3VOQA

Crystal structure of the pleckstrin homology domain of human sin1, a torc2 subunit
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
122
structure length
116
Chain Sequence
GAMATVQDMLSSHHYKSFKVSMIHRLRFTTDVQLGISGDKVEIDPVTKFWIKQKPISIDSDLLCACDLAEEKSPSHAIFKLTYLSNHDYKHLYFESDAATVNEIVLKVNYILESRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structures of the pleckstrin homology domain of Saccharomyces cerevisiae Avo1 and its human orthologue Sin1, an essential subunit of TOR complex 2
pubmed doi rcsb
source organism Homo sapiens
molecule tags Membrane protein
molecule keywords Target of rapamycin complex 2 subunit MAPKAP1
total genus 28
structure length 116
sequence length 122
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-01-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16979 SIN1_PH SAPK-interacting protein 1 (Sin1), Pleckstrin-homology
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 3voqA00
4DBBA 2Y8FA 3FSSA 1K5GB 3PG7A 1KZGA 5JHHA 3RCPA 2H7EA 2DX5A 1GG3A 1OMWA 1OQNA 3MDBC 3UZTA 2RGNB 1UNQA 3AU4A 3M1IB 4F7HA 3U7DA 2ELBA 2PZ1A 2ZPYA 3U8ZA 2Y8GA 4HB2B 2QKMA 3AU5A 2ROZB 1WJMA 5DH9B 5HE3A 2HE7A 3ZDTA 4GMVA 2I1JA 5C6RA 3PVLA 3DXEA 2D9XA 4HATB 2R09A 4IOYX 2JP2A 1BTKA 3PP2A 1XD4A 2P0HA 2VSZA 1Q67A 3NSUA 2BCJA 1QQGA 2H7DA 3AJ4A 4YL8A 5HE0A 4HAWB 3O96A 5J3YA 1B55A 1TQZA 3FM8C 4K2OA 4MK0A 1V61A 1X86A 1MPHA 4HAVB 4C0AA 2UVMA 1UPQA 2DYNA 1PLSA 3SV1A 1U5FA 4K17A 2K2UA 2LOXA 2KGXB 3P6AA 3LJUX 3PSCA 2Y7BA 1W1DA 5HE1A 3CXBB 1PMSA 1J0WA 1EVHA 1ZC3B 2I1KA 5EFXA 1U2BA 3TO1A 4ZRIA 2K2JA 1NTVA 2RLOA 2W2WA 2UZSA 3KRXA 4DX90 1MK9B 2FJLA 4NSWA 1UPRA 1Y5OA 3G9WA 2D9VA 2OQBA 1FOEA 3D8EA 5C5BA 4HB4B 4WJ7A 5JP4A 3F0WA 1FAOA 1WGQA 1GC7A 1U5EA 4NY0A 5J3TA 1X05A 1H4RA 2EMSA 1XR0B 1UNRA 1MKEA 4ZRKA 4A5KA 3X23A 2ROVA 1UNPA 3WA0A 1ISNA 3KRWA 2DLWA 4WVFB 2J0JA 3SNHA 4F7GA 2RNRB 1ZSQA 4HB3B 5JHGA 2ADZA 3SO6A 1I7AA 1LW3A 3N7CA 4YONA 4Z2MB 2EJ8A 2COFA 3TVVA 2LOZA 3QWMA 4EKUA 4DX8A 3A8PA 4K81A 1DROA 2L1CA 1AQCA 1J19A 2YVCA 2Z0QA 2DX1A 4HAZB 2M38A 2IYBA 2NMBA 5CLQB 4L6EA 2P0FA 1NTYA 5DIFB 1NI2A 3F5RA 1EF1A 1GC6A 1V88A 1BWNA 2YT1A 3KSYA 4ZRJA 3SUZA 3SYXA 1KI1B 2J0MA 2D2QA 4XWXA 1FHXA 2YRYA 2RSGA 4HB0B 2P0DA 3KY9A 1M7EA 1XODA 2I5FA 3HW2B 1XKEA 2DHJA 2K00A 1SHCA 2RVBB 1ZM0A 3A98B 4HDOA 5C16A 1P3RA 2YS5A 1DDMA 1PFJA 2N0YA 2P8VA 1V5UA 2DHKA 1XX0A 3FEHA 3ODWA 2M14A 4F7UP 1DBHA 1AWEA 1WI1A 4TYZA 1WVHA 4BBKA 1BTNA 4MY6A 1WGUA 4H8SA 4WSFA 1V5MA 2I5CA 4IAPA 2YS3A 4IFSA 1K5DB 1W1HA 4HAXB 4CHJA 5DHFB 3DXDA 1NU2A 2CRFA 2Z0PA 1W1GA 3OANA 4MT7A 1LB1A 2VRWB 1H10A 4KVGB 1EGXA 4CHMA 4EMOA 2KCJA 3T06A 2HTHB 3A8QA 2DHIA 4TKNA 4HAUB 1N3HA 3D8DA 2J0KA 2YS1A 3MPXA 1IRSA 1MK7B 4HDQA 5D3YA 3HK0A 5C5BB 1V89A 3IVFA 4KHBB 2D9WA 2MKRA 3ULCA 4GMXB 3V5WA 2GJYA 3TW1A 2CY4A 3PZDA 5CLLB 1DDWA 1FGZA 5DI9B 3GYPA 1U27A 2CY5A 3ULBA 4B6HA 3VOQA 4EJNA 1WG7A 1E5WA 3CIKA 3QIJA 2MFQA 3QBVB 1TXDA 5LONB 1P6SA 4KHOA 4PQ0A 2AL6A 2D4QA 2XQNM 3KZ1A 4KAXB 2DYQA 1KZ7A 1RRPB 2X18A 1RJ2A 5L81A 3ZVRA 1TJ6A 5D3WA 1X1FA 1XCGA 1ZVRA 2GCLA 3WYFB 2AEHA 2Z0OA 3D8FA 2V76A 2COCA 3VIAA 5JLJB 2DTCA 4A6KA 2D10A 1MIZB 5KQ4A 3GYOA 3ML4A 3P7ZA 4GZUA 4A6HA 3ODXA 2RUKB 1V5PA 2VKIA 1MIXA 1X11A 4GPTB 4Z2NA 2LULA 1DDVA 2W2XC 2D9ZA 5D27A 3TFMA 2L2IA 2IFSA 2DA0A 4CYEA 1FHOA 5D3XA 4A6FA 5J3QA 4K2PA 1FGYA 1FB8A 4A6FB 2MDXA 1MAIA 3BJIA 5D3VA 2DKQA 4DXAB 2R0DA 2LG1A 3PVWA 1M7RA 2DFKA 2DKPA 2CODA 3TCAA 3DXCA 2CAYA 3PEGA 1U29A 2UZRA 3PVUA 2YSZA 2LKOA 1SGHA 2E2XA 2GCJA 2N23A 3BINA 2GS0A 4GXBA 1WJ1A 2QKLA 1Y19B 5KCVA 4HAYB 1U5DA 1ZC4B 2COAA 4P7IA 1U5GA 2DN6A 4PNKA 1EAZA 1P5TA 2OTXA 5C79A 5KQ1A 2MWNB 4Y94A 1I2HA 2D9YA 2LYDA 2D11A 2Q13A 4KHAA 4D0NB 4GN1A 5LOPB 3ODOA 1Z87A 2KUPA 5FI0A 2NZ8B 3HQCA 1OY2A 2G35A 1DYNA 4HHVA 2EMTA 5DHAB 5FI1A 5HE2A 1X1GA 2EC1A 2YT0A 1BAKA 1QC6A 1UEFA 1FHWA 2W2XD 2YF0A 5GOWB 2J59M 2ELAA
chains in the Genus database with same CATH superfamily
4DBBA 2Y8FA 3FSSA 1K5GB 3PG7A 4GOUA 1KZGA 5JHHA 3RCPA 2H7EA 2DX5A 1GG3A 1OMWA 1OQNA 3MDBC 3UZTA 2RGNB 1UNQA 3AU4A 3M1IB 4F7HA 3U7DA 2ELBA 2PZ1A 2ZPYA 5IRSA 3U8ZA 2Y8GA 4HB2B 2QKMA 3AU5A 2ROZB 1WJMA 5DH9B 5HE3A 2HE7A 1T77A 3ZDTA 4GMVA 2I1JA 5C6RA 3PVLA 3DXEA 2D9XA 4HATB 2R09A 4IOYX 2JP2A 1BTKA 3NWDA 3PP2A 1XD4A 2P0HA 2VSZA 1Q67A 3NSUA 2BCJA 1QQGA 2H7DA 3AJ4A 4YL8A 5HE0A 4HAWB 3HIEA 3O96A 5J3YA 1B55A 1TQZA 3FM8C 4K2OA 4MK0A 1V61A 1X86A 1MPHA 4HAVB 2K49A 4C0AA 2UVMA 1UPQA 2DYNA 1PLSA 3SV1A 1U5FA 4K17A 1ZYIA 2K2UA 2LOXA 2KGXB 5I2SA 3P6AA 3LJUX 3PSCA 2Y7BA 1W1DA 5HE1A 3CXBB 1PMSA 1J0WA 1EVHA 1ZC3B 2I1KA 2K8EA 5EFXA 1U2BA 3TO1A 4ZRIA 2K2JA 1NTVA 2RLOA 2W2WA 2UZSA 3KRXA 4DX90 1MK9B 2FJLA 4NSWA 1UPRA 1Y5OA 1MI1A 3G9WA 2D9VA 2OQBA 1FOEA 3D8EA 5C5BA 4HB4B 4WJ7A 5JP4A 3NWAA 3F0WA 1FAOA 1WGQA 1GC7A 1U5EA 4NY0A 5J3TA 1X05A 1H4RA 2EMSA 1XR0B 1UNRA 1MKEA 4ZRKA 4A5KA 4DIXA 3X23A 2ROVA 1UNPA 3WA0A 1ISNA 3KRWA 2DLWA 4WVFB 2J0JA 2KIGA 2GUMA 3SNHA 4F7GA 2RNRB 1ZSQA 4HB3B 5JHGA 2ADZA 3SO6A 1I7AA 1LW3A 3N7CA 4YONA 4Z2MB 2EJ8A 2COFA 3TVVA 2LOZA 4QJ5B 3QWMA 4EKUA 4DX8A 3A8PA 4K81A 1DROA 2L1CA 4D6WA 1AQCA 1J19A 2YVCA 2Z0QA 2DX1A 4HAZB 2M38A 2IYBA 2NMBA 5CLQB 4L6EA 2P0FA 1NTYA 5DIFB 1NI2A 3F5RA 2Z14A 1EF1A 1GC6A 1V88A 2Z4DA 1BWNA 3KSYA 2YT1A 4ZRJA 3SUZA 3SYXA 1KI1B 2J0MA 4CSQA 2D2QA 4XWXA 1FHXA 3DCXA 2YRYA 2RSGA 4HB0B 2Z59A 2P0DA 3KY9A 4OSNA 1M7EA 1XODA 3OHMB 2I5FA 3HW2B 1XKEA 2DHJA 2K00A 1SHCA 2RVBB 1ZM0A 3A98B 4HDOA 5C16A 1P3RA 2YS5A 1DDMA 1PFJA 2N0YA 2P8VA 1V5UA 2DHKA 1XX0A 4OT1A 3FEHA 3ODWA 2M14A 4F7UP 1DBHA 1AWEA 1WI1A 4TYZA 1WVHA 4QXAB 1BTNA 4BBKA 4MY6A 1WGUA 4H8SA 4WSFA 3B77A 1V5MA 2Z13A 2I5CA 4IAPA 2YS3A 4IFSA 1K5DB 1W1HA 4HAXB 4CHJA 5DHFB 3DXDA 1NU2A 2CRFA 2Z0PA 1W1GA 3A58A 3OANA 4MT7A 1LB1A 2VRWB 1H10A 4KVGB 1EGXA 4CHMA 4EMOA 2KCJA 3T06A 2HTHB 3A8QA 2DHIA 4TKNA 4HAUB 1N3HA 3D8DA 2J0KA 4KHBA 2YS1A 3MPXA 1IRSA 1MK7B 4HDQA 5D3YA 3HK0A 3NW8A 5C5BB 1V89A 3IVFA 4KHBB 2D9WA 2MKRA 3NWFA 3ULCA 4GMXB 3V5WA 2GJYA 3TW1A 2CY4A 3PZDA 2NBVA 5CLLB 5I2MA 1DDWA 1FGZA 4QJ3B 5DI9B 3GYPA 2R2YA 1U27A 2CY5A 3ULBA 4B6HA 3VOQA 3U12A 4EJNA 1WG7A 1E5WA 3CIKA 3QIJA 2MFQA 3QBVB 1TXDA 5LONB 1P6SA 4KHOA 2YT2A 4PQ0A 2AL6A 2D4QA 2XQNM 3KZ1A 4KAXB 2DYQA 1KZ7A 1RRPB 2X18A 1RJ2A 5L81A 3ZVRA 1TJ6A 5D3WA 2RRFA 1X1FA 1XCGA 1ZVRA 2GCLA 3WYFB 2AEHA 2Z0OA 4HSIA 3D8FA 2V76A 2COCA 3VIAA 2KUQA 5JLJB 2FJUB 2DTCA 4A6KA 2D10A 1MIZB 5KQ4A 3GYOA 3ML4A 3P7ZA 4GZUA 4A6HA 2KIEA 3ODXA 2RUKB 1V5PA 2VKIA 1MIXA 1X11A 4GPTB 4Z2NA 2LULA 4QJ4B 1DDVA 2W2XC 2D9ZA 5D27A 3TFMA 2ZKMX 2L2IA 2IFSA 2DA0A 4CYEA 1FHOA 5D3XA 4A6FA 5J3QA 4K2PA 1FGYA 1FB8A 4A6FB 2MDXA 1MAIA 3BJIA 3FVCA 5D3VA 5LG4B 2DKQA 4DXAB 2R0DA 2LG1A 3PVWA 1M7RA 2DFKA 2DKPA 2CODA 3TCAA 3DXCA 2CAYA 3PEGA 1U29A 2UZRA 3PVUA 2YSZA 2LKOA 1SGHA 2E2XA 2GCJA 5M4YB 2N23A 3BINA 2GS0A 4GXBA 1WJ1A 2QKLA 1Y19B 5KCVA 4HAYB 1U5DA 1ZC4B 2COAA 4L1RA 4P7IA 1U5GA 2DN6A 4PNKA 1EAZA 1P5TA 2OTXA 5C79A 5KQ1A 2MWNB 4Y94A 1I2HA 3HSAA 2D9YA 2LYDA 2D11A 2Q13A 4KHAA 4D0NB 4GN1A 5LOPB 3ODOA 1Z87A 2KUPA 5FI0A 2NZ8B 3HQCA 1OY2A 2G35A 1DYNA 4HHVA 2EMTA 5DHAB 5FI1A 5HE2A 1X1GA 4GNKB 2KR0A 2EC1A 2YT0A 1BAKA 1QC6A 1UEFA 1FHWA 2W2XD 2YF0A 5GOWB 2J59M 2ELAA
chains in the Genus database with same CATH topology
4DBBA 2Y8FA 3FSSA 1K5GB 3PG7A 1KZGA 5JHHA 3RCPA 2H7EA 2DX5A 1GG3A 1OMWA 1OQNA 3MDBC 3UZTA 2RGNB 1UNQA 3AU4A 3M1IB 4F7HA 3U7DA 2ELBA 2PZ1A 2ZPYA 3U8ZA 2Y8GA 4HB2B 2QKMA 3AU5A 2ROZB 1WJMA 5DH9B 5HE3A 2HE7A 3ZDTA 4GMVA 2I1JA 5C6RA 3PVLA 3DXEA 2D9XA 4HATB 2R09A 4IOYX 2JP2A 1BTKA 3PP2A 1XD4A 2P0HA 2VSZA 1Q67A 3NSUA 2BCJA 1QQGA 2H7DA 3AJ4A 4YL8A 5HE0A 4HAWB 3O96A 5J3YA 1B55A 1TQZA 3FM8C 4K2OA 4MK0A 1V61A 1X86A 1MPHA 4HAVB 4C0AA 2UVMA 1UPQA 2DYNA 1PLSA 3SV1A 1U5FA 4K17A 2K2UA 2LOXA 2KGXB 3P6AA 3LJUX 3PSCA 2Y7BA 1W1DA 5HE1A 3CXBB 1PMSA 1J0WA 1EVHA 1ZC3B 2I1KA 5EFXA 1U2BA 3TO1A 4ZRIA 2K2JA 1NTVA 2RLOA 2W2WA 2UZSA 3KRXA 4DX90 1MK9B 2FJLA 4NSWA 1UPRA 1Y5OA 3G9WA 2D9VA 2OQBA 1FOEA 3D8EA 5C5BA 4HB4B 4WJ7A 5JP4A 3F0WA 1FAOA 1WGQA 1GC7A 1U5EA 4NY0A 5J3TA 1X05A 1H4RA 2EMSA 1XR0B 1UNRA 1MKEA 4ZRKA 4A5KA 3X23A 2ROVA 1UNPA 3WA0A 1ISNA 3KRWA 2DLWA 4WVFB 2J0JA 3SNHA 4F7GA 2RNRB 1ZSQA 4HB3B 5JHGA 2ADZA 3SO6A 1I7AA 1LW3A 3N7CA 4YONA 4Z2MB 2EJ8A 2COFA 3TVVA 2LOZA 3QWMA 4EKUA 4DX8A 3A8PA 4K81A 1DROA 2L1CA 1AQCA 1J19A 2YVCA 2Z0QA 2DX1A 4HAZB 2M38A 2IYBA 2NMBA 5CLQB 4L6EA 2P0FA 1NTYA 5DIFB 1NI2A 3F5RA 1EF1A 1GC6A 1V88A 1BWNA 2YT1A 3KSYA 4ZRJA 3SUZA 3SYXA 1KI1B 2J0MA 2D2QA 4XWXA 1FHXA 2YRYA 2RSGA 4HB0B 2P0DA 3KY9A 1M7EA 1XODA 2I5FA 3HW2B 1XKEA 2DHJA 2K00A 1SHCA 2RVBB 1ZM0A 3A98B 4HDOA 5C16A 1P3RA 2YS5A 1DDMA 1PFJA 2N0YA 2P8VA 1V5UA 2DHKA 1XX0A 3FEHA 3ODWA 2M14A 4F7UP 1DBHA 1AWEA 1WI1A 4TYZA 1WVHA 4BBKA 1BTNA 4MY6A 1WGUA 4H8SA 4WSFA 1V5MA 2I5CA 4IAPA 2YS3A 4IFSA 1K5DB 1W1HA 4HAXB 4CHJA 5DHFB 3DXDA 1NU2A 2CRFA 2Z0PA 1W1GA 3OANA 4MT7A 1LB1A 2VRWB 1H10A 4KVGB 1EGXA 4CHMA 4EMOA 2KCJA 3T06A 2HTHB 3A8QA 2DHIA 4TKNA 4HAUB 1N3HA 3D8DA 2J0KA 2YS1A 3MPXA 1IRSA 1MK7B 4HDQA 5D3YA 3HK0A 5C5BB 1V89A 3IVFA 4KHBB 2D9WA 2MKRA 3ULCA 4GMXB 3V5WA 2GJYA 3TW1A 2CY4A 3PZDA 5CLLB 1DDWA 1FGZA 5DI9B 3GYPA 1U27A 2CY5A 3ULBA 4B6HA 3VOQA 4EJNA 1WG7A 1E5WA 3CIKA 3QIJA 2MFQA 3QBVB 1TXDA 5LONB 1P6SA 4KHOA 4PQ0A 2AL6A 2D4QA 2XQNM 3KZ1A 4KAXB 2DYQA 1KZ7A 1RRPB 2X18A 1RJ2A 5L81A 3ZVRA 1TJ6A 5D3WA 1X1FA 1XCGA 1ZVRA 2GCLA 3WYFB 2AEHA 2Z0OA 3D8FA 2V76A 2COCA 3VIAA 5JLJB 2DTCA 4A6KA 2D10A 1MIZB 5KQ4A 3GYOA 3ML4A 3P7ZA 4GZUA 4A6HA 3ODXA 2RUKB 1V5PA 2VKIA 1MIXA 1X11A 4GPTB 4Z2NA 2LULA 1DDVA 2W2XC 2D9ZA 5D27A 3TFMA 2L2IA 2IFSA 2DA0A 4CYEA 1FHOA 5D3XA 4A6FA 5J3QA 4K2PA 1FGYA 1FB8A 4A6FB 2MDXA 1MAIA 3BJIA 5D3VA 2DKQA 4DXAB 2R0DA 2LG1A 3PVWA 1M7RA 2DFKA 2DKPA 2CODA 3TCAA 3DXCA 2CAYA 3PEGA 1U29A 2UZRA 3PVUA 2YSZA 2LKOA 1SGHA 2E2XA 2GCJA 2N23A 3BINA 2GS0A 4GXBA 1WJ1A 2QKLA 1Y19B 5KCVA 4HAYB 1U5DA 1ZC4B 2COAA 4P7IA 1U5GA 2DN6A 4PNKA 1EAZA 1P5TA 2OTXA 5C79A 5KQ1A 2MWNB 4Y94A 1I2HA 2D9YA 2LYDA 2D11A 2Q13A 4KHAA 4D0NB 4GN1A 5LOPB 3ODOA 1Z87A 2KUPA 5FI0A 2NZ8B 3HQCA 1OY2A 2G35A 1DYNA 4HHVA 2EMTA 5DHAB 5FI1A 5HE2A 1X1GA 2EC1A 2YT0A 1BAKA 1QC6A 1UEFA 1FHWA 2W2XD 2YF0A 5GOWB 2J59M 2ELAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DBB A;  2Y8F A;  3FSS A;  1K5G B;  3PG7 A;  1KZG A;  5JHH A;  3RCP A;  2H7E A;  2DX5 A;  1GG3 A;  1OMW A;  1OQN A;  3MDB C;  3UZT A;  2RGN B;  1UNQ A;  3AU4 A;  3M1I B;  4F7H A;  3U7D A;  2ELB A;  2PZ1 A;  2ZPY A;  3U8Z A;  2Y8G A;  4HB2 B;  2QKM A;  3AU5 A;  2ROZ B;  1WJM A;  5DH9 B;  5HE3 A;  2HE7 A;  3ZDT A;  4GMV A;  2I1J A;  5C6R A;  3PVL A;  3DXE A;  2D9X A;  4HAT B;  2R09 A;  4IOY X;  2JP2 A;  1BTK A;  3PP2 A;  1XD4 A;  2P0H A;  2VSZ A;  1Q67 A;  3NSU A;  2BCJ A;  1QQG A;  2H7D A;  3AJ4 A;  4YL8 A;  5HE0 A;  4HAW B;  3O96 A;  5J3Y A;  1B55 A;  1TQZ A;  3FM8 C;  4K2O A;  4MK0 A;  1V61 A;  1X86 A;  1MPH A;  4HAV B;  4C0A A;  2UVM A;  1UPQ A;  2DYN A;  1PLS A;  3SV1 A;  1U5F A;  4K17 A;  2K2U A;  2LOX A;  2KGX B;  3P6A A;  3LJU X;  3PSC A;  2Y7B A;  1W1D A;  5HE1 A;  3CXB B;  1PMS A;  1J0W A;  1EVH A;  1ZC3 B;  2I1K A;  5EFX A;  1U2B A;  3TO1 A;  4ZRI A;  2K2J A;  1NTV A;  2RLO A;  2W2W A;  2UZS A;  3KRX A;  4DX9 0;  1MK9 B;  2FJL A;  4NSW A;  1UPR A;  1Y5O A;  3G9W A;  2D9V A;  2OQB A;  1FOE A;  3D8E A;  5C5B A;  4HB4 B;  4WJ7 A;  5JP4 A;  3F0W A;  1FAO A;  1WGQ A;  1GC7 A;  1U5E A;  4NY0 A;  5J3T A;  1X05 A;  1H4R A;  2EMS A;  1XR0 B;  1UNR A;  1MKE A;  4ZRK A;  4A5K A;  3X23 A;  2ROV A;  1UNP A;  3WA0 A;  1ISN A;  3KRW A;  2DLW A;  4WVF B;  2J0J A;  3SNH A;  4F7G A;  2RNR B;  1ZSQ A;  4HB3 B;  5JHG A;  2ADZ A;  3SO6 A;  1I7A A;  1LW3 A;  3N7C A;  4YON A;  4Z2M B;  2EJ8 A;  2COF A;  3TVV A;  2LOZ A;  3QWM A;  4EKU A;  4DX8 A;  3A8P A;  4K81 A;  1DRO A;  2L1C A;  1AQC A;  1J19 A;  2YVC A;  2Z0Q A;  2DX1 A;  4HAZ B;  2M38 A;  2IYB A;  2NMB A;  5CLQ B;  4L6E A;  2P0F A;  1NTY A;  5DIF B;  1NI2 A;  3F5R A;  1EF1 A;  1GC6 A;  1V88 A;  1BWN A;  2YT1 A;  3KSY A;  4ZRJ A;  3SUZ A;  3SYX A;  1KI1 B;  2J0M A;  2D2Q A;  4XWX A;  1FHX A;  2YRY A;  2RSG A;  4HB0 B;  2P0D A;  3KY9 A;  1M7E A;  1XOD A;  2I5F A;  3HW2 B;  1XKE A;  2DHJ A;  2K00 A;  1SHC A;  2RVB B;  1ZM0 A;  3A98 B;  4HDO A;  5C16 A;  1P3R A;  2YS5 A;  1DDM A;  1PFJ A;  2N0Y A;  2P8V A;  1V5U A;  2DHK A;  1XX0 A;  3FEH A;  3ODW A;  2M14 A;  4F7U P;  1DBH A;  1AWE A;  1WI1 A;  4TYZ A;  1WVH A;  4BBK A;  1BTN A;  4MY6 A;  1WGU A;  4H8S A;  4WSF A;  1V5M A;  2I5C A;  4IAP A;  2YS3 A;  4IFS A;  1K5D B;  1W1H A;  4HAX B;  4CHJ A;  5DHF B;  3DXD A;  1NU2 A;  2CRF A;  2Z0P A;  1W1G A;  3OAN A;  4MT7 A;  1LB1 A;  2VRW B;  1H10 A;  4KVG B;  1EGX A;  4CHM A;  4EMO A;  2KCJ A;  3T06 A;  2HTH B;  3A8Q A;  2DHI A;  4TKN A;  4HAU B;  1N3H A;  3D8D A;  2J0K A;  2YS1 A;  3MPX A;  1IRS A;  1MK7 B;  4HDQ A;  5D3Y A;  3HK0 A;  5C5B B;  1V89 A;  3IVF A;  4KHB B;  2D9W A;  2MKR A;  3ULC A;  4GMX B;  3V5W A;  2GJY A;  3TW1 A;  2CY4 A;  3PZD A;  5CLL B;  1DDW A;  1FGZ A;  5DI9 B;  3GYP A;  1U27 A;  2CY5 A;  3ULB A;  4B6H A;  3VOQ A;  4EJN A;  1WG7 A;  1E5W A;  3CIK A;  3QIJ A;  2MFQ A;  3QBV B;  1TXD A;  5LON B;  1P6S A;  4KHO A;  4PQ0 A;  2AL6 A;  2D4Q A;  2XQN M;  3KZ1 A;  4KAX B;  2DYQ A;  1KZ7 A;  1RRP B;  2X18 A;  1RJ2 A;  5L81 A;  3ZVR A;  1TJ6 A;  5D3W A;  1X1F A;  1XCG A;  1ZVR A;  2GCL A;  3WYF B;  2AEH A;  2Z0O A;  3D8F A;  2V76 A;  2COC A;  3VIA A;  5JLJ B;  2DTC A;  4A6K A;  2D10 A;  1MIZ B;  5KQ4 A;  3GYO A;  3ML4 A;  3P7Z A;  4GZU A;  4A6H A;  3ODX A;  2RUK B;  1V5P A;  2VKI A;  1MIX A;  1X11 A;  4GPT B;  4Z2N A;  2LUL A;  1DDV A;  2W2X C;  2D9Z A;  5D27 A;  3TFM A;  2L2I A;  2IFS A;  2DA0 A;  4CYE A;  1FHO A;  5D3X A;  4A6F A;  5J3Q A;  4K2P A;  1FGY A;  1FB8 A;  4A6F B;  2MDX A;  1MAI A;  3BJI A;  5D3V A;  2DKQ A;  4DXA B;  2R0D A;  2LG1 A;  3PVW A;  1M7R A;  2DFK A;  2DKP A;  2COD A;  3TCA A;  3DXC A;  2CAY A;  3PEG A;  1U29 A;  2UZR A;  3PVU A;  2YSZ A;  2LKO A;  1SGH A;  2E2X A;  2GCJ A;  2N23 A;  3BIN A;  2GS0 A;  4GXB A;  1WJ1 A;  2QKL A;  1Y19 B;  5KCV A;  4HAY B;  1U5D A;  1ZC4 B;  2COA A;  4P7I A;  1U5G A;  2DN6 A;  4PNK A;  1EAZ A;  1P5T A;  2OTX A;  5C79 A;  5KQ1 A;  2MWN B;  4Y94 A;  1I2H A;  2D9Y A;  2LYD A;  2D11 A;  2Q13 A;  4KHA A;  4D0N B;  4GN1 A;  5LOP B;  3ODO A;  1Z87 A;  2KUP A;  5FI0 A;  2NZ8 B;  3HQC A;  1OY2 A;  2G35 A;  1DYN A;  4HHV A;  2EMT A;  5DHA B;  5FI1 A;  5HE2 A;  1X1G A;  2EC1 A;  2YT0 A;  1BAK A;  1QC6 A;  1UEF A;  1FHW A;  2W2X D;  2YF0 A;  5GOW B;  2J59 M;  2ELA A; 
#chains in the Genus database with same CATH topology
 4DBB A;  2Y8F A;  3FSS A;  1K5G B;  3PG7 A;  4GOU A;  1KZG A;  5JHH A;  3RCP A;  2H7E A;  2DX5 A;  1GG3 A;  1OMW A;  1OQN A;  3MDB C;  3UZT A;  2RGN B;  1UNQ A;  3AU4 A;  3M1I B;  4F7H A;  3U7D A;  2ELB A;  2PZ1 A;  2ZPY A;  5IRS A;  3U8Z A;  2Y8G A;  4HB2 B;  2QKM A;  3AU5 A;  2ROZ B;  1WJM A;  5DH9 B;  5HE3 A;  2HE7 A;  1T77 A;  3ZDT A;  4GMV A;  2I1J A;  5C6R A;  3PVL A;  3DXE A;  2D9X A;  4HAT B;  2R09 A;  4IOY X;  2JP2 A;  1BTK A;  3NWD A;  3PP2 A;  1XD4 A;  2P0H A;  2VSZ A;  1Q67 A;  3NSU A;  2BCJ A;  1QQG A;  2H7D A;  3AJ4 A;  4YL8 A;  5HE0 A;  4HAW B;  3HIE A;  3O96 A;  5J3Y A;  1B55 A;  1TQZ A;  3FM8 C;  4K2O A;  4MK0 A;  1V61 A;  1X86 A;  1MPH A;  4HAV B;  2K49 A;  4C0A A;  2UVM A;  1UPQ A;  2DYN A;  1PLS A;  3SV1 A;  1U5F A;  4K17 A;  1ZYI A;  2K2U A;  2LOX A;  2KGX B;  5I2S A;  3P6A A;  3LJU X;  3PSC A;  2Y7B A;  1W1D A;  5HE1 A;  3CXB B;  1PMS A;  1J0W A;  1EVH A;  1ZC3 B;  2I1K A;  2K8E A;  5EFX A;  1U2B A;  3TO1 A;  4ZRI A;  2K2J A;  1NTV A;  2RLO A;  2W2W A;  2UZS A;  3KRX A;  4DX9 0;  1MK9 B;  2FJL A;  4NSW A;  1UPR A;  1Y5O A;  1MI1 A;  3G9W A;  2D9V A;  2OQB A;  1FOE A;  3D8E A;  5C5B A;  4HB4 B;  4WJ7 A;  5JP4 A;  3NWA A;  3F0W A;  1FAO A;  1WGQ A;  1GC7 A;  1U5E A;  4NY0 A;  5J3T A;  1X05 A;  1H4R A;  2EMS A;  1XR0 B;  1UNR A;  1MKE A;  4ZRK A;  4A5K A;  4DIX A;  3X23 A;  2ROV A;  1UNP A;  3WA0 A;  1ISN A;  3KRW A;  2DLW A;  4WVF B;  2J0J A;  2KIG A;  2GUM A;  3SNH A;  4F7G A;  2RNR B;  1ZSQ A;  4HB3 B;  5JHG A;  2ADZ A;  3SO6 A;  1I7A A;  1LW3 A;  3N7C A;  4YON A;  4Z2M B;  2EJ8 A;  2COF A;  3TVV A;  2LOZ A;  4QJ5 B;  3QWM A;  4EKU A;  4DX8 A;  3A8P A;  4K81 A;  1DRO A;  2L1C A;  4D6W A;  1AQC A;  1J19 A;  2YVC A;  2Z0Q A;  2DX1 A;  4HAZ B;  2M38 A;  2IYB A;  2NMB A;  5CLQ B;  4L6E A;  2P0F A;  1NTY A;  5DIF B;  1NI2 A;  3F5R A;  2Z14 A;  1EF1 A;  1GC6 A;  1V88 A;  2Z4D A;  1BWN A;  3KSY A;  2YT1 A;  4ZRJ A;  3SUZ A;  3SYX A;  1KI1 B;  2J0M A;  4CSQ A;  2D2Q A;  4XWX A;  1FHX A;  3DCX A;  2YRY A;  2RSG A;  4HB0 B;  2Z59 A;  2P0D A;  3KY9 A;  4OSN A;  1M7E A;  1XOD A;  3OHM B;  2I5F A;  3HW2 B;  1XKE A;  2DHJ A;  2K00 A;  1SHC A;  2RVB B;  1ZM0 A;  3A98 B;  4HDO A;  5C16 A;  1P3R A;  2YS5 A;  1DDM A;  1PFJ A;  2N0Y A;  2P8V A;  1V5U A;  2DHK A;  1XX0 A;  4OT1 A;  3FEH A;  3ODW A;  2M14 A;  4F7U P;  1DBH A;  1AWE A;  1WI1 A;  4TYZ A;  1WVH A;  4QXA B;  1BTN A;  4BBK A;  4MY6 A;  1WGU A;  4H8S A;  4WSF A;  3B77 A;  1V5M A;  2Z13 A;  2I5C A;  4IAP A;  2YS3 A;  4IFS A;  1K5D B;  1W1H A;  4HAX B;  4CHJ A;  5DHF B;  3DXD A;  1NU2 A;  2CRF A;  2Z0P A;  1W1G A;  3A58 A;  3OAN A;  4MT7 A;  1LB1 A;  2VRW B;  1H10 A;  4KVG B;  1EGX A;  4CHM A;  4EMO A;  2KCJ A;  3T06 A;  2HTH B;  3A8Q A;  2DHI A;  4TKN A;  4HAU B;  1N3H A;  3D8D A;  2J0K A;  4KHB A;  2YS1 A;  3MPX A;  1IRS A;  1MK7 B;  4HDQ A;  5D3Y A;  3HK0 A;  3NW8 A;  5C5B B;  1V89 A;  3IVF A;  4KHB B;  2D9W A;  2MKR A;  3NWF A;  3ULC A;  4GMX B;  3V5W A;  2GJY A;  3TW1 A;  2CY4 A;  3PZD A;  2NBV A;  5CLL B;  5I2M A;  1DDW A;  1FGZ A;  4QJ3 B;  5DI9 B;  3GYP A;  2R2Y A;  1U27 A;  2CY5 A;  3ULB A;  4B6H A;  3VOQ A;  3U12 A;  4EJN A;  1WG7 A;  1E5W A;  3CIK A;  3QIJ A;  2MFQ A;  3QBV B;  1TXD A;  5LON B;  1P6S A;  4KHO A;  2YT2 A;  4PQ0 A;  2AL6 A;  2D4Q A;  2XQN M;  3KZ1 A;  4KAX B;  2DYQ A;  1KZ7 A;  1RRP B;  2X18 A;  1RJ2 A;  5L81 A;  3ZVR A;  1TJ6 A;  5D3W A;  2RRF A;  1X1F A;  1XCG A;  1ZVR A;  2GCL A;  3WYF B;  2AEH A;  2Z0O A;  4HSI A;  3D8F A;  2V76 A;  2COC A;  3VIA A;  2KUQ A;  5JLJ B;  2FJU B;  2DTC A;  4A6K A;  2D10 A;  1MIZ B;  5KQ4 A;  3GYO A;  3ML4 A;  3P7Z A;  4GZU A;  4A6H A;  2KIE A;  3ODX A;  2RUK B;  1V5P A;  2VKI A;  1MIX A;  1X11 A;  4GPT B;  4Z2N A;  2LUL A;  4QJ4 B;  1DDV A;  2W2X C;  2D9Z A;  5D27 A;  3TFM A;  2ZKM X;  2L2I A;  2IFS A;  2DA0 A;  4CYE A;  1FHO A;  5D3X A;  4A6F A;  5J3Q A;  4K2P A;  1FGY A;  1FB8 A;  4A6F B;  2MDX A;  1MAI A;  3BJI A;  3FVC A;  5D3V A;  5LG4 B;  2DKQ A;  4DXA B;  2R0D A;  2LG1 A;  3PVW A;  1M7R A;  2DFK A;  2DKP A;  2COD A;  3TCA A;  3DXC A;  2CAY A;  3PEG A;  1U29 A;  2UZR A;  3PVU A;  2YSZ A;  2LKO A;  1SGH A;  2E2X A;  2GCJ A;  5M4Y B;  2N23 A;  3BIN A;  2GS0 A;  4GXB A;  1WJ1 A;  2QKL A;  1Y19 B;  5KCV A;  4HAY B;  1U5D A;  1ZC4 B;  2COA A;  4L1R A;  4P7I A;  1U5G A;  2DN6 A;  4PNK A;  1EAZ A;  1P5T A;  2OTX A;  5C79 A;  5KQ1 A;  2MWN B;  4Y94 A;  1I2H A;  3HSA A;  2D9Y A;  2LYD A;  2D11 A;  2Q13 A;  4KHA A;  4D0N B;  4GN1 A;  5LOP B;  3ODO A;  1Z87 A;  2KUP A;  5FI0 A;  2NZ8 B;  3HQC A;  1OY2 A;  2G35 A;  1DYN A;  4HHV A;  2EMT A;  5DHA B;  5FI1 A;  5HE2 A;  1X1G A;  4GNK B;  2KR0 A;  2EC1 A;  2YT0 A;  1BAK A;  1QC6 A;  1UEF A;  1FHW A;  2W2X D;  2YF0 A;  5GOW B;  2J59 M;  2ELA A; 
#chains in the Genus database with same CATH homology
 4DBB A;  2Y8F A;  3FSS A;  1K5G B;  3PG7 A;  1KZG A;  5JHH A;  3RCP A;  2H7E A;  2DX5 A;  1GG3 A;  1OMW A;  1OQN A;  3MDB C;  3UZT A;  2RGN B;  1UNQ A;  3AU4 A;  3M1I B;  4F7H A;  3U7D A;  2ELB A;  2PZ1 A;  2ZPY A;  3U8Z A;  2Y8G A;  4HB2 B;  2QKM A;  3AU5 A;  2ROZ B;  1WJM A;  5DH9 B;  5HE3 A;  2HE7 A;  3ZDT A;  4GMV A;  2I1J A;  5C6R A;  3PVL A;  3DXE A;  2D9X A;  4HAT B;  2R09 A;  4IOY X;  2JP2 A;  1BTK A;  3PP2 A;  1XD4 A;  2P0H A;  2VSZ A;  1Q67 A;  3NSU A;  2BCJ A;  1QQG A;  2H7D A;  3AJ4 A;  4YL8 A;  5HE0 A;  4HAW B;  3O96 A;  5J3Y A;  1B55 A;  1TQZ A;  3FM8 C;  4K2O A;  4MK0 A;  1V61 A;  1X86 A;  1MPH A;  4HAV B;  4C0A A;  2UVM A;  1UPQ A;  2DYN A;  1PLS A;  3SV1 A;  1U5F A;  4K17 A;  2K2U A;  2LOX A;  2KGX B;  3P6A A;  3LJU X;  3PSC A;  2Y7B A;  1W1D A;  5HE1 A;  3CXB B;  1PMS A;  1J0W A;  1EVH A;  1ZC3 B;  2I1K A;  5EFX A;  1U2B A;  3TO1 A;  4ZRI A;  2K2J A;  1NTV A;  2RLO A;  2W2W A;  2UZS A;  3KRX A;  4DX9 0;  1MK9 B;  2FJL A;  4NSW A;  1UPR A;  1Y5O A;  3G9W A;  2D9V A;  2OQB A;  1FOE A;  3D8E A;  5C5B A;  4HB4 B;  4WJ7 A;  5JP4 A;  3F0W A;  1FAO A;  1WGQ A;  1GC7 A;  1U5E A;  4NY0 A;  5J3T A;  1X05 A;  1H4R A;  2EMS A;  1XR0 B;  1UNR A;  1MKE A;  4ZRK A;  4A5K A;  3X23 A;  2ROV A;  1UNP A;  3WA0 A;  1ISN A;  3KRW A;  2DLW A;  4WVF B;  2J0J A;  3SNH A;  4F7G A;  2RNR B;  1ZSQ A;  4HB3 B;  5JHG A;  2ADZ A;  3SO6 A;  1I7A A;  1LW3 A;  3N7C A;  4YON A;  4Z2M B;  2EJ8 A;  2COF A;  3TVV A;  2LOZ A;  3QWM A;  4EKU A;  4DX8 A;  3A8P A;  4K81 A;  1DRO A;  2L1C A;  1AQC A;  1J19 A;  2YVC A;  2Z0Q A;  2DX1 A;  4HAZ B;  2M38 A;  2IYB A;  2NMB A;  5CLQ B;  4L6E A;  2P0F A;  1NTY A;  5DIF B;  1NI2 A;  3F5R A;  1EF1 A;  1GC6 A;  1V88 A;  1BWN A;  2YT1 A;  3KSY A;  4ZRJ A;  3SUZ A;  3SYX A;  1KI1 B;  2J0M A;  2D2Q A;  4XWX A;  1FHX A;  2YRY A;  2RSG A;  4HB0 B;  2P0D A;  3KY9 A;  1M7E A;  1XOD A;  2I5F A;  3HW2 B;  1XKE A;  2DHJ A;  2K00 A;  1SHC A;  2RVB B;  1ZM0 A;  3A98 B;  4HDO A;  5C16 A;  1P3R A;  2YS5 A;  1DDM A;  1PFJ A;  2N0Y A;  2P8V A;  1V5U A;  2DHK A;  1XX0 A;  3FEH A;  3ODW A;  2M14 A;  4F7U P;  1DBH A;  1AWE A;  1WI1 A;  4TYZ A;  1WVH A;  4BBK A;  1BTN A;  4MY6 A;  1WGU A;  4H8S A;  4WSF A;  1V5M A;  2I5C A;  4IAP A;  2YS3 A;  4IFS A;  1K5D B;  1W1H A;  4HAX B;  4CHJ A;  5DHF B;  3DXD A;  1NU2 A;  2CRF A;  2Z0P A;  1W1G A;  3OAN A;  4MT7 A;  1LB1 A;  2VRW B;  1H10 A;  4KVG B;  1EGX A;  4CHM A;  4EMO A;  2KCJ A;  3T06 A;  2HTH B;  3A8Q A;  2DHI A;  4TKN A;  4HAU B;  1N3H A;  3D8D A;  2J0K A;  2YS1 A;  3MPX A;  1IRS A;  1MK7 B;  4HDQ A;  5D3Y A;  3HK0 A;  5C5B B;  1V89 A;  3IVF A;  4KHB B;  2D9W A;  2MKR A;  3ULC A;  4GMX B;  3V5W A;  2GJY A;  3TW1 A;  2CY4 A;  3PZD A;  5CLL B;  1DDW A;  1FGZ A;  5DI9 B;  3GYP A;  1U27 A;  2CY5 A;  3ULB A;  4B6H A;  3VOQ A;  4EJN A;  1WG7 A;  1E5W A;  3CIK A;  3QIJ A;  2MFQ A;  3QBV B;  1TXD A;  5LON B;  1P6S A;  4KHO A;  4PQ0 A;  2AL6 A;  2D4Q A;  2XQN M;  3KZ1 A;  4KAX B;  2DYQ A;  1KZ7 A;  1RRP B;  2X18 A;  1RJ2 A;  5L81 A;  3ZVR A;  1TJ6 A;  5D3W A;  1X1F A;  1XCG A;  1ZVR A;  2GCL A;  3WYF B;  2AEH A;  2Z0O A;  3D8F A;  2V76 A;  2COC A;  3VIA A;  5JLJ B;  2DTC A;  4A6K A;  2D10 A;  1MIZ B;  5KQ4 A;  3GYO A;  3ML4 A;  3P7Z A;  4GZU A;  4A6H A;  3ODX A;  2RUK B;  1V5P A;  2VKI A;  1MIX A;  1X11 A;  4GPT B;  4Z2N A;  2LUL A;  1DDV A;  2W2X C;  2D9Z A;  5D27 A;  3TFM A;  2L2I A;  2IFS A;  2DA0 A;  4CYE A;  1FHO A;  5D3X A;  4A6F A;  5J3Q A;  4K2P A;  1FGY A;  1FB8 A;  4A6F B;  2MDX A;  1MAI A;  3BJI A;  5D3V A;  2DKQ A;  4DXA B;  2R0D A;  2LG1 A;  3PVW A;  1M7R A;  2DFK A;  2DKP A;  2COD A;  3TCA A;  3DXC A;  2CAY A;  3PEG A;  1U29 A;  2UZR A;  3PVU A;  2YSZ A;  2LKO A;  1SGH A;  2E2X A;  2GCJ A;  2N23 A;  3BIN A;  2GS0 A;  4GXB A;  1WJ1 A;  2QKL A;  1Y19 B;  5KCV A;  4HAY B;  1U5D A;  1ZC4 B;  2COA A;  4P7I A;  1U5G A;  2DN6 A;  4PNK A;  1EAZ A;  1P5T A;  2OTX A;  5C79 A;  5KQ1 A;  2MWN B;  4Y94 A;  1I2H A;  2D9Y A;  2LYD A;  2D11 A;  2Q13 A;  4KHA A;  4D0N B;  4GN1 A;  5LOP B;  3ODO A;  1Z87 A;  2KUP A;  5FI0 A;  2NZ8 B;  3HQC A;  1OY2 A;  2G35 A;  1DYN A;  4HHV A;  2EMT A;  5DHA B;  5FI1 A;  5HE2 A;  1X1G A;  2EC1 A;  2YT0 A;  1BAK A;  1QC6 A;  1UEF A;  1FHW A;  2W2X D;  2YF0 A;  5GOW B;  2J59 M;  2ELA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...