3VOQA

Crystal structure of the pleckstrin homology domain of human sin1, a torc2 subunit
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
122
structure length
116
Chain Sequence
GAMATVQDMLSSHHYKSFKVSMIHRLRFTTDVQLGISGDKVEIDPVTKFWIKQKPISIDSDLLCACDLAEEKSPSHAIFKLTYLSNHDYKHLYFESDAATVNEIVLKVNYILESRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structures of the pleckstrin homology domain of Saccharomyces cerevisiae Avo1 and its human orthologue Sin1, an essential subunit of TOR complex 2
pubmed doi rcsb
source organism Homo sapiens
molecule tags Membrane protein
molecule keywords Target of rapamycin complex 2 subunit MAPKAP1
total genus 28
structure length 116
sequence length 122
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-01-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16979 SIN1_PH SAPK-interacting protein 1 (Sin1), Pleckstrin-homology
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 3voqA00
3CIKA 2R0DA 4WSFA 1SGHA 1RRPB 2D9XA 5DHFB 1ZM0A 2P0FA 1WJMA 5D3XA 1MIXA 3IVFA 1GC7A 1NI2A 4HAXB 2D9WA 2D10A 1M7EA 2RGNB 1WGQA 1J0WA 2W2XC 3WYFB 1K5DB 2M38A 3P6AA 1H10A 1FHXA 5D27A 1BTNA 1LB1A 4DXAB 2EJ8A 2MKRA 3FM8C 3TCAA 1GC6A 1FHWA 2L1CA 3TO1A 3BINA 1XODA 2ELBA 5C5BB 4K17A 3PG7A 5DIFB 4H8SA 2GJYA 2UZRA 2Z0QA 3UZTA 2AEHA 2ROVA 4MK0A 4TYZA 3TVVA 1U5EA 4A6HA 3TW1A 5LONB 2K00A 3HQCA 3N7CA 3QBVB 2I5CA 5L81A 1PFJA 2D9YA 3A8PA 2ROZB 3ODOA 3DXEA 2YSZA 1XX0A 1XCGA 2PZ1A 4HAVB 4EMOA 4ZRJA 4YONA 2JP2A 1X11A 4PNKA 3X23A 4A5KA 1WJ1A 4F7GA 2DKQA 2K2UA 3SO6A 4F7UP 1V88A 4GMXB 1I2HA 4XWXA 2YS1A 4HB3B 2DN6A 5KCVA 1DROA 4IAPA 2COCA 1XD4A 5HE1A 4BBKA 5J3QA 2HE7A 1U5FA 5DHAB 2UVMA 4L6EA 2QKLA 1NU2A 1FOEA 3AJ4A 1NTYA 3PZDA 4EJNA 4ZRIA 4Z2MB 3KZ1A 1P3RA 5HE0A 3F5RA 3SNHA 1OQNA 1E5WA 4HAYB 1X86A 3PEGA 3SUZA 1Z87A 1X1GA 1UPQA 2K2JA 2L2IA 1M7RA 3ZVRA 2DYNA 2IYBA 2VKIA 3PVUA 4D0NB 2J0KA 5JHHA 1ISNA 1OMWA 3G9WA 5EFXA 2CAYA 2M14A 3KRWA 2DFKA 1FB8A 4KVGB 5JP4A 4GXBA 1RJ2A 1U5GA 2R09A 2IFSA 4HAZB 1MK9B 1AQCA 2EMTA 2CY5A 5FI1A 2HTHB 1AWEA 1W1GA 2ZPYA 1FAOA 3MPXA 3V5WA 3M1IB 3MDBC 3BJIA 3ZDTA 1MAIA 2D9VA 1UNRA 2CODA 3U8ZA 1WI1A 4K2PA 2UZSA 5JLJB 2G35A 4CYEA 2VSZA 4GMVA 1MIZB 2Y8FA 2EMSA 2N23A 3QIJA 2P0DA 2KUPA 3A8QA 1IRSA 2COAA 2Y8GA 2I5FA 4A6FB 3GYPA 3ML4A 2YS3A 2MFQA 1BAKA 2DYQA 4HDOA 1W1DA 1QQGA 1XKEA 1UNQA 2DHIA 4WVFB 5LOPB 4TKNA 1ZSQA 3PP2A 2J0MA 2EC1A 3A98B 3AU4A 2XQNM 1MK7B 2D2QA 5C79A 1KZGA 3SYXA 3DXDA 5C5BA 2J0JA 2YT1A 1UNPA 1V89A 1XR0B 4GZUA 1FGYA 1WGUA 2BCJA 1U5DA 4MT7A 2J59M 2LOXA 1WVHA 2GCJA 1SHCA 1UEFA 1FGZA 1V61A 5C6RA 5CLLB 4K2OA 2DHKA 1PLSA 1MKEA 1WG7A 1BTKA 2D9ZA 5HE3A 4Z2NA 2KCJA 3PVLA 1Q67A 1NTVA 2LULA 1U2BA 2RSGA 1DBHA 1TXDA 1X1FA 1KI1B 1U29A 4HAUB 3KSYA 3LJUX 2Y7BA 2ADZA 1UPRA 1LW3A 2RVBB 2RNRB 3ODWA 1OY2A 3OANA 2Z0PA 4GPTB 2YVCA 1H4RA 3PVWA 3WA0A 4HHVA 4A6KA 1BWNA 1PMSA 2DX5A 2H7DA 3D8FA 2DA0A 3CXBB 5D3WA 4NSWA 4B6HA 4HDQA 2CRFA 4CHJA 3D8EA 2MDXA 4DBBA 5J3YA 5DH9B 2LKOA 4HAWB 1I7AA 1ZC3B 4ZRKA 2Z0OA 1X05A 2W2XD 4HB2B 2I1KA 3ULCA 2YRYA 4C0AA 4KHOA 2GS0A 1U27A 2NMBA 1N3HA 5JHGA 1FHOA 1TJ6A 2DKPA 1EF1A 1KZ7A 2LG1A 2COFA 2YF0A 5CLQB 2E2XA 3VIAA 1DDVA 1V5PA 2P8VA 2NZ8B 1Y5OA 3GYOA 2LOZA 2OTXA 4A6FA 1QC6A 4K81A 5KQ4A 2KGXB 3RCPA 5D3VA 5DI9B 5KQ1A 2D11A 3NSUA 4NY0A 4KAXB 3U7DA 4HB0B 5FI0A 5HE2A 3T06A 1K5GB 5D3YA 1ZC4B 4P7IA 2W2WA 2AL6A 5C16A 2Q13A 2YS5A 1DYNA 2X18A 2RLOA 2V76A 1EGXA 3D8DA 1P5TA 4YL8A 2FJLA 2P0HA 1V5UA 2RUKB 3O96A 4IOYX 1Y19B 2DHJA 4HB4B 3ULBA 4DX8A 2GCLA 2ELAA 2CY4A 2N0YA 1DDMA 3QWMA 1GG3A 1MPHA 4F7HA 2LYDA 1B55A 3HW2B 1EVHA 4GN1A 4DX90 2DX1A 2DLWA 4HATB 3F0WA 5J3TA 5GOWB 3AU5A 1V5MA 3ODXA 4MY6A 1ZVRA 2OQBA 3TFMA 1J19A 3SV1A 1W1HA 3FEHA 2MWNB 3VOQA 3PSCA 4WJ7A 4EKUA 1DDWA 3DXCA 2H7EA 2VRWB 1TQZA 3P7ZA 1EAZA 4KHBB 3FSSA 2I1JA 4IFSA 2YT0A 3KRXA 4KHAA 2QKMA 2DTCA 3KY9A 4Y94A 3HK0A 1P6SA 4PQ0A 2D4QA 4CHMA
chains in the Genus database with same CATH superfamily
3CIKA 2R0DA 4WSFA 1SGHA 1RRPB 2D9XA 5DHFB 1ZM0A 4OT1A 4D6WA 2P0FA 1WJMA 5D3XA 1MIXA 3IVFA 1GC7A 1NI2A 4HAXB 2D9WA 2D10A 1M7EA 2RGNB 1WGQA 1J0WA 2W2XC 2KUQA 1K5DB 2M38A 3P6AA 1H10A 1FHXA 5D27A 3WYFB 1BTNA 1LB1A 4DXAB 2EJ8A 2MKRA 3FM8C 3TCAA 1GC6A 1FHWA 2L1CA 3TO1A 3BINA 1XODA 2ELBA 5C5BB 4K17A 3PG7A 5DIFB 4H8SA 2GJYA 2UZRA 2GUMA 2Z0QA 3UZTA 2AEHA 2ROVA 4MK0A 4TYZA 3TVVA 1U5EA 4A6HA 3TW1A 5LONB 2K00A 3HQCA 3N7CA 3QBVB 2I5CA 5L81A 1PFJA 2D9YA 3A8PA 2ROZB 3ODOA 3DXEA 2YSZA 1XX0A 1XCGA 2PZ1A 4HAVB 4EMOA 4KHBA 4ZRJA 4YONA 2JP2A 1X11A 4PNKA 3X23A 4A5KA 1WJ1A 4F7GA 2DKQA 2K2UA 3SO6A 4F7UP 1V88A 4GMXB 2K8EA 1I2HA 4XWXA 2YS1A 4HB3B 2DN6A 5KCVA 1DROA 4IAPA 2COCA 1XD4A 5HE1A 4BBKA 2K49A 5J3QA 2HE7A 1U5FA 5DHAB 2UVMA 4L6EA 2QKLA 1NU2A 1FOEA 1ZYIA 3AJ4A 1NTYA 3PZDA 4EJNA 4ZRIA 4QJ3B 3NWAA 4Z2MB 3KZ1A 1P3RA 5HE0A 3F5RA 3SNHA 1OQNA 1E5WA 4HAYB 1X86A 2FJUB 4GOUA 3PEGA 3SUZA 1Z87A 1X1GA 3DCXA 1UPQA 2K2JA 3FVCA 2L2IA 1M7RA 3ZVRA 2DYNA 2IYBA 2R2YA 2VKIA 3PVUA 4D0NB 2J0KA 2RRFA 5JHHA 1ISNA 1OMWA 3G9WA 5EFXA 2CAYA 2M14A 3KRWA 2DFKA 1FB8A 4KVGB 5JP4A 4GXBA 1RJ2A 1U5GA 2ZKMX 2R09A 2IFSA 4HAZB 1MK9B 1AQCA 2EMTA 2CY5A 5FI1A 2HTHB 1AWEA 1W1GA 2ZPYA 1FAOA 3MPXA 3V5WA 3M1IB 3MDBC 3BJIA 3ZDTA 4QXAB 1MAIA 2D9VA 1MI1A 1UNRA 2CODA 3U8ZA 1WI1A 4K2PA 2UZSA 5JLJB 2G35A 4CYEA 2VSZA 4GMVA 1MIZB 5IRSA 2Y8FA 2EMSA 2N23A 3QIJA 2P0DA 2KUPA 3A8QA 1IRSA 2COAA 2Y8GA 3HIEA 2I5FA 4A6FB 3GYPA 3ML4A 2YS3A 2MFQA 1BAKA 2DYQA 4HDOA 1W1DA 3NW8A 4QJ5B 1QQGA 1XKEA 1UNQA 2DHIA 4WVFB 5LOPB 4TKNA 1ZSQA 3PP2A 2J0MA 2EC1A 3A98B 2KIEA 3AU4A 2XQNM 1MK7B 2D2QA 5C79A 1KZGA 3SYXA 2Z14A 3DXDA 5C5BA 2J0JA 2YT1A 1UNPA 1V89A 1XR0B 4GZUA 1FGYA 1WGUA 2BCJA 1U5DA 4MT7A 2J59M 2LOXA 1WVHA 2GCJA 1SHCA 3NWFA 4DIXA 5LG4B 3HSAA 1UEFA 1FGZA 1V61A 5C6RA 5CLLB 4K2OA 2DHKA 3NWDA 1PLSA 1MKEA 1WG7A 1BTKA 2D9ZA 5HE3A 4Z2NA 2KCJA 3PVLA 1Q67A 1NTVA 2LULA 1U2BA 2RSGA 1DBHA 1TXDA 1X1FA 1KI1B 1U29A 4HAUB 3KSYA 3LJUX 2Y7BA 2ADZA 1UPRA 3B77A 1LW3A 2RVBB 2RNRB 3ODWA 1OY2A 3OANA 1T77A 2Z0PA 4GPTB 2YVCA 1H4RA 3PVWA 3WA0A 4HHVA 4A6KA 1BWNA 1PMSA 2DX5A 2H7DA 4CSQA 3D8FA 2DA0A 3CXBB 5D3WA 4NSWA 4B6HA 4HDQA 2CRFA 4CHJA 3D8EA 2MDXA 4DBBA 5I2MA 5J3YA 5DH9B 2LKOA 4HAWB 1I7AA 1ZC3B 4ZRKA 2Z0OA 1X05A 2W2XD 4HB2B 2I1KA 3ULCA 2YRYA 3U12A 4C0AA 4KHOA 2GS0A 1U27A 2NMBA 1N3HA 5JHGA 1FHOA 2NBVA 5I2SA 1TJ6A 2DKPA 1EF1A 1KZ7A 2LG1A 2COFA 2YF0A 5CLQB 2E2XA 3VIAA 1DDVA 1V5PA 2P8VA 2NZ8B 1Y5OA 3GYOA 2LOZA 2OTXA 4A6FA 5M4YB 1QC6A 4K81A 5KQ4A 2KGXB 3RCPA 5D3VA 5DI9B 5KQ1A 2D11A 3NSUA 4HSIA 4NY0A 4KAXB 3U7DA 4HB0B 5FI0A 5HE2A 3T06A 1K5GB 5D3YA 1ZC4B 4P7IA 2W2WA 2AL6A 5C16A 2Q13A 2YS5A 1DYNA 2KR0A 2X18A 2RLOA 2V76A 1EGXA 3D8DA 1P5TA 4YL8A 2FJLA 2P0HA 1V5UA 2RUKB 2Z59A 4L1RA 3O96A 4IOYX 1Y19B 2DHJA 4HB4B 3ULBA 4DX8A 2GCLA 2ELAA 2CY4A 2N0YA 2KIGA 1DDMA 3QWMA 1GG3A 1MPHA 4F7HA 2LYDA 1B55A 3HW2B 1EVHA 4OSNA 4QJ4B 4GN1A 4DX90 2DX1A 3OHMB 2DLWA 3A58A 4HATB 2Z4DA 3F0WA 5J3TA 5GOWB 3AU5A 1V5MA 3ODXA 4MY6A 1ZVRA 2OQBA 3TFMA 4GNKB 1J19A 3SV1A 1W1HA 3FEHA 2MWNB 3VOQA 3PSCA 4WJ7A 4EKUA 1DDWA 3DXCA 2H7EA 2YT2A 2VRWB 1TQZA 3P7ZA 2Z13A 1EAZA 4KHBB 3FSSA 2I1JA 4IFSA 2YT0A 3KRXA 4KHAA 2QKMA 2DTCA 3KY9A 4Y94A 3HK0A 1P6SA 4PQ0A 2D4QA 4CHMA
chains in the Genus database with same CATH topology
3CIKA 2R0DA 4WSFA 1SGHA 1RRPB 2D9XA 5DHFB 1ZM0A 2P0FA 1WJMA 5D3XA 1MIXA 3IVFA 1GC7A 1NI2A 4HAXB 2D9WA 2D10A 1M7EA 2RGNB 1WGQA 1J0WA 2W2XC 3WYFB 1K5DB 2M38A 3P6AA 1H10A 1FHXA 5D27A 1BTNA 1LB1A 4DXAB 2EJ8A 2MKRA 3FM8C 3TCAA 1GC6A 1FHWA 2L1CA 3TO1A 3BINA 1XODA 2ELBA 5C5BB 4K17A 3PG7A 5DIFB 4H8SA 2GJYA 2UZRA 2Z0QA 3UZTA 2AEHA 2ROVA 4MK0A 4TYZA 3TVVA 1U5EA 4A6HA 3TW1A 5LONB 2K00A 3HQCA 3N7CA 3QBVB 2I5CA 5L81A 1PFJA 2D9YA 3A8PA 2ROZB 3ODOA 3DXEA 2YSZA 1XX0A 1XCGA 2PZ1A 4HAVB 4EMOA 4ZRJA 4YONA 2JP2A 1X11A 4PNKA 3X23A 4A5KA 1WJ1A 4F7GA 2DKQA 2K2UA 3SO6A 4F7UP 1V88A 4GMXB 1I2HA 4XWXA 2YS1A 4HB3B 2DN6A 5KCVA 1DROA 4IAPA 2COCA 1XD4A 5HE1A 4BBKA 5J3QA 2HE7A 1U5FA 5DHAB 2UVMA 4L6EA 2QKLA 1NU2A 1FOEA 3AJ4A 1NTYA 3PZDA 4EJNA 4ZRIA 4Z2MB 3KZ1A 1P3RA 5HE0A 3F5RA 3SNHA 1OQNA 1E5WA 4HAYB 1X86A 3PEGA 3SUZA 1Z87A 1X1GA 1UPQA 2K2JA 2L2IA 1M7RA 3ZVRA 2DYNA 2IYBA 2VKIA 3PVUA 4D0NB 2J0KA 5JHHA 1ISNA 1OMWA 3G9WA 5EFXA 2CAYA 2M14A 3KRWA 2DFKA 1FB8A 4KVGB 5JP4A 4GXBA 1RJ2A 1U5GA 2R09A 2IFSA 4HAZB 1MK9B 1AQCA 2EMTA 2CY5A 5FI1A 2HTHB 1AWEA 1W1GA 2ZPYA 1FAOA 3MPXA 3V5WA 3M1IB 3MDBC 3BJIA 3ZDTA 1MAIA 2D9VA 1UNRA 2CODA 3U8ZA 1WI1A 4K2PA 2UZSA 5JLJB 2G35A 4CYEA 2VSZA 4GMVA 1MIZB 2Y8FA 2EMSA 2N23A 3QIJA 2P0DA 2KUPA 3A8QA 1IRSA 2COAA 2Y8GA 2I5FA 4A6FB 3GYPA 3ML4A 2YS3A 2MFQA 1BAKA 2DYQA 4HDOA 1W1DA 1QQGA 1XKEA 1UNQA 2DHIA 4WVFB 5LOPB 4TKNA 1ZSQA 3PP2A 2J0MA 2EC1A 3A98B 3AU4A 2XQNM 1MK7B 2D2QA 5C79A 1KZGA 3SYXA 3DXDA 5C5BA 2J0JA 2YT1A 1UNPA 1V89A 1XR0B 4GZUA 1FGYA 1WGUA 2BCJA 1U5DA 4MT7A 2J59M 2LOXA 1WVHA 2GCJA 1SHCA 1UEFA 1FGZA 1V61A 5C6RA 5CLLB 4K2OA 2DHKA 1PLSA 1MKEA 1WG7A 1BTKA 2D9ZA 5HE3A 4Z2NA 2KCJA 3PVLA 1Q67A 1NTVA 2LULA 1U2BA 2RSGA 1DBHA 1TXDA 1X1FA 1KI1B 1U29A 4HAUB 3KSYA 3LJUX 2Y7BA 2ADZA 1UPRA 1LW3A 2RVBB 2RNRB 3ODWA 1OY2A 3OANA 2Z0PA 4GPTB 2YVCA 1H4RA 3PVWA 3WA0A 4HHVA 4A6KA 1BWNA 1PMSA 2DX5A 2H7DA 3D8FA 2DA0A 3CXBB 5D3WA 4NSWA 4B6HA 4HDQA 2CRFA 4CHJA 3D8EA 2MDXA 4DBBA 5J3YA 5DH9B 2LKOA 4HAWB 1I7AA 1ZC3B 4ZRKA 2Z0OA 1X05A 2W2XD 4HB2B 2I1KA 3ULCA 2YRYA 4C0AA 4KHOA 2GS0A 1U27A 2NMBA 1N3HA 5JHGA 1FHOA 1TJ6A 2DKPA 1EF1A 1KZ7A 2LG1A 2COFA 2YF0A 5CLQB 2E2XA 3VIAA 1DDVA 1V5PA 2P8VA 2NZ8B 1Y5OA 3GYOA 2LOZA 2OTXA 4A6FA 1QC6A 4K81A 5KQ4A 2KGXB 3RCPA 5D3VA 5DI9B 5KQ1A 2D11A 3NSUA 4NY0A 4KAXB 3U7DA 4HB0B 5FI0A 5HE2A 3T06A 1K5GB 5D3YA 1ZC4B 4P7IA 2W2WA 2AL6A 5C16A 2Q13A 2YS5A 1DYNA 2X18A 2RLOA 2V76A 1EGXA 3D8DA 1P5TA 4YL8A 2FJLA 2P0HA 1V5UA 2RUKB 3O96A 4IOYX 1Y19B 2DHJA 4HB4B 3ULBA 4DX8A 2GCLA 2ELAA 2CY4A 2N0YA 1DDMA 3QWMA 1GG3A 1MPHA 4F7HA 2LYDA 1B55A 3HW2B 1EVHA 4GN1A 4DX90 2DX1A 2DLWA 4HATB 3F0WA 5J3TA 5GOWB 3AU5A 1V5MA 3ODXA 4MY6A 1ZVRA 2OQBA 3TFMA 1J19A 3SV1A 1W1HA 3FEHA 2MWNB 3VOQA 3PSCA 4WJ7A 4EKUA 1DDWA 3DXCA 2H7EA 2VRWB 1TQZA 3P7ZA 1EAZA 4KHBB 3FSSA 2I1JA 4IFSA 2YT0A 3KRXA 4KHAA 2QKMA 2DTCA 3KY9A 4Y94A 3HK0A 1P6SA 4PQ0A 2D4QA 4CHMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CIK A;  2R0D A;  4WSF A;  1SGH A;  1RRP B;  2D9X A;  5DHF B;  1ZM0 A;  2P0F A;  1WJM A;  5D3X A;  1MIX A;  3IVF A;  1GC7 A;  1NI2 A;  4HAX B;  2D9W A;  2D10 A;  1M7E A;  2RGN B;  1WGQ A;  1J0W A;  2W2X C;  3WYF B;  1K5D B;  2M38 A;  3P6A A;  1H10 A;  1FHX A;  5D27 A;  1BTN A;  1LB1 A;  4DXA B;  2EJ8 A;  2MKR A;  3FM8 C;  3TCA A;  1GC6 A;  1FHW A;  2L1C A;  3TO1 A;  3BIN A;  1XOD A;  2ELB A;  5C5B B;  4K17 A;  3PG7 A;  5DIF B;  4H8S A;  2GJY A;  2UZR A;  2Z0Q A;  3UZT A;  2AEH A;  2ROV A;  4MK0 A;  4TYZ A;  3TVV A;  1U5E A;  4A6H A;  3TW1 A;  5LON B;  2K00 A;  3HQC A;  3N7C A;  3QBV B;  2I5C A;  5L81 A;  1PFJ A;  2D9Y A;  3A8P A;  2ROZ B;  3ODO A;  3DXE A;  2YSZ A;  1XX0 A;  1XCG A;  2PZ1 A;  4HAV B;  4EMO A;  4ZRJ A;  4YON A;  2JP2 A;  1X11 A;  4PNK A;  3X23 A;  4A5K A;  1WJ1 A;  4F7G A;  2DKQ A;  2K2U A;  3SO6 A;  4F7U P;  1V88 A;  4GMX B;  1I2H A;  4XWX A;  2YS1 A;  4HB3 B;  2DN6 A;  5KCV A;  1DRO A;  4IAP A;  2COC A;  1XD4 A;  5HE1 A;  4BBK A;  5J3Q A;  2HE7 A;  1U5F A;  5DHA B;  2UVM A;  4L6E A;  2QKL A;  1NU2 A;  1FOE A;  3AJ4 A;  1NTY A;  3PZD A;  4EJN A;  4ZRI A;  4Z2M B;  3KZ1 A;  1P3R A;  5HE0 A;  3F5R A;  3SNH A;  1OQN A;  1E5W A;  4HAY B;  1X86 A;  3PEG A;  3SUZ A;  1Z87 A;  1X1G A;  1UPQ A;  2K2J A;  2L2I A;  1M7R A;  3ZVR A;  2DYN A;  2IYB A;  2VKI A;  3PVU A;  4D0N B;  2J0K A;  5JHH A;  1ISN A;  1OMW A;  3G9W A;  5EFX A;  2CAY A;  2M14 A;  3KRW A;  2DFK A;  1FB8 A;  4KVG B;  5JP4 A;  4GXB A;  1RJ2 A;  1U5G A;  2R09 A;  2IFS A;  4HAZ B;  1MK9 B;  1AQC A;  2EMT A;  2CY5 A;  5FI1 A;  2HTH B;  1AWE A;  1W1G A;  2ZPY A;  1FAO A;  3MPX A;  3V5W A;  3M1I B;  3MDB C;  3BJI A;  3ZDT A;  1MAI A;  2D9V A;  1UNR A;  2COD A;  3U8Z A;  1WI1 A;  4K2P A;  2UZS A;  5JLJ B;  2G35 A;  4CYE A;  2VSZ A;  4GMV A;  1MIZ B;  2Y8F A;  2EMS A;  2N23 A;  3QIJ A;  2P0D A;  2KUP A;  3A8Q A;  1IRS A;  2COA A;  2Y8G A;  2I5F A;  4A6F B;  3GYP A;  3ML4 A;  2YS3 A;  2MFQ A;  1BAK A;  2DYQ A;  4HDO A;  1W1D A;  1QQG A;  1XKE A;  1UNQ A;  2DHI A;  4WVF B;  5LOP B;  4TKN A;  1ZSQ A;  3PP2 A;  2J0M A;  2EC1 A;  3A98 B;  3AU4 A;  2XQN M;  1MK7 B;  2D2Q A;  5C79 A;  1KZG A;  3SYX A;  3DXD A;  5C5B A;  2J0J A;  2YT1 A;  1UNP A;  1V89 A;  1XR0 B;  4GZU A;  1FGY A;  1WGU A;  2BCJ A;  1U5D A;  4MT7 A;  2J59 M;  2LOX A;  1WVH A;  2GCJ A;  1SHC A;  1UEF A;  1FGZ A;  1V61 A;  5C6R A;  5CLL B;  4K2O A;  2DHK A;  1PLS A;  1MKE A;  1WG7 A;  1BTK A;  2D9Z A;  5HE3 A;  4Z2N A;  2KCJ A;  3PVL A;  1Q67 A;  1NTV A;  2LUL A;  1U2B A;  2RSG A;  1DBH A;  1TXD A;  1X1F A;  1KI1 B;  1U29 A;  4HAU B;  3KSY A;  3LJU X;  2Y7B A;  2ADZ A;  1UPR A;  1LW3 A;  2RVB B;  2RNR B;  3ODW A;  1OY2 A;  3OAN A;  2Z0P A;  4GPT B;  2YVC A;  1H4R A;  3PVW A;  3WA0 A;  4HHV A;  4A6K A;  1BWN A;  1PMS A;  2DX5 A;  2H7D A;  3D8F A;  2DA0 A;  3CXB B;  5D3W A;  4NSW A;  4B6H A;  4HDQ A;  2CRF A;  4CHJ A;  3D8E A;  2MDX A;  4DBB A;  5J3Y A;  5DH9 B;  2LKO A;  4HAW B;  1I7A A;  1ZC3 B;  4ZRK A;  2Z0O A;  1X05 A;  2W2X D;  4HB2 B;  2I1K A;  3ULC A;  2YRY A;  4C0A A;  4KHO A;  2GS0 A;  1U27 A;  2NMB A;  1N3H A;  5JHG A;  1FHO A;  1TJ6 A;  2DKP A;  1EF1 A;  1KZ7 A;  2LG1 A;  2COF A;  2YF0 A;  5CLQ B;  2E2X A;  3VIA A;  1DDV A;  1V5P A;  2P8V A;  2NZ8 B;  1Y5O A;  3GYO A;  2LOZ A;  2OTX A;  4A6F A;  1QC6 A;  4K81 A;  5KQ4 A;  2KGX B;  3RCP A;  5D3V A;  5DI9 B;  5KQ1 A;  2D11 A;  3NSU A;  4NY0 A;  4KAX B;  3U7D A;  4HB0 B;  5FI0 A;  5HE2 A;  3T06 A;  1K5G B;  5D3Y A;  1ZC4 B;  4P7I A;  2W2W A;  2AL6 A;  5C16 A;  2Q13 A;  2YS5 A;  1DYN A;  2X18 A;  2RLO A;  2V76 A;  1EGX A;  3D8D A;  1P5T A;  4YL8 A;  2FJL A;  2P0H A;  1V5U A;  2RUK B;  3O96 A;  4IOY X;  1Y19 B;  2DHJ A;  4HB4 B;  3ULB A;  4DX8 A;  2GCL A;  2ELA A;  2CY4 A;  2N0Y A;  1DDM A;  3QWM A;  1GG3 A;  1MPH A;  4F7H A;  2LYD A;  1B55 A;  3HW2 B;  1EVH A;  4GN1 A;  4DX9 0;  2DX1 A;  2DLW A;  4HAT B;  3F0W A;  5J3T A;  5GOW B;  3AU5 A;  1V5M A;  3ODX A;  4MY6 A;  1ZVR A;  2OQB A;  3TFM A;  1J19 A;  3SV1 A;  1W1H A;  3FEH A;  2MWN B;  3VOQ A;  3PSC A;  4WJ7 A;  4EKU A;  1DDW A;  3DXC A;  2H7E A;  2VRW B;  1TQZ A;  3P7Z A;  1EAZ A;  4KHB B;  3FSS A;  2I1J A;  4IFS A;  2YT0 A;  3KRX A;  4KHA A;  2QKM A;  2DTC A;  3KY9 A;  4Y94 A;  3HK0 A;  1P6S A;  4PQ0 A;  2D4Q A;  4CHM A; 
#chains in the Genus database with same CATH topology
 3CIK A;  2R0D A;  4WSF A;  1SGH A;  1RRP B;  2D9X A;  5DHF B;  1ZM0 A;  4OT1 A;  4D6W A;  2P0F A;  1WJM A;  5D3X A;  1MIX A;  3IVF A;  1GC7 A;  1NI2 A;  4HAX B;  2D9W A;  2D10 A;  1M7E A;  2RGN B;  1WGQ A;  1J0W A;  2W2X C;  2KUQ A;  1K5D B;  2M38 A;  3P6A A;  1H10 A;  1FHX A;  5D27 A;  3WYF B;  1BTN A;  1LB1 A;  4DXA B;  2EJ8 A;  2MKR A;  3FM8 C;  3TCA A;  1GC6 A;  1FHW A;  2L1C A;  3TO1 A;  3BIN A;  1XOD A;  2ELB A;  5C5B B;  4K17 A;  3PG7 A;  5DIF B;  4H8S A;  2GJY A;  2UZR A;  2GUM A;  2Z0Q A;  3UZT A;  2AEH A;  2ROV A;  4MK0 A;  4TYZ A;  3TVV A;  1U5E A;  4A6H A;  3TW1 A;  5LON B;  2K00 A;  3HQC A;  3N7C A;  3QBV B;  2I5C A;  5L81 A;  1PFJ A;  2D9Y A;  3A8P A;  2ROZ B;  3ODO A;  3DXE A;  2YSZ A;  1XX0 A;  1XCG A;  2PZ1 A;  4HAV B;  4EMO A;  4KHB A;  4ZRJ A;  4YON A;  2JP2 A;  1X11 A;  4PNK A;  3X23 A;  4A5K A;  1WJ1 A;  4F7G A;  2DKQ A;  2K2U A;  3SO6 A;  4F7U P;  1V88 A;  4GMX B;  2K8E A;  1I2H A;  4XWX A;  2YS1 A;  4HB3 B;  2DN6 A;  5KCV A;  1DRO A;  4IAP A;  2COC A;  1XD4 A;  5HE1 A;  4BBK A;  2K49 A;  5J3Q A;  2HE7 A;  1U5F A;  5DHA B;  2UVM A;  4L6E A;  2QKL A;  1NU2 A;  1FOE A;  1ZYI A;  3AJ4 A;  1NTY A;  3PZD A;  4EJN A;  4ZRI A;  4QJ3 B;  3NWA A;  4Z2M B;  3KZ1 A;  1P3R A;  5HE0 A;  3F5R A;  3SNH A;  1OQN A;  1E5W A;  4HAY B;  1X86 A;  2FJU B;  4GOU A;  3PEG A;  3SUZ A;  1Z87 A;  1X1G A;  3DCX A;  1UPQ A;  2K2J A;  3FVC A;  2L2I A;  1M7R A;  3ZVR A;  2DYN A;  2IYB A;  2R2Y A;  2VKI A;  3PVU A;  4D0N B;  2J0K A;  2RRF A;  5JHH A;  1ISN A;  1OMW A;  3G9W A;  5EFX A;  2CAY A;  2M14 A;  3KRW A;  2DFK A;  1FB8 A;  4KVG B;  5JP4 A;  4GXB A;  1RJ2 A;  1U5G A;  2ZKM X;  2R09 A;  2IFS A;  4HAZ B;  1MK9 B;  1AQC A;  2EMT A;  2CY5 A;  5FI1 A;  2HTH B;  1AWE A;  1W1G A;  2ZPY A;  1FAO A;  3MPX A;  3V5W A;  3M1I B;  3MDB C;  3BJI A;  3ZDT A;  4QXA B;  1MAI A;  2D9V A;  1MI1 A;  1UNR A;  2COD A;  3U8Z A;  1WI1 A;  4K2P A;  2UZS A;  5JLJ B;  2G35 A;  4CYE A;  2VSZ A;  4GMV A;  1MIZ B;  5IRS A;  2Y8F A;  2EMS A;  2N23 A;  3QIJ A;  2P0D A;  2KUP A;  3A8Q A;  1IRS A;  2COA A;  2Y8G A;  3HIE A;  2I5F A;  4A6F B;  3GYP A;  3ML4 A;  2YS3 A;  2MFQ A;  1BAK A;  2DYQ A;  4HDO A;  1W1D A;  3NW8 A;  4QJ5 B;  1QQG A;  1XKE A;  1UNQ A;  2DHI A;  4WVF B;  5LOP B;  4TKN A;  1ZSQ A;  3PP2 A;  2J0M A;  2EC1 A;  3A98 B;  2KIE A;  3AU4 A;  2XQN M;  1MK7 B;  2D2Q A;  5C79 A;  1KZG A;  3SYX A;  2Z14 A;  3DXD A;  5C5B A;  2J0J A;  2YT1 A;  1UNP A;  1V89 A;  1XR0 B;  4GZU A;  1FGY A;  1WGU A;  2BCJ A;  1U5D A;  4MT7 A;  2J59 M;  2LOX A;  1WVH A;  2GCJ A;  1SHC A;  3NWF A;  4DIX A;  5LG4 B;  3HSA A;  1UEF A;  1FGZ A;  1V61 A;  5C6R A;  5CLL B;  4K2O A;  2DHK A;  3NWD A;  1PLS A;  1MKE A;  1WG7 A;  1BTK A;  2D9Z A;  5HE3 A;  4Z2N A;  2KCJ A;  3PVL A;  1Q67 A;  1NTV A;  2LUL A;  1U2B A;  2RSG A;  1DBH A;  1TXD A;  1X1F A;  1KI1 B;  1U29 A;  4HAU B;  3KSY A;  3LJU X;  2Y7B A;  2ADZ A;  1UPR A;  3B77 A;  1LW3 A;  2RVB B;  2RNR B;  3ODW A;  1OY2 A;  3OAN A;  1T77 A;  2Z0P A;  4GPT B;  2YVC A;  1H4R A;  3PVW A;  3WA0 A;  4HHV A;  4A6K A;  1BWN A;  1PMS A;  2DX5 A;  2H7D A;  4CSQ A;  3D8F A;  2DA0 A;  3CXB B;  5D3W A;  4NSW A;  4B6H A;  4HDQ A;  2CRF A;  4CHJ A;  3D8E A;  2MDX A;  4DBB A;  5I2M A;  5J3Y A;  5DH9 B;  2LKO A;  4HAW B;  1I7A A;  1ZC3 B;  4ZRK A;  2Z0O A;  1X05 A;  2W2X D;  4HB2 B;  2I1K A;  3ULC A;  2YRY A;  3U12 A;  4C0A A;  4KHO A;  2GS0 A;  1U27 A;  2NMB A;  1N3H A;  5JHG A;  1FHO A;  2NBV A;  5I2S A;  1TJ6 A;  2DKP A;  1EF1 A;  1KZ7 A;  2LG1 A;  2COF A;  2YF0 A;  5CLQ B;  2E2X A;  3VIA A;  1DDV A;  1V5P A;  2P8V A;  2NZ8 B;  1Y5O A;  3GYO A;  2LOZ A;  2OTX A;  4A6F A;  5M4Y B;  1QC6 A;  4K81 A;  5KQ4 A;  2KGX B;  3RCP A;  5D3V A;  5DI9 B;  5KQ1 A;  2D11 A;  3NSU A;  4HSI A;  4NY0 A;  4KAX B;  3U7D A;  4HB0 B;  5FI0 A;  5HE2 A;  3T06 A;  1K5G B;  5D3Y A;  1ZC4 B;  4P7I A;  2W2W A;  2AL6 A;  5C16 A;  2Q13 A;  2YS5 A;  1DYN A;  2KR0 A;  2X18 A;  2RLO A;  2V76 A;  1EGX A;  3D8D A;  1P5T A;  4YL8 A;  2FJL A;  2P0H A;  1V5U A;  2RUK B;  2Z59 A;  4L1R A;  3O96 A;  4IOY X;  1Y19 B;  2DHJ A;  4HB4 B;  3ULB A;  4DX8 A;  2GCL A;  2ELA A;  2CY4 A;  2N0Y A;  2KIG A;  1DDM A;  3QWM A;  1GG3 A;  1MPH A;  4F7H A;  2LYD A;  1B55 A;  3HW2 B;  1EVH A;  4OSN A;  4QJ4 B;  4GN1 A;  4DX9 0;  2DX1 A;  3OHM B;  2DLW A;  3A58 A;  4HAT B;  2Z4D A;  3F0W A;  5J3T A;  5GOW B;  3AU5 A;  1V5M A;  3ODX A;  4MY6 A;  1ZVR A;  2OQB A;  3TFM A;  4GNK B;  1J19 A;  3SV1 A;  1W1H A;  3FEH A;  2MWN B;  3VOQ A;  3PSC A;  4WJ7 A;  4EKU A;  1DDW A;  3DXC A;  2H7E A;  2YT2 A;  2VRW B;  1TQZ A;  3P7Z A;  2Z13 A;  1EAZ A;  4KHB B;  3FSS A;  2I1J A;  4IFS A;  2YT0 A;  3KRX A;  4KHA A;  2QKM A;  2DTC A;  3KY9 A;  4Y94 A;  3HK0 A;  1P6S A;  4PQ0 A;  2D4Q A;  4CHM A; 
#chains in the Genus database with same CATH homology
 3CIK A;  2R0D A;  4WSF A;  1SGH A;  1RRP B;  2D9X A;  5DHF B;  1ZM0 A;  2P0F A;  1WJM A;  5D3X A;  1MIX A;  3IVF A;  1GC7 A;  1NI2 A;  4HAX B;  2D9W A;  2D10 A;  1M7E A;  2RGN B;  1WGQ A;  1J0W A;  2W2X C;  3WYF B;  1K5D B;  2M38 A;  3P6A A;  1H10 A;  1FHX A;  5D27 A;  1BTN A;  1LB1 A;  4DXA B;  2EJ8 A;  2MKR A;  3FM8 C;  3TCA A;  1GC6 A;  1FHW A;  2L1C A;  3TO1 A;  3BIN A;  1XOD A;  2ELB A;  5C5B B;  4K17 A;  3PG7 A;  5DIF B;  4H8S A;  2GJY A;  2UZR A;  2Z0Q A;  3UZT A;  2AEH A;  2ROV A;  4MK0 A;  4TYZ A;  3TVV A;  1U5E A;  4A6H A;  3TW1 A;  5LON B;  2K00 A;  3HQC A;  3N7C A;  3QBV B;  2I5C A;  5L81 A;  1PFJ A;  2D9Y A;  3A8P A;  2ROZ B;  3ODO A;  3DXE A;  2YSZ A;  1XX0 A;  1XCG A;  2PZ1 A;  4HAV B;  4EMO A;  4ZRJ A;  4YON A;  2JP2 A;  1X11 A;  4PNK A;  3X23 A;  4A5K A;  1WJ1 A;  4F7G A;  2DKQ A;  2K2U A;  3SO6 A;  4F7U P;  1V88 A;  4GMX B;  1I2H A;  4XWX A;  2YS1 A;  4HB3 B;  2DN6 A;  5KCV A;  1DRO A;  4IAP A;  2COC A;  1XD4 A;  5HE1 A;  4BBK A;  5J3Q A;  2HE7 A;  1U5F A;  5DHA B;  2UVM A;  4L6E A;  2QKL A;  1NU2 A;  1FOE A;  3AJ4 A;  1NTY A;  3PZD A;  4EJN A;  4ZRI A;  4Z2M B;  3KZ1 A;  1P3R A;  5HE0 A;  3F5R A;  3SNH A;  1OQN A;  1E5W A;  4HAY B;  1X86 A;  3PEG A;  3SUZ A;  1Z87 A;  1X1G A;  1UPQ A;  2K2J A;  2L2I A;  1M7R A;  3ZVR A;  2DYN A;  2IYB A;  2VKI A;  3PVU A;  4D0N B;  2J0K A;  5JHH A;  1ISN A;  1OMW A;  3G9W A;  5EFX A;  2CAY A;  2M14 A;  3KRW A;  2DFK A;  1FB8 A;  4KVG B;  5JP4 A;  4GXB A;  1RJ2 A;  1U5G A;  2R09 A;  2IFS A;  4HAZ B;  1MK9 B;  1AQC A;  2EMT A;  2CY5 A;  5FI1 A;  2HTH B;  1AWE A;  1W1G A;  2ZPY A;  1FAO A;  3MPX A;  3V5W A;  3M1I B;  3MDB C;  3BJI A;  3ZDT A;  1MAI A;  2D9V A;  1UNR A;  2COD A;  3U8Z A;  1WI1 A;  4K2P A;  2UZS A;  5JLJ B;  2G35 A;  4CYE A;  2VSZ A;  4GMV A;  1MIZ B;  2Y8F A;  2EMS A;  2N23 A;  3QIJ A;  2P0D A;  2KUP A;  3A8Q A;  1IRS A;  2COA A;  2Y8G A;  2I5F A;  4A6F B;  3GYP A;  3ML4 A;  2YS3 A;  2MFQ A;  1BAK A;  2DYQ A;  4HDO A;  1W1D A;  1QQG A;  1XKE A;  1UNQ A;  2DHI A;  4WVF B;  5LOP B;  4TKN A;  1ZSQ A;  3PP2 A;  2J0M A;  2EC1 A;  3A98 B;  3AU4 A;  2XQN M;  1MK7 B;  2D2Q A;  5C79 A;  1KZG A;  3SYX A;  3DXD A;  5C5B A;  2J0J A;  2YT1 A;  1UNP A;  1V89 A;  1XR0 B;  4GZU A;  1FGY A;  1WGU A;  2BCJ A;  1U5D A;  4MT7 A;  2J59 M;  2LOX A;  1WVH A;  2GCJ A;  1SHC A;  1UEF A;  1FGZ A;  1V61 A;  5C6R A;  5CLL B;  4K2O A;  2DHK A;  1PLS A;  1MKE A;  1WG7 A;  1BTK A;  2D9Z A;  5HE3 A;  4Z2N A;  2KCJ A;  3PVL A;  1Q67 A;  1NTV A;  2LUL A;  1U2B A;  2RSG A;  1DBH A;  1TXD A;  1X1F A;  1KI1 B;  1U29 A;  4HAU B;  3KSY A;  3LJU X;  2Y7B A;  2ADZ A;  1UPR A;  1LW3 A;  2RVB B;  2RNR B;  3ODW A;  1OY2 A;  3OAN A;  2Z0P A;  4GPT B;  2YVC A;  1H4R A;  3PVW A;  3WA0 A;  4HHV A;  4A6K A;  1BWN A;  1PMS A;  2DX5 A;  2H7D A;  3D8F A;  2DA0 A;  3CXB B;  5D3W A;  4NSW A;  4B6H A;  4HDQ A;  2CRF A;  4CHJ A;  3D8E A;  2MDX A;  4DBB A;  5J3Y A;  5DH9 B;  2LKO A;  4HAW B;  1I7A A;  1ZC3 B;  4ZRK A;  2Z0O A;  1X05 A;  2W2X D;  4HB2 B;  2I1K A;  3ULC A;  2YRY A;  4C0A A;  4KHO A;  2GS0 A;  1U27 A;  2NMB A;  1N3H A;  5JHG A;  1FHO A;  1TJ6 A;  2DKP A;  1EF1 A;  1KZ7 A;  2LG1 A;  2COF A;  2YF0 A;  5CLQ B;  2E2X A;  3VIA A;  1DDV A;  1V5P A;  2P8V A;  2NZ8 B;  1Y5O A;  3GYO A;  2LOZ A;  2OTX A;  4A6F A;  1QC6 A;  4K81 A;  5KQ4 A;  2KGX B;  3RCP A;  5D3V A;  5DI9 B;  5KQ1 A;  2D11 A;  3NSU A;  4NY0 A;  4KAX B;  3U7D A;  4HB0 B;  5FI0 A;  5HE2 A;  3T06 A;  1K5G B;  5D3Y A;  1ZC4 B;  4P7I A;  2W2W A;  2AL6 A;  5C16 A;  2Q13 A;  2YS5 A;  1DYN A;  2X18 A;  2RLO A;  2V76 A;  1EGX A;  3D8D A;  1P5T A;  4YL8 A;  2FJL A;  2P0H A;  1V5U A;  2RUK B;  3O96 A;  4IOY X;  1Y19 B;  2DHJ A;  4HB4 B;  3ULB A;  4DX8 A;  2GCL A;  2ELA A;  2CY4 A;  2N0Y A;  1DDM A;  3QWM A;  1GG3 A;  1MPH A;  4F7H A;  2LYD A;  1B55 A;  3HW2 B;  1EVH A;  4GN1 A;  4DX9 0;  2DX1 A;  2DLW A;  4HAT B;  3F0W A;  5J3T A;  5GOW B;  3AU5 A;  1V5M A;  3ODX A;  4MY6 A;  1ZVR A;  2OQB A;  3TFM A;  1J19 A;  3SV1 A;  1W1H A;  3FEH A;  2MWN B;  3VOQ A;  3PSC A;  4WJ7 A;  4EKU A;  1DDW A;  3DXC A;  2H7E A;  2VRW B;  1TQZ A;  3P7Z A;  1EAZ A;  4KHB B;  3FSS A;  2I1J A;  4IFS A;  2YT0 A;  3KRX A;  4KHA A;  2QKM A;  2DTC A;  3KY9 A;  4Y94 A;  3HK0 A;  1P6S A;  4PQ0 A;  2D4Q A;  4CHM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...