1TQZA

Solution structure of necap1 protein
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
133
structure length
133
Chain Sequence
b'MAAELEYESVLCVKPDVSVYRIPPRASNRGYRASDWKLDQPDWTGRLRITSKGKIAYIKLEDKVSGELFAQAPVEQYPGIAVETVTDSSRYFVIRIQDGTGRSAFIGIGFTDRGDAFDFNVSLQDHFKWVKQE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NECAP1
publication title Solution structure of NECAP1 protein
rcsb
source organism Mus musculus
molecule tags Endocytosis/exocytosis
total genus 14
structure length 133
sequence length 133
ec nomenclature
pdb deposition date 2004-06-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 1tqzA01
1X86A 3ULCA 4TYZA 3ODWA 2LYDA 2MDXA 2EMSA 3SNHA 1KZ7A 5C16A 3ULBA 1I2HA 3A98B 2ZPYA 2P8VA 2J59M 5CLLB 2D11A 1LB1A 5JHHA 4EJNA 1FGYA 3KZ1A 2RGNB 2YF0A 5L81A 4WSFA 2CODA 4Z2NA 2YS3A 2W2WA 5J3TA 1ISNA 1WI1A 1M7EA 5D3XA 4IFSA 3QWMA 4CYEA 1OY2A 1UPRA 1DYNA 2YVCA 2M14A 3KRXA 1WVHA 5C5BA 2GCJA 2GCLA 2K00A 1XD4A 2DKQA 4C0AA 1GC6A 3D8EA 2VSZA 4GZUA 1UNPA 3ODXA 2LOXA 3KSYA 4KHBB 1X05A 4WJ7A 2W2XD 3P7ZA 2D9VA 2PZ1A 5FI1A 5HE1A 2I1KA 5C6RA 2CY5A 2UVMA 2LULA 1UNRA 3HQCA 4HAUB 1FOEA 4BBKA 1PMSA 1XKEA 4GPTB 2G35A 3KY9A 5LOPB 3F0WA 2COCA 5D3YA 2Z0OA 3SYXA 1WGUA 3DXEA 2P0HA 1SHCA 2N0YA 2YT1A 3QIJA 3VOQA 1X1GA 2K2JA 2GJYA 1NU2A 3BINA 2LG1A 1J19A 2RSGA 1ZC3B 3ML4A 5J3YA 3HW2B 1P5TA 3VIAA 1QC6A 4HAYB 2P0DA 4NSWA 1ZVRA 4F7GA 1FGZA 2DYQA 3U8ZA 4K81A 1V5UA 2J0KA 4HATB 1M7RA 1V61A 1RJ2A 5HE0A 3FM8C 2ELAA 2ELBA 1EAZA 4CHMA 1BWNA 4ZRKA 3G9WA 2DHKA 3O96A 1GC7A 3N7CA 5D3VA 2D10A 1J0WA 1FHOA 3F5RA 1K5GB 3U7DA 2DHJA 2CAYA 3ODOA 3BJIA 4YL8A 5DH9B 1FHWA 3ZDTA 3FSSA 2AL6A 4F7UP 1DDVA 2GS0A 1BAKA 1H10A 1Q67A 1AQCA 2CY4A 2D9XA 4ZRJA 2IYBA 3AJ4A 1B55A 2ROVA 4A5KA 3MPXA 4KVGB 4EKUA 1FAOA 4WVFB 5FI0A 2ADZA 3WYFB 2RNRB 1U2BA 1TJ6A 4DXAB 3DXCA 2UZRA 1U5GA 2E2XA 3PSCA 1V5PA 1H4RA 1OQNA 5HE2A 2OQBA 4GXBA 1PFJA 5DHFB 5HE3A 5D27A 2MKRA 3NSUA 3P6AA 3WA0A 1ZSQA 2I1JA 1MIZB 4F7HA 3AU4A 3DXDA 3M1IB 3ZVRA 2DHIA 2NMBA 4ZRIA 2I5FA 2LKOA 4MT7A 2W2XC 3SV1A 5KQ1A 4HAZB 3TO1A 1EF1A 2M38A 4HAWB 3OANA 2D4QA 4GMXB 1SGHA 2COAA 3UZTA 3X23A 5JLJB 1MPHA 1RRPB 2DX5A 2Y8FA 2RLOA 2D9WA 2HE7A 1X1FA 2H7DA 2Y7BA 3A8PA 4KAXB 2YS5A 2DX1A 3PVWA 2V76A 4L6EA 3PZDA 2P0FA 4GMVA 4KHOA 2DN6A 2NZ8B 1U29A 5DHAB 2BCJA 1Z87A 2Q13A 4D0NB 3RCPA 1PLSA 1KZGA 5EFXA 2YRYA 3HK0A 1GG3A 2RVBB 4Y94A 1XX0A 1I7AA 2YS1A 4B6HA 5CLQB 2R0DA 1DBHA 3GYPA 5KQ4A 5JHGA 4TKNA 2OTXA 1ZM0A 4K2OA 3SUZA 1E5WA 2N23A 4HAVB 1DDMA 2K2UA 3LJUX 3TCAA 3V5WA 4DX90 3MDBC 4A6FB 4HDQA 3PG7A 3TW1A 4H8SA 1Y5OA 1LW3A 1W1DA 2JP2A 1UPQA 1QQGA 1W1HA 4HB4B 2CRFA 1OMWA 3AU5A 1MKEA 5JP4A 1FHXA 1AWEA 2I5CA 3SO6A 2YSZA 2VKIA 3A8QA 1WJMA 1P3RA 5LONB 3D8FA 4A6HA 1XR0B 3D8DA 1V88A 2XQNM 4Z2MB 4GN1A 3TVVA 2AEHA 3PVLA 1WGQA 4NY0A 4DBBA 2MFQA 3T06A 1N3HA 2D9YA 4HDOA 2Z0QA 1MAIA 4HB0B 1NTYA 2D9ZA 2LOZA 4P7IA 4DX8A 1UNQA 4IAPA 1P6SA 2EC1A 1NTVA 2DA0A 1NI2A 1WJ1A 1DDWA 3CXBB 2Z0PA 2QKMA 2RUKB 1WG7A 1XCGA 4XWXA 1BTNA 2UZSA 4HB2B 2H7EA 1U5DA 4YONA 1EVHA 2R09A 4A6FA 1DROA 5GOWB 1XODA 3IVFA 5KCVA 2J0MA 1U27A 1MK7B 4HHVA 1TXDA 5DIFB 2EJ8A 2L2IA 5C79A 2KGXB 1ZC4B 2FJLA 2COFA 2DTCA 4IOYX 4EMOA 4KHAA 1K5DB 4MK0A 1Y19B 4A6KA 1TQZA 2J0JA 2VRWB 2MWNB 2HTHB 4CHJA 5C5BB 1V89A 3KRWA 2DFKA 1MK9B 2KUPA 2DKPA 3PP2A 3GYOA 1UEFA 2EMTA 2L1CA 1KI1B 4K17A 2KCJA 3QBVB 5D3WA 5DI9B 1BTKA 4PQ0A 3PEGA 3CIKA 1W1GA 4K2PA 3PVUA 1FB8A 3FEHA 1V5MA 4HAXB 3TFMA 2ROZB 1U5FA 2D2QA 2DLWA 2Y8GA 1U5EA 4HB3B 1EGXA 2X18A 1IRSA 2QKLA 5J3QA 1MIXA 4PNKA 2YT0A 1X11A 2DYNA 2IFSA 4MY6A
chains in the Genus database with same CATH superfamily
1X86A 3ULCA 3OHMB 4TYZA 3ODWA 2LYDA 2MDXA 2EMSA 3SNHA 1KZ7A 5C16A 3ULBA 1I2HA 3A98B 2ZPYA 2P8VA 2J59M 5CLLB 2D11A 1LB1A 5JHHA 4EJNA 1FGYA 3KZ1A 2RGNB 2YF0A 5L81A 4WSFA 2CODA 4Z2NA 2YS3A 4GNKB 2W2WA 5J3TA 1ISNA 2R2YA 1WI1A 1M7EA 5D3XA 4IFSA 3QWMA 4CYEA 3NW8A 1OY2A 1UPRA 1DYNA 2YVCA 2M14A 3KRXA 1WVHA 5C5BA 2GCJA 2GCLA 2K00A 1XD4A 2DKQA 4C0AA 1GC6A 3D8EA 2VSZA 4GZUA 1UNPA 4QJ4B 3ODXA 2LOXA 3KSYA 4KHBB 1X05A 4WJ7A 5I2MA 4CSQA 2W2XD 3P7ZA 2D9VA 2PZ1A 5FI1A 5HE1A 2I1KA 5C6RA 2CY5A 2UVMA 2LULA 1UNRA 3HQCA 4HAUB 1FOEA 4BBKA 1PMSA 1XKEA 2RRFA 4GPTB 2G35A 3KY9A 5LOPB 2Z59A 3F0WA 2COCA 5D3YA 2Z0OA 3B77A 3SYXA 1WGUA 3DXEA 3FVCA 2P0HA 1SHCA 2N0YA 2YT1A 3QIJA 2KIEA 3VOQA 1X1GA 2K2JA 2GJYA 1NU2A 3BINA 2LG1A 1J19A 2RSGA 1ZC3B 3ML4A 5J3YA 3NWAA 3HW2B 1P5TA 3VIAA 1QC6A 4HAYB 2P0DA 4NSWA 1ZVRA 4F7GA 1FGZA 2K8EA 2DYQA 3U8ZA 4K81A 1V5UA 2Z13A 2J0KA 4HATB 1M7RA 1V61A 1RJ2A 5HE0A 3FM8C 2ELAA 2ELBA 1EAZA 4CHMA 1BWNA 4ZRKA 3G9WA 2DHKA 3O96A 1GC7A 3N7CA 5D3VA 2D10A 1J0WA 1FHOA 3F5RA 1K5GB 3U7DA 2DHJA 2CAYA 3ODOA 3BJIA 4YL8A 5DH9B 1FHWA 3ZDTA 3FSSA 2AL6A 4F7UP 1DDVA 2GS0A 1BAKA 1H10A 1Q67A 1AQCA 4KHBA 2CY4A 2D9XA 4ZRJA 2IYBA 3AJ4A 1B55A 2ROVA 4A5KA 3MPXA 4QJ3B 4KVGB 4EKUA 1FAOA 4WVFB 5FI0A 2ADZA 3WYFB 2RNRB 1U2BA 1TJ6A 4DXAB 3DXCA 2UZRA 1U5GA 2E2XA 3PSCA 1V5PA 1H4RA 1OQNA 5HE2A 2OQBA 4GXBA 1PFJA 5DHFB 5HE3A 5D27A 2MKRA 3NSUA 3P6AA 3WA0A 1ZSQA 2I1JA 1MIZB 4F7HA 4HSIA 3DXDA 3AU4A 3M1IB 3ZVRA 2DHIA 2NMBA 4ZRIA 2I5FA 2LKOA 4MT7A 2W2XC 3SV1A 5KQ1A 4HAZB 3TO1A 4QJ5B 1EF1A 2M38A 4HAWB 3OANA 2D4QA 4GMXB 1SGHA 2COAA 3UZTA 3X23A 5JLJB 1MPHA 2KUQA 1RRPB 2DX5A 2Y8FA 2RLOA 2Z4DA 2D9WA 2HE7A 1X1FA 2H7DA 2Y7BA 3A8PA 4KAXB 2YS5A 2DX1A 3PVWA 2V76A 4L6EA 3PZDA 2P0FA 4GMVA 3U12A 4KHOA 2DN6A 2NZ8B 1U29A 5DHAB 2BCJA 1Z87A 2Q13A 4D0NB 3RCPA 5LG4B 1PLSA 1KZGA 5EFXA 2YRYA 4D6WA 3HK0A 1GG3A 2RVBB 4Y94A 1XX0A 2K49A 1I7AA 2Z14A 2YS1A 4DIXA 4B6HA 5CLQB 2R0DA 5M4YB 1DBHA 3GYPA 5KQ4A 5JHGA 4TKNA 2OTXA 1ZM0A 3NWFA 4K2OA 3SUZA 1E5WA 1ZYIA 2N23A 4HAVB 1DDMA 2K2UA 3LJUX 3TCAA 2KR0A 3V5WA 4DX90 3MDBC 4A6FB 4QXAB 4HDQA 3PG7A 3TW1A 4H8SA 1Y5OA 1LW3A 1W1DA 2JP2A 3HSAA 1UPQA 1QQGA 1W1HA 4HB4B 2CRFA 1OMWA 3AU5A 1MKEA 5JP4A 1FHXA 1AWEA 2I5CA 3SO6A 2YSZA 2VKIA 3A8QA 1WJMA 1P3RA 5LONB 3D8FA 4A6HA 1XR0B 3D8DA 1V88A 2XQNM 2NBVA 4Z2MB 4GN1A 3TVVA 2AEHA 3PVLA 1WGQA 4NY0A 4DBBA 1MI1A 4L1RA 2MFQA 3T06A 1N3HA 2D9YA 4HDOA 2Z0QA 1MAIA 4HB0B 1NTYA 2D9ZA 5IRSA 2LOZA 4P7IA 4DX8A 1UNQA 4IAPA 1P6SA 2EC1A 1NTVA 2DA0A 1NI2A 1WJ1A 1DDWA 3CXBB 1T77A 2Z0PA 2QKMA 2RUKB 1WG7A 1XCGA 2KIGA 4XWXA 1BTNA 2UZSA 4HB2B 2ZKMX 2H7EA 1U5DA 4YONA 1EVHA 2R09A 4A6FA 1DROA 5GOWB 1XODA 3IVFA 5KCVA 2J0MA 1U27A 1MK7B 4HHVA 1TXDA 5DIFB 2EJ8A 2L2IA 3DCXA 5C79A 2KGXB 1ZC4B 2FJLA 2COFA 2DTCA 4IOYX 4EMOA 4KHAA 4GOUA 1K5DB 4MK0A 1Y19B 4A6KA 1TQZA 2J0JA 2VRWB 2MWNB 2HTHB 4CHJA 5C5BB 1V89A 3KRWA 2DFKA 3A58A 1MK9B 2KUPA 5I2SA 2DKPA 3PP2A 3GYOA 1UEFA 2EMTA 2L1CA 1KI1B 4K17A 2KCJA 3QBVB 5D3WA 4OSNA 5DI9B 2FJUB 1BTKA 4PQ0A 3PEGA 3CIKA 4OT1A 2GUMA 1W1GA 4K2PA 3PVUA 1FB8A 3FEHA 1V5MA 4HAXB 3NWDA 3TFMA 2ROZB 1U5FA 2D2QA 2DLWA 3HIEA 2Y8GA 1U5EA 4HB3B 1EGXA 2X18A 1IRSA 2QKLA 5J3QA 1MIXA 2YT2A 4PNKA 2YT0A 1X11A 2DYNA 2IFSA 4MY6A
chains in the Genus database with same CATH topology
1X86A 3ULCA 4TYZA 3ODWA 2LYDA 2MDXA 2EMSA 3SNHA 1KZ7A 5C16A 3ULBA 1I2HA 3A98B 2ZPYA 2P8VA 2J59M 5CLLB 2D11A 1LB1A 5JHHA 4EJNA 1FGYA 3KZ1A 2RGNB 2YF0A 5L81A 4WSFA 2CODA 4Z2NA 2YS3A 2W2WA 5J3TA 1ISNA 1WI1A 1M7EA 5D3XA 4IFSA 3QWMA 4CYEA 1OY2A 1UPRA 1DYNA 2YVCA 2M14A 3KRXA 1WVHA 5C5BA 2GCJA 2GCLA 2K00A 1XD4A 2DKQA 4C0AA 1GC6A 3D8EA 2VSZA 4GZUA 1UNPA 3ODXA 2LOXA 3KSYA 4KHBB 1X05A 4WJ7A 2W2XD 3P7ZA 2D9VA 2PZ1A 5FI1A 5HE1A 2I1KA 5C6RA 2CY5A 2UVMA 2LULA 1UNRA 3HQCA 4HAUB 1FOEA 4BBKA 1PMSA 1XKEA 4GPTB 2G35A 3KY9A 5LOPB 3F0WA 2COCA 5D3YA 2Z0OA 3SYXA 1WGUA 3DXEA 2P0HA 1SHCA 2N0YA 2YT1A 3QIJA 3VOQA 1X1GA 2K2JA 2GJYA 1NU2A 3BINA 2LG1A 1J19A 2RSGA 1ZC3B 3ML4A 5J3YA 3HW2B 1P5TA 3VIAA 1QC6A 4HAYB 2P0DA 4NSWA 1ZVRA 4F7GA 1FGZA 2DYQA 3U8ZA 4K81A 1V5UA 2J0KA 4HATB 1M7RA 1V61A 1RJ2A 5HE0A 3FM8C 2ELAA 2ELBA 1EAZA 4CHMA 1BWNA 4ZRKA 3G9WA 2DHKA 3O96A 1GC7A 3N7CA 5D3VA 2D10A 1J0WA 1FHOA 3F5RA 1K5GB 3U7DA 2DHJA 2CAYA 3ODOA 3BJIA 4YL8A 5DH9B 1FHWA 3ZDTA 3FSSA 2AL6A 4F7UP 1DDVA 2GS0A 1BAKA 1H10A 1Q67A 1AQCA 2CY4A 2D9XA 4ZRJA 2IYBA 3AJ4A 1B55A 2ROVA 4A5KA 3MPXA 4KVGB 4EKUA 1FAOA 4WVFB 5FI0A 2ADZA 3WYFB 2RNRB 1U2BA 1TJ6A 4DXAB 3DXCA 2UZRA 1U5GA 2E2XA 3PSCA 1V5PA 1H4RA 1OQNA 5HE2A 2OQBA 4GXBA 1PFJA 5DHFB 5HE3A 5D27A 2MKRA 3NSUA 3P6AA 3WA0A 1ZSQA 2I1JA 1MIZB 4F7HA 3AU4A 3DXDA 3M1IB 3ZVRA 2DHIA 2NMBA 4ZRIA 2I5FA 2LKOA 4MT7A 2W2XC 3SV1A 5KQ1A 4HAZB 3TO1A 1EF1A 2M38A 4HAWB 3OANA 2D4QA 4GMXB 1SGHA 2COAA 3UZTA 3X23A 5JLJB 1MPHA 1RRPB 2DX5A 2Y8FA 2RLOA 2D9WA 2HE7A 1X1FA 2H7DA 2Y7BA 3A8PA 4KAXB 2YS5A 2DX1A 3PVWA 2V76A 4L6EA 3PZDA 2P0FA 4GMVA 4KHOA 2DN6A 2NZ8B 1U29A 5DHAB 2BCJA 1Z87A 2Q13A 4D0NB 3RCPA 1PLSA 1KZGA 5EFXA 2YRYA 3HK0A 1GG3A 2RVBB 4Y94A 1XX0A 1I7AA 2YS1A 4B6HA 5CLQB 2R0DA 1DBHA 3GYPA 5KQ4A 5JHGA 4TKNA 2OTXA 1ZM0A 4K2OA 3SUZA 1E5WA 2N23A 4HAVB 1DDMA 2K2UA 3LJUX 3TCAA 3V5WA 4DX90 3MDBC 4A6FB 4HDQA 3PG7A 3TW1A 4H8SA 1Y5OA 1LW3A 1W1DA 2JP2A 1UPQA 1QQGA 1W1HA 4HB4B 2CRFA 1OMWA 3AU5A 1MKEA 5JP4A 1FHXA 1AWEA 2I5CA 3SO6A 2YSZA 2VKIA 3A8QA 1WJMA 1P3RA 5LONB 3D8FA 4A6HA 1XR0B 3D8DA 1V88A 2XQNM 4Z2MB 4GN1A 3TVVA 2AEHA 3PVLA 1WGQA 4NY0A 4DBBA 2MFQA 3T06A 1N3HA 2D9YA 4HDOA 2Z0QA 1MAIA 4HB0B 1NTYA 2D9ZA 2LOZA 4P7IA 4DX8A 1UNQA 4IAPA 1P6SA 2EC1A 1NTVA 2DA0A 1NI2A 1WJ1A 1DDWA 3CXBB 2Z0PA 2QKMA 2RUKB 1WG7A 1XCGA 4XWXA 1BTNA 2UZSA 4HB2B 2H7EA 1U5DA 4YONA 1EVHA 2R09A 4A6FA 1DROA 5GOWB 1XODA 3IVFA 5KCVA 2J0MA 1U27A 1MK7B 4HHVA 1TXDA 5DIFB 2EJ8A 2L2IA 5C79A 2KGXB 1ZC4B 2FJLA 2COFA 2DTCA 4IOYX 4EMOA 4KHAA 1K5DB 4MK0A 1Y19B 4A6KA 1TQZA 2J0JA 2VRWB 2MWNB 2HTHB 4CHJA 5C5BB 1V89A 3KRWA 2DFKA 1MK9B 2KUPA 2DKPA 3PP2A 3GYOA 1UEFA 2EMTA 2L1CA 1KI1B 4K17A 2KCJA 3QBVB 5D3WA 5DI9B 1BTKA 4PQ0A 3PEGA 3CIKA 1W1GA 4K2PA 3PVUA 1FB8A 3FEHA 1V5MA 4HAXB 3TFMA 2ROZB 1U5FA 2D2QA 2DLWA 2Y8GA 1U5EA 4HB3B 1EGXA 2X18A 1IRSA 2QKLA 5J3QA 1MIXA 4PNKA 2YT0A 1X11A 2DYNA 2IFSA 4MY6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1X86 A;  3ULC A;  4TYZ A;  3ODW A;  2LYD A;  2MDX A;  2EMS A;  3SNH A;  1KZ7 A;  5C16 A;  3ULB A;  1I2H A;  3A98 B;  2ZPY A;  2P8V A;  2J59 M;  5CLL B;  2D11 A;  1LB1 A;  5JHH A;  4EJN A;  1FGY A;  3KZ1 A;  2RGN B;  2YF0 A;  5L81 A;  4WSF A;  2COD A;  4Z2N A;  2YS3 A;  2W2W A;  5J3T A;  1ISN A;  1WI1 A;  1M7E A;  5D3X A;  4IFS A;  3QWM A;  4CYE A;  1OY2 A;  1UPR A;  1DYN A;  2YVC A;  2M14 A;  3KRX A;  1WVH A;  5C5B A;  2GCJ A;  2GCL A;  2K00 A;  1XD4 A;  2DKQ A;  4C0A A;  1GC6 A;  3D8E A;  2VSZ A;  4GZU A;  1UNP A;  3ODX A;  2LOX A;  3KSY A;  4KHB B;  1X05 A;  4WJ7 A;  2W2X D;  3P7Z A;  2D9V A;  2PZ1 A;  5FI1 A;  5HE1 A;  2I1K A;  5C6R A;  2CY5 A;  2UVM A;  2LUL A;  1UNR A;  3HQC A;  4HAU B;  1FOE A;  4BBK A;  1PMS A;  1XKE A;  4GPT B;  2G35 A;  3KY9 A;  5LOP B;  3F0W A;  2COC A;  5D3Y A;  2Z0O A;  3SYX A;  1WGU A;  3DXE A;  2P0H A;  1SHC A;  2N0Y A;  2YT1 A;  3QIJ A;  3VOQ A;  1X1G A;  2K2J A;  2GJY A;  1NU2 A;  3BIN A;  2LG1 A;  1J19 A;  2RSG A;  1ZC3 B;  3ML4 A;  5J3Y A;  3HW2 B;  1P5T A;  3VIA A;  1QC6 A;  4HAY B;  2P0D A;  4NSW A;  1ZVR A;  4F7G A;  1FGZ A;  2DYQ A;  3U8Z A;  4K81 A;  1V5U A;  2J0K A;  4HAT B;  1M7R A;  1V61 A;  1RJ2 A;  5HE0 A;  3FM8 C;  2ELA A;  2ELB A;  1EAZ A;  4CHM A;  1BWN A;  4ZRK A;  3G9W A;  2DHK A;  3O96 A;  1GC7 A;  3N7C A;  5D3V A;  2D10 A;  1J0W A;  1FHO A;  3F5R A;  1K5G B;  3U7D A;  2DHJ A;  2CAY A;  3ODO A;  3BJI A;  4YL8 A;  5DH9 B;  1FHW A;  3ZDT A;  3FSS A;  2AL6 A;  4F7U P;  1DDV A;  2GS0 A;  1BAK A;  1H10 A;  1Q67 A;  1AQC A;  2CY4 A;  2D9X A;  4ZRJ A;  2IYB A;  3AJ4 A;  1B55 A;  2ROV A;  4A5K A;  3MPX A;  4KVG B;  4EKU A;  1FAO A;  4WVF B;  5FI0 A;  2ADZ A;  3WYF B;  2RNR B;  1U2B A;  1TJ6 A;  4DXA B;  3DXC A;  2UZR A;  1U5G A;  2E2X A;  3PSC A;  1V5P A;  1H4R A;  1OQN A;  5HE2 A;  2OQB A;  4GXB A;  1PFJ A;  5DHF B;  5HE3 A;  5D27 A;  2MKR A;  3NSU A;  3P6A A;  3WA0 A;  1ZSQ A;  2I1J A;  1MIZ B;  4F7H A;  3AU4 A;  3DXD A;  3M1I B;  3ZVR A;  2DHI A;  2NMB A;  4ZRI A;  2I5F A;  2LKO A;  4MT7 A;  2W2X C;  3SV1 A;  5KQ1 A;  4HAZ B;  3TO1 A;  1EF1 A;  2M38 A;  4HAW B;  3OAN A;  2D4Q A;  4GMX B;  1SGH A;  2COA A;  3UZT A;  3X23 A;  5JLJ B;  1MPH A;  1RRP B;  2DX5 A;  2Y8F A;  2RLO A;  2D9W A;  2HE7 A;  1X1F A;  2H7D A;  2Y7B A;  3A8P A;  4KAX B;  2YS5 A;  2DX1 A;  3PVW A;  2V76 A;  4L6E A;  3PZD A;  2P0F A;  4GMV A;  4KHO A;  2DN6 A;  2NZ8 B;  1U29 A;  5DHA B;  2BCJ A;  1Z87 A;  2Q13 A;  4D0N B;  3RCP A;  1PLS A;  1KZG A;  5EFX A;  2YRY A;  3HK0 A;  1GG3 A;  2RVB B;  4Y94 A;  1XX0 A;  1I7A A;  2YS1 A;  4B6H A;  5CLQ B;  2R0D A;  1DBH A;  3GYP A;  5KQ4 A;  5JHG A;  4TKN A;  2OTX A;  1ZM0 A;  4K2O A;  3SUZ A;  1E5W A;  2N23 A;  4HAV B;  1DDM A;  2K2U A;  3LJU X;  3TCA A;  3V5W A;  4DX9 0;  3MDB C;  4A6F B;  4HDQ A;  3PG7 A;  3TW1 A;  4H8S A;  1Y5O A;  1LW3 A;  1W1D A;  2JP2 A;  1UPQ A;  1QQG A;  1W1H A;  4HB4 B;  2CRF A;  1OMW A;  3AU5 A;  1MKE A;  5JP4 A;  1FHX A;  1AWE A;  2I5C A;  3SO6 A;  2YSZ A;  2VKI A;  3A8Q A;  1WJM A;  1P3R A;  5LON B;  3D8F A;  4A6H A;  1XR0 B;  3D8D A;  1V88 A;  2XQN M;  4Z2M B;  4GN1 A;  3TVV A;  2AEH A;  3PVL A;  1WGQ A;  4NY0 A;  4DBB A;  2MFQ A;  3T06 A;  1N3H A;  2D9Y A;  4HDO A;  2Z0Q A;  1MAI A;  4HB0 B;  1NTY A;  2D9Z A;  2LOZ A;  4P7I A;  4DX8 A;  1UNQ A;  4IAP A;  1P6S A;  2EC1 A;  1NTV A;  2DA0 A;  1NI2 A;  1WJ1 A;  1DDW A;  3CXB B;  2Z0P A;  2QKM A;  2RUK B;  1WG7 A;  1XCG A;  4XWX A;  1BTN A;  2UZS A;  4HB2 B;  2H7E A;  1U5D A;  4YON A;  1EVH A;  2R09 A;  4A6F A;  1DRO A;  5GOW B;  1XOD A;  3IVF A;  5KCV A;  2J0M A;  1U27 A;  1MK7 B;  4HHV A;  1TXD A;  5DIF B;  2EJ8 A;  2L2I A;  5C79 A;  2KGX B;  1ZC4 B;  2FJL A;  2COF A;  2DTC A;  4IOY X;  4EMO A;  4KHA A;  1K5D B;  4MK0 A;  1Y19 B;  4A6K A;  1TQZ A;  2J0J A;  2VRW B;  2MWN B;  2HTH B;  4CHJ A;  5C5B B;  1V89 A;  3KRW A;  2DFK A;  1MK9 B;  2KUP A;  2DKP A;  3PP2 A;  3GYO A;  1UEF A;  2EMT A;  2L1C A;  1KI1 B;  4K17 A;  2KCJ A;  3QBV B;  5D3W A;  5DI9 B;  1BTK A;  4PQ0 A;  3PEG A;  3CIK A;  1W1G A;  4K2P A;  3PVU A;  1FB8 A;  3FEH A;  1V5M A;  4HAX B;  3TFM A;  2ROZ B;  1U5F A;  2D2Q A;  2DLW A;  2Y8G A;  1U5E A;  4HB3 B;  1EGX A;  2X18 A;  1IRS A;  2QKL A;  5J3Q A;  1MIX A;  4PNK A;  2YT0 A;  1X11 A;  2DYN A;  2IFS A;  4MY6 A; 
#chains in the Genus database with same CATH topology
 1X86 A;  3ULC A;  3OHM B;  4TYZ A;  3ODW A;  2LYD A;  2MDX A;  2EMS A;  3SNH A;  1KZ7 A;  5C16 A;  3ULB A;  1I2H A;  3A98 B;  2ZPY A;  2P8V A;  2J59 M;  5CLL B;  2D11 A;  1LB1 A;  5JHH A;  4EJN A;  1FGY A;  3KZ1 A;  2RGN B;  2YF0 A;  5L81 A;  4WSF A;  2COD A;  4Z2N A;  2YS3 A;  4GNK B;  2W2W A;  5J3T A;  1ISN A;  2R2Y A;  1WI1 A;  1M7E A;  5D3X A;  4IFS A;  3QWM A;  4CYE A;  3NW8 A;  1OY2 A;  1UPR A;  1DYN A;  2YVC A;  2M14 A;  3KRX A;  1WVH A;  5C5B A;  2GCJ A;  2GCL A;  2K00 A;  1XD4 A;  2DKQ A;  4C0A A;  1GC6 A;  3D8E A;  2VSZ A;  4GZU A;  1UNP A;  4QJ4 B;  3ODX A;  2LOX A;  3KSY A;  4KHB B;  1X05 A;  4WJ7 A;  5I2M A;  4CSQ A;  2W2X D;  3P7Z A;  2D9V A;  2PZ1 A;  5FI1 A;  5HE1 A;  2I1K A;  5C6R A;  2CY5 A;  2UVM A;  2LUL A;  1UNR A;  3HQC A;  4HAU B;  1FOE A;  4BBK A;  1PMS A;  1XKE A;  2RRF A;  4GPT B;  2G35 A;  3KY9 A;  5LOP B;  2Z59 A;  3F0W A;  2COC A;  5D3Y A;  2Z0O A;  3B77 A;  3SYX A;  1WGU A;  3DXE A;  3FVC A;  2P0H A;  1SHC A;  2N0Y A;  2YT1 A;  3QIJ A;  2KIE A;  3VOQ A;  1X1G A;  2K2J A;  2GJY A;  1NU2 A;  3BIN A;  2LG1 A;  1J19 A;  2RSG A;  1ZC3 B;  3ML4 A;  5J3Y A;  3NWA A;  3HW2 B;  1P5T A;  3VIA A;  1QC6 A;  4HAY B;  2P0D A;  4NSW A;  1ZVR A;  4F7G A;  1FGZ A;  2K8E A;  2DYQ A;  3U8Z A;  4K81 A;  1V5U A;  2Z13 A;  2J0K A;  4HAT B;  1M7R A;  1V61 A;  1RJ2 A;  5HE0 A;  3FM8 C;  2ELA A;  2ELB A;  1EAZ A;  4CHM A;  1BWN A;  4ZRK A;  3G9W A;  2DHK A;  3O96 A;  1GC7 A;  3N7C A;  5D3V A;  2D10 A;  1J0W A;  1FHO A;  3F5R A;  1K5G B;  3U7D A;  2DHJ A;  2CAY A;  3ODO A;  3BJI A;  4YL8 A;  5DH9 B;  1FHW A;  3ZDT A;  3FSS A;  2AL6 A;  4F7U P;  1DDV A;  2GS0 A;  1BAK A;  1H10 A;  1Q67 A;  1AQC A;  4KHB A;  2CY4 A;  2D9X A;  4ZRJ A;  2IYB A;  3AJ4 A;  1B55 A;  2ROV A;  4A5K A;  3MPX A;  4QJ3 B;  4KVG B;  4EKU A;  1FAO A;  4WVF B;  5FI0 A;  2ADZ A;  3WYF B;  2RNR B;  1U2B A;  1TJ6 A;  4DXA B;  3DXC A;  2UZR A;  1U5G A;  2E2X A;  3PSC A;  1V5P A;  1H4R A;  1OQN A;  5HE2 A;  2OQB A;  4GXB A;  1PFJ A;  5DHF B;  5HE3 A;  5D27 A;  2MKR A;  3NSU A;  3P6A A;  3WA0 A;  1ZSQ A;  2I1J A;  1MIZ B;  4F7H A;  4HSI A;  3DXD A;  3AU4 A;  3M1I B;  3ZVR A;  2DHI A;  2NMB A;  4ZRI A;  2I5F A;  2LKO A;  4MT7 A;  2W2X C;  3SV1 A;  5KQ1 A;  4HAZ B;  3TO1 A;  4QJ5 B;  1EF1 A;  2M38 A;  4HAW B;  3OAN A;  2D4Q A;  4GMX B;  1SGH A;  2COA A;  3UZT A;  3X23 A;  5JLJ B;  1MPH A;  2KUQ A;  1RRP B;  2DX5 A;  2Y8F A;  2RLO A;  2Z4D A;  2D9W A;  2HE7 A;  1X1F A;  2H7D A;  2Y7B A;  3A8P A;  4KAX B;  2YS5 A;  2DX1 A;  3PVW A;  2V76 A;  4L6E A;  3PZD A;  2P0F A;  4GMV A;  3U12 A;  4KHO A;  2DN6 A;  2NZ8 B;  1U29 A;  5DHA B;  2BCJ A;  1Z87 A;  2Q13 A;  4D0N B;  3RCP A;  5LG4 B;  1PLS A;  1KZG A;  5EFX A;  2YRY A;  4D6W A;  3HK0 A;  1GG3 A;  2RVB B;  4Y94 A;  1XX0 A;  2K49 A;  1I7A A;  2Z14 A;  2YS1 A;  4DIX A;  4B6H A;  5CLQ B;  2R0D A;  5M4Y B;  1DBH A;  3GYP A;  5KQ4 A;  5JHG A;  4TKN A;  2OTX A;  1ZM0 A;  3NWF A;  4K2O A;  3SUZ A;  1E5W A;  1ZYI A;  2N23 A;  4HAV B;  1DDM A;  2K2U A;  3LJU X;  3TCA A;  2KR0 A;  3V5W A;  4DX9 0;  3MDB C;  4A6F B;  4QXA B;  4HDQ A;  3PG7 A;  3TW1 A;  4H8S A;  1Y5O A;  1LW3 A;  1W1D A;  2JP2 A;  3HSA A;  1UPQ A;  1QQG A;  1W1H A;  4HB4 B;  2CRF A;  1OMW A;  3AU5 A;  1MKE A;  5JP4 A;  1FHX A;  1AWE A;  2I5C A;  3SO6 A;  2YSZ A;  2VKI A;  3A8Q A;  1WJM A;  1P3R A;  5LON B;  3D8F A;  4A6H A;  1XR0 B;  3D8D A;  1V88 A;  2XQN M;  2NBV A;  4Z2M B;  4GN1 A;  3TVV A;  2AEH A;  3PVL A;  1WGQ A;  4NY0 A;  4DBB A;  1MI1 A;  4L1R A;  2MFQ A;  3T06 A;  1N3H A;  2D9Y A;  4HDO A;  2Z0Q A;  1MAI A;  4HB0 B;  1NTY A;  2D9Z A;  5IRS A;  2LOZ A;  4P7I A;  4DX8 A;  1UNQ A;  4IAP A;  1P6S A;  2EC1 A;  1NTV A;  2DA0 A;  1NI2 A;  1WJ1 A;  1DDW A;  3CXB B;  1T77 A;  2Z0P A;  2QKM A;  2RUK B;  1WG7 A;  1XCG A;  2KIG A;  4XWX A;  1BTN A;  2UZS A;  4HB2 B;  2ZKM X;  2H7E A;  1U5D A;  4YON A;  1EVH A;  2R09 A;  4A6F A;  1DRO A;  5GOW B;  1XOD A;  3IVF A;  5KCV A;  2J0M A;  1U27 A;  1MK7 B;  4HHV A;  1TXD A;  5DIF B;  2EJ8 A;  2L2I A;  3DCX A;  5C79 A;  2KGX B;  1ZC4 B;  2FJL A;  2COF A;  2DTC A;  4IOY X;  4EMO A;  4KHA A;  4GOU A;  1K5D B;  4MK0 A;  1Y19 B;  4A6K A;  1TQZ A;  2J0J A;  2VRW B;  2MWN B;  2HTH B;  4CHJ A;  5C5B B;  1V89 A;  3KRW A;  2DFK A;  3A58 A;  1MK9 B;  2KUP A;  5I2S A;  2DKP A;  3PP2 A;  3GYO A;  1UEF A;  2EMT A;  2L1C A;  1KI1 B;  4K17 A;  2KCJ A;  3QBV B;  5D3W A;  4OSN A;  5DI9 B;  2FJU B;  1BTK A;  4PQ0 A;  3PEG A;  3CIK A;  4OT1 A;  2GUM A;  1W1G A;  4K2P A;  3PVU A;  1FB8 A;  3FEH A;  1V5M A;  4HAX B;  3NWD A;  3TFM A;  2ROZ B;  1U5F A;  2D2Q A;  2DLW A;  3HIE A;  2Y8G A;  1U5E A;  4HB3 B;  1EGX A;  2X18 A;  1IRS A;  2QKL A;  5J3Q A;  1MIX A;  2YT2 A;  4PNK A;  2YT0 A;  1X11 A;  2DYN A;  2IFS A;  4MY6 A; 
#chains in the Genus database with same CATH homology
 1X86 A;  3ULC A;  4TYZ A;  3ODW A;  2LYD A;  2MDX A;  2EMS A;  3SNH A;  1KZ7 A;  5C16 A;  3ULB A;  1I2H A;  3A98 B;  2ZPY A;  2P8V A;  2J59 M;  5CLL B;  2D11 A;  1LB1 A;  5JHH A;  4EJN A;  1FGY A;  3KZ1 A;  2RGN B;  2YF0 A;  5L81 A;  4WSF A;  2COD A;  4Z2N A;  2YS3 A;  2W2W A;  5J3T A;  1ISN A;  1WI1 A;  1M7E A;  5D3X A;  4IFS A;  3QWM A;  4CYE A;  1OY2 A;  1UPR A;  1DYN A;  2YVC A;  2M14 A;  3KRX A;  1WVH A;  5C5B A;  2GCJ A;  2GCL A;  2K00 A;  1XD4 A;  2DKQ A;  4C0A A;  1GC6 A;  3D8E A;  2VSZ A;  4GZU A;  1UNP A;  3ODX A;  2LOX A;  3KSY A;  4KHB B;  1X05 A;  4WJ7 A;  2W2X D;  3P7Z A;  2D9V A;  2PZ1 A;  5FI1 A;  5HE1 A;  2I1K A;  5C6R A;  2CY5 A;  2UVM A;  2LUL A;  1UNR A;  3HQC A;  4HAU B;  1FOE A;  4BBK A;  1PMS A;  1XKE A;  4GPT B;  2G35 A;  3KY9 A;  5LOP B;  3F0W A;  2COC A;  5D3Y A;  2Z0O A;  3SYX A;  1WGU A;  3DXE A;  2P0H A;  1SHC A;  2N0Y A;  2YT1 A;  3QIJ A;  3VOQ A;  1X1G A;  2K2J A;  2GJY A;  1NU2 A;  3BIN A;  2LG1 A;  1J19 A;  2RSG A;  1ZC3 B;  3ML4 A;  5J3Y A;  3HW2 B;  1P5T A;  3VIA A;  1QC6 A;  4HAY B;  2P0D A;  4NSW A;  1ZVR A;  4F7G A;  1FGZ A;  2DYQ A;  3U8Z A;  4K81 A;  1V5U A;  2J0K A;  4HAT B;  1M7R A;  1V61 A;  1RJ2 A;  5HE0 A;  3FM8 C;  2ELA A;  2ELB A;  1EAZ A;  4CHM A;  1BWN A;  4ZRK A;  3G9W A;  2DHK A;  3O96 A;  1GC7 A;  3N7C A;  5D3V A;  2D10 A;  1J0W A;  1FHO A;  3F5R A;  1K5G B;  3U7D A;  2DHJ A;  2CAY A;  3ODO A;  3BJI A;  4YL8 A;  5DH9 B;  1FHW A;  3ZDT A;  3FSS A;  2AL6 A;  4F7U P;  1DDV A;  2GS0 A;  1BAK A;  1H10 A;  1Q67 A;  1AQC A;  2CY4 A;  2D9X A;  4ZRJ A;  2IYB A;  3AJ4 A;  1B55 A;  2ROV A;  4A5K A;  3MPX A;  4KVG B;  4EKU A;  1FAO A;  4WVF B;  5FI0 A;  2ADZ A;  3WYF B;  2RNR B;  1U2B A;  1TJ6 A;  4DXA B;  3DXC A;  2UZR A;  1U5G A;  2E2X A;  3PSC A;  1V5P A;  1H4R A;  1OQN A;  5HE2 A;  2OQB A;  4GXB A;  1PFJ A;  5DHF B;  5HE3 A;  5D27 A;  2MKR A;  3NSU A;  3P6A A;  3WA0 A;  1ZSQ A;  2I1J A;  1MIZ B;  4F7H A;  3AU4 A;  3DXD A;  3M1I B;  3ZVR A;  2DHI A;  2NMB A;  4ZRI A;  2I5F A;  2LKO A;  4MT7 A;  2W2X C;  3SV1 A;  5KQ1 A;  4HAZ B;  3TO1 A;  1EF1 A;  2M38 A;  4HAW B;  3OAN A;  2D4Q A;  4GMX B;  1SGH A;  2COA A;  3UZT A;  3X23 A;  5JLJ B;  1MPH A;  1RRP B;  2DX5 A;  2Y8F A;  2RLO A;  2D9W A;  2HE7 A;  1X1F A;  2H7D A;  2Y7B A;  3A8P A;  4KAX B;  2YS5 A;  2DX1 A;  3PVW A;  2V76 A;  4L6E A;  3PZD A;  2P0F A;  4GMV A;  4KHO A;  2DN6 A;  2NZ8 B;  1U29 A;  5DHA B;  2BCJ A;  1Z87 A;  2Q13 A;  4D0N B;  3RCP A;  1PLS A;  1KZG A;  5EFX A;  2YRY A;  3HK0 A;  1GG3 A;  2RVB B;  4Y94 A;  1XX0 A;  1I7A A;  2YS1 A;  4B6H A;  5CLQ B;  2R0D A;  1DBH A;  3GYP A;  5KQ4 A;  5JHG A;  4TKN A;  2OTX A;  1ZM0 A;  4K2O A;  3SUZ A;  1E5W A;  2N23 A;  4HAV B;  1DDM A;  2K2U A;  3LJU X;  3TCA A;  3V5W A;  4DX9 0;  3MDB C;  4A6F B;  4HDQ A;  3PG7 A;  3TW1 A;  4H8S A;  1Y5O A;  1LW3 A;  1W1D A;  2JP2 A;  1UPQ A;  1QQG A;  1W1H A;  4HB4 B;  2CRF A;  1OMW A;  3AU5 A;  1MKE A;  5JP4 A;  1FHX A;  1AWE A;  2I5C A;  3SO6 A;  2YSZ A;  2VKI A;  3A8Q A;  1WJM A;  1P3R A;  5LON B;  3D8F A;  4A6H A;  1XR0 B;  3D8D A;  1V88 A;  2XQN M;  4Z2M B;  4GN1 A;  3TVV A;  2AEH A;  3PVL A;  1WGQ A;  4NY0 A;  4DBB A;  2MFQ A;  3T06 A;  1N3H A;  2D9Y A;  4HDO A;  2Z0Q A;  1MAI A;  4HB0 B;  1NTY A;  2D9Z A;  2LOZ A;  4P7I A;  4DX8 A;  1UNQ A;  4IAP A;  1P6S A;  2EC1 A;  1NTV A;  2DA0 A;  1NI2 A;  1WJ1 A;  1DDW A;  3CXB B;  2Z0P A;  2QKM A;  2RUK B;  1WG7 A;  1XCG A;  4XWX A;  1BTN A;  2UZS A;  4HB2 B;  2H7E A;  1U5D A;  4YON A;  1EVH A;  2R09 A;  4A6F A;  1DRO A;  5GOW B;  1XOD A;  3IVF A;  5KCV A;  2J0M A;  1U27 A;  1MK7 B;  4HHV A;  1TXD A;  5DIF B;  2EJ8 A;  2L2I A;  5C79 A;  2KGX B;  1ZC4 B;  2FJL A;  2COF A;  2DTC A;  4IOY X;  4EMO A;  4KHA A;  1K5D B;  4MK0 A;  1Y19 B;  4A6K A;  1TQZ A;  2J0J A;  2VRW B;  2MWN B;  2HTH B;  4CHJ A;  5C5B B;  1V89 A;  3KRW A;  2DFK A;  1MK9 B;  2KUP A;  2DKP A;  3PP2 A;  3GYO A;  1UEF A;  2EMT A;  2L1C A;  1KI1 B;  4K17 A;  2KCJ A;  3QBV B;  5D3W A;  5DI9 B;  1BTK A;  4PQ0 A;  3PEG A;  3CIK A;  1W1G A;  4K2P A;  3PVU A;  1FB8 A;  3FEH A;  1V5M A;  4HAX B;  3TFM A;  2ROZ B;  1U5F A;  2D2Q A;  2DLW A;  2Y8G A;  1U5E A;  4HB3 B;  1EGX A;  2X18 A;  1IRS A;  2QKL A;  5J3Q A;  1MIX A;  4PNK A;  2YT0 A;  1X11 A;  2DYN A;  2IFS A;  4MY6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...