1TQZA

Solution structure of necap1 protein
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
133
structure length
133
Chain Sequence
MAAELEYESVLCVKPDVSVYRIPPRASNRGYRASDWKLDQPDWTGRLRITSKGKIAYIKLEDKVSGELFAQAPVEQYPGIAVETVTDSSRYFVIRIQDGTGRSAFIGIGFTDRGDAFDFNVSLQDHFKWVKQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Endocytosis/exocytosis
molecule keywords NECAP1
publication title Solution structure of NECAP1 protein
rcsb
source organism Mus musculus
total genus 14
structure length 133
sequence length 133
ec nomenclature
pdb deposition date 2004-06-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 1tqzA01
2OQBA 2Y8GA 4F7UP 2Q13A 2DHKA 1PMSA 2GCJA 4KHBB 3PVWA 1EVHA 4GMXB 5HE2A 3FEHA 1DDVA 1UEFA 2DTCA 4HB3B 2D4QA 2L1CA 4CYEA 1MK7B 1U27A 5KQ4A 4WSFA 3PP2A 2DX1A 5LONB 1SGHA 3P7ZA 1M7RA 1NTVA 5D3WA 1TJ6A 4HDQA 1W1HA 5KQ1A 1V61A 4Y94A 2K2UA 3PEGA 4A5KA 2DYNA 1Z87A 3T06A 1W1DA 4K2PA 2LULA 2ELAA 1P5TA 1AWEA 2L2IA 3KRXA 3M1IB 3PZDA 2R09A 4HAXB 2VRWB 5J3YA 2EC1A 3X23A 2AL6A 5D3YA 2G35A 3A98B 5DI9B 2RUKB 2E2XA 3P6AA 4WJ7A 4BBKA 1QC6A 2DA0A 2DKPA 1WJ1A 2D11A 1DDMA 4EJNA 5C79A 2DX5A 2RLOA 4IAPA 1FGZA 1MAIA 3D8FA 1GC7A 2DN6A 3DXDA 3ML4A 3ODXA 1PFJA 4YL8A 3ULBA 2ROVA 3MPXA 2DHJA 3VOQA 4B6HA 5JP4A 1XD4A 1GC6A 3QBVB 1QQGA 5JHGA 3KSYA 2KGXB 1J0WA 1X1GA 4GPTB 1U5EA 1UPRA 2J0KA 1N3HA 1WVHA 2VSZA 4IFSA 5KCVA 5C6RA 4PNKA 1PLSA 2KCJA 4D0NB 1BAKA 2R0DA 3F0WA 2H7EA 1OY2A 1X1FA 1X05A 3O96A 4HDOA 2MKRA 1EGXA 2OTXA 4YONA 2GJYA 2ROZB 3PSCA 2D2QA 3ODWA 2DLWA 5C16A 2LYDA 1GG3A 3RCPA 1XR0B 1EF1A 3BJIA 4PQ0A 4HAVB 5GOWB 1FHOA 4ZRIA 4TYZA 1V5UA 2P8VA 1RRPB 5DHFB 1WJMA 2I1KA 1H10A 2HTHB 1ZC3B 2Z0PA 2RSGA 4HAWB 1SHCA 2D9YA 1FAOA 1J19A 3HW2B 4ZRKA 4NSWA 2I5FA 4HHVA 4K17A 2N23A 4MT7A 3SNHA 3SYXA 3V5WA 2LG1A 3QWMA 2N0YA 2P0DA 2CODA 3AU4A 3PVUA 2W2XC 5JHHA 1X86A 2AEHA 5FI0A 2YT0A 1K5GB 2DFKA 3ODOA 1W1GA 3AJ4A 3KY9A 2YT1A 5EFXA 3QIJA 1DBHA 4L6EA 5J3TA 2MFQA 2V76A 2CY5A 5CLLB 3VIAA 4A6FB 5JLJB 2CY4A 2K2JA 1U5FA 1X11A 3N7CA 2M14A 1ZC4B 5CLQB 2UZRA 4GMVA 4ZRJA 1XODA 1ZVRA 4GN1A 1UPQA 1KZ7A 1IRSA 3TW1A 3NSUA 2Y7BA 2Y8FA 1RJ2A 3F5RA 1UNPA 2D9WA 4A6FA 2DYQA 4KVGB 4HAYB 3ZVRA 1OMWA 4MK0A 1XKEA 4K2OA 5DHAB 2D9XA 3TCAA 1XCGA 3D8EA 1KI1B 1FOEA 2COAA 1Y19B 2QKLA 1AQCA 2KUPA 1ISNA 2P0FA 1P6SA 5C5BB 4CHMA 2EMTA 1U2BA 4WVFB 2CRFA 1LB1A 3AU5A 1MIZB 4EKUA 4A6HA 1V5PA 1V89A 4HB2B 2QKMA 3KZ1A 1Q67A 3ZDTA 1FHXA 3LJUX 4HB0B 2NZ8B 1MKEA 1TQZA 3BINA 3GYOA 1MIXA 4HAZB 2DKQA 1UNQA 1OQNA 3DXCA 1DYNA 1ZM0A 5D3VA 2ZPYA 4DBBA 3OANA 3UZTA 1NI2A 2LOZA 3ULCA 2I5CA 1H4RA 4DX90 2ADZA 4Z2MB 2DHIA 1MPHA 2LOXA 3PVLA 2FJLA 2GS0A 2J0JA 1U29A 4Z2NA 1I7AA 1K5DB 3GYPA 4GZUA 1XX0A 1EAZA 4TKNA 1WG7A 5D3XA 2IYBA 1WGUA 3IVFA 3HK0A 4GXBA 1FGYA 2YS1A 3SO6A 1I2HA 4A6KA 2Z0QA 2GCLA 2YRYA 1M7EA 5HE1A 3WYFB 2YSZA 1U5DA 4IOYX 1E5WA 2EJ8A 4XWXA 2K00A 2COCA 1BTKA 2UVMA 4DX8A 4H8SA 3U7DA 3MDBC 2X18A 1NU2A 1P3RA 2YF0A 3HQCA 1NTYA 5LOPB 1WI1A 1WGQA 1U5GA 2D9ZA 2JP2A 2D9VA 1MK9B 1DDWA 2UZSA 1V5MA 2BCJA 5DIFB 5HE3A 3TO1A 3SUZA 1BTNA 2J59M 2YVCA 2Z0OA 1FB8A 4KAXB 3TVVA 1BWNA 2YS5A 2RVBB 2W2XD 5J3QA 1V88A 2W2WA 5HE0A 3FM8C 4C0AA 4HB4B 2P0HA 4HAUB 2IFSA 5L81A 2NMBA 2EMSA 2HE7A 3TFMA 4MY6A 4KHOA 2YS3A 4DXAB 4KHAA 1LW3A 2I1JA 4CHJA 3PG7A 2M38A 1KZGA 2ELBA 4HATB 2XQNM 3WA0A 3A8QA 2RNRB 2J0MA 2LKOA 3CXBB 3D8DA 5DH9B 4NY0A 4F7GA 2D10A 2CAYA 4EMOA 5D27A 3FSSA 4K81A 4P7IA 3DXEA 5C5BA 2MWNB 2VKIA 3CIKA 1ZSQA 1DROA 1B55A 3G9WA 1TXDA 1FHWA 4F7HA 2COFA 2PZ1A 3U8ZA 3SV1A 1UNRA 1Y5OA 2H7DA 2RGNB 5FI1A 2MDXA 3A8PA 3KRWA
chains in the Genus database with same CATH superfamily
2K49A 2OQBA 2Y8GA 3NWDA 4F7UP 2Q13A 2DHKA 1PMSA 2GCJA 4KHBB 3PVWA 1EVHA 4GMXB 5HE2A 3FEHA 1DDVA 1UEFA 2DTCA 4HB3B 2D4QA 2L1CA 4CYEA 1MK7B 1U27A 5KQ4A 4WSFA 3PP2A 2DX1A 5LONB 1SGHA 3HIEA 3P7ZA 1M7RA 1NTVA 5D3WA 2YT2A 1TJ6A 4HDQA 1W1HA 2Z4DA 5KQ1A 1V61A 4Y94A 2K2UA 2KR0A 3PEGA 4A5KA 4KHBA 2DYNA 1Z87A 3T06A 1W1DA 4K2PA 2LULA 2ELAA 1P5TA 1AWEA 1T77A 2L2IA 3KRXA 3M1IB 3PZDA 2R09A 4HAXB 2VRWB 5J3YA 2EC1A 3X23A 2AL6A 5D3YA 2G35A 3A98B 5DI9B 2RUKB 2E2XA 3P6AA 4WJ7A 4BBKA 3U12A 1QC6A 2DA0A 3B77A 2DKPA 4D6WA 1WJ1A 2D11A 1DDMA 4EJNA 5C79A 2DX5A 2RLOA 4IAPA 1FGZA 1MAIA 3D8FA 1GC7A 2DN6A 3DXDA 3ML4A 2Z13A 3ODXA 1PFJA 4YL8A 3ULBA 2ROVA 3MPXA 2DHJA 3VOQA 4B6HA 5JP4A 1XD4A 1GC6A 3DCXA 1ZYIA 3QBVB 1QQGA 5JHGA 3KSYA 2KGXB 1J0WA 1X1GA 4GPTB 1U5EA 1UPRA 5IRSA 2J0KA 1N3HA 1WVHA 2VSZA 4IFSA 5KCVA 5C6RA 4PNKA 1PLSA 2GUMA 2KCJA 4D0NB 1BAKA 2R0DA 3F0WA 2H7EA 1OY2A 1X1FA 1X05A 2K8EA 4QJ5B 3O96A 4HDOA 2MKRA 1EGXA 2OTXA 4YONA 2GJYA 2ROZB 3PSCA 2D2QA 3ODWA 2DLWA 5C16A 2LYDA 3NWAA 1GG3A 3RCPA 1XR0B 2FJUB 1EF1A 3BJIA 4PQ0A 4HAVB 5GOWB 1FHOA 4ZRIA 4TYZA 1V5UA 2P8VA 1RRPB 5DHFB 1WJMA 2I1KA 1H10A 2HTHB 1ZC3B 2Z0PA 2RSGA 2Z59A 4HAWB 1SHCA 2D9YA 1FAOA 1J19A 3HW2B 4ZRKA 4NSWA 2I5FA 4HHVA 4K17A 2N23A 4MT7A 3SNHA 3SYXA 3V5WA 2LG1A 3QWMA 2N0YA 2Z14A 2P0DA 2CODA 3AU4A 3PVUA 5LG4B 2W2XC 5JHHA 1X86A 2AEHA 5FI0A 2YT0A 1K5GB 2DFKA 3ODOA 1W1GA 3AJ4A 3KY9A 2YT1A 5EFXA 3QIJA 1DBHA 4L6EA 5J3TA 2MFQA 2V76A 2CY5A 5CLLB 3VIAA 4A6FB 5JLJB 2CY4A 2K2JA 1U5FA 1X11A 3N7CA 2M14A 1ZC4B 5CLQB 2UZRA 4GMVA 4ZRJA 1XODA 1ZVRA 4GN1A 1UPQA 1KZ7A 1IRSA 3TW1A 3NSUA 2Y7BA 2Y8FA 1RJ2A 3F5RA 1UNPA 2D9WA 4A6FA 2DYQA 2R2YA 4KVGB 4HAYB 3ZVRA 1OMWA 4MK0A 1XKEA 2KUQA 4K2OA 5DHAB 2D9XA 3TCAA 1XCGA 3D8EA 1KI1B 1FOEA 2COAA 1Y19B 2KIGA 2QKLA 1AQCA 2KUPA 1ISNA 2P0FA 1P6SA 4L1RA 5C5BB 4CHMA 2EMTA 1U2BA 4WVFB 2CRFA 1LB1A 3AU5A 1MIZB 4EKUA 4A6HA 1V5PA 1V89A 4HB2B 2QKMA 3KZ1A 5M4YB 1Q67A 3ZDTA 1FHXA 3FVCA 3LJUX 4HB0B 2NZ8B 1MKEA 1TQZA 3BINA 2NBVA 4DIXA 3GYOA 1MIXA 4HAZB 2DKQA 1UNQA 1OQNA 3DXCA 1DYNA 1ZM0A 5D3VA 2ZPYA 4DBBA 3OANA 3UZTA 1NI2A 2LOZA 3ULCA 2I5CA 1H4RA 4OSNA 4DX90 2ADZA 4Z2MB 3HSAA 2DHIA 1MPHA 2LOXA 3PVLA 2FJLA 2GS0A 2J0JA 1U29A 4Z2NA 4GNKB 1MI1A 1I7AA 1K5DB 3GYPA 4GZUA 1XX0A 1EAZA 4TKNA 1WG7A 5D3XA 2IYBA 1WGUA 3IVFA 3HK0A 4GXBA 1FGYA 2YS1A 3SO6A 1I2HA 4A6KA 2Z0QA 2GCLA 2YRYA 1M7EA 5HE1A 5I2MA 3WYFB 2YSZA 1U5DA 4IOYX 1E5WA 2RRFA 3A58A 2EJ8A 4XWXA 2K00A 2COCA 1BTKA 2UVMA 4DX8A 5I2SA 4H8SA 3U7DA 3MDBC 2X18A 4CSQA 1NU2A 1P3RA 2YF0A 3HQCA 1NTYA 5LOPB 1WI1A 1WGQA 4OT1A 1U5GA 2D9ZA 2JP2A 2D9VA 1MK9B 1DDWA 2UZSA 1V5MA 2BCJA 5DIFB 5HE3A 3TO1A 3SUZA 1BTNA 2J59M 2YVCA 2Z0OA 1FB8A 4KAXB 3TVVA 1BWNA 4QXAB 2YS5A 2RVBB 2W2XD 5J3QA 1V88A 2W2WA 5HE0A 3FM8C 4C0AA 4HB4B 3OHMB 2P0HA 4HAUB 2ZKMX 2IFSA 5L81A 2NMBA 2EMSA 2HE7A 3TFMA 4MY6A 4QJ4B 4KHOA 2YS3A 4DXAB 4KHAA 1LW3A 4QJ3B 2I1JA 4CHJA 3PG7A 2M38A 1KZGA 2ELBA 4HATB 2XQNM 3WA0A 3A8QA 2RNRB 2J0MA 4GOUA 2LKOA 3CXBB 4HSIA 3D8DA 5DH9B 4NY0A 4F7GA 2D10A 2CAYA 3NWFA 4EMOA 5D27A 3FSSA 4K81A 4P7IA 3NW8A 3DXEA 5C5BA 2MWNB 2VKIA 3CIKA 1ZSQA 1DROA 1B55A 3G9WA 1TXDA 1FHWA 4F7HA 2COFA 2KIEA 2PZ1A 3U8ZA 3SV1A 1UNRA 1Y5OA 2H7DA 2RGNB 5FI1A 2MDXA 3A8PA 3KRWA
chains in the Genus database with same CATH topology
2OQBA 2Y8GA 4F7UP 2Q13A 2DHKA 1PMSA 2GCJA 4KHBB 3PVWA 1EVHA 4GMXB 5HE2A 3FEHA 1DDVA 1UEFA 2DTCA 4HB3B 2D4QA 2L1CA 4CYEA 1MK7B 1U27A 5KQ4A 4WSFA 3PP2A 2DX1A 5LONB 1SGHA 3P7ZA 1M7RA 1NTVA 5D3WA 1TJ6A 4HDQA 1W1HA 5KQ1A 1V61A 4Y94A 2K2UA 3PEGA 4A5KA 2DYNA 1Z87A 3T06A 1W1DA 4K2PA 2LULA 2ELAA 1P5TA 1AWEA 2L2IA 3KRXA 3M1IB 3PZDA 2R09A 4HAXB 2VRWB 5J3YA 2EC1A 3X23A 2AL6A 5D3YA 2G35A 3A98B 5DI9B 2RUKB 2E2XA 3P6AA 4WJ7A 4BBKA 1QC6A 2DA0A 2DKPA 1WJ1A 2D11A 1DDMA 4EJNA 5C79A 2DX5A 2RLOA 4IAPA 1FGZA 1MAIA 3D8FA 1GC7A 2DN6A 3DXDA 3ML4A 3ODXA 1PFJA 4YL8A 3ULBA 2ROVA 3MPXA 2DHJA 3VOQA 4B6HA 5JP4A 1XD4A 1GC6A 3QBVB 1QQGA 5JHGA 3KSYA 2KGXB 1J0WA 1X1GA 4GPTB 1U5EA 1UPRA 2J0KA 1N3HA 1WVHA 2VSZA 4IFSA 5KCVA 5C6RA 4PNKA 1PLSA 2KCJA 4D0NB 1BAKA 2R0DA 3F0WA 2H7EA 1OY2A 1X1FA 1X05A 3O96A 4HDOA 2MKRA 1EGXA 2OTXA 4YONA 2GJYA 2ROZB 3PSCA 2D2QA 3ODWA 2DLWA 5C16A 2LYDA 1GG3A 3RCPA 1XR0B 1EF1A 3BJIA 4PQ0A 4HAVB 5GOWB 1FHOA 4ZRIA 4TYZA 1V5UA 2P8VA 1RRPB 5DHFB 1WJMA 2I1KA 1H10A 2HTHB 1ZC3B 2Z0PA 2RSGA 4HAWB 1SHCA 2D9YA 1FAOA 1J19A 3HW2B 4ZRKA 4NSWA 2I5FA 4HHVA 4K17A 2N23A 4MT7A 3SNHA 3SYXA 3V5WA 2LG1A 3QWMA 2N0YA 2P0DA 2CODA 3AU4A 3PVUA 2W2XC 5JHHA 1X86A 2AEHA 5FI0A 2YT0A 1K5GB 2DFKA 3ODOA 1W1GA 3AJ4A 3KY9A 2YT1A 5EFXA 3QIJA 1DBHA 4L6EA 5J3TA 2MFQA 2V76A 2CY5A 5CLLB 3VIAA 4A6FB 5JLJB 2CY4A 2K2JA 1U5FA 1X11A 3N7CA 2M14A 1ZC4B 5CLQB 2UZRA 4GMVA 4ZRJA 1XODA 1ZVRA 4GN1A 1UPQA 1KZ7A 1IRSA 3TW1A 3NSUA 2Y7BA 2Y8FA 1RJ2A 3F5RA 1UNPA 2D9WA 4A6FA 2DYQA 4KVGB 4HAYB 3ZVRA 1OMWA 4MK0A 1XKEA 4K2OA 5DHAB 2D9XA 3TCAA 1XCGA 3D8EA 1KI1B 1FOEA 2COAA 1Y19B 2QKLA 1AQCA 2KUPA 1ISNA 2P0FA 1P6SA 5C5BB 4CHMA 2EMTA 1U2BA 4WVFB 2CRFA 1LB1A 3AU5A 1MIZB 4EKUA 4A6HA 1V5PA 1V89A 4HB2B 2QKMA 3KZ1A 1Q67A 3ZDTA 1FHXA 3LJUX 4HB0B 2NZ8B 1MKEA 1TQZA 3BINA 3GYOA 1MIXA 4HAZB 2DKQA 1UNQA 1OQNA 3DXCA 1DYNA 1ZM0A 5D3VA 2ZPYA 4DBBA 3OANA 3UZTA 1NI2A 2LOZA 3ULCA 2I5CA 1H4RA 4DX90 2ADZA 4Z2MB 2DHIA 1MPHA 2LOXA 3PVLA 2FJLA 2GS0A 2J0JA 1U29A 4Z2NA 1I7AA 1K5DB 3GYPA 4GZUA 1XX0A 1EAZA 4TKNA 1WG7A 5D3XA 2IYBA 1WGUA 3IVFA 3HK0A 4GXBA 1FGYA 2YS1A 3SO6A 1I2HA 4A6KA 2Z0QA 2GCLA 2YRYA 1M7EA 5HE1A 3WYFB 2YSZA 1U5DA 4IOYX 1E5WA 2EJ8A 4XWXA 2K00A 2COCA 1BTKA 2UVMA 4DX8A 4H8SA 3U7DA 3MDBC 2X18A 1NU2A 1P3RA 2YF0A 3HQCA 1NTYA 5LOPB 1WI1A 1WGQA 1U5GA 2D9ZA 2JP2A 2D9VA 1MK9B 1DDWA 2UZSA 1V5MA 2BCJA 5DIFB 5HE3A 3TO1A 3SUZA 1BTNA 2J59M 2YVCA 2Z0OA 1FB8A 4KAXB 3TVVA 1BWNA 2YS5A 2RVBB 2W2XD 5J3QA 1V88A 2W2WA 5HE0A 3FM8C 4C0AA 4HB4B 2P0HA 4HAUB 2IFSA 5L81A 2NMBA 2EMSA 2HE7A 3TFMA 4MY6A 4KHOA 2YS3A 4DXAB 4KHAA 1LW3A 2I1JA 4CHJA 3PG7A 2M38A 1KZGA 2ELBA 4HATB 2XQNM 3WA0A 3A8QA 2RNRB 2J0MA 2LKOA 3CXBB 3D8DA 5DH9B 4NY0A 4F7GA 2D10A 2CAYA 4EMOA 5D27A 3FSSA 4K81A 4P7IA 3DXEA 5C5BA 2MWNB 2VKIA 3CIKA 1ZSQA 1DROA 1B55A 3G9WA 1TXDA 1FHWA 4F7HA 2COFA 2PZ1A 3U8ZA 3SV1A 1UNRA 1Y5OA 2H7DA 2RGNB 5FI1A 2MDXA 3A8PA 3KRWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OQB A;  2Y8G A;  4F7U P;  2Q13 A;  2DHK A;  1PMS A;  2GCJ A;  4KHB B;  3PVW A;  1EVH A;  4GMX B;  5HE2 A;  3FEH A;  1DDV A;  1UEF A;  2DTC A;  4HB3 B;  2D4Q A;  2L1C A;  4CYE A;  1MK7 B;  1U27 A;  5KQ4 A;  4WSF A;  3PP2 A;  2DX1 A;  5LON B;  1SGH A;  3P7Z A;  1M7R A;  1NTV A;  5D3W A;  1TJ6 A;  4HDQ A;  1W1H A;  5KQ1 A;  1V61 A;  4Y94 A;  2K2U A;  3PEG A;  4A5K A;  2DYN A;  1Z87 A;  3T06 A;  1W1D A;  4K2P A;  2LUL A;  2ELA A;  1P5T A;  1AWE A;  2L2I A;  3KRX A;  3M1I B;  3PZD A;  2R09 A;  4HAX B;  2VRW B;  5J3Y A;  2EC1 A;  3X23 A;  2AL6 A;  5D3Y A;  2G35 A;  3A98 B;  5DI9 B;  2RUK B;  2E2X A;  3P6A A;  4WJ7 A;  4BBK A;  1QC6 A;  2DA0 A;  2DKP A;  1WJ1 A;  2D11 A;  1DDM A;  4EJN A;  5C79 A;  2DX5 A;  2RLO A;  4IAP A;  1FGZ A;  1MAI A;  3D8F A;  1GC7 A;  2DN6 A;  3DXD A;  3ML4 A;  3ODX A;  1PFJ A;  4YL8 A;  3ULB A;  2ROV A;  3MPX A;  2DHJ A;  3VOQ A;  4B6H A;  5JP4 A;  1XD4 A;  1GC6 A;  3QBV B;  1QQG A;  5JHG A;  3KSY A;  2KGX B;  1J0W A;  1X1G A;  4GPT B;  1U5E A;  1UPR A;  2J0K A;  1N3H A;  1WVH A;  2VSZ A;  4IFS A;  5KCV A;  5C6R A;  4PNK A;  1PLS A;  2KCJ A;  4D0N B;  1BAK A;  2R0D A;  3F0W A;  2H7E A;  1OY2 A;  1X1F A;  1X05 A;  3O96 A;  4HDO A;  2MKR A;  1EGX A;  2OTX A;  4YON A;  2GJY A;  2ROZ B;  3PSC A;  2D2Q A;  3ODW A;  2DLW A;  5C16 A;  2LYD A;  1GG3 A;  3RCP A;  1XR0 B;  1EF1 A;  3BJI A;  4PQ0 A;  4HAV B;  5GOW B;  1FHO A;  4ZRI A;  4TYZ A;  1V5U A;  2P8V A;  1RRP B;  5DHF B;  1WJM A;  2I1K A;  1H10 A;  2HTH B;  1ZC3 B;  2Z0P A;  2RSG A;  4HAW B;  1SHC A;  2D9Y A;  1FAO A;  1J19 A;  3HW2 B;  4ZRK A;  4NSW A;  2I5F A;  4HHV A;  4K17 A;  2N23 A;  4MT7 A;  3SNH A;  3SYX A;  3V5W A;  2LG1 A;  3QWM A;  2N0Y A;  2P0D A;  2COD A;  3AU4 A;  3PVU A;  2W2X C;  5JHH A;  1X86 A;  2AEH A;  5FI0 A;  2YT0 A;  1K5G B;  2DFK A;  3ODO A;  1W1G A;  3AJ4 A;  3KY9 A;  2YT1 A;  5EFX A;  3QIJ A;  1DBH A;  4L6E A;  5J3T A;  2MFQ A;  2V76 A;  2CY5 A;  5CLL B;  3VIA A;  4A6F B;  5JLJ B;  2CY4 A;  2K2J A;  1U5F A;  1X11 A;  3N7C A;  2M14 A;  1ZC4 B;  5CLQ B;  2UZR A;  4GMV A;  4ZRJ A;  1XOD A;  1ZVR A;  4GN1 A;  1UPQ A;  1KZ7 A;  1IRS A;  3TW1 A;  3NSU A;  2Y7B A;  2Y8F A;  1RJ2 A;  3F5R A;  1UNP A;  2D9W A;  4A6F A;  2DYQ A;  4KVG B;  4HAY B;  3ZVR A;  1OMW A;  4MK0 A;  1XKE A;  4K2O A;  5DHA B;  2D9X A;  3TCA A;  1XCG A;  3D8E A;  1KI1 B;  1FOE A;  2COA A;  1Y19 B;  2QKL A;  1AQC A;  2KUP A;  1ISN A;  2P0F A;  1P6S A;  5C5B B;  4CHM A;  2EMT A;  1U2B A;  4WVF B;  2CRF A;  1LB1 A;  3AU5 A;  1MIZ B;  4EKU A;  4A6H A;  1V5P A;  1V89 A;  4HB2 B;  2QKM A;  3KZ1 A;  1Q67 A;  3ZDT A;  1FHX A;  3LJU X;  4HB0 B;  2NZ8 B;  1MKE A;  1TQZ A;  3BIN A;  3GYO A;  1MIX A;  4HAZ B;  2DKQ A;  1UNQ A;  1OQN A;  3DXC A;  1DYN A;  1ZM0 A;  5D3V A;  2ZPY A;  4DBB A;  3OAN A;  3UZT A;  1NI2 A;  2LOZ A;  3ULC A;  2I5C A;  1H4R A;  4DX9 0;  2ADZ A;  4Z2M B;  2DHI A;  1MPH A;  2LOX A;  3PVL A;  2FJL A;  2GS0 A;  2J0J A;  1U29 A;  4Z2N A;  1I7A A;  1K5D B;  3GYP A;  4GZU A;  1XX0 A;  1EAZ A;  4TKN A;  1WG7 A;  5D3X A;  2IYB A;  1WGU A;  3IVF A;  3HK0 A;  4GXB A;  1FGY A;  2YS1 A;  3SO6 A;  1I2H A;  4A6K A;  2Z0Q A;  2GCL A;  2YRY A;  1M7E A;  5HE1 A;  3WYF B;  2YSZ A;  1U5D A;  4IOY X;  1E5W A;  2EJ8 A;  4XWX A;  2K00 A;  2COC A;  1BTK A;  2UVM A;  4DX8 A;  4H8S A;  3U7D A;  3MDB C;  2X18 A;  1NU2 A;  1P3R A;  2YF0 A;  3HQC A;  1NTY A;  5LOP B;  1WI1 A;  1WGQ A;  1U5G A;  2D9Z A;  2JP2 A;  2D9V A;  1MK9 B;  1DDW A;  2UZS A;  1V5M A;  2BCJ A;  5DIF B;  5HE3 A;  3TO1 A;  3SUZ A;  1BTN A;  2J59 M;  2YVC A;  2Z0O A;  1FB8 A;  4KAX B;  3TVV A;  1BWN A;  2YS5 A;  2RVB B;  2W2X D;  5J3Q A;  1V88 A;  2W2W A;  5HE0 A;  3FM8 C;  4C0A A;  4HB4 B;  2P0H A;  4HAU B;  2IFS A;  5L81 A;  2NMB A;  2EMS A;  2HE7 A;  3TFM A;  4MY6 A;  4KHO A;  2YS3 A;  4DXA B;  4KHA A;  1LW3 A;  2I1J A;  4CHJ A;  3PG7 A;  2M38 A;  1KZG A;  2ELB A;  4HAT B;  2XQN M;  3WA0 A;  3A8Q A;  2RNR B;  2J0M A;  2LKO A;  3CXB B;  3D8D A;  5DH9 B;  4NY0 A;  4F7G A;  2D10 A;  2CAY A;  4EMO A;  5D27 A;  3FSS A;  4K81 A;  4P7I A;  3DXE A;  5C5B A;  2MWN B;  2VKI A;  3CIK A;  1ZSQ A;  1DRO A;  1B55 A;  3G9W A;  1TXD A;  1FHW A;  4F7H A;  2COF A;  2PZ1 A;  3U8Z A;  3SV1 A;  1UNR A;  1Y5O A;  2H7D A;  2RGN B;  5FI1 A;  2MDX A;  3A8P A;  3KRW A; 
#chains in the Genus database with same CATH topology
 2K49 A;  2OQB A;  2Y8G A;  3NWD A;  4F7U P;  2Q13 A;  2DHK A;  1PMS A;  2GCJ A;  4KHB B;  3PVW A;  1EVH A;  4GMX B;  5HE2 A;  3FEH A;  1DDV A;  1UEF A;  2DTC A;  4HB3 B;  2D4Q A;  2L1C A;  4CYE A;  1MK7 B;  1U27 A;  5KQ4 A;  4WSF A;  3PP2 A;  2DX1 A;  5LON B;  1SGH A;  3HIE A;  3P7Z A;  1M7R A;  1NTV A;  5D3W A;  2YT2 A;  1TJ6 A;  4HDQ A;  1W1H A;  2Z4D A;  5KQ1 A;  1V61 A;  4Y94 A;  2K2U A;  2KR0 A;  3PEG A;  4A5K A;  4KHB A;  2DYN A;  1Z87 A;  3T06 A;  1W1D A;  4K2P A;  2LUL A;  2ELA A;  1P5T A;  1AWE A;  1T77 A;  2L2I A;  3KRX A;  3M1I B;  3PZD A;  2R09 A;  4HAX B;  2VRW B;  5J3Y A;  2EC1 A;  3X23 A;  2AL6 A;  5D3Y A;  2G35 A;  3A98 B;  5DI9 B;  2RUK B;  2E2X A;  3P6A A;  4WJ7 A;  4BBK A;  3U12 A;  1QC6 A;  2DA0 A;  3B77 A;  2DKP A;  4D6W A;  1WJ1 A;  2D11 A;  1DDM A;  4EJN A;  5C79 A;  2DX5 A;  2RLO A;  4IAP A;  1FGZ A;  1MAI A;  3D8F A;  1GC7 A;  2DN6 A;  3DXD A;  3ML4 A;  2Z13 A;  3ODX A;  1PFJ A;  4YL8 A;  3ULB A;  2ROV A;  3MPX A;  2DHJ A;  3VOQ A;  4B6H A;  5JP4 A;  1XD4 A;  1GC6 A;  3DCX A;  1ZYI A;  3QBV B;  1QQG A;  5JHG A;  3KSY A;  2KGX B;  1J0W A;  1X1G A;  4GPT B;  1U5E A;  1UPR A;  5IRS A;  2J0K A;  1N3H A;  1WVH A;  2VSZ A;  4IFS A;  5KCV A;  5C6R A;  4PNK A;  1PLS A;  2GUM A;  2KCJ A;  4D0N B;  1BAK A;  2R0D A;  3F0W A;  2H7E A;  1OY2 A;  1X1F A;  1X05 A;  2K8E A;  4QJ5 B;  3O96 A;  4HDO A;  2MKR A;  1EGX A;  2OTX A;  4YON A;  2GJY A;  2ROZ B;  3PSC A;  2D2Q A;  3ODW A;  2DLW A;  5C16 A;  2LYD A;  3NWA A;  1GG3 A;  3RCP A;  1XR0 B;  2FJU B;  1EF1 A;  3BJI A;  4PQ0 A;  4HAV B;  5GOW B;  1FHO A;  4ZRI A;  4TYZ A;  1V5U A;  2P8V A;  1RRP B;  5DHF B;  1WJM A;  2I1K A;  1H10 A;  2HTH B;  1ZC3 B;  2Z0P A;  2RSG A;  2Z59 A;  4HAW B;  1SHC A;  2D9Y A;  1FAO A;  1J19 A;  3HW2 B;  4ZRK A;  4NSW A;  2I5F A;  4HHV A;  4K17 A;  2N23 A;  4MT7 A;  3SNH A;  3SYX A;  3V5W A;  2LG1 A;  3QWM A;  2N0Y A;  2Z14 A;  2P0D A;  2COD A;  3AU4 A;  3PVU A;  5LG4 B;  2W2X C;  5JHH A;  1X86 A;  2AEH A;  5FI0 A;  2YT0 A;  1K5G B;  2DFK A;  3ODO A;  1W1G A;  3AJ4 A;  3KY9 A;  2YT1 A;  5EFX A;  3QIJ A;  1DBH A;  4L6E A;  5J3T A;  2MFQ A;  2V76 A;  2CY5 A;  5CLL B;  3VIA A;  4A6F B;  5JLJ B;  2CY4 A;  2K2J A;  1U5F A;  1X11 A;  3N7C A;  2M14 A;  1ZC4 B;  5CLQ B;  2UZR A;  4GMV A;  4ZRJ A;  1XOD A;  1ZVR A;  4GN1 A;  1UPQ A;  1KZ7 A;  1IRS A;  3TW1 A;  3NSU A;  2Y7B A;  2Y8F A;  1RJ2 A;  3F5R A;  1UNP A;  2D9W A;  4A6F A;  2DYQ A;  2R2Y A;  4KVG B;  4HAY B;  3ZVR A;  1OMW A;  4MK0 A;  1XKE A;  2KUQ A;  4K2O A;  5DHA B;  2D9X A;  3TCA A;  1XCG A;  3D8E A;  1KI1 B;  1FOE A;  2COA A;  1Y19 B;  2KIG A;  2QKL A;  1AQC A;  2KUP A;  1ISN A;  2P0F A;  1P6S A;  4L1R A;  5C5B B;  4CHM A;  2EMT A;  1U2B A;  4WVF B;  2CRF A;  1LB1 A;  3AU5 A;  1MIZ B;  4EKU A;  4A6H A;  1V5P A;  1V89 A;  4HB2 B;  2QKM A;  3KZ1 A;  5M4Y B;  1Q67 A;  3ZDT A;  1FHX A;  3FVC A;  3LJU X;  4HB0 B;  2NZ8 B;  1MKE A;  1TQZ A;  3BIN A;  2NBV A;  4DIX A;  3GYO A;  1MIX A;  4HAZ B;  2DKQ A;  1UNQ A;  1OQN A;  3DXC A;  1DYN A;  1ZM0 A;  5D3V A;  2ZPY A;  4DBB A;  3OAN A;  3UZT A;  1NI2 A;  2LOZ A;  3ULC A;  2I5C A;  1H4R A;  4OSN A;  4DX9 0;  2ADZ A;  4Z2M B;  3HSA A;  2DHI A;  1MPH A;  2LOX A;  3PVL A;  2FJL A;  2GS0 A;  2J0J A;  1U29 A;  4Z2N A;  4GNK B;  1MI1 A;  1I7A A;  1K5D B;  3GYP A;  4GZU A;  1XX0 A;  1EAZ A;  4TKN A;  1WG7 A;  5D3X A;  2IYB A;  1WGU A;  3IVF A;  3HK0 A;  4GXB A;  1FGY A;  2YS1 A;  3SO6 A;  1I2H A;  4A6K A;  2Z0Q A;  2GCL A;  2YRY A;  1M7E A;  5HE1 A;  5I2M A;  3WYF B;  2YSZ A;  1U5D A;  4IOY X;  1E5W A;  2RRF A;  3A58 A;  2EJ8 A;  4XWX A;  2K00 A;  2COC A;  1BTK A;  2UVM A;  4DX8 A;  5I2S A;  4H8S A;  3U7D A;  3MDB C;  2X18 A;  4CSQ A;  1NU2 A;  1P3R A;  2YF0 A;  3HQC A;  1NTY A;  5LOP B;  1WI1 A;  1WGQ A;  4OT1 A;  1U5G A;  2D9Z A;  2JP2 A;  2D9V A;  1MK9 B;  1DDW A;  2UZS A;  1V5M A;  2BCJ A;  5DIF B;  5HE3 A;  3TO1 A;  3SUZ A;  1BTN A;  2J59 M;  2YVC A;  2Z0O A;  1FB8 A;  4KAX B;  3TVV A;  1BWN A;  4QXA B;  2YS5 A;  2RVB B;  2W2X D;  5J3Q A;  1V88 A;  2W2W A;  5HE0 A;  3FM8 C;  4C0A A;  4HB4 B;  3OHM B;  2P0H A;  4HAU B;  2ZKM X;  2IFS A;  5L81 A;  2NMB A;  2EMS A;  2HE7 A;  3TFM A;  4MY6 A;  4QJ4 B;  4KHO A;  2YS3 A;  4DXA B;  4KHA A;  1LW3 A;  4QJ3 B;  2I1J A;  4CHJ A;  3PG7 A;  2M38 A;  1KZG A;  2ELB A;  4HAT B;  2XQN M;  3WA0 A;  3A8Q A;  2RNR B;  2J0M A;  4GOU A;  2LKO A;  3CXB B;  4HSI A;  3D8D A;  5DH9 B;  4NY0 A;  4F7G A;  2D10 A;  2CAY A;  3NWF A;  4EMO A;  5D27 A;  3FSS A;  4K81 A;  4P7I A;  3NW8 A;  3DXE A;  5C5B A;  2MWN B;  2VKI A;  3CIK A;  1ZSQ A;  1DRO A;  1B55 A;  3G9W A;  1TXD A;  1FHW A;  4F7H A;  2COF A;  2KIE A;  2PZ1 A;  3U8Z A;  3SV1 A;  1UNR A;  1Y5O A;  2H7D A;  2RGN B;  5FI1 A;  2MDX A;  3A8P A;  3KRW A; 
#chains in the Genus database with same CATH homology
 2OQB A;  2Y8G A;  4F7U P;  2Q13 A;  2DHK A;  1PMS A;  2GCJ A;  4KHB B;  3PVW A;  1EVH A;  4GMX B;  5HE2 A;  3FEH A;  1DDV A;  1UEF A;  2DTC A;  4HB3 B;  2D4Q A;  2L1C A;  4CYE A;  1MK7 B;  1U27 A;  5KQ4 A;  4WSF A;  3PP2 A;  2DX1 A;  5LON B;  1SGH A;  3P7Z A;  1M7R A;  1NTV A;  5D3W A;  1TJ6 A;  4HDQ A;  1W1H A;  5KQ1 A;  1V61 A;  4Y94 A;  2K2U A;  3PEG A;  4A5K A;  2DYN A;  1Z87 A;  3T06 A;  1W1D A;  4K2P A;  2LUL A;  2ELA A;  1P5T A;  1AWE A;  2L2I A;  3KRX A;  3M1I B;  3PZD A;  2R09 A;  4HAX B;  2VRW B;  5J3Y A;  2EC1 A;  3X23 A;  2AL6 A;  5D3Y A;  2G35 A;  3A98 B;  5DI9 B;  2RUK B;  2E2X A;  3P6A A;  4WJ7 A;  4BBK A;  1QC6 A;  2DA0 A;  2DKP A;  1WJ1 A;  2D11 A;  1DDM A;  4EJN A;  5C79 A;  2DX5 A;  2RLO A;  4IAP A;  1FGZ A;  1MAI A;  3D8F A;  1GC7 A;  2DN6 A;  3DXD A;  3ML4 A;  3ODX A;  1PFJ A;  4YL8 A;  3ULB A;  2ROV A;  3MPX A;  2DHJ A;  3VOQ A;  4B6H A;  5JP4 A;  1XD4 A;  1GC6 A;  3QBV B;  1QQG A;  5JHG A;  3KSY A;  2KGX B;  1J0W A;  1X1G A;  4GPT B;  1U5E A;  1UPR A;  2J0K A;  1N3H A;  1WVH A;  2VSZ A;  4IFS A;  5KCV A;  5C6R A;  4PNK A;  1PLS A;  2KCJ A;  4D0N B;  1BAK A;  2R0D A;  3F0W A;  2H7E A;  1OY2 A;  1X1F A;  1X05 A;  3O96 A;  4HDO A;  2MKR A;  1EGX A;  2OTX A;  4YON A;  2GJY A;  2ROZ B;  3PSC A;  2D2Q A;  3ODW A;  2DLW A;  5C16 A;  2LYD A;  1GG3 A;  3RCP A;  1XR0 B;  1EF1 A;  3BJI A;  4PQ0 A;  4HAV B;  5GOW B;  1FHO A;  4ZRI A;  4TYZ A;  1V5U A;  2P8V A;  1RRP B;  5DHF B;  1WJM A;  2I1K A;  1H10 A;  2HTH B;  1ZC3 B;  2Z0P A;  2RSG A;  4HAW B;  1SHC A;  2D9Y A;  1FAO A;  1J19 A;  3HW2 B;  4ZRK A;  4NSW A;  2I5F A;  4HHV A;  4K17 A;  2N23 A;  4MT7 A;  3SNH A;  3SYX A;  3V5W A;  2LG1 A;  3QWM A;  2N0Y A;  2P0D A;  2COD A;  3AU4 A;  3PVU A;  2W2X C;  5JHH A;  1X86 A;  2AEH A;  5FI0 A;  2YT0 A;  1K5G B;  2DFK A;  3ODO A;  1W1G A;  3AJ4 A;  3KY9 A;  2YT1 A;  5EFX A;  3QIJ A;  1DBH A;  4L6E A;  5J3T A;  2MFQ A;  2V76 A;  2CY5 A;  5CLL B;  3VIA A;  4A6F B;  5JLJ B;  2CY4 A;  2K2J A;  1U5F A;  1X11 A;  3N7C A;  2M14 A;  1ZC4 B;  5CLQ B;  2UZR A;  4GMV A;  4ZRJ A;  1XOD A;  1ZVR A;  4GN1 A;  1UPQ A;  1KZ7 A;  1IRS A;  3TW1 A;  3NSU A;  2Y7B A;  2Y8F A;  1RJ2 A;  3F5R A;  1UNP A;  2D9W A;  4A6F A;  2DYQ A;  4KVG B;  4HAY B;  3ZVR A;  1OMW A;  4MK0 A;  1XKE A;  4K2O A;  5DHA B;  2D9X A;  3TCA A;  1XCG A;  3D8E A;  1KI1 B;  1FOE A;  2COA A;  1Y19 B;  2QKL A;  1AQC A;  2KUP A;  1ISN A;  2P0F A;  1P6S A;  5C5B B;  4CHM A;  2EMT A;  1U2B A;  4WVF B;  2CRF A;  1LB1 A;  3AU5 A;  1MIZ B;  4EKU A;  4A6H A;  1V5P A;  1V89 A;  4HB2 B;  2QKM A;  3KZ1 A;  1Q67 A;  3ZDT A;  1FHX A;  3LJU X;  4HB0 B;  2NZ8 B;  1MKE A;  1TQZ A;  3BIN A;  3GYO A;  1MIX A;  4HAZ B;  2DKQ A;  1UNQ A;  1OQN A;  3DXC A;  1DYN A;  1ZM0 A;  5D3V A;  2ZPY A;  4DBB A;  3OAN A;  3UZT A;  1NI2 A;  2LOZ A;  3ULC A;  2I5C A;  1H4R A;  4DX9 0;  2ADZ A;  4Z2M B;  2DHI A;  1MPH A;  2LOX A;  3PVL A;  2FJL A;  2GS0 A;  2J0J A;  1U29 A;  4Z2N A;  1I7A A;  1K5D B;  3GYP A;  4GZU A;  1XX0 A;  1EAZ A;  4TKN A;  1WG7 A;  5D3X A;  2IYB A;  1WGU A;  3IVF A;  3HK0 A;  4GXB A;  1FGY A;  2YS1 A;  3SO6 A;  1I2H A;  4A6K A;  2Z0Q A;  2GCL A;  2YRY A;  1M7E A;  5HE1 A;  3WYF B;  2YSZ A;  1U5D A;  4IOY X;  1E5W A;  2EJ8 A;  4XWX A;  2K00 A;  2COC A;  1BTK A;  2UVM A;  4DX8 A;  4H8S A;  3U7D A;  3MDB C;  2X18 A;  1NU2 A;  1P3R A;  2YF0 A;  3HQC A;  1NTY A;  5LOP B;  1WI1 A;  1WGQ A;  1U5G A;  2D9Z A;  2JP2 A;  2D9V A;  1MK9 B;  1DDW A;  2UZS A;  1V5M A;  2BCJ A;  5DIF B;  5HE3 A;  3TO1 A;  3SUZ A;  1BTN A;  2J59 M;  2YVC A;  2Z0O A;  1FB8 A;  4KAX B;  3TVV A;  1BWN A;  2YS5 A;  2RVB B;  2W2X D;  5J3Q A;  1V88 A;  2W2W A;  5HE0 A;  3FM8 C;  4C0A A;  4HB4 B;  2P0H A;  4HAU B;  2IFS A;  5L81 A;  2NMB A;  2EMS A;  2HE7 A;  3TFM A;  4MY6 A;  4KHO A;  2YS3 A;  4DXA B;  4KHA A;  1LW3 A;  2I1J A;  4CHJ A;  3PG7 A;  2M38 A;  1KZG A;  2ELB A;  4HAT B;  2XQN M;  3WA0 A;  3A8Q A;  2RNR B;  2J0M A;  2LKO A;  3CXB B;  3D8D A;  5DH9 B;  4NY0 A;  4F7G A;  2D10 A;  2CAY A;  4EMO A;  5D27 A;  3FSS A;  4K81 A;  4P7I A;  3DXE A;  5C5B A;  2MWN B;  2VKI A;  3CIK A;  1ZSQ A;  1DRO A;  1B55 A;  3G9W A;  1TXD A;  1FHW A;  4F7H A;  2COF A;  2PZ1 A;  3U8Z A;  3SV1 A;  1UNR A;  1Y5O A;  2H7D A;  2RGN B;  5FI1 A;  2MDX A;  3A8P A;  3KRW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...