1TQZA

Solution structure of necap1 protein
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
133
structure length
133
Chain Sequence
MAAELEYESVLCVKPDVSVYRIPPRASNRGYRASDWKLDQPDWTGRLRITSKGKIAYIKLEDKVSGELFAQAPVEQYPGIAVETVTDSSRYFVIRIQDGTGRSAFIGIGFTDRGDAFDFNVSLQDHFKWVKQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NECAP1
publication title Solution structure of NECAP1 protein
rcsb
source organism Mus musculus
molecule tags Endocytosis/exocytosis
total genus 14
structure length 133
sequence length 133
ec nomenclature
pdb deposition date 2004-06-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 1tqzA01
4HAVB 2DN6A 2YS1A 1V5UA 2DX5A 2EMSA 2NMBA 1H10A 4HB2B 3ODXA 4YONA 2L2IA 4HATB 2KUPA 1Y19B 4KHBB 3G9WA 2P0HA 1FB8A 4B6HA 4EMOA 1NTVA 3FEHA 5J3QA 4K81A 2JP2A 5DHFB 3SYXA 2K00A 1WGUA 3HK0A 4L6EA 4MY6A 1MK9B 4HHVA 2W2XC 3PVWA 1H4RA 3MDBC 1FHWA 2YT0A 3MPXA 5HE3A 4H8SA 3TCAA 3BINA 2D9ZA 1DYNA 1MK7B 1QQGA 2YS3A 4DX8A 1UPRA 1WI1A 1QC6A 1X86A 1LB1A 1Z87A 5JP4A 3TW1A 3QBVB 2G35A 2H7DA 1DBHA 2W2WA 4HB0B 2L1CA 2OQBA 2Z0OA 1U2BA 2UZSA 3IVFA 2Y8GA 1RJ2A 3SO6A 1U5GA 1V89A 4MT7A 4ZRKA 1M7RA 2D10A 2ELAA 2J0KA 1NTYA 4ZRIA 2P8VA 4EKUA 1UNRA 4PNKA 2P0DA 1U29A 2EMTA 2LOXA 2I5CA 5CLQB 4HB3B 4NSWA 1DDMA 2DTCA 1UNPA 4K17A 1M7EA 2LOZA 4GMVA 4A6HA 2KGXB 2DYQA 2RNRB 2RUKB 3QIJA 2CRFA 5KQ1A 1GC7A 4KAXB 1TJ6A 2IFSA 5GOWB 1EAZA 4Z2NA 4EJNA 4Z2MB 2H7EA 1PFJA 4KVGB 5C5BA 2Y7BA 2AEHA 3TO1A 5HE1A 3PVUA 1FOEA 2DA0A 2UVMA 1U5EA 3BJIA 4DX90 3U7DA 2ZPYA 3GYPA 5KCVA 1FHOA 1X1GA 4WJ7A 1SGHA 3PG7A 3N7CA 1DDWA 1XKEA 1BTKA 3CIKA 1PLSA 1XR0B 1EVHA 5EFXA 2M14A 2D9XA 2DHJA 3O96A 2DYNA 2D9WA 2UZRA 3FSSA 1B55A 1W1GA 1K5GB 2LULA 4HAZB 5D3XA 2GS0A 3KRXA 3ZDTA 2N0YA 2COFA 2EJ8A 3KSYA 2PZ1A 1EF1A 2QKLA 5JLJB 2J59M 3AU5A 1MIZB 1I2HA 4IAPA 1BWNA 2D11A 5D3YA 1XD4A 5DHAB 1I7AA 1U5FA 4TKNA 2YS5A 2R09A 1XCGA 3AJ4A 1WJ1A 5J3YA 1UEFA 1AWEA 2E2XA 4D0NB 1J19A 4HAXB 2MKRA 1NU2A 4GN1A 5LONB 4NY0A 3P7ZA 3VIAA 2DLWA 1ZC4B 3VOQA 1KZ7A 5DH9B 2I1KA 2Y8FA 1GC6A 5DI9B 4DBBA 2RSGA 1FHXA 3DXDA 1X11A 2AL6A 1ZSQA 1NI2A 4YL8A 2I1JA 3LJUX 1UPQA 2DFKA 2ROVA 2EC1A 2D9VA 2LG1A 3A8QA 1ZVRA 1BTNA 2ROZB 2MFQA 4P7IA 4A6FB 2GJYA 1KZGA 1Q67A 3M1IB 4CHMA 2XQNM 2CY4A 1U5DA 1OY2A 1Y5OA 2VRWB 3F0WA 3WA0A 1XX0A 4GMXB 2NZ8B 1ZC3B 3SUZA 2X18A 3A8PA 2BCJA 4ZRJA 1WJMA 1WGQA 4HAUB 2D2QA 2DKPA 3F5RA 2GCJA 4HDQA 5JHGA 1TXDA 3RCPA 4F7GA 4KHOA 2Z0QA 1IRSA 2Z0PA 3NSUA 4CYEA 2HE7A 2CODA 1OMWA 1V88A 2MDXA 2YSZA 5D3WA 2V76A 1X1FA 2D4QA 1N3HA 1WVHA 3KZ1A 4XWXA 2J0MA 1K5DB 3UZTA 4WSFA 5HE0A 3AU4A 3ML4A 2GCLA 5KQ4A 3PP2A 3OANA 1DDVA 1SHCA 3V5WA 2YF0A 2KCJA 3GYOA 2DX1A 2J0JA 5D3VA 1P6SA 3HW2B 5L81A 3PZDA 2OTXA 2YRYA 2IYBA 5FI1A 3U8ZA 5J3TA 4A6FA 1J0WA 3HQCA 1UNQA 1MAIA 1U27A 5C6RA 4K2PA 3TVVA 4TYZA 2Q13A 4F7HA 1PMSA 2K2UA 2I5FA 2LYDA 2COCA 3ODOA 3ODWA 3T06A 5D27A 5C5BB 3ULBA 4BBKA 4WVFB 4IOYX 1MPHA 5CLLB 4KHAA 1V5MA 1P3RA 1FGZA 2DHIA 4A5KA 1OQNA 4F7UP 4HAWB 5C16A 2MWNB 2M38A 3FM8C 1BAKA 1V5PA 4MK0A 1XODA 1MIXA 2LKOA 1W1DA 2YVCA 4IFSA 1FGYA 2HTHB 3PVLA 4Y94A 5FI0A 1MKEA 4GXBA 2COAA 1W1HA 5HE2A 2RLOA 5JHHA 2CY5A 2RGNB 4HAYB 2VKIA 2VSZA 2P0FA 3KY9A 2CAYA 1GG3A 1P5TA 3CXBB 4HDOA 2K2JA 4C0AA 2RVBB 1FAOA 2DHKA 2ELBA 3D8EA 2QKMA 2YT1A 4HB4B 1TQZA 3D8FA 2ADZA 2D9YA 1RRPB 3P6AA 5LOPB 4DXAB 3D8DA 1E5WA 2DKQA 4GZUA 1EGXA 1V61A 1DROA 3KRWA 3TFMA 1AQCA 1WG7A 3ULCA 3PSCA 4K2OA 2FJLA 4PQ0A 3WYFB 2W2XD 5C79A 2R0DA 4A6KA 1X05A 3DXCA 4CHJA 3SNHA 3A98B 5DIFB 1LW3A 3X23A 4GPTB 1ZM0A 3PEGA 1KI1B 3QWMA 3ZVRA 1ISNA 3DXEA 2N23A 3SV1A
chains in the Genus database with same CATH superfamily
4HAVB 1T77A 2DN6A 2YS1A 1V5UA 2DX5A 2EMSA 2NMBA 5IRSA 1H10A 4HB2B 3ODXA 4YONA 2L2IA 4HATB 2KUPA 1Y19B 4KHBB 3G9WA 2P0HA 1FB8A 4B6HA 4EMOA 1NTVA 3FEHA 5J3QA 4K81A 2JP2A 5DHFB 3SYXA 2K00A 1WGUA 3HK0A 4L6EA 4MY6A 1MK9B 4HHVA 2W2XC 3PVWA 1H4RA 3MDBC 1FHWA 2YT0A 3MPXA 5HE3A 4H8SA 3TCAA 3NWAA 3BINA 2D9ZA 1DYNA 1MK7B 1QQGA 2YS3A 4DX8A 1UPRA 1WI1A 1QC6A 1X86A 1LB1A 1Z87A 5JP4A 4L1RA 3TW1A 3QBVB 2G35A 2H7DA 1DBHA 2W2WA 4HB0B 2L1CA 2OQBA 2Z0OA 1U2BA 2UZSA 3IVFA 2Y8GA 1RJ2A 1MI1A 3SO6A 1U5GA 1V89A 4MT7A 4ZRKA 1M7RA 2D10A 2ELAA 2J0KA 1NTYA 4QJ3B 4ZRIA 2P8VA 4EKUA 1UNRA 4PNKA 2P0DA 1U29A 2EMTA 2Z4DA 2LOXA 2I5CA 5CLQB 4HB3B 4NSWA 1DDMA 2DTCA 1UNPA 4K17A 1M7EA 3OHMB 2LOZA 4GMVA 4A6HA 2KGXB 3NWFA 2DYQA 2RNRB 3A58A 2RUKB 3QIJA 2CRFA 5KQ1A 1GC7A 4KAXB 4KHBA 1TJ6A 2IFSA 5GOWB 1EAZA 4Z2NA 4EJNA 4Z2MB 5M4YB 2H7EA 1PFJA 4KVGB 5C5BA 2Y7BA 2AEHA 3TO1A 5HE1A 3PVUA 2Z14A 1FOEA 2DA0A 4D6WA 5I2MA 2UVMA 1U5EA 3BJIA 4DX90 2NBVA 3U7DA 2ZPYA 3GYPA 5KCVA 1FHOA 1X1GA 4WJ7A 1SGHA 3PG7A 3N7CA 1DDWA 1XKEA 1BTKA 3CIKA 1PLSA 1XR0B 1EVHA 5EFXA 2K8EA 2M14A 2D9XA 2DHJA 3O96A 2DYNA 3HIEA 2D9WA 2UZRA 3FSSA 1B55A 4CSQA 1W1GA 1K5GB 2LULA 4HAZB 5D3XA 2GS0A 3KRXA 3ZDTA 2N0YA 2COFA 2EJ8A 3KSYA 2PZ1A 2Z13A 1EF1A 2QKLA 5JLJB 2J59M 3AU5A 1MIZB 1I2HA 4IAPA 1BWNA 2KUQA 2D11A 5D3YA 1XD4A 5DHAB 1I7AA 1U5FA 4TKNA 2YS5A 2R09A 1XCGA 3AJ4A 1WJ1A 5J3YA 1UEFA 1AWEA 2E2XA 4D0NB 1J19A 4HAXB 2MKRA 1NU2A 4QJ4B 4GN1A 5LONB 4NY0A 3P7ZA 3VIAA 2DLWA 1ZC4B 3VOQA 1KZ7A 2FJUB 5DH9B 2I1KA 2Y8FA 1GC6A 5DI9B 4DBBA 2RSGA 1FHXA 3DXDA 2YT2A 1X11A 2AL6A 1ZSQA 1NI2A 4YL8A 2I1JA 3LJUX 1UPQA 2DFKA 2ROVA 2EC1A 2D9VA 2LG1A 3A8QA 2KIEA 1ZVRA 1BTNA 2ROZB 5I2SA 2MFQA 4P7IA 4A6FB 2K49A 2GJYA 1KZGA 1Q67A 3M1IB 4CHMA 2XQNM 2CY4A 1U5DA 1OY2A 1Y5OA 2VRWB 3F0WA 3WA0A 1XX0A 4GMXB 2NZ8B 1ZC3B 3SUZA 2X18A 3A8PA 2BCJA 4ZRJA 4DIXA 1WJMA 4GNKB 1WGQA 4HAUB 2GUMA 2D2QA 2DKPA 3F5RA 2GCJA 2RRFA 4HDQA 5JHGA 1TXDA 3RCPA 4F7GA 4KHOA 2Z0QA 3FVCA 4HSIA 1IRSA 2Z0PA 3NSUA 4CYEA 2HE7A 2CODA 1OMWA 1V88A 2MDXA 2YSZA 5D3WA 2V76A 3B77A 1X1FA 2D4QA 1N3HA 1WVHA 3KZ1A 4XWXA 2J0MA 1K5DB 3UZTA 4WSFA 5HE0A 3AU4A 3ML4A 2GCLA 5KQ4A 3PP2A 3OANA 1DDVA 1SHCA 3V5WA 2YF0A 2KCJA 3GYOA 2DX1A 2J0JA 5D3VA 1P6SA 3HW2B 2KIGA 5L81A 2Z59A 3PZDA 2OTXA 2YRYA 2IYBA 5FI1A 3U8ZA 5J3TA 4A6FA 1J0WA 3HQCA 1UNQA 1MAIA 1U27A 5C6RA 4K2PA 3TVVA 4TYZA 2Q13A 4F7HA 1PMSA 2K2UA 2I5FA 2LYDA 2COCA 3ODOA 3ODWA 3T06A 5D27A 5C5BB 3ULBA 2ZKMX 4BBKA 1ZYIA 4WVFB 4IOYX 1MPHA 4GOUA 5CLLB 4KHAA 1V5MA 1P3RA 1FGZA 2DHIA 4A5KA 1OQNA 4F7UP 4HAWB 5C16A 2MWNB 2M38A 3FM8C 1BAKA 1V5PA 4MK0A 1XODA 1MIXA 2LKOA 1W1DA 2YVCA 4IFSA 1FGYA 2HTHB 2R2YA 3PVLA 4Y94A 5FI0A 1MKEA 4GXBA 2COAA 1W1HA 5HE2A 2KR0A 2RLOA 5JHHA 2CY5A 2RGNB 4HAYB 4OSNA 2VKIA 2VSZA 2P0FA 3KY9A 2CAYA 1GG3A 1P5TA 3CXBB 4HDOA 2K2JA 4C0AA 2RVBB 1FAOA 3NWDA 2DHKA 2ELBA 3D8EA 2QKMA 2YT1A 4HB4B 1TQZA 3D8FA 2ADZA 2D9YA 1RRPB 3P6AA 4QJ5B 5LOPB 4DXAB 3D8DA 1E5WA 2DKQA 3U12A 4GZUA 1EGXA 1V61A 1DROA 3KRWA 3TFMA 1AQCA 3DCXA 1WG7A 3ULCA 3PSCA 4K2OA 2FJLA 4PQ0A 3WYFB 2W2XD 5C79A 2R0DA 4A6KA 1X05A 4QXAB 3DXCA 4CHJA 3SNHA 3A98B 4OT1A 5DIFB 1LW3A 3X23A 4GPTB 1ZM0A 3PEGA 3HSAA 1KI1B 3QWMA 3ZVRA 1ISNA 5LG4B 3DXEA 3NW8A 2N23A 3SV1A
chains in the Genus database with same CATH topology
4HAVB 2DN6A 2YS1A 1V5UA 2DX5A 2EMSA 2NMBA 1H10A 4HB2B 3ODXA 4YONA 2L2IA 4HATB 2KUPA 1Y19B 4KHBB 3G9WA 2P0HA 1FB8A 4B6HA 4EMOA 1NTVA 3FEHA 5J3QA 4K81A 2JP2A 5DHFB 3SYXA 2K00A 1WGUA 3HK0A 4L6EA 4MY6A 1MK9B 4HHVA 2W2XC 3PVWA 1H4RA 3MDBC 1FHWA 2YT0A 3MPXA 5HE3A 4H8SA 3TCAA 3BINA 2D9ZA 1DYNA 1MK7B 1QQGA 2YS3A 4DX8A 1UPRA 1WI1A 1QC6A 1X86A 1LB1A 1Z87A 5JP4A 3TW1A 3QBVB 2G35A 2H7DA 1DBHA 2W2WA 4HB0B 2L1CA 2OQBA 2Z0OA 1U2BA 2UZSA 3IVFA 2Y8GA 1RJ2A 3SO6A 1U5GA 1V89A 4MT7A 4ZRKA 1M7RA 2D10A 2ELAA 2J0KA 1NTYA 4ZRIA 2P8VA 4EKUA 1UNRA 4PNKA 2P0DA 1U29A 2EMTA 2LOXA 2I5CA 5CLQB 4HB3B 4NSWA 1DDMA 2DTCA 1UNPA 4K17A 1M7EA 2LOZA 4GMVA 4A6HA 2KGXB 2DYQA 2RNRB 2RUKB 3QIJA 2CRFA 5KQ1A 1GC7A 4KAXB 1TJ6A 2IFSA 5GOWB 1EAZA 4Z2NA 4EJNA 4Z2MB 2H7EA 1PFJA 4KVGB 5C5BA 2Y7BA 2AEHA 3TO1A 5HE1A 3PVUA 1FOEA 2DA0A 2UVMA 1U5EA 3BJIA 4DX90 3U7DA 2ZPYA 3GYPA 5KCVA 1FHOA 1X1GA 4WJ7A 1SGHA 3PG7A 3N7CA 1DDWA 1XKEA 1BTKA 3CIKA 1PLSA 1XR0B 1EVHA 5EFXA 2M14A 2D9XA 2DHJA 3O96A 2DYNA 2D9WA 2UZRA 3FSSA 1B55A 1W1GA 1K5GB 2LULA 4HAZB 5D3XA 2GS0A 3KRXA 3ZDTA 2N0YA 2COFA 2EJ8A 3KSYA 2PZ1A 1EF1A 2QKLA 5JLJB 2J59M 3AU5A 1MIZB 1I2HA 4IAPA 1BWNA 2D11A 5D3YA 1XD4A 5DHAB 1I7AA 1U5FA 4TKNA 2YS5A 2R09A 1XCGA 3AJ4A 1WJ1A 5J3YA 1UEFA 1AWEA 2E2XA 4D0NB 1J19A 4HAXB 2MKRA 1NU2A 4GN1A 5LONB 4NY0A 3P7ZA 3VIAA 2DLWA 1ZC4B 3VOQA 1KZ7A 5DH9B 2I1KA 2Y8FA 1GC6A 5DI9B 4DBBA 2RSGA 1FHXA 3DXDA 1X11A 2AL6A 1ZSQA 1NI2A 4YL8A 2I1JA 3LJUX 1UPQA 2DFKA 2ROVA 2EC1A 2D9VA 2LG1A 3A8QA 1ZVRA 1BTNA 2ROZB 2MFQA 4P7IA 4A6FB 2GJYA 1KZGA 1Q67A 3M1IB 4CHMA 2XQNM 2CY4A 1U5DA 1OY2A 1Y5OA 2VRWB 3F0WA 3WA0A 1XX0A 4GMXB 2NZ8B 1ZC3B 3SUZA 2X18A 3A8PA 2BCJA 4ZRJA 1WJMA 1WGQA 4HAUB 2D2QA 2DKPA 3F5RA 2GCJA 4HDQA 5JHGA 1TXDA 3RCPA 4F7GA 4KHOA 2Z0QA 1IRSA 2Z0PA 3NSUA 4CYEA 2HE7A 2CODA 1OMWA 1V88A 2MDXA 2YSZA 5D3WA 2V76A 1X1FA 2D4QA 1N3HA 1WVHA 3KZ1A 4XWXA 2J0MA 1K5DB 3UZTA 4WSFA 5HE0A 3AU4A 3ML4A 2GCLA 5KQ4A 3PP2A 3OANA 1DDVA 1SHCA 3V5WA 2YF0A 2KCJA 3GYOA 2DX1A 2J0JA 5D3VA 1P6SA 3HW2B 5L81A 3PZDA 2OTXA 2YRYA 2IYBA 5FI1A 3U8ZA 5J3TA 4A6FA 1J0WA 3HQCA 1UNQA 1MAIA 1U27A 5C6RA 4K2PA 3TVVA 4TYZA 2Q13A 4F7HA 1PMSA 2K2UA 2I5FA 2LYDA 2COCA 3ODOA 3ODWA 3T06A 5D27A 5C5BB 3ULBA 4BBKA 4WVFB 4IOYX 1MPHA 5CLLB 4KHAA 1V5MA 1P3RA 1FGZA 2DHIA 4A5KA 1OQNA 4F7UP 4HAWB 5C16A 2MWNB 2M38A 3FM8C 1BAKA 1V5PA 4MK0A 1XODA 1MIXA 2LKOA 1W1DA 2YVCA 4IFSA 1FGYA 2HTHB 3PVLA 4Y94A 5FI0A 1MKEA 4GXBA 2COAA 1W1HA 5HE2A 2RLOA 5JHHA 2CY5A 2RGNB 4HAYB 2VKIA 2VSZA 2P0FA 3KY9A 2CAYA 1GG3A 1P5TA 3CXBB 4HDOA 2K2JA 4C0AA 2RVBB 1FAOA 2DHKA 2ELBA 3D8EA 2QKMA 2YT1A 4HB4B 1TQZA 3D8FA 2ADZA 2D9YA 1RRPB 3P6AA 5LOPB 4DXAB 3D8DA 1E5WA 2DKQA 4GZUA 1EGXA 1V61A 1DROA 3KRWA 3TFMA 1AQCA 1WG7A 3ULCA 3PSCA 4K2OA 2FJLA 4PQ0A 3WYFB 2W2XD 5C79A 2R0DA 4A6KA 1X05A 3DXCA 4CHJA 3SNHA 3A98B 5DIFB 1LW3A 3X23A 4GPTB 1ZM0A 3PEGA 1KI1B 3QWMA 3ZVRA 1ISNA 3DXEA 2N23A 3SV1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HAV B;  2DN6 A;  2YS1 A;  1V5U A;  2DX5 A;  2EMS A;  2NMB A;  1H10 A;  4HB2 B;  3ODX A;  4YON A;  2L2I A;  4HAT B;  2KUP A;  1Y19 B;  4KHB B;  3G9W A;  2P0H A;  1FB8 A;  4B6H A;  4EMO A;  1NTV A;  3FEH A;  5J3Q A;  4K81 A;  2JP2 A;  5DHF B;  3SYX A;  2K00 A;  1WGU A;  3HK0 A;  4L6E A;  4MY6 A;  1MK9 B;  4HHV A;  2W2X C;  3PVW A;  1H4R A;  3MDB C;  1FHW A;  2YT0 A;  3MPX A;  5HE3 A;  4H8S A;  3TCA A;  3BIN A;  2D9Z A;  1DYN A;  1MK7 B;  1QQG A;  2YS3 A;  4DX8 A;  1UPR A;  1WI1 A;  1QC6 A;  1X86 A;  1LB1 A;  1Z87 A;  5JP4 A;  3TW1 A;  3QBV B;  2G35 A;  2H7D A;  1DBH A;  2W2W A;  4HB0 B;  2L1C A;  2OQB A;  2Z0O A;  1U2B A;  2UZS A;  3IVF A;  2Y8G A;  1RJ2 A;  3SO6 A;  1U5G A;  1V89 A;  4MT7 A;  4ZRK A;  1M7R A;  2D10 A;  2ELA A;  2J0K A;  1NTY A;  4ZRI A;  2P8V A;  4EKU A;  1UNR A;  4PNK A;  2P0D A;  1U29 A;  2EMT A;  2LOX A;  2I5C A;  5CLQ B;  4HB3 B;  4NSW A;  1DDM A;  2DTC A;  1UNP A;  4K17 A;  1M7E A;  2LOZ A;  4GMV A;  4A6H A;  2KGX B;  2DYQ A;  2RNR B;  2RUK B;  3QIJ A;  2CRF A;  5KQ1 A;  1GC7 A;  4KAX B;  1TJ6 A;  2IFS A;  5GOW B;  1EAZ A;  4Z2N A;  4EJN A;  4Z2M B;  2H7E A;  1PFJ A;  4KVG B;  5C5B A;  2Y7B A;  2AEH A;  3TO1 A;  5HE1 A;  3PVU A;  1FOE A;  2DA0 A;  2UVM A;  1U5E A;  3BJI A;  4DX9 0;  3U7D A;  2ZPY A;  3GYP A;  5KCV A;  1FHO A;  1X1G A;  4WJ7 A;  1SGH A;  3PG7 A;  3N7C A;  1DDW A;  1XKE A;  1BTK A;  3CIK A;  1PLS A;  1XR0 B;  1EVH A;  5EFX A;  2M14 A;  2D9X A;  2DHJ A;  3O96 A;  2DYN A;  2D9W A;  2UZR A;  3FSS A;  1B55 A;  1W1G A;  1K5G B;  2LUL A;  4HAZ B;  5D3X A;  2GS0 A;  3KRX A;  3ZDT A;  2N0Y A;  2COF A;  2EJ8 A;  3KSY A;  2PZ1 A;  1EF1 A;  2QKL A;  5JLJ B;  2J59 M;  3AU5 A;  1MIZ B;  1I2H A;  4IAP A;  1BWN A;  2D11 A;  5D3Y A;  1XD4 A;  5DHA B;  1I7A A;  1U5F A;  4TKN A;  2YS5 A;  2R09 A;  1XCG A;  3AJ4 A;  1WJ1 A;  5J3Y A;  1UEF A;  1AWE A;  2E2X A;  4D0N B;  1J19 A;  4HAX B;  2MKR A;  1NU2 A;  4GN1 A;  5LON B;  4NY0 A;  3P7Z A;  3VIA A;  2DLW A;  1ZC4 B;  3VOQ A;  1KZ7 A;  5DH9 B;  2I1K A;  2Y8F A;  1GC6 A;  5DI9 B;  4DBB A;  2RSG A;  1FHX A;  3DXD A;  1X11 A;  2AL6 A;  1ZSQ A;  1NI2 A;  4YL8 A;  2I1J A;  3LJU X;  1UPQ A;  2DFK A;  2ROV A;  2EC1 A;  2D9V A;  2LG1 A;  3A8Q A;  1ZVR A;  1BTN A;  2ROZ B;  2MFQ A;  4P7I A;  4A6F B;  2GJY A;  1KZG A;  1Q67 A;  3M1I B;  4CHM A;  2XQN M;  2CY4 A;  1U5D A;  1OY2 A;  1Y5O A;  2VRW B;  3F0W A;  3WA0 A;  1XX0 A;  4GMX B;  2NZ8 B;  1ZC3 B;  3SUZ A;  2X18 A;  3A8P A;  2BCJ A;  4ZRJ A;  1WJM A;  1WGQ A;  4HAU B;  2D2Q A;  2DKP A;  3F5R A;  2GCJ A;  4HDQ A;  5JHG A;  1TXD A;  3RCP A;  4F7G A;  4KHO A;  2Z0Q A;  1IRS A;  2Z0P A;  3NSU A;  4CYE A;  2HE7 A;  2COD A;  1OMW A;  1V88 A;  2MDX A;  2YSZ A;  5D3W A;  2V76 A;  1X1F A;  2D4Q A;  1N3H A;  1WVH A;  3KZ1 A;  4XWX A;  2J0M A;  1K5D B;  3UZT A;  4WSF A;  5HE0 A;  3AU4 A;  3ML4 A;  2GCL A;  5KQ4 A;  3PP2 A;  3OAN A;  1DDV A;  1SHC A;  3V5W A;  2YF0 A;  2KCJ A;  3GYO A;  2DX1 A;  2J0J A;  5D3V A;  1P6S A;  3HW2 B;  5L81 A;  3PZD A;  2OTX A;  2YRY A;  2IYB A;  5FI1 A;  3U8Z A;  5J3T A;  4A6F A;  1J0W A;  3HQC A;  1UNQ A;  1MAI A;  1U27 A;  5C6R A;  4K2P A;  3TVV A;  4TYZ A;  2Q13 A;  4F7H A;  1PMS A;  2K2U A;  2I5F A;  2LYD A;  2COC A;  3ODO A;  3ODW A;  3T06 A;  5D27 A;  5C5B B;  3ULB A;  4BBK A;  4WVF B;  4IOY X;  1MPH A;  5CLL B;  4KHA A;  1V5M A;  1P3R A;  1FGZ A;  2DHI A;  4A5K A;  1OQN A;  4F7U P;  4HAW B;  5C16 A;  2MWN B;  2M38 A;  3FM8 C;  1BAK A;  1V5P A;  4MK0 A;  1XOD A;  1MIX A;  2LKO A;  1W1D A;  2YVC A;  4IFS A;  1FGY A;  2HTH B;  3PVL A;  4Y94 A;  5FI0 A;  1MKE A;  4GXB A;  2COA A;  1W1H A;  5HE2 A;  2RLO A;  5JHH A;  2CY5 A;  2RGN B;  4HAY B;  2VKI A;  2VSZ A;  2P0F A;  3KY9 A;  2CAY A;  1GG3 A;  1P5T A;  3CXB B;  4HDO A;  2K2J A;  4C0A A;  2RVB B;  1FAO A;  2DHK A;  2ELB A;  3D8E A;  2QKM A;  2YT1 A;  4HB4 B;  1TQZ A;  3D8F A;  2ADZ A;  2D9Y A;  1RRP B;  3P6A A;  5LOP B;  4DXA B;  3D8D A;  1E5W A;  2DKQ A;  4GZU A;  1EGX A;  1V61 A;  1DRO A;  3KRW A;  3TFM A;  1AQC A;  1WG7 A;  3ULC A;  3PSC A;  4K2O A;  2FJL A;  4PQ0 A;  3WYF B;  2W2X D;  5C79 A;  2R0D A;  4A6K A;  1X05 A;  3DXC A;  4CHJ A;  3SNH A;  3A98 B;  5DIF B;  1LW3 A;  3X23 A;  4GPT B;  1ZM0 A;  3PEG A;  1KI1 B;  3QWM A;  3ZVR A;  1ISN A;  3DXE A;  2N23 A;  3SV1 A; 
#chains in the Genus database with same CATH topology
 4HAV B;  1T77 A;  2DN6 A;  2YS1 A;  1V5U A;  2DX5 A;  2EMS A;  2NMB A;  5IRS A;  1H10 A;  4HB2 B;  3ODX A;  4YON A;  2L2I A;  4HAT B;  2KUP A;  1Y19 B;  4KHB B;  3G9W A;  2P0H A;  1FB8 A;  4B6H A;  4EMO A;  1NTV A;  3FEH A;  5J3Q A;  4K81 A;  2JP2 A;  5DHF B;  3SYX A;  2K00 A;  1WGU A;  3HK0 A;  4L6E A;  4MY6 A;  1MK9 B;  4HHV A;  2W2X C;  3PVW A;  1H4R A;  3MDB C;  1FHW A;  2YT0 A;  3MPX A;  5HE3 A;  4H8S A;  3TCA A;  3NWA A;  3BIN A;  2D9Z A;  1DYN A;  1MK7 B;  1QQG A;  2YS3 A;  4DX8 A;  1UPR A;  1WI1 A;  1QC6 A;  1X86 A;  1LB1 A;  1Z87 A;  5JP4 A;  4L1R A;  3TW1 A;  3QBV B;  2G35 A;  2H7D A;  1DBH A;  2W2W A;  4HB0 B;  2L1C A;  2OQB A;  2Z0O A;  1U2B A;  2UZS A;  3IVF A;  2Y8G A;  1RJ2 A;  1MI1 A;  3SO6 A;  1U5G A;  1V89 A;  4MT7 A;  4ZRK A;  1M7R A;  2D10 A;  2ELA A;  2J0K A;  1NTY A;  4QJ3 B;  4ZRI A;  2P8V A;  4EKU A;  1UNR A;  4PNK A;  2P0D A;  1U29 A;  2EMT A;  2Z4D A;  2LOX A;  2I5C A;  5CLQ B;  4HB3 B;  4NSW A;  1DDM A;  2DTC A;  1UNP A;  4K17 A;  1M7E A;  3OHM B;  2LOZ A;  4GMV A;  4A6H A;  2KGX B;  3NWF A;  2DYQ A;  2RNR B;  3A58 A;  2RUK B;  3QIJ A;  2CRF A;  5KQ1 A;  1GC7 A;  4KAX B;  4KHB A;  1TJ6 A;  2IFS A;  5GOW B;  1EAZ A;  4Z2N A;  4EJN A;  4Z2M B;  5M4Y B;  2H7E A;  1PFJ A;  4KVG B;  5C5B A;  2Y7B A;  2AEH A;  3TO1 A;  5HE1 A;  3PVU A;  2Z14 A;  1FOE A;  2DA0 A;  4D6W A;  5I2M A;  2UVM A;  1U5E A;  3BJI A;  4DX9 0;  2NBV A;  3U7D A;  2ZPY A;  3GYP A;  5KCV A;  1FHO A;  1X1G A;  4WJ7 A;  1SGH A;  3PG7 A;  3N7C A;  1DDW A;  1XKE A;  1BTK A;  3CIK A;  1PLS A;  1XR0 B;  1EVH A;  5EFX A;  2K8E A;  2M14 A;  2D9X A;  2DHJ A;  3O96 A;  2DYN A;  3HIE A;  2D9W A;  2UZR A;  3FSS A;  1B55 A;  4CSQ A;  1W1G A;  1K5G B;  2LUL A;  4HAZ B;  5D3X A;  2GS0 A;  3KRX A;  3ZDT A;  2N0Y A;  2COF A;  2EJ8 A;  3KSY A;  2PZ1 A;  2Z13 A;  1EF1 A;  2QKL A;  5JLJ B;  2J59 M;  3AU5 A;  1MIZ B;  1I2H A;  4IAP A;  1BWN A;  2KUQ A;  2D11 A;  5D3Y A;  1XD4 A;  5DHA B;  1I7A A;  1U5F A;  4TKN A;  2YS5 A;  2R09 A;  1XCG A;  3AJ4 A;  1WJ1 A;  5J3Y A;  1UEF A;  1AWE A;  2E2X A;  4D0N B;  1J19 A;  4HAX B;  2MKR A;  1NU2 A;  4QJ4 B;  4GN1 A;  5LON B;  4NY0 A;  3P7Z A;  3VIA A;  2DLW A;  1ZC4 B;  3VOQ A;  1KZ7 A;  2FJU B;  5DH9 B;  2I1K A;  2Y8F A;  1GC6 A;  5DI9 B;  4DBB A;  2RSG A;  1FHX A;  3DXD A;  2YT2 A;  1X11 A;  2AL6 A;  1ZSQ A;  1NI2 A;  4YL8 A;  2I1J A;  3LJU X;  1UPQ A;  2DFK A;  2ROV A;  2EC1 A;  2D9V A;  2LG1 A;  3A8Q A;  2KIE A;  1ZVR A;  1BTN A;  2ROZ B;  5I2S A;  2MFQ A;  4P7I A;  4A6F B;  2K49 A;  2GJY A;  1KZG A;  1Q67 A;  3M1I B;  4CHM A;  2XQN M;  2CY4 A;  1U5D A;  1OY2 A;  1Y5O A;  2VRW B;  3F0W A;  3WA0 A;  1XX0 A;  4GMX B;  2NZ8 B;  1ZC3 B;  3SUZ A;  2X18 A;  3A8P A;  2BCJ A;  4ZRJ A;  4DIX A;  1WJM A;  4GNK B;  1WGQ A;  4HAU B;  2GUM A;  2D2Q A;  2DKP A;  3F5R A;  2GCJ A;  2RRF A;  4HDQ A;  5JHG A;  1TXD A;  3RCP A;  4F7G A;  4KHO A;  2Z0Q A;  3FVC A;  4HSI A;  1IRS A;  2Z0P A;  3NSU A;  4CYE A;  2HE7 A;  2COD A;  1OMW A;  1V88 A;  2MDX A;  2YSZ A;  5D3W A;  2V76 A;  3B77 A;  1X1F A;  2D4Q A;  1N3H A;  1WVH A;  3KZ1 A;  4XWX A;  2J0M A;  1K5D B;  3UZT A;  4WSF A;  5HE0 A;  3AU4 A;  3ML4 A;  2GCL A;  5KQ4 A;  3PP2 A;  3OAN A;  1DDV A;  1SHC A;  3V5W A;  2YF0 A;  2KCJ A;  3GYO A;  2DX1 A;  2J0J A;  5D3V A;  1P6S A;  3HW2 B;  2KIG A;  5L81 A;  2Z59 A;  3PZD A;  2OTX A;  2YRY A;  2IYB A;  5FI1 A;  3U8Z A;  5J3T A;  4A6F A;  1J0W A;  3HQC A;  1UNQ A;  1MAI A;  1U27 A;  5C6R A;  4K2P A;  3TVV A;  4TYZ A;  2Q13 A;  4F7H A;  1PMS A;  2K2U A;  2I5F A;  2LYD A;  2COC A;  3ODO A;  3ODW A;  3T06 A;  5D27 A;  5C5B B;  3ULB A;  2ZKM X;  4BBK A;  1ZYI A;  4WVF B;  4IOY X;  1MPH A;  4GOU A;  5CLL B;  4KHA A;  1V5M A;  1P3R A;  1FGZ A;  2DHI A;  4A5K A;  1OQN A;  4F7U P;  4HAW B;  5C16 A;  2MWN B;  2M38 A;  3FM8 C;  1BAK A;  1V5P A;  4MK0 A;  1XOD A;  1MIX A;  2LKO A;  1W1D A;  2YVC A;  4IFS A;  1FGY A;  2HTH B;  2R2Y A;  3PVL A;  4Y94 A;  5FI0 A;  1MKE A;  4GXB A;  2COA A;  1W1H A;  5HE2 A;  2KR0 A;  2RLO A;  5JHH A;  2CY5 A;  2RGN B;  4HAY B;  4OSN A;  2VKI A;  2VSZ A;  2P0F A;  3KY9 A;  2CAY A;  1GG3 A;  1P5T A;  3CXB B;  4HDO A;  2K2J A;  4C0A A;  2RVB B;  1FAO A;  3NWD A;  2DHK A;  2ELB A;  3D8E A;  2QKM A;  2YT1 A;  4HB4 B;  1TQZ A;  3D8F A;  2ADZ A;  2D9Y A;  1RRP B;  3P6A A;  4QJ5 B;  5LOP B;  4DXA B;  3D8D A;  1E5W A;  2DKQ A;  3U12 A;  4GZU A;  1EGX A;  1V61 A;  1DRO A;  3KRW A;  3TFM A;  1AQC A;  3DCX A;  1WG7 A;  3ULC A;  3PSC A;  4K2O A;  2FJL A;  4PQ0 A;  3WYF B;  2W2X D;  5C79 A;  2R0D A;  4A6K A;  1X05 A;  4QXA B;  3DXC A;  4CHJ A;  3SNH A;  3A98 B;  4OT1 A;  5DIF B;  1LW3 A;  3X23 A;  4GPT B;  1ZM0 A;  3PEG A;  3HSA A;  1KI1 B;  3QWM A;  3ZVR A;  1ISN A;  5LG4 B;  3DXE A;  3NW8 A;  2N23 A;  3SV1 A; 
#chains in the Genus database with same CATH homology
 4HAV B;  2DN6 A;  2YS1 A;  1V5U A;  2DX5 A;  2EMS A;  2NMB A;  1H10 A;  4HB2 B;  3ODX A;  4YON A;  2L2I A;  4HAT B;  2KUP A;  1Y19 B;  4KHB B;  3G9W A;  2P0H A;  1FB8 A;  4B6H A;  4EMO A;  1NTV A;  3FEH A;  5J3Q A;  4K81 A;  2JP2 A;  5DHF B;  3SYX A;  2K00 A;  1WGU A;  3HK0 A;  4L6E A;  4MY6 A;  1MK9 B;  4HHV A;  2W2X C;  3PVW A;  1H4R A;  3MDB C;  1FHW A;  2YT0 A;  3MPX A;  5HE3 A;  4H8S A;  3TCA A;  3BIN A;  2D9Z A;  1DYN A;  1MK7 B;  1QQG A;  2YS3 A;  4DX8 A;  1UPR A;  1WI1 A;  1QC6 A;  1X86 A;  1LB1 A;  1Z87 A;  5JP4 A;  3TW1 A;  3QBV B;  2G35 A;  2H7D A;  1DBH A;  2W2W A;  4HB0 B;  2L1C A;  2OQB A;  2Z0O A;  1U2B A;  2UZS A;  3IVF A;  2Y8G A;  1RJ2 A;  3SO6 A;  1U5G A;  1V89 A;  4MT7 A;  4ZRK A;  1M7R A;  2D10 A;  2ELA A;  2J0K A;  1NTY A;  4ZRI A;  2P8V A;  4EKU A;  1UNR A;  4PNK A;  2P0D A;  1U29 A;  2EMT A;  2LOX A;  2I5C A;  5CLQ B;  4HB3 B;  4NSW A;  1DDM A;  2DTC A;  1UNP A;  4K17 A;  1M7E A;  2LOZ A;  4GMV A;  4A6H A;  2KGX B;  2DYQ A;  2RNR B;  2RUK B;  3QIJ A;  2CRF A;  5KQ1 A;  1GC7 A;  4KAX B;  1TJ6 A;  2IFS A;  5GOW B;  1EAZ A;  4Z2N A;  4EJN A;  4Z2M B;  2H7E A;  1PFJ A;  4KVG B;  5C5B A;  2Y7B A;  2AEH A;  3TO1 A;  5HE1 A;  3PVU A;  1FOE A;  2DA0 A;  2UVM A;  1U5E A;  3BJI A;  4DX9 0;  3U7D A;  2ZPY A;  3GYP A;  5KCV A;  1FHO A;  1X1G A;  4WJ7 A;  1SGH A;  3PG7 A;  3N7C A;  1DDW A;  1XKE A;  1BTK A;  3CIK A;  1PLS A;  1XR0 B;  1EVH A;  5EFX A;  2M14 A;  2D9X A;  2DHJ A;  3O96 A;  2DYN A;  2D9W A;  2UZR A;  3FSS A;  1B55 A;  1W1G A;  1K5G B;  2LUL A;  4HAZ B;  5D3X A;  2GS0 A;  3KRX A;  3ZDT A;  2N0Y A;  2COF A;  2EJ8 A;  3KSY A;  2PZ1 A;  1EF1 A;  2QKL A;  5JLJ B;  2J59 M;  3AU5 A;  1MIZ B;  1I2H A;  4IAP A;  1BWN A;  2D11 A;  5D3Y A;  1XD4 A;  5DHA B;  1I7A A;  1U5F A;  4TKN A;  2YS5 A;  2R09 A;  1XCG A;  3AJ4 A;  1WJ1 A;  5J3Y A;  1UEF A;  1AWE A;  2E2X A;  4D0N B;  1J19 A;  4HAX B;  2MKR A;  1NU2 A;  4GN1 A;  5LON B;  4NY0 A;  3P7Z A;  3VIA A;  2DLW A;  1ZC4 B;  3VOQ A;  1KZ7 A;  5DH9 B;  2I1K A;  2Y8F A;  1GC6 A;  5DI9 B;  4DBB A;  2RSG A;  1FHX A;  3DXD A;  1X11 A;  2AL6 A;  1ZSQ A;  1NI2 A;  4YL8 A;  2I1J A;  3LJU X;  1UPQ A;  2DFK A;  2ROV A;  2EC1 A;  2D9V A;  2LG1 A;  3A8Q A;  1ZVR A;  1BTN A;  2ROZ B;  2MFQ A;  4P7I A;  4A6F B;  2GJY A;  1KZG A;  1Q67 A;  3M1I B;  4CHM A;  2XQN M;  2CY4 A;  1U5D A;  1OY2 A;  1Y5O A;  2VRW B;  3F0W A;  3WA0 A;  1XX0 A;  4GMX B;  2NZ8 B;  1ZC3 B;  3SUZ A;  2X18 A;  3A8P A;  2BCJ A;  4ZRJ A;  1WJM A;  1WGQ A;  4HAU B;  2D2Q A;  2DKP A;  3F5R A;  2GCJ A;  4HDQ A;  5JHG A;  1TXD A;  3RCP A;  4F7G A;  4KHO A;  2Z0Q A;  1IRS A;  2Z0P A;  3NSU A;  4CYE A;  2HE7 A;  2COD A;  1OMW A;  1V88 A;  2MDX A;  2YSZ A;  5D3W A;  2V76 A;  1X1F A;  2D4Q A;  1N3H A;  1WVH A;  3KZ1 A;  4XWX A;  2J0M A;  1K5D B;  3UZT A;  4WSF A;  5HE0 A;  3AU4 A;  3ML4 A;  2GCL A;  5KQ4 A;  3PP2 A;  3OAN A;  1DDV A;  1SHC A;  3V5W A;  2YF0 A;  2KCJ A;  3GYO A;  2DX1 A;  2J0J A;  5D3V A;  1P6S A;  3HW2 B;  5L81 A;  3PZD A;  2OTX A;  2YRY A;  2IYB A;  5FI1 A;  3U8Z A;  5J3T A;  4A6F A;  1J0W A;  3HQC A;  1UNQ A;  1MAI A;  1U27 A;  5C6R A;  4K2P A;  3TVV A;  4TYZ A;  2Q13 A;  4F7H A;  1PMS A;  2K2U A;  2I5F A;  2LYD A;  2COC A;  3ODO A;  3ODW A;  3T06 A;  5D27 A;  5C5B B;  3ULB A;  4BBK A;  4WVF B;  4IOY X;  1MPH A;  5CLL B;  4KHA A;  1V5M A;  1P3R A;  1FGZ A;  2DHI A;  4A5K A;  1OQN A;  4F7U P;  4HAW B;  5C16 A;  2MWN B;  2M38 A;  3FM8 C;  1BAK A;  1V5P A;  4MK0 A;  1XOD A;  1MIX A;  2LKO A;  1W1D A;  2YVC A;  4IFS A;  1FGY A;  2HTH B;  3PVL A;  4Y94 A;  5FI0 A;  1MKE A;  4GXB A;  2COA A;  1W1H A;  5HE2 A;  2RLO A;  5JHH A;  2CY5 A;  2RGN B;  4HAY B;  2VKI A;  2VSZ A;  2P0F A;  3KY9 A;  2CAY A;  1GG3 A;  1P5T A;  3CXB B;  4HDO A;  2K2J A;  4C0A A;  2RVB B;  1FAO A;  2DHK A;  2ELB A;  3D8E A;  2QKM A;  2YT1 A;  4HB4 B;  1TQZ A;  3D8F A;  2ADZ A;  2D9Y A;  1RRP B;  3P6A A;  5LOP B;  4DXA B;  3D8D A;  1E5W A;  2DKQ A;  4GZU A;  1EGX A;  1V61 A;  1DRO A;  3KRW A;  3TFM A;  1AQC A;  1WG7 A;  3ULC A;  3PSC A;  4K2O A;  2FJL A;  4PQ0 A;  3WYF B;  2W2X D;  5C79 A;  2R0D A;  4A6K A;  1X05 A;  3DXC A;  4CHJ A;  3SNH A;  3A98 B;  5DIF B;  1LW3 A;  3X23 A;  4GPT B;  1ZM0 A;  3PEG A;  1KI1 B;  3QWM A;  3ZVR A;  1ISN A;  3DXE A;  2N23 A;  3SV1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...