B;  1NI2 A;  1EVH A;  4GMV A;  3WA0 A;  3PVU A;  4DXA B;  1QC6 A;  1AQC A;  3PEG A;  4YON A;  5DIF B;  2XQN M;  1B55 A;  3HQC A;  1WG7 A;  3VIA A;  2Z0Q A;  2Y8F A;  2L1C A;  2ELB A;  3TFM A;  4NSW A;  2RNR B;  5DH9 B;  5D3X A;  2L2I A;  3U7D A;  1X11 A;  1OMW A;  3ODO A;  5C6R A;  5KQ4 A;  2J59 M;  4KVG B;  1X1G A;  3N7C A;  4A6H A;  4CYE A;  4P7I A;  1V5P A;  5J3Q A;  1UPQ A;  1M7E A;  2AL6 A;  2P0D A;  2DKP A;  2COA A;  2VKI A;  5J3Y A;  1FB8 A;  3ULB A;  2COF A;  1U5F A;  2N0Y A;  1EF1 A;  2YS3 A;  4WVF B;  4D0N B;  5DI9 B;  5C79 A;  1X86 A;  1FOE A;  2J0K A;  3KRW A;  4WSF A;  4DX8 A;  3FSS A;  2LKO A;  2J0M A;  3OAN A;  5L81 A;  4DX9 0;  1UEF A;  3U8Z A;  4WJ7 A;  2KGX B;  3X23 A;  2CRF A;  2P8V A;  2DYN A;  2QKL A;  3A98 B;  2RVB B;  2Z0O A;  3QWM A;  3ULC A;  2DYQ A;  2W2X C;  2DHI A;  1EAZ A;  3M1I B;  3RCP A;  1M7R A;  3IVF A;  4ZRK A;  3UZT A;  1TJ6 A;  2ELA A;  1UPR A;  2DFK A;  4BBK A;  2CY5 A;  4F7U P;  1LW3 A;  1W1D A;  2RSG A;  2H7D A;  4PQ0 A;  4PNK A;  1J0W A;  3GYO A;  1GC6 A;  2G35 A;  1DDW A;  2K2J A;  4Y94 A;  1K5D B;  1XD4 A;  5D3V A;  1FHW A;  1PFJ A;  2P0F A;  2MFQ A;  4K2P A;  1TXD A;  2DA0 A;  4HAV B;  3DXD A;  3VOQ A;  2D9V A;  1P5T A;  5C16 A;  2QKM A;  3A8Q A;  4MT7 A;  1BAK A;  2OQB A;  5FI1 A;  4KHB B;  5J3T A;  4GMX B;  4HB2 B;  4DBB A;  1FGZ A;  4EMO A;  2D4Q A;  5JHH A;  3F5R A;  3AU4 A;  2I5C A;  5C5B B;  2K00 A;  1E5W A;  5HE0 A;  2R0D A;  2DN6 A;  5GOW B;  2IFS A;  3V5W A;  4HB3 B;  1U2B A;  3TW1 A;  2OTX A;  4MY6 A;  1KI1 B;  2DX1 A;  2KUP A;  2LOZ A;  2MDX A;  2LUL A;  2UZS A;  3P6A A;  1X1F A;  4HB4 B;  4CHJ A;  2JP2 A;  4B6H A;  1ZSQ A;  2R09 A;  3KSY A;  4XWX A;  4IFS A;  3AU5 A;  3TCA A;  1PMS A;  4TYZ A;  5D3Y A;  2MWN B;  3TVV A;  3CXB B;  1H4R A;  2Y8G A;  1H10 A;  1ISN A;  3MDB C;  3P7Z A;  2D9Z A;  1WJ1 A;  1U5G A;  1V5U A;  4A6K A;  3DXC A;  5HE1 A;  2COC A;  2LG1 A;  5D3W A;  2W2W A;  1PLS A;  4HDO A;  5CLQ B;  3BIN A;  1P6S A;  2YVC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...