1TQZA

Solution structure of necap1 protein
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
133
structure length
133
Chain Sequence
MAAELEYESVLCVKPDVSVYRIPPRASNRGYRASDWKLDQPDWTGRLRITSKGKIAYIKLEDKVSGELFAQAPVEQYPGIAVETVTDSSRYFVIRIQDGTGRSAFIGIGFTDRGDAFDFNVSLQDHFKWVKQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NECAP1
publication title Solution structure of NECAP1 protein
rcsb
source organism Mus musculus
molecule tags Endocytosis/exocytosis
total genus 14
structure length 133
sequence length 133
ec nomenclature
pdb deposition date 2004-06-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 1tqzA01
3ZDTA 2I1KA 1MIZB 5D3WA 1IRSA 4GN1A 4MY6A 1TQZA 2GCLA 1H4RA 1BAKA 3U7DA 3U8ZA 3FSSA 2CY5A 1FGYA 4YL8A 2K2UA 2Q13A 3TFMA 2XQNM 4HAZB 2H7EA 3D8DA 1M7EA 1MAIA 5CLLB 4HATB 4F7GA 1U5FA 3NSUA 2Z0QA 1WJ1A 1MPHA 3G9WA 3M1IB 2DX1A 1UPQA 1MKEA 1UEFA 1XD4A 3KRXA 1QQGA 1K5GB 1Y5OA 3BJIA 2J0KA 2ZPYA 1ZSQA 5D3YA 1RRPB 2P8VA 4PQ0A 5KQ4A 4HAUB 2P0FA 5JHGA 4A6HA 5C6RA 4F7HA 2KGXB 2YS1A 4Y94A 3A98B 1EGXA 3F5RA 5LONB 5J3QA 4K2OA 4ZRKA 1LB1A 3D8EA 3TW1A 2J0JA 3BINA 2RVBB 1NTVA 4WSFA 4GZUA 1ZM0A 1PMSA 5KCVA 1X05A 2LOXA 3N7CA 3PVLA 5DI9B 4HB0B 1UPRA 2LG1A 1WGUA 3FEHA 2JP2A 3A8QA 2BCJA 1GG3A 3KSYA 3PSCA 4Z2NA 2G35A 4L6EA 1U5GA 2LOZA 2DTCA 4HHVA 1X11A 1V88A 1XX0A 1DDMA 2K2JA 2GJYA 3ODWA 3ODXA 2W2WA 1OY2A 2RLOA 3DXDA 4P7IA 1XR0B 4KHBB 4Z2MB 4NSWA 2W2XD 5JHHA 2J0MA 1U27A 5JLJB 4ZRJA 1WG7A 1OMWA 4GMVA 4KHOA 3IVFA 5J3YA 1FOEA 2D2QA 3QIJA 3ULCA 3QWMA 5GOWB 2DN6A 1GC6A 1EAZA 3X23A 2H7DA 1X1GA 3AU5A 1BTKA 2DHKA 3SYXA 4WJ7A 2DA0A 2Y8GA 1WVHA 2OQBA 4WVFB 2D4QA 5KQ1A 4PNKA 3PVWA 3PZDA 1V5UA 1UNPA 2ELBA 3GYOA 2UVMA 1J0WA 3MPXA 2KCJA 2UZRA 1N3HA 2DKPA 5C5BA 3DXCA 1SGHA 1Y19B 4HB4B 1WJMA 4GMXB 3AU4A 2AEHA 1X1FA 1LW3A 1P5TA 1W1GA 2I5FA 1FB8A 2CRFA 1I7AA 2P0HA 1J19A 2HTHB 2COAA 1KZGA 5DHFB 2EJ8A 3ML4A 2I5CA 1PFJA 3RCPA 1DDVA 1V5PA 2FJLA 2RNRB 1MIXA 3PG7A 4K17A 1NU2A 2L1CA 1DDWA 1V89A 2IFSA 1V61A 4C0AA 2AL6A 3LJUX 2PZ1A 2LULA 3TO1A 2ROZB 2CY4A 4YONA 4HAXB 1DYNA 1E5WA 1UNQA 2W2XC 3O96A 4MK0A 1MK9B 3ODOA 4EJNA 3SNHA 1XODA 2NMBA 4HB2B 5HE3A 3OANA 3HW2B 2YVCA 1DROA 2D9VA 1K5DB 4B6HA 2VSZA 2D9ZA 3A8PA 4DX8A 4D0NB 2IYBA 2YS5A 2J59M 4IOYX 3TVVA 4EMOA 4ZRIA 2VRWB 1NTYA 5FI0A 1P6SA 5HE1A 5EFXA 2Z0OA 2EC1A 2X18A 5D27A 5JP4A 3WYFB 1XKEA 1AQCA 4HAWB 3SUZA 4DX90 1X86A 2VKIA 3QBVB 2Y7BA 5HE0A 2R0DA 3PP2A 3P6AA 2QKLA 2M14A 4TYZA 1SHCA 2DHJA 2UZSA 4MT7A 1XCGA 1EVHA 1BWNA 2COCA 4A6FB 2DLWA 1U2BA 5CLQB 4XWXA 3V5WA 1I2HA 1MK7B 2N0YA 1AWEA 3VOQA 2D11A 2ELAA 3VIAA 2RUKB 3UZTA 1FHOA 3D8FA 1U29A 5DIFB 4GXBA 1WI1A 2LYDA 2HE7A 2CAYA 1Z87A 3DXEA 4A6FA 1FGZA 1RJ2A 1PLSA 1UNRA 4IFSA 4K2PA 1W1HA 1EF1A 5FI1A 4HB3B 2L2IA 3T06A 3PEGA 4NY0A 2RGNB 5HE2A 2R09A 3GYPA 4A6KA 1B55A 2YT0A 1ZC3B 2ADZA 4GPTB 2COFA 5D3VA 1BTNA 1DBHA 1TJ6A 4DBBA 3SO6A 2CODA 1QC6A 4DXAB 5J3TA 3HK0A 3ZVRA 5L81A 3KZ1A 2MWNB 1FHXA 1V5MA 5DH9B 4CHJA 2DYNA 4CHMA 3WA0A 2EMSA 2DX5A 4IAPA 4H8SA 3HQCA 3CIKA 1GC7A 2GCJA 1ZC4B 2RSGA 4KAXB 4KHAA 4BBKA 1ZVRA 4TKNA 2QKMA 2YF0A 3PVUA 2K00A 2D9WA 1FAOA 2MKRA 2DKQA 2YSZA 2GS0A 2OTXA 2EMTA 2YS3A 2Z0PA 2DYQA 2E2XA 4F7UP 1KZ7A 4HAYB 1WGQA 1W1DA 5D3XA 2MFQA 3SV1A 3F0WA 1U5EA 3CXBB 4CYEA 1OQNA 2M38A 4HDOA 2MDXA 5C16A 2YT1A 2I1JA 2LKOA 3KY9A 2D9XA 2DFKA 1FHWA 3MDBC 2ROVA 1NI2A 3AJ4A 4HAVB 4KVGB 5DHAB 3FM8C 1P3RA 1TXDA 2N23A 2DHIA 2V76A 3TCAA 1M7RA 2NZ8B 4HDQA 4K81A 4A5KA 1ISNA 2P0DA 1Q67A 4EKUA 3KRWA 1H10A 2KUPA 5C79A 3P7ZA 1KI1B 5LOPB 2YRYA 5C5BB 2D10A 2Y8FA 1U5DA 3ULBA 2D9YA
chains in the Genus database with same CATH superfamily
3ZDTA 2I1KA 1MIZB 5D3WA 1IRSA 4QXAB 4GN1A 4MY6A 1TQZA 2GCLA 1H4RA 4DIXA 1BAKA 3U7DA 3U8ZA 3FSSA 2CY5A 1FGYA 4YL8A 2K2UA 2Q13A 5IRSA 3TFMA 2XQNM 4HAZB 2KR0A 2H7EA 3U12A 3D8DA 1M7EA 1MAIA 5CLLB 4HATB 4F7GA 1U5FA 3NSUA 2Z0QA 1WJ1A 1MPHA 3G9WA 2ZKMX 3M1IB 2DX1A 1UPQA 1MKEA 1UEFA 1XD4A 3KRXA 1QQGA 1K5GB 1Y5OA 3BJIA 2J0KA 2ZPYA 1ZSQA 5D3YA 1RRPB 2P8VA 3HSAA 4PQ0A 5KQ4A 4HAUB 2P0FA 5JHGA 4A6HA 5C6RA 4F7HA 2KGXB 2YS1A 4Y94A 3A98B 2RRFA 1EGXA 3F5RA 5LONB 5J3QA 4K2OA 4ZRKA 1LB1A 3D8EA 3DCXA 3OHMB 3TW1A 5M4YB 2J0JA 3BINA 2RVBB 1NTVA 4WSFA 4GZUA 3B77A 1ZM0A 1PMSA 2FJUB 5KCVA 1X05A 2LOXA 3N7CA 3PVLA 5DI9B 4HB0B 1UPRA 2LG1A 1WGUA 3FEHA 2JP2A 3A8QA 2BCJA 1GG3A 3KSYA 3PSCA 4Z2NA 2G35A 4L6EA 1U5GA 2LOZA 2DTCA 4HHVA 1X11A 1V88A 1XX0A 1DDMA 2K2JA 2GJYA 2Z14A 3ODWA 2Z59A 3ODXA 2W2WA 1OY2A 2RLOA 3DXDA 4P7IA 1XR0B 4KHBB 5LG4B 4Z2MB 4NSWA 2W2XD 5JHHA 2J0MA 1U27A 5JLJB 4ZRJA 1WG7A 1OMWA 4GMVA 2NBVA 4QJ5B 4KHOA 3IVFA 5J3YA 1FOEA 2D2QA 3QIJA 3ULCA 3QWMA 4L1RA 5GOWB 2DN6A 1GC6A 4HSIA 1EAZA 3X23A 2H7DA 1X1GA 3AU5A 1BTKA 2DHKA 3SYXA 4WJ7A 2DA0A 2Y8GA 4KHBA 1WVHA 2OQBA 4WVFB 2D4QA 3FVCA 5KQ1A 4PNKA 1ZYIA 3PVWA 3PZDA 1V5UA 1UNPA 2ELBA 3GYOA 2UVMA 1J0WA 3MPXA 2KCJA 2UZRA 1N3HA 2DKPA 5C5BA 3DXCA 3NWAA 1SGHA 1Y19B 4HB4B 1WJMA 4GMXB 3AU4A 2AEHA 1X1FA 1LW3A 1P5TA 1W1GA 2I5FA 1FB8A 2CRFA 1I7AA 2R2YA 2P0HA 1J19A 2HTHB 2COAA 1KZGA 5DHFB 2EJ8A 3ML4A 2I5CA 1PFJA 3RCPA 1DDVA 1V5PA 2FJLA 2RNRB 5I2SA 1MIXA 3PG7A 4K17A 1NU2A 3NW8A 2L1CA 1DDWA 1V89A 2IFSA 1V61A 4C0AA 2AL6A 5I2MA 3LJUX 2KIEA 2PZ1A 2LULA 3TO1A 2ROZB 2Z4DA 2CY4A 4YONA 4HAXB 4CSQA 1DYNA 1E5WA 1UNQA 2W2XC 3O96A 4MK0A 1MK9B 3ODOA 4EJNA 4QJ3B 3SNHA 1XODA 2NMBA 4HB2B 5HE3A 3OANA 3HW2B 2KUQA 2YVCA 1DROA 2D9VA 1K5DB 4B6HA 2VSZA 2D9ZA 3A8PA 4DX8A 4D0NB 2IYBA 2YS5A 2J59M 4IOYX 3TVVA 4EMOA 4ZRIA 2VRWB 1NTYA 5FI0A 1P6SA 5HE1A 5EFXA 2Z0OA 2EC1A 2X18A 5D27A 5JP4A 3WYFB 1XKEA 1AQCA 4HAWB 3SUZA 4DX90 1X86A 2VKIA 3QBVB 2Y7BA 5HE0A 2R0DA 3PP2A 3P6AA 2QKLA 2K8EA 2M14A 4TYZA 1SHCA 2DHJA 2UZSA 4MT7A 1XCGA 1EVHA 1BWNA 2COCA 4A6FB 2DLWA 1U2BA 5CLQB 4XWXA 3V5WA 2YT2A 1I2HA 1MK7B 2N0YA 1AWEA 3VOQA 2D11A 2ELAA 3VIAA 2RUKB 3UZTA 1FHOA 3D8FA 2KIGA 1U29A 1MI1A 2Z13A 5DIFB 4GXBA 1WI1A 2LYDA 2HE7A 2CAYA 1Z87A 3DXEA 2K49A 4A6FA 1FGZA 1RJ2A 1PLSA 1UNRA 4IFSA 4K2PA 1W1HA 1EF1A 5FI1A 4HB3B 2L2IA 3T06A 3PEGA 4NY0A 2RGNB 3NWFA 5HE2A 2R09A 3GYPA 4A6KA 1B55A 2YT0A 1ZC3B 2ADZA 4GPTB 2COFA 1T77A 5D3VA 1BTNA 1DBHA 1TJ6A 4DBBA 3SO6A 3NWDA 4D6WA 2CODA 1QC6A 3A58A 4DXAB 5J3TA 3HK0A 3ZVRA 5L81A 3KZ1A 2MWNB 1FHXA 2GUMA 1V5MA 5DH9B 4CHJA 4OSNA 4GOUA 2DYNA 4QJ4B 4CHMA 3WA0A 2EMSA 2DX5A 4IAPA 4H8SA 3HQCA 3CIKA 1GC7A 2GCJA 1ZC4B 2RSGA 4KAXB 4KHAA 4BBKA 1ZVRA 4TKNA 2QKMA 2YF0A 3PVUA 2K00A 2D9WA 1FAOA 2MKRA 2DKQA 2YSZA 2GS0A 2OTXA 2EMTA 2YS3A 2Z0PA 2DYQA 2E2XA 4F7UP 1KZ7A 4HAYB 1WGQA 1W1DA 5D3XA 2MFQA 3SV1A 3F0WA 1U5EA 3CXBB 3HIEA 4CYEA 1OQNA 2M38A 4HDOA 2MDXA 5C16A 2YT1A 2I1JA 2LKOA 3KY9A 2D9XA 2DFKA 1FHWA 3MDBC 2ROVA 4OT1A 1NI2A 3AJ4A 4HAVB 4KVGB 5DHAB 3FM8C 1P3RA 1TXDA 2N23A 4GNKB 2DHIA 2V76A 3TCAA 1M7RA 2NZ8B 4HDQA 4K81A 4A5KA 1ISNA 2P0DA 1Q67A 4EKUA 3KRWA 1H10A 2KUPA 5C79A 3P7ZA 1KI1B 5LOPB 2YRYA 5C5BB 2D10A 2Y8FA 1U5DA 3ULBA 2D9YA
chains in the Genus database with same CATH topology
3ZDTA 2I1KA 1MIZB 5D3WA 1IRSA 4GN1A 4MY6A 1TQZA 2GCLA 1H4RA 1BAKA 3U7DA 3U8ZA 3FSSA 2CY5A 1FGYA 4YL8A 2K2UA 2Q13A 3TFMA 2XQNM 4HAZB 2H7EA 3D8DA 1M7EA 1MAIA 5CLLB 4HATB 4F7GA 1U5FA 3NSUA 2Z0QA 1WJ1A 1MPHA 3G9WA 3M1IB 2DX1A 1UPQA 1MKEA 1UEFA 1XD4A 3KRXA 1QQGA 1K5GB 1Y5OA 3BJIA 2J0KA 2ZPYA 1ZSQA 5D3YA 1RRPB 2P8VA 4PQ0A 5KQ4A 4HAUB 2P0FA 5JHGA 4A6HA 5C6RA 4F7HA 2KGXB 2YS1A 4Y94A 3A98B 1EGXA 3F5RA 5LONB 5J3QA 4K2OA 4ZRKA 1LB1A 3D8EA 3TW1A 2J0JA 3BINA 2RVBB 1NTVA 4WSFA 4GZUA 1ZM0A 1PMSA 5KCVA 1X05A 2LOXA 3N7CA 3PVLA 5DI9B 4HB0B 1UPRA 2LG1A 1WGUA 3FEHA 2JP2A 3A8QA 2BCJA 1GG3A 3KSYA 3PSCA 4Z2NA 2G35A 4L6EA 1U5GA 2LOZA 2DTCA 4HHVA 1X11A 1V88A 1XX0A 1DDMA 2K2JA 2GJYA 3ODWA 3ODXA 2W2WA 1OY2A 2RLOA 3DXDA 4P7IA 1XR0B 4KHBB 4Z2MB 4NSWA 2W2XD 5JHHA 2J0MA 1U27A 5JLJB 4ZRJA 1WG7A 1OMWA 4GMVA 4KHOA 3IVFA 5J3YA 1FOEA 2D2QA 3QIJA 3ULCA 3QWMA 5GOWB 2DN6A 1GC6A 1EAZA 3X23A 2H7DA 1X1GA 3AU5A 1BTKA 2DHKA 3SYXA 4WJ7A 2DA0A 2Y8GA 1WVHA 2OQBA 4WVFB 2D4QA 5KQ1A 4PNKA 3PVWA 3PZDA 1V5UA 1UNPA 2ELBA 3GYOA 2UVMA 1J0WA 3MPXA 2KCJA 2UZRA 1N3HA 2DKPA 5C5BA 3DXCA 1SGHA 1Y19B 4HB4B 1WJMA 4GMXB 3AU4A 2AEHA 1X1FA 1LW3A 1P5TA 1W1GA 2I5FA 1FB8A 2CRFA 1I7AA 2P0HA 1J19A 2HTHB 2COAA 1KZGA 5DHFB 2EJ8A 3ML4A 2I5CA 1PFJA 3RCPA 1DDVA 1V5PA 2FJLA 2RNRB 1MIXA 3PG7A 4K17A 1NU2A 2L1CA 1DDWA 1V89A 2IFSA 1V61A 4C0AA 2AL6A 3LJUX 2PZ1A 2LULA 3TO1A 2ROZB 2CY4A 4YONA 4HAXB 1DYNA 1E5WA 1UNQA 2W2XC 3O96A 4MK0A 1MK9B 3ODOA 4EJNA 3SNHA 1XODA 2NMBA 4HB2B 5HE3A 3OANA 3HW2B 2YVCA 1DROA 2D9VA 1K5DB 4B6HA 2VSZA 2D9ZA 3A8PA 4DX8A 4D0NB 2IYBA 2YS5A 2J59M 4IOYX 3TVVA 4EMOA 4ZRIA 2VRWB 1NTYA 5FI0A 1P6SA 5HE1A 5EFXA 2Z0OA 2EC1A 2X18A 5D27A 5JP4A 3WYFB 1XKEA 1AQCA 4HAWB 3SUZA 4DX90 1X86A 2VKIA 3QBVB 2Y7BA 5HE0A 2R0DA 3PP2A 3P6AA 2QKLA 2M14A 4TYZA 1SHCA 2DHJA 2UZSA 4MT7A 1XCGA 1EVHA 1BWNA 2COCA 4A6FB 2DLWA 1U2BA 5CLQB 4XWXA 3V5WA 1I2HA 1MK7B 2N0YA 1AWEA 3VOQA 2D11A 2ELAA 3VIAA 2RUKB 3UZTA 1FHOA 3D8FA 1U29A 5DIFB 4GXBA 1WI1A 2LYDA 2HE7A 2CAYA 1Z87A 3DXEA 4A6FA 1FGZA 1RJ2A 1PLSA 1UNRA 4IFSA 4K2PA 1W1HA 1EF1A 5FI1A 4HB3B 2L2IA 3T06A 3PEGA 4NY0A 2RGNB 5HE2A 2R09A 3GYPA 4A6KA 1B55A 2YT0A 1ZC3B 2ADZA 4GPTB 2COFA 5D3VA 1BTNA 1DBHA 1TJ6A 4DBBA 3SO6A 2CODA 1QC6A 4DXAB 5J3TA 3HK0A 3ZVRA 5L81A 3KZ1A 2MWNB 1FHXA 1V5MA 5DH9B 4CHJA 2DYNA 4CHMA 3WA0A 2EMSA 2DX5A 4IAPA 4H8SA 3HQCA 3CIKA 1GC7A 2GCJA 1ZC4B 2RSGA 4KAXB 4KHAA 4BBKA 1ZVRA 4TKNA 2QKMA 2YF0A 3PVUA 2K00A 2D9WA 1FAOA 2MKRA 2DKQA 2YSZA 2GS0A 2OTXA 2EMTA 2YS3A 2Z0PA 2DYQA 2E2XA 4F7UP 1KZ7A 4HAYB 1WGQA 1W1DA 5D3XA 2MFQA 3SV1A 3F0WA 1U5EA 3CXBB 4CYEA 1OQNA 2M38A 4HDOA 2MDXA 5C16A 2YT1A 2I1JA 2LKOA 3KY9A 2D9XA 2DFKA 1FHWA 3MDBC 2ROVA 1NI2A 3AJ4A 4HAVB 4KVGB 5DHAB 3FM8C 1P3RA 1TXDA 2N23A 2DHIA 2V76A 3TCAA 1M7RA 2NZ8B 4HDQA 4K81A 4A5KA 1ISNA 2P0DA 1Q67A 4EKUA 3KRWA 1H10A 2KUPA 5C79A 3P7ZA 1KI1B 5LOPB 2YRYA 5C5BB 2D10A 2Y8FA 1U5DA 3ULBA 2D9YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZDT A;  2I1K A;  1MIZ B;  5D3W A;  1IRS A;  4GN1 A;  4MY6 A;  1TQZ A;  2GCL A;  1H4R A;  1BAK A;  3U7D A;  3U8Z A;  3FSS A;  2CY5 A;  1FGY A;  4YL8 A;  2K2U A;  2Q13 A;  3TFM A;  2XQN M;  4HAZ B;  2H7E A;  3D8D A;  1M7E A;  1MAI A;  5CLL B;  4HAT B;  4F7G A;  1U5F A;  3NSU A;  2Z0Q A;  1WJ1 A;  1MPH A;  3G9W A;  3M1I B;  2DX1 A;  1UPQ A;  1MKE A;  1UEF A;  1XD4 A;  3KRX A;  1QQG A;  1K5G B;  1Y5O A;  3BJI A;  2J0K A;  2ZPY A;  1ZSQ A;  5D3Y A;  1RRP B;  2P8V A;  4PQ0 A;  5KQ4 A;  4HAU B;  2P0F A;  5JHG A;  4A6H A;  5C6R A;  4F7H A;  2KGX B;  2YS1 A;  4Y94 A;  3A98 B;  1EGX A;  3F5R A;  5LON B;  5J3Q A;  4K2O A;  4ZRK A;  1LB1 A;  3D8E A;  3TW1 A;  2J0J A;  3BIN A;  2RVB B;  1NTV A;  4WSF A;  4GZU A;  1ZM0 A;  1PMS A;  5KCV A;  1X05 A;  2LOX A;  3N7C A;  3PVL A;  5DI9 B;  4HB0 B;  1UPR A;  2LG1 A;  1WGU A;  3FEH A;  2JP2 A;  3A8Q A;  2BCJ A;  1GG3 A;  3KSY A;  3PSC A;  4Z2N A;  2G35 A;  4L6E A;  1U5G A;  2LOZ A;  2DTC A;  4HHV A;  1X11 A;  1V88 A;  1XX0 A;  1DDM A;  2K2J A;  2GJY A;  3ODW A;  3ODX A;  2W2W A;  1OY2 A;  2RLO A;  3DXD A;  4P7I A;  1XR0 B;  4KHB B;  4Z2M B;  4NSW A;  2W2X D;  5JHH A;  2J0M A;  1U27 A;  5JLJ B;  4ZRJ A;  1WG7 A;  1OMW A;  4GMV A;  4KHO A;  3IVF A;  5J3Y A;  1FOE A;  2D2Q A;  3QIJ A;  3ULC A;  3QWM A;  5GOW B;  2DN6 A;  1GC6 A;  1EAZ A;  3X23 A;  2H7D A;  1X1G A;  3AU5 A;  1BTK A;  2DHK A;  3SYX A;  4WJ7 A;  2DA0 A;  2Y8G A;  1WVH A;  2OQB A;  4WVF B;  2D4Q A;  5KQ1 A;  4PNK A;  3PVW A;  3PZD A;  1V5U A;  1UNP A;  2ELB A;  3GYO A;  2UVM A;  1J0W A;  3MPX A;  2KCJ A;  2UZR A;  1N3H A;  2DKP A;  5C5B A;  3DXC A;  1SGH A;  1Y19 B;  4HB4 B;  1WJM A;  4GMX B;  3AU4 A;  2AEH A;  1X1F A;  1LW3 A;  1P5T A;  1W1G A;  2I5F A;  1FB8 A;  2CRF A;  1I7A A;  2P0H A;  1J19 A;  2HTH B;  2COA A;  1KZG A;  5DHF B;  2EJ8 A;  3ML4 A;  2I5C A;  1PFJ A;  3RCP A;  1DDV A;  1V5P A;  2FJL A;  2RNR B;  1MIX A;  3PG7 A;  4K17 A;  1NU2 A;  2L1C A;  1DDW A;  1V89 A;  2IFS A;  1V61 A;  4C0A A;  2AL6 A;  3LJU X;  2PZ1 A;  2LUL A;  3TO1 A;  2ROZ B;  2CY4 A;  4YON A;  4HAX B;  1DYN A;  1E5W A;  1UNQ A;  2W2X C;  3O96 A;  4MK0 A;  1MK9 B;  3ODO A;  4EJN A;  3SNH A;  1XOD A;  2NMB A;  4HB2 B;  5HE3 A;  3OAN A;  3HW2 B;  2YVC A;  1DRO A;  2D9V A;  1K5D B;  4B6H A;  2VSZ A;  2D9Z A;  3A8P A;  4DX8 A;  4D0N B;  2IYB A;  2YS5 A;  2J59 M;  4IOY X;  3TVV A;  4EMO A;  4ZRI A;  2VRW B;  1NTY A;  5FI0 A;  1P6S A;  5HE1 A;  5EFX A;  2Z0O A;  2EC1 A;  2X18 A;  5D27 A;  5JP4 A;  3WYF B;  1XKE A;  1AQC A;  4HAW B;  3SUZ A;  4DX9 0;  1X86 A;  2VKI A;  3QBV B;  2Y7B A;  5HE0 A;  2R0D A;  3PP2 A;  3P6A A;  2QKL A;  2M14 A;  4TYZ A;  1SHC A;  2DHJ A;  2UZS A;  4MT7 A;  1XCG A;  1EVH A;  1BWN A;  2COC A;  4A6F B;  2DLW A;  1U2B A;  5CLQ B;  4XWX A;  3V5W A;  1I2H A;  1MK7 B;  2N0Y A;  1AWE A;  3VOQ A;  2D11 A;  2ELA A;  3VIA A;  2RUK B;  3UZT A;  1FHO A;  3D8F A;  1U29 A;  5DIF B;  4GXB A;  1WI1 A;  2LYD A;  2HE7 A;  2CAY A;  1Z87 A;  3DXE A;  4A6F A;  1FGZ A;  1RJ2 A;  1PLS A;  1UNR A;  4IFS A;  4K2P A;  1W1H A;  1EF1 A;  5FI1 A;  4HB3 B;  2L2I A;  3T06 A;  3PEG A;  4NY0 A;  2RGN B;  5HE2 A;  2R09 A;  3GYP A;  4A6K A;  1B55 A;  2YT0 A;  1ZC3 B;  2ADZ A;  4GPT B;  2COF A;  5D3V A;  1BTN A;  1DBH A;  1TJ6 A;  4DBB A;  3SO6 A;  2COD A;  1QC6 A;  4DXA B;  5J3T A;  3HK0 A;  3ZVR A;  5L81 A;  3KZ1 A;  2MWN B;  1FHX A;  1V5M A;  5DH9 B;  4CHJ A;  2DYN A;  4CHM A;  3WA0 A;  2EMS A;  2DX5 A;  4IAP A;  4H8S A;  3HQC A;  3CIK A;  1GC7 A;  2GCJ A;  1ZC4 B;  2RSG A;  4KAX B;  4KHA A;  4BBK A;  1ZVR A;  4TKN A;  2QKM A;  2YF0 A;  3PVU A;  2K00 A;  2D9W A;  1FAO A;  2MKR A;  2DKQ A;  2YSZ A;  2GS0 A;  2OTX A;  2EMT A;  2YS3 A;  2Z0P A;  2DYQ A;  2E2X A;  4F7U P;  1KZ7 A;  4HAY B;  1WGQ A;  1W1D A;  5D3X A;  2MFQ A;  3SV1 A;  3F0W A;  1U5E A;  3CXB B;  4CYE A;  1OQN A;  2M38 A;  4HDO A;  2MDX A;  5C16 A;  2YT1 A;  2I1J A;  2LKO A;  3KY9 A;  2D9X A;  2DFK A;  1FHW A;  3MDB C;  2ROV A;  1NI2 A;  3AJ4 A;  4HAV B;  4KVG B;  5DHA B;  3FM8 C;  1P3R A;  1TXD A;  2N23 A;  2DHI A;  2V76 A;  3TCA A;  1M7R A;  2NZ8 B;  4HDQ A;  4K81 A;  4A5K A;  1ISN A;  2P0D A;  1Q67 A;  4EKU A;  3KRW A;  1H10 A;  2KUP A;  5C79 A;  3P7Z A;  1KI1 B;  5LOP B;  2YRY A;  5C5B B;  2D10 A;  2Y8F A;  1U5D A;  3ULB A;  2D9Y A; 
#chains in the Genus database with same CATH topology
 3ZDT A;  2I1K A;  1MIZ B;  5D3W A;  1IRS A;  4QXA B;  4GN1 A;  4MY6 A;  1TQZ A;  2GCL A;  1H4R A;  4DIX A;  1BAK A;  3U7D A;  3U8Z A;  3FSS A;  2CY5 A;  1FGY A;  4YL8 A;  2K2U A;  2Q13 A;  5IRS A;  3TFM A;  2XQN M;  4HAZ B;  2KR0 A;  2H7E A;  3U12 A;  3D8D A;  1M7E A;  1MAI A;  5CLL B;  4HAT B;  4F7G A;  1U5F A;  3NSU A;  2Z0Q A;  1WJ1 A;  1MPH A;  3G9W A;  2ZKM X;  3M1I B;  2DX1 A;  1UPQ A;  1MKE A;  1UEF A;  1XD4 A;  3KRX A;  1QQG A;  1K5G B;  1Y5O A;  3BJI A;  2J0K A;  2ZPY A;  1ZSQ A;  5D3Y A;  1RRP B;  2P8V A;  3HSA A;  4PQ0 A;  5KQ4 A;  4HAU B;  2P0F A;  5JHG A;  4A6H A;  5C6R A;  4F7H A;  2KGX B;  2YS1 A;  4Y94 A;  3A98 B;  2RRF A;  1EGX A;  3F5R A;  5LON B;  5J3Q A;  4K2O A;  4ZRK A;  1LB1 A;  3D8E A;  3DCX A;  3OHM B;  3TW1 A;  5M4Y B;  2J0J A;  3BIN A;  2RVB B;  1NTV A;  4WSF A;  4GZU A;  3B77 A;  1ZM0 A;  1PMS A;  2FJU B;  5KCV A;  1X05 A;  2LOX A;  3N7C A;  3PVL A;  5DI9 B;  4HB0 B;  1UPR A;  2LG1 A;  1WGU A;  3FEH A;  2JP2 A;  3A8Q A;  2BCJ A;  1GG3 A;  3KSY A;  3PSC A;  4Z2N A;  2G35 A;  4L6E A;  1U5G A;  2LOZ A;  2DTC A;  4HHV A;  1X11 A;  1V88 A;  1XX0 A;  1DDM A;  2K2J A;  2GJY A;  2Z14 A;  3ODW A;  2Z59 A;  3ODX A;  2W2W A;  1OY2 A;  2RLO A;  3DXD A;  4P7I A;  1XR0 B;  4KHB B;  5LG4 B;  4Z2M B;  4NSW A;  2W2X D;  5JHH A;  2J0M A;  1U27 A;  5JLJ B;  4ZRJ A;  1WG7 A;  1OMW A;  4GMV A;  2NBV A;  4QJ5 B;  4KHO A;  3IVF A;  5J3Y A;  1FOE A;  2D2Q A;  3QIJ A;  3ULC A;  3QWM A;  4L1R A;  5GOW B;  2DN6 A;  1GC6 A;  4HSI A;  1EAZ A;  3X23 A;  2H7D A;  1X1G A;  3AU5 A;  1BTK A;  2DHK A;  3SYX A;  4WJ7 A;  2DA0 A;  2Y8G A;  4KHB A;  1WVH A;  2OQB A;  4WVF B;  2D4Q A;  3FVC A;  5KQ1 A;  4PNK A;  1ZYI A;  3PVW A;  3PZD A;  1V5U A;  1UNP A;  2ELB A;  3GYO A;  2UVM A;  1J0W A;  3MPX A;  2KCJ A;  2UZR A;  1N3H A;  2DKP A;  5C5B A;  3DXC A;  3NWA A;  1SGH A;  1Y19 B;  4HB4 B;  1WJM A;  4GMX B;  3AU4 A;  2AEH A;  1X1F A;  1LW3 A;  1P5T A;  1W1G A;  2I5F A;  1FB8 A;  2CRF A;  1I7A A;  2R2Y A;  2P0H A;  1J19 A;  2HTH B;  2COA A;  1KZG A;  5DHF B;  2EJ8 A;  3ML4 A;  2I5C A;  1PFJ A;  3RCP A;  1DDV A;  1V5P A;  2FJL A;  2RNR B;  5I2S A;  1MIX A;  3PG7 A;  4K17 A;  1NU2 A;  3NW8 A;  2L1C A;  1DDW A;  1V89 A;  2IFS A;  1V61 A;  4C0A A;  2AL6 A;  5I2M A;  3LJU X;  2KIE A;  2PZ1 A;  2LUL A;  3TO1 A;  2ROZ B;  2Z4D A;  2CY4 A;  4YON A;  4HAX B;  4CSQ A;  1DYN A;  1E5W A;  1UNQ A;  2W2X C;  3O96 A;  4MK0 A;  1MK9 B;  3ODO A;  4EJN A;  4QJ3 B;  3SNH A;  1XOD A;  2NMB A;  4HB2 B;  5HE3 A;  3OAN A;  3HW2 B;  2KUQ A;  2YVC A;  1DRO A;  2D9V A;  1K5D B;  4B6H A;  2VSZ A;  2D9Z A;  3A8P A;  4DX8 A;  4D0N B;  2IYB A;  2YS5 A;  2J59 M;  4IOY X;  3TVV A;  4EMO A;  4ZRI A;  2VRW B;  1NTY A;  5FI0 A;  1P6S A;  5HE1 A;  5EFX A;  2Z0O A;  2EC1 A;  2X18 A;  5D27 A;  5JP4 A;  3WYF B;  1XKE A;  1AQC A;  4HAW B;  3SUZ A;  4DX9 0;  1X86 A;  2VKI A;  3QBV B;  2Y7B A;  5HE0 A;  2R0D A;  3PP2 A;  3P6A A;  2QKL A;  2K8E A;  2M14 A;  4TYZ A;  1SHC A;  2DHJ A;  2UZS A;  4MT7 A;  1XCG A;  1EVH A;  1BWN A;  2COC A;  4A6F B;  2DLW A;  1U2B A;  5CLQ B;  4XWX A;  3V5W A;  2YT2 A;  1I2H A;  1MK7 B;  2N0Y A;  1AWE A;  3VOQ A;  2D11 A;  2ELA A;  3VIA A;  2RUK B;  3UZT A;  1FHO A;  3D8F A;  2KIG A;  1U29 A;  1MI1 A;  2Z13 A;  5DIF B;  4GXB A;  1WI1 A;  2LYD A;  2HE7 A;  2CAY A;  1Z87 A;  3DXE A;  2K49 A;  4A6F A;  1FGZ A;  1RJ2 A;  1PLS A;  1UNR A;  4IFS A;  4K2P A;  1W1H A;  1EF1 A;  5FI1 A;  4HB3 B;  2L2I A;  3T06 A;  3PEG A;  4NY0 A;  2RGN B;  3NWF A;  5HE2 A;  2R09 A;  3GYP A;  4A6K A;  1B55 A;  2YT0 A;  1ZC3 B;  2ADZ A;  4GPT B;  2COF A;  1T77 A;  5D3V A;  1BTN A;  1DBH A;  1TJ6 A;  4DBB A;  3SO6 A;  3NWD A;  4D6W A;  2COD A;  1QC6 A;  3A58 A;  4DXA B;  5J3T A;  3HK0 A;  3ZVR A;  5L81 A;  3KZ1 A;  2MWN B;  1FHX A;  2GUM A;  1V5M A;  5DH9 B;  4CHJ A;  4OSN A;  4GOU A;  2DYN A;  4QJ4 B;  4CHM A;  3WA0 A;  2EMS A;  2DX5 A;  4IAP A;  4H8S A;  3HQC A;  3CIK A;  1GC7 A;  2GCJ A;  1ZC4 B;  2RSG A;  4KAX B;  4KHA A;  4BBK A;  1ZVR A;  4TKN A;  2QKM A;  2YF0 A;  3PVU A;  2K00 A;  2D9W A;  1FAO A;  2MKR A;  2DKQ A;  2YSZ A;  2GS0 A;  2OTX A;  2EMT A;  2YS3 A;  2Z0P A;  2DYQ A;  2E2X A;  4F7U P;  1KZ7 A;  4HAY B;  1WGQ A;  1W1D A;  5D3X A;  2MFQ A;  3SV1 A;  3F0W A;  1U5E A;  3CXB B;  3HIE A;  4CYE A;  1OQN A;  2M38 A;  4HDO A;  2MDX A;  5C16 A;  2YT1 A;  2I1J A;  2LKO A;  3KY9 A;  2D9X A;  2DFK A;  1FHW A;  3MDB C;  2ROV A;  4OT1 A;  1NI2 A;  3AJ4 A;  4HAV B;  4KVG B;  5DHA B;  3FM8 C;  1P3R A;  1TXD A;  2N23 A;  4GNK B;  2DHI A;  2V76 A;  3TCA A;  1M7R A;  2NZ8 B;  4HDQ A;  4K81 A;  4A5K A;  1ISN A;  2P0D A;  1Q67 A;  4EKU A;  3KRW A;  1H10 A;  2KUP A;  5C79 A;  3P7Z A;  1KI1 B;  5LOP B;  2YRY A;  5C5B B;  2D10 A;  2Y8F A;  1U5D A;  3ULB A;  2D9Y A; 
#chains in the Genus database with same CATH homology
 3ZDT A;  2I1K A;  1MIZ B;  5D3W A;  1IRS A;  4GN1 A;  4MY6 A;  1TQZ A;  2GCL A;  1H4R A;  1BAK A;  3U7D A;  3U8Z A;  3FSS A;  2CY5 A;  1FGY A;  4YL8 A;  2K2U A;  2Q13 A;  3TFM A;  2XQN M;  4HAZ B;  2H7E A;  3D8D A;  1M7E A;  1MAI A;  5CLL B;  4HAT B;  4F7G A;  1U5F A;  3NSU A;  2Z0Q A;  1WJ1 A;  1MPH A;  3G9W A;  3M1I B;  2DX1 A;  1UPQ A;  1MKE A;  1UEF A;  1XD4 A;  3KRX A;  1QQG A;  1K5G B;  1Y5O A;  3BJI A;  2J0K A;  2ZPY A;  1ZSQ A;  5D3Y A;  1RRP B;  2P8V A;  4PQ0 A;  5KQ4 A;  4HAU B;  2P0F A;  5JHG A;  4A6H A;  5C6R A;  4F7H A;  2KGX B;  2YS1 A;  4Y94 A;  3A98 B;  1EGX A;  3F5R A;  5LON B;  5J3Q A;  4K2O A;  4ZRK A;  1LB1 A;  3D8E A;  3TW1 A;  2J0J A;  3BIN A;  2RVB B;  1NTV A;  4WSF A;  4GZU A;  1ZM0 A;  1PMS A;  5KCV A;  1X05 A;  2LOX A;  3N7C A;  3PVL A;  5DI9 B;  4HB0 B;  1UPR A;  2LG1 A;  1WGU A;  3FEH A;  2JP2 A;  3A8Q A;  2BCJ A;  1GG3 A;  3KSY A;  3PSC A;  4Z2N A;  2G35 A;  4L6E A;  1U5G A;  2LOZ A;  2DTC A;  4HHV A;  1X11 A;  1V88 A;  1XX0 A;  1DDM A;  2K2J A;  2GJY A;  3ODW A;  3ODX A;  2W2W A;  1OY2 A;  2RLO A;  3DXD A;  4P7I A;  1XR0 B;  4KHB B;  4Z2M B;  4NSW A;  2W2X D;  5JHH A;  2J0M A;  1U27 A;  5JLJ B;  4ZRJ A;  1WG7 A;  1OMW A;  4GMV A;  4KHO A;  3IVF A;  5J3Y A;  1FOE A;  2D2Q A;  3QIJ A;  3ULC A;  3QWM A;  5GOW B;  2DN6 A;  1GC6 A;  1EAZ A;  3X23 A;  2H7D A;  1X1G A;  3AU5 A;  1BTK A;  2DHK A;  3SYX A;  4WJ7 A;  2DA0 A;  2Y8G A;  1WVH A;  2OQB A;  4WVF B;  2D4Q A;  5KQ1 A;  4PNK A;  3PVW A;  3PZD A;  1V5U A;  1UNP A;  2ELB A;  3GYO A;  2UVM A;  1J0W A;  3MPX A;  2KCJ A;  2UZR A;  1N3H A;  2DKP A;  5C5B A;  3DXC A;  1SGH A;  1Y19 B;  4HB4 B;  1WJM A;  4GMX B;  3AU4 A;  2AEH A;  1X1F A;  1LW3 A;  1P5T A;  1W1G A;  2I5F A;  1FB8 A;  2CRF A;  1I7A A;  2P0H A;  1J19 A;  2HTH B;  2COA A;  1KZG A;  5DHF B;  2EJ8 A;  3ML4 A;  2I5C A;  1PFJ A;  3RCP A;  1DDV A;  1V5P A;  2FJL A;  2RNR B;  1MIX A;  3PG7 A;  4K17 A;  1NU2 A;  2L1C A;  1DDW A;  1V89 A;  2IFS A;  1V61 A;  4C0A A;  2AL6 A;  3LJU X;  2PZ1 A;  2LUL A;  3TO1 A;  2ROZ B;  2CY4 A;  4YON A;  4HAX B;  1DYN A;  1E5W A;  1UNQ A;  2W2X C;  3O96 A;  4MK0 A;  1MK9 B;  3ODO A;  4EJN A;  3SNH A;  1XOD A;  2NMB A;  4HB2 B;  5HE3 A;  3OAN A;  3HW2 B;  2YVC A;  1DRO A;  2D9V A;  1K5D B;  4B6H A;  2VSZ A;  2D9Z A;  3A8P A;  4DX8 A;  4D0N B;  2IYB A;  2YS5 A;  2J59 M;  4IOY X;  3TVV A;  4EMO A;  4ZRI A;  2VRW B;  1NTY A;  5FI0 A;  1P6S A;  5HE1 A;  5EFX A;  2Z0O A;  2EC1 A;  2X18 A;  5D27 A;  5JP4 A;  3WYF B;  1XKE A;  1AQC A;  4HAW B;  3SUZ A;  4DX9 0;  1X86 A;  2VKI A;  3QBV B;  2Y7B A;  5HE0 A;  2R0D A;  3PP2 A;  3P6A A;  2QKL A;  2M14 A;  4TYZ A;  1SHC A;  2DHJ A;  2UZS A;  4MT7 A;  1XCG A;  1EVH A;  1BWN A;  2COC A;  4A6F B;  2DLW A;  1U2B A;  5CLQ B;  4XWX A;  3V5W A;  1I2H A;  1MK7 B;  2N0Y A;  1AWE A;  3VOQ A;  2D11 A;  2ELA A;  3VIA A;  2RUK B;  3UZT A;  1FHO A;  3D8F A;  1U29 A;  5DIF B;  4GXB A;  1WI1 A;  2LYD A;  2HE7 A;  2CAY A;  1Z87 A;  3DXE A;  4A6F A;  1FGZ A;  1RJ2 A;  1PLS A;  1UNR A;  4IFS A;  4K2P A;  1W1H A;  1EF1 A;  5FI1 A;  4HB3 B;  2L2I A;  3T06 A;  3PEG A;  4NY0 A;  2RGN B;  5HE2 A;  2R09 A;  3GYP A;  4A6K A;  1B55 A;  2YT0 A;  1ZC3 B;  2ADZ A;  4GPT B;  2COF A;  5D3V A;  1BTN A;  1DBH A;  1TJ6 A;  4DBB A;  3SO6 A;  2COD A;  1QC6 A;  4DXA B;  5J3T A;  3HK0 A;  3ZVR A;  5L81 A;  3KZ1 A;  2MWN B;  1FHX A;  1V5M A;  5DH9 B;  4CHJ A;  2DYN A;  4CHM A;  3WA0 A;  2EMS A;  2DX5 A;  4IAP A;  4H8S A;  3HQC A;  3CIK A;  1GC7 A;  2GCJ A;  1ZC4 B;  2RSG A;  4KAX B;  4KHA A;  4BBK A;  1ZVR A;  4TKN A;  2QKM A;  2YF0 A;  3PVU A;  2K00 A;  2D9W A;  1FAO A;  2MKR A;  2DKQ A;  2YSZ A;  2GS0 A;  2OTX A;  2EMT A;  2YS3 A;  2Z0P A;  2DYQ A;  2E2X A;  4F7U P;  1KZ7 A;  4HAY B;  1WGQ A;  1W1D A;  5D3X A;  2MFQ A;  3SV1 A;  3F0W A;  1U5E A;  3CXB B;  4CYE A;  1OQN A;  2M38 A;  4HDO A;  2MDX A;  5C16 A;  2YT1 A;  2I1J A;  2LKO A;  3KY9 A;  2D9X A;  2DFK A;  1FHW A;  3MDB C;  2ROV A;  1NI2 A;  3AJ4 A;  4HAV B;  4KVG B;  5DHA B;  3FM8 C;  1P3R A;  1TXD A;  2N23 A;  2DHI A;  2V76 A;  3TCA A;  1M7R A;  2NZ8 B;  4HDQ A;  4K81 A;  4A5K A;  1ISN A;  2P0D A;  1Q67 A;  4EKU A;  3KRW A;  1H10 A;  2KUP A;  5C79 A;  3P7Z A;  1KI1 B;  5LOP B;  2YRY A;  5C5B B;  2D10 A;  2Y8F A;  1U5D A;  3ULB A;  2D9Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...