3VOQA

Crystal structure of the pleckstrin homology domain of human sin1, a torc2 subunit
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
122
structure length
116
Chain Sequence
GAMATVQDMLSSHHYKSFKVSMIHRLRFTTDVQLGISGDKVEIDPVTKFWIKQKPISIDSDLLCACDLAEEKSPSHAIFKLTYLSNHDYKHLYFESDAATVNEIVLKVNYILESRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Membrane protein
molecule keywords Target of rapamycin complex 2 subunit MAPKAP1
publication title Structures of the pleckstrin homology domain of Saccharomyces cerevisiae Avo1 and its human orthologue Sin1, an essential subunit of TOR complex 2
pubmed doi rcsb
source organism Homo sapiens
total genus 28
structure length 116
sequence length 122
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-01-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16979 SIN1_PH SAPK-interacting protein 1 (Sin1), Pleckstrin-homology
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 3voqA00
2GS0A 2RNRB 2DX1A 2V76A 4HDOA 1MIZB 2Z0QA 2MDXA 1UPRA 2CY4A 1DYNA 5HE0A 1M7RA 5KQ1A 5KCVA 2ZPYA 1P6SA 3FEHA 1FHXA 5D3XA 3LJUX 1WI1A 1UNQA 4KHOA 2M38A 2LG1A 1V5UA 4L6EA 5D3WA 4ZRIA 4IOYX 2CODA 5HE2A 2CAYA 1XX0A 5CLLB 1V89A 2ROVA 2KCJA 4PQ0A 2DLWA 1FHWA 4Z2NA 4HAUB 3PEGA 5D27A 1AWEA 1SGHA 1LB1A 3N7CA 1PFJA 1NTYA 1U27A 4YL8A 1MAIA 2UVMA 4EJNA 4A6FA 1WG7A 1ZSQA 4K2PA 2OQBA 2LOZA 5FI0A 4Z2MB 4A6HA 4WVFB 1DDMA 3FSSA 5JHGA 2ROZB 3BINA 1QC6A 4EKUA 3A98B 4HB0B 5C16A 2Y8GA 2YRYA 2D4QA 1FB8A 1WGUA 1UNPA 5LONB 2IYBA 3CXBB 1DDVA 1Y19B 2W2XC 3ULCA 4DX8A 3MDBC 5C6RA 4HDQA 1EAZA 1XODA 2X18A 2VSZA 2I1JA 2K2JA 3PG7A 5DH9B 1W1HA 4GXBA 3X23A 2KUPA 5HE1A 3PVWA 2Y8FA 3KSYA 3SNHA 1H10A 2J0MA 2Q13A 5JHHA 3ODWA 1ZC3B 4F7HA 4EMOA 1Q67A 2DKPA 3QBVB 2D9VA 2GJYA 2IFSA 2D11A 2DYNA 3MPXA 2FJLA 1MK9B 1XCGA 3ZDTA 2EJ8A 4A5KA 1BTNA 3TCAA 2ADZA 2UZRA 2MFQA 5L81A 1Z87A 2Y7BA 1OY2A 1KZGA 1P5TA 3DXCA 1WGQA 4MY6A 2N0YA 2J0KA 5D3VA 5DHAB 2LKOA 3PP2A 1X11A 2GCJA 1TQZA 4K17A 1DDWA 2DA0A 2MKRA 1OQNA 4GN1A 1UPQA 3KRXA 3ZVRA 1ZC4B 4Y94A 2D10A 2EC1A 4YONA 3WYFB 2YT1A 4P7IA 1PLSA 4DX90 3P6AA 2I1KA 5C5BA 1U5GA 4BBKA 1X1GA 3GYPA 1U29A 1DROA 4ZRKA 4XWXA 2K00A 1ZVRA 4TYZA 1LW3A 4GMVA 3D8FA 2H7DA 3U7DA 3KY9A 2AEHA 1XKEA 1FHOA 1SHCA 2ELAA 5J3TA 2ELBA 5EFXA 4WJ7A 2R09A 3TVVA 4A6FB 3PZDA 5JP4A 3V5WA 2I5FA 2COFA 1NTVA 2CY5A 1AQCA 1V88A 1MIXA 3O96A 4HAYB 2NMBA 2DHJA 4NY0A 2W2WA 2YSZA 4F7GA 2EMTA 2RUKB 2Z0PA 2D9ZA 1WJMA 3AU4A 3RCPA 5DI9B 2CRFA 1BWNA 2DX5A 3BJIA 2LYDA 1J0WA 1H4RA 2K2UA 1NU2A 2YF0A 4DXAB 3TO1A 3ODXA 4DBBA 3A8PA 2QKMA 3KZ1A 2DN6A 3TW1A 4B6HA 5GOWB 2D2QA 1FAOA 3DXEA 3D8DA 3U8ZA 2JP2A 2RSGA 3QWMA 2RGNB 4CHJA 3SV1A 3VIAA 1K5DB 1WVHA 2E2XA 1U2BA 1U5EA 1V5PA 1I2HA 2DFKA 5FI1A 4MT7A 1I7AA 1FGZA 3G9WA 4K2OA 1GC6A 4KAXB 3AJ4A 1DBHA 2L2IA 3A8QA 3NSUA 2N23A 1BTKA 3PVLA 4KVGB 3PVUA 4HB4B 4KHBB 4PNKA 3F5RA 2VRWB 3UZTA 4CYEA 3GYOA 2P0FA 3ML4A 2AL6A 2Z0OA 4GPTB 5KQ4A 1P3RA 3SUZA 3SYXA 3WA0A 1E5WA 2D9XA 1EVHA 1N3HA 4C0AA 1KI1B 2OTXA 1XD4A 2COAA 2QKLA 2P0HA 1FGYA 1V5MA 2YS3A 4MK0A 5LOPB 3AU5A 1RRPB 3ODOA 5JLJB 1U5DA 2YS1A 3M1IB 4K81A 1GG3A 1Y5OA 2LULA 5HE3A 1GC7A 3KRWA 4HAXB 4F7UP 1X1FA 1K5GB 4NSWA 1W1GA 5CLQB 4HAVB 3HQCA 5J3YA 1FOEA 4HB3B 3TFMA 1ISNA 5C5BB 1W1DA 3T06A 2KGXB 3HK0A 2COCA 3PSCA 1TXDA 1UEFA 3SO6A 5J3QA 2HTHB 4HAZB 4IFSA 4IAPA 3ULBA 2NZ8B 4KHAA 2G35A 3VOQA 3P7ZA 4GZUA 5DIFB 2RVBB 3QIJA 4GMXB 2D9YA 1BAKA 1EF1A 1RJ2A 3CIKA 1KZ7A 3IVFA 2YT0A 1B55A 2H7EA 2UZSA 1MPHA 1UNRA 1QQGA 3HW2B 4HAWB 4A6KA 1IRSA 4WSFA 3F0WA 2J59M 2L1CA 4HHVA 3FM8C 2R0DA 5C79A 2VKIA 1V61A 2XQNM 1PMSA 4CHMA 1XR0B 3DXDA 2DHKA 1X86A 1NI2A 2M14A 1MK7B 2HE7A 3D8EA 1EGXA 2MWNB 2GCLA 4TKNA 2DHIA 5DHFB 2J0JA 1MKEA 2W2XD 2DKQA 1TJ6A 2YS5A 4D0NB 1U5FA 2BCJA 2I5CA 4HB2B 2D9WA 1M7EA 2RLOA 4H8SA 1WJ1A 4ZRJA 1ZM0A 2LOXA 1X05A 2DYQA 5D3YA 4HATB 2DTCA 2P0DA 1OMWA 2P8VA 3OANA 2EMSA 2YVCA 1J19A 2PZ1A
chains in the Genus database with same CATH superfamily
2GS0A 2RNRB 2DX1A 2V76A 4HDOA 1MIZB 2Z0QA 2MDXA 1UPRA 2CY4A 1DYNA 5HE0A 1M7RA 5KQ1A 5KCVA 2ZPYA 1P6SA 3FEHA 1FHXA 5D3XA 3LJUX 1WI1A 1UNQA 4KHOA 2M38A 2LG1A 1V5UA 4L6EA 5D3WA 4ZRIA 4IOYX 2CODA 5HE2A 2CAYA 1XX0A 5CLLB 1V89A 2NBVA 2ROVA 3HSAA 2KCJA 4PQ0A 2DLWA 1FHWA 4Z2NA 4HAUB 3PEGA 5D27A 1AWEA 1SGHA 1LB1A 3N7CA 1PFJA 1NTYA 1U27A 4YL8A 1MAIA 2UVMA 4EJNA 4A6FA 1WG7A 1ZSQA 4K2PA 2OQBA 2LOZA 5FI0A 2GUMA 4Z2MB 4A6HA 4WVFB 1DDMA 3FSSA 5JHGA 2ROZB 3BINA 1QC6A 2KR0A 4EKUA 3A98B 4HB0B 5C16A 2Y8GA 2YRYA 2K8EA 2D4QA 1FB8A 1WGUA 1UNPA 1T77A 5LONB 2IYBA 3CXBB 1DDVA 1Y19B 2W2XC 2Z14A 3ULCA 4DX8A 4QJ3B 3MDBC 5C6RA 4HDQA 1EAZA 2Z4DA 1XODA 5I2MA 2X18A 2VSZA 2I1JA 2K2JA 3PG7A 4OT1A 5DH9B 1W1HA 4GXBA 3HIEA 3X23A 2KUPA 5HE1A 3PVWA 2Y8FA 3KSYA 3SNHA 1H10A 2J0MA 2Q13A 5JHHA 3ODWA 1ZC3B 4F7HA 1MI1A 4EMOA 1Q67A 2DKPA 3QBVB 2D9VA 2GJYA 4KHBA 2IFSA 2D11A 2DYNA 3MPXA 2FJLA 1MK9B 1XCGA 3ZDTA 2EJ8A 4A5KA 1BTNA 3TCAA 2ADZA 2UZRA 2MFQA 5L81A 3NWFA 1Z87A 2Y7BA 1OY2A 1KZGA 1P5TA 2Z59A 3DXCA 1WGQA 4MY6A 2N0YA 2J0KA 5D3VA 5DHAB 2LKOA 3NW8A 3PP2A 1X11A 2GCJA 1TQZA 4K17A 1DDWA 2DA0A 2MKRA 1OQNA 4GN1A 2KUQA 5IRSA 1ZYIA 1UPQA 3KRXA 3ZVRA 1ZC4B 3NWAA 4Y94A 2D10A 3U12A 2EC1A 4YONA 3WYFB 2YT1A 4P7IA 1PLSA 4DX90 3P6AA 2I1KA 5C5BA 1U5GA 4BBKA 1X1GA 3GYPA 1U29A 1DROA 4ZRKA 4XWXA 2K00A 1ZVRA 4TYZA 1LW3A 4GMVA 4GOUA 3D8FA 2H7DA 3U7DA 3KY9A 2YT2A 2AEHA 5I2SA 1XKEA 1FHOA 1SHCA 2ELAA 5J3TA 2ELBA 5EFXA 4WJ7A 2R09A 3TVVA 5M4YB 4A6FB 3PZDA 5JP4A 3V5WA 2I5FA 2COFA 1NTVA 2CY5A 1AQCA 2K49A 1V88A 1MIXA 3O96A 4HAYB 2NMBA 2DHJA 4NY0A 2W2WA 2YSZA 4F7GA 2EMTA 2RUKB 2Z0PA 2D9ZA 1WJMA 3AU4A 3RCPA 5DI9B 2CRFA 1BWNA 2DX5A 3BJIA 2LYDA 2KIEA 1J0WA 1H4RA 2K2UA 1NU2A 2YF0A 4DXAB 4QJ4B 3TO1A 3ODXA 4DBBA 3A8PA 2QKMA 3KZ1A 2DN6A 3TW1A 4B6HA 5GOWB 2D2QA 1FAOA 3DXEA 3D8DA 3U8ZA 2JP2A 2RSGA 3QWMA 2RGNB 4CHJA 3SV1A 3VIAA 2KIGA 1K5DB 3FVCA 1WVHA 2E2XA 1U2BA 1U5EA 1V5PA 1I2HA 2DFKA 5FI1A 4MT7A 1I7AA 1FGZA 4QXAB 3G9WA 4K2OA 1GC6A 4KAXB 3AJ4A 1DBHA 2L2IA 3A8QA 3NSUA 2N23A 1BTKA 3PVLA 4KVGB 3PVUA 4HB4B 4KHBB 4PNKA 2FJUB 3F5RA 2VRWB 3UZTA 4CYEA 3GYOA 2P0FA 3ML4A 2AL6A 2Z0OA 4GPTB 5KQ4A 1P3RA 3SUZA 3SYXA 3WA0A 1E5WA 2D9XA 1EVHA 1N3HA 4C0AA 1KI1B 2OTXA 1XD4A 2COAA 2QKLA 2P0HA 1FGYA 1V5MA 2YS3A 4MK0A 5LOPB 3AU5A 2Z13A 1RRPB 3ODOA 5JLJB 1U5DA 2YS1A 3A58A 3M1IB 4K81A 1GG3A 1Y5OA 2LULA 5LG4B 5HE3A 1GC7A 3B77A 3KRWA 4HAXB 4F7UP 1X1FA 1K5GB 4NSWA 1W1GA 5CLQB 4HAVB 3HQCA 4D6WA 5J3YA 1FOEA 4HB3B 3TFMA 1ISNA 5C5BB 1W1DA 3T06A 2KGXB 3HK0A 2COCA 3PSCA 1TXDA 4L1RA 1UEFA 3SO6A 5J3QA 2HTHB 2ZKMX 3OHMB 4HAZB 4IFSA 4IAPA 3ULBA 2NZ8B 4KHAA 2G35A 3VOQA 3P7ZA 4GZUA 5DIFB 2RVBB 3QIJA 4GNKB 4GMXB 2D9YA 3NWDA 1BAKA 1EF1A 1RJ2A 3CIKA 1KZ7A 3IVFA 2YT0A 1B55A 2H7EA 2UZSA 1MPHA 1UNRA 1QQGA 3HW2B 4HAWB 4A6KA 1IRSA 4WSFA 3F0WA 4HSIA 2J59M 2L1CA 4HHVA 3FM8C 2R0DA 5C79A 2VKIA 1V61A 2XQNM 1PMSA 4CHMA 1XR0B 3DXDA 2DHKA 1X86A 1NI2A 4DIXA 2M14A 1MK7B 2HE7A 3D8EA 1EGXA 2MWNB 2GCLA 4TKNA 2DHIA 5DHFB 2J0JA 1MKEA 2W2XD 2DKQA 1TJ6A 2YS5A 4D0NB 4CSQA 1U5FA 2BCJA 2I5CA 2RRFA 4HB2B 2D9WA 1M7EA 3DCXA 2RLOA 4H8SA 1WJ1A 4OSNA 4ZRJA 1ZM0A 2LOXA 1X05A 2DYQA 5D3YA 4HATB 4QJ5B 2DTCA 2P0DA 1OMWA 2P8VA 2R2YA 3OANA 2EMSA 2YVCA 1J19A 2PZ1A
chains in the Genus database with same CATH topology
2GS0A 2RNRB 2DX1A 2V76A 4HDOA 1MIZB 2Z0QA 2MDXA 1UPRA 2CY4A 1DYNA 5HE0A 1M7RA 5KQ1A 5KCVA 2ZPYA 1P6SA 3FEHA 1FHXA 5D3XA 3LJUX 1WI1A 1UNQA 4KHOA 2M38A 2LG1A 1V5UA 4L6EA 5D3WA 4ZRIA 4IOYX 2CODA 5HE2A 2CAYA 1XX0A 5CLLB 1V89A 2ROVA 2KCJA 4PQ0A 2DLWA 1FHWA 4Z2NA 4HAUB 3PEGA 5D27A 1AWEA 1SGHA 1LB1A 3N7CA 1PFJA 1NTYA 1U27A 4YL8A 1MAIA 2UVMA 4EJNA 4A6FA 1WG7A 1ZSQA 4K2PA 2OQBA 2LOZA 5FI0A 4Z2MB 4A6HA 4WVFB 1DDMA 3FSSA 5JHGA 2ROZB 3BINA 1QC6A 4EKUA 3A98B 4HB0B 5C16A 2Y8GA 2YRYA 2D4QA 1FB8A 1WGUA 1UNPA 5LONB 2IYBA 3CXBB 1DDVA 1Y19B 2W2XC 3ULCA 4DX8A 3MDBC 5C6RA 4HDQA 1EAZA 1XODA 2X18A 2VSZA 2I1JA 2K2JA 3PG7A 5DH9B 1W1HA 4GXBA 3X23A 2KUPA 5HE1A 3PVWA 2Y8FA 3KSYA 3SNHA 1H10A 2J0MA 2Q13A 5JHHA 3ODWA 1ZC3B 4F7HA 4EMOA 1Q67A 2DKPA 3QBVB 2D9VA 2GJYA 2IFSA 2D11A 2DYNA 3MPXA 2FJLA 1MK9B 1XCGA 3ZDTA 2EJ8A 4A5KA 1BTNA 3TCAA 2ADZA 2UZRA 2MFQA 5L81A 1Z87A 2Y7BA 1OY2A 1KZGA 1P5TA 3DXCA 1WGQA 4MY6A 2N0YA 2J0KA 5D3VA 5DHAB 2LKOA 3PP2A 1X11A 2GCJA 1TQZA 4K17A 1DDWA 2DA0A 2MKRA 1OQNA 4GN1A 1UPQA 3KRXA 3ZVRA 1ZC4B 4Y94A 2D10A 2EC1A 4YONA 3WYFB 2YT1A 4P7IA 1PLSA 4DX90 3P6AA 2I1KA 5C5BA 1U5GA 4BBKA 1X1GA 3GYPA 1U29A 1DROA 4ZRKA 4XWXA 2K00A 1ZVRA 4TYZA 1LW3A 4GMVA 3D8FA 2H7DA 3U7DA 3KY9A 2AEHA 1XKEA 1FHOA 1SHCA 2ELAA 5J3TA 2ELBA 5EFXA 4WJ7A 2R09A 3TVVA 4A6FB 3PZDA 5JP4A 3V5WA 2I5FA 2COFA 1NTVA 2CY5A 1AQCA 1V88A 1MIXA 3O96A 4HAYB 2NMBA 2DHJA 4NY0A 2W2WA 2YSZA 4F7GA 2EMTA 2RUKB 2Z0PA 2D9ZA 1WJMA 3AU4A 3RCPA 5DI9B 2CRFA 1BWNA 2DX5A 3BJIA 2LYDA 1J0WA 1H4RA 2K2UA 1NU2A 2YF0A 4DXAB 3TO1A 3ODXA 4DBBA 3A8PA 2QKMA 3KZ1A 2DN6A 3TW1A 4B6HA 5GOWB 2D2QA 1FAOA 3DXEA 3D8DA 3U8ZA 2JP2A 2RSGA 3QWMA 2RGNB 4CHJA 3SV1A 3VIAA 1K5DB 1WVHA 2E2XA 1U2BA 1U5EA 1V5PA 1I2HA 2DFKA 5FI1A 4MT7A 1I7AA 1FGZA 3G9WA 4K2OA 1GC6A 4KAXB 3AJ4A 1DBHA 2L2IA 3A8QA 3NSUA 2N23A 1BTKA 3PVLA 4KVGB 3PVUA 4HB4B 4KHBB 4PNKA 3F5RA 2VRWB 3UZTA 4CYEA 3GYOA 2P0FA 3ML4A 2AL6A 2Z0OA 4GPTB 5KQ4A 1P3RA 3SUZA 3SYXA 3WA0A 1E5WA 2D9XA 1EVHA 1N3HA 4C0AA 1KI1B 2OTXA 1XD4A 2COAA 2QKLA 2P0HA 1FGYA 1V5MA 2YS3A 4MK0A 5LOPB 3AU5A 1RRPB 3ODOA 5JLJB 1U5DA 2YS1A 3M1IB 4K81A 1GG3A 1Y5OA 2LULA 5HE3A 1GC7A 3KRWA 4HAXB 4F7UP 1X1FA 1K5GB 4NSWA 1W1GA 5CLQB 4HAVB 3HQCA 5J3YA 1FOEA 4HB3B 3TFMA 1ISNA 5C5BB 1W1DA 3T06A 2KGXB 3HK0A 2COCA 3PSCA 1TXDA 1UEFA 3SO6A 5J3QA 2HTHB 4HAZB 4IFSA 4IAPA 3ULBA 2NZ8B 4KHAA 2G35A 3VOQA 3P7ZA 4GZUA 5DIFB 2RVBB 3QIJA 4GMXB 2D9YA 1BAKA 1EF1A 1RJ2A 3CIKA 1KZ7A 3IVFA 2YT0A 1B55A 2H7EA 2UZSA 1MPHA 1UNRA 1QQGA 3HW2B 4HAWB 4A6KA 1IRSA 4WSFA 3F0WA 2J59M 2L1CA 4HHVA 3FM8C 2R0DA 5C79A 2VKIA 1V61A 2XQNM 1PMSA 4CHMA 1XR0B 3DXDA 2DHKA 1X86A 1NI2A 2M14A 1MK7B 2HE7A 3D8EA 1EGXA 2MWNB 2GCLA 4TKNA 2DHIA 5DHFB 2J0JA 1MKEA 2W2XD 2DKQA 1TJ6A 2YS5A 4D0NB 1U5FA 2BCJA 2I5CA 4HB2B 2D9WA 1M7EA 2RLOA 4H8SA 1WJ1A 4ZRJA 1ZM0A 2LOXA 1X05A 2DYQA 5D3YA 4HATB 2DTCA 2P0DA 1OMWA 2P8VA 3OANA 2EMSA 2YVCA 1J19A 2PZ1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GS0 A;  2RNR B;  2DX1 A;  2V76 A;  4HDO A;  1MIZ B;  2Z0Q A;  2MDX A;  1UPR A;  2CY4 A;  1DYN A;  5HE0 A;  1M7R A;  5KQ1 A;  5KCV A;  2ZPY A;  1P6S A;  3FEH A;  1FHX A;  5D3X A;  3LJU X;  1WI1 A;  1UNQ A;  4KHO A;  2M38 A;  2LG1 A;  1V5U A;  4L6E A;  5D3W A;  4ZRI A;  4IOY X;  2COD A;  5HE2 A;  2CAY A;  1XX0 A;  5CLL B;  1V89 A;  2ROV A;  2KCJ A;  4PQ0 A;  2DLW A;  1FHW A;  4Z2N A;  4HAU B;  3PEG A;  5D27 A;  1AWE A;  1SGH A;  1LB1 A;  3N7C A;  1PFJ A;  1NTY A;  1U27 A;  4YL8 A;  1MAI A;  2UVM A;  4EJN A;  4A6F A;  1WG7 A;  1ZSQ A;  4K2P A;  2OQB A;  2LOZ A;  5FI0 A;  4Z2M B;  4A6H A;  4WVF B;  1DDM A;  3FSS A;  5JHG A;  2ROZ B;  3BIN A;  1QC6 A;  4EKU A;  3A98 B;  4HB0 B;  5C16 A;  2Y8G A;  2YRY A;  2D4Q A;  1FB8 A;  1WGU A;  1UNP A;  5LON B;  2IYB A;  3CXB B;  1DDV A;  1Y19 B;  2W2X C;  3ULC A;  4DX8 A;  3MDB C;  5C6R A;  4HDQ A;  1EAZ A;  1XOD A;  2X18 A;  2VSZ A;  2I1J A;  2K2J A;  3PG7 A;  5DH9 B;  1W1H A;  4GXB A;  3X23 A;  2KUP A;  5HE1 A;  3PVW A;  2Y8F A;  3KSY A;  3SNH A;  1H10 A;  2J0M A;  2Q13 A;  5JHH A;  3ODW A;  1ZC3 B;  4F7H A;  4EMO A;  1Q67 A;  2DKP A;  3QBV B;  2D9V A;  2GJY A;  2IFS A;  2D11 A;  2DYN A;  3MPX A;  2FJL A;  1MK9 B;  1XCG A;  3ZDT A;  2EJ8 A;  4A5K A;  1BTN A;  3TCA A;  2ADZ A;  2UZR A;  2MFQ A;  5L81 A;  1Z87 A;  2Y7B A;  1OY2 A;  1KZG A;  1P5T A;  3DXC A;  1WGQ A;  4MY6 A;  2N0Y A;  2J0K A;  5D3V A;  5DHA B;  2LKO A;  3PP2 A;  1X11 A;  2GCJ A;  1TQZ A;  4K17 A;  1DDW A;  2DA0 A;  2MKR A;  1OQN A;  4GN1 A;  1UPQ A;  3KRX A;  3ZVR A;  1ZC4 B;  4Y94 A;  2D10 A;  2EC1 A;  4YON A;  3WYF B;  2YT1 A;  4P7I A;  1PLS A;  4DX9 0;  3P6A A;  2I1K A;  5C5B A;  1U5G A;  4BBK A;  1X1G A;  3GYP A;  1U29 A;  1DRO A;  4ZRK A;  4XWX A;  2K00 A;  1ZVR A;  4TYZ A;  1LW3 A;  4GMV A;  3D8F A;  2H7D A;  3U7D A;  3KY9 A;  2AEH A;  1XKE A;  1FHO A;  1SHC A;  2ELA A;  5J3T A;  2ELB A;  5EFX A;  4WJ7 A;  2R09 A;  3TVV A;  4A6F B;  3PZD A;  5JP4 A;  3V5W A;  2I5F A;  2COF A;  1NTV A;  2CY5 A;  1AQC A;  1V88 A;  1MIX A;  3O96 A;  4HAY B;  2NMB A;  2DHJ A;  4NY0 A;  2W2W A;  2YSZ A;  4F7G A;  2EMT A;  2RUK B;  2Z0P A;  2D9Z A;  1WJM A;  3AU4 A;  3RCP A;  5DI9 B;  2CRF A;  1BWN A;  2DX5 A;  3BJI A;  2LYD A;  1J0W A;  1H4R A;  2K2U A;  1NU2 A;  2YF0 A;  4DXA B;  3TO1 A;  3ODX A;  4DBB A;  3A8P A;  2QKM A;  3KZ1 A;  2DN6 A;  3TW1 A;  4B6H A;  5GOW B;  2D2Q A;  1FAO A;  3DXE A;  3D8D A;  3U8Z A;  2JP2 A;  2RSG A;  3QWM A;  2RGN B;  4CHJ A;  3SV1 A;  3VIA A;  1K5D B;  1WVH A;  2E2X A;  1U2B A;  1U5E A;  1V5P A;  1I2H A;  2DFK A;  5FI1 A;  4MT7 A;  1I7A A;  1FGZ A;  3G9W A;  4K2O A;  1GC6 A;  4KAX B;  3AJ4 A;  1DBH A;  2L2I A;  3A8Q A;  3NSU A;  2N23 A;  1BTK A;  3PVL A;  4KVG B;  3PVU A;  4HB4 B;  4KHB B;  4PNK A;  3F5R A;  2VRW B;  3UZT A;  4CYE A;  3GYO A;  2P0F A;  3ML4 A;  2AL6 A;  2Z0O A;  4GPT B;  5KQ4 A;  1P3R A;  3SUZ A;  3SYX A;  3WA0 A;  1E5W A;  2D9X A;  1EVH A;  1N3H A;  4C0A A;  1KI1 B;  2OTX A;  1XD4 A;  2COA A;  2QKL A;  2P0H A;  1FGY A;  1V5M A;  2YS3 A;  4MK0 A;  5LOP B;  3AU5 A;  1RRP B;  3ODO A;  5JLJ B;  1U5D A;  2YS1 A;  3M1I B;  4K81 A;  1GG3 A;  1Y5O A;  2LUL A;  5HE3 A;  1GC7 A;  3KRW A;  4HAX B;  4F7U P;  1X1F A;  1K5G B;  4NSW A;  1W1G A;  5CLQ B;  4HAV B;  3HQC A;  5J3Y A;  1FOE A;  4HB3 B;  3TFM A;  1ISN A;  5C5B B;  1W1D A;  3T06 A;  2KGX B;  3HK0 A;  2COC A;  3PSC A;  1TXD A;  1UEF A;  3SO6 A;  5J3Q A;  2HTH B;  4HAZ B;  4IFS A;  4IAP A;  3ULB A;  2NZ8 B;  4KHA A;  2G35 A;  3VOQ A;  3P7Z A;  4GZU A;  5DIF B;  2RVB B;  3QIJ A;  4GMX B;  2D9Y A;  1BAK A;  1EF1 A;  1RJ2 A;  3CIK A;  1KZ7 A;  3IVF A;  2YT0 A;  1B55 A;  2H7E A;  2UZS A;  1MPH A;  1UNR A;  1QQG A;  3HW2 B;  4HAW B;  4A6K A;  1IRS A;  4WSF A;  3F0W A;  2J59 M;  2L1C A;  4HHV A;  3FM8 C;  2R0D A;  5C79 A;  2VKI A;  1V61 A;  2XQN M;  1PMS A;  4CHM A;  1XR0 B;  3DXD A;  2DHK A;  1X86 A;  1NI2 A;  2M14 A;  1MK7 B;  2HE7 A;  3D8E A;  1EGX A;  2MWN B;  2GCL A;  4TKN A;  2DHI A;  5DHF B;  2J0J A;  1MKE A;  2W2X D;  2DKQ A;  1TJ6 A;  2YS5 A;  4D0N B;  1U5F A;  2BCJ A;  2I5C A;  4HB2 B;  2D9W A;  1M7E A;  2RLO A;  4H8S A;  1WJ1 A;  4ZRJ A;  1ZM0 A;  2LOX A;  1X05 A;  2DYQ A;  5D3Y A;  4HAT B;  2DTC A;  2P0D A;  1OMW A;  2P8V A;  3OAN A;  2EMS A;  2YVC A;  1J19 A;  2PZ1 A; 
#chains in the Genus database with same CATH topology
 2GS0 A;  2RNR B;  2DX1 A;  2V76 A;  4HDO A;  1MIZ B;  2Z0Q A;  2MDX A;  1UPR A;  2CY4 A;  1DYN A;  5HE0 A;  1M7R A;  5KQ1 A;  5KCV A;  2ZPY A;  1P6S A;  3FEH A;  1FHX A;  5D3X A;  3LJU X;  1WI1 A;  1UNQ A;  4KHO A;  2M38 A;  2LG1 A;  1V5U A;  4L6E A;  5D3W A;  4ZRI A;  4IOY X;  2COD A;  5HE2 A;  2CAY A;  1XX0 A;  5CLL B;  1V89 A;  2NBV A;  2ROV A;  3HSA A;  2KCJ A;  4PQ0 A;  2DLW A;  1FHW A;  4Z2N A;  4HAU B;  3PEG A;  5D27 A;  1AWE A;  1SGH A;  1LB1 A;  3N7C A;  1PFJ A;  1NTY A;  1U27 A;  4YL8 A;  1MAI A;  2UVM A;  4EJN A;  4A6F A;  1WG7 A;  1ZSQ A;  4K2P A;  2OQB A;  2LOZ A;  5FI0 A;  2GUM A;  4Z2M B;  4A6H A;  4WVF B;  1DDM A;  3FSS A;  5JHG A;  2ROZ B;  3BIN A;  1QC6 A;  2KR0 A;  4EKU A;  3A98 B;  4HB0 B;  5C16 A;  2Y8G A;  2YRY A;  2K8E A;  2D4Q A;  1FB8 A;  1WGU A;  1UNP A;  1T77 A;  5LON B;  2IYB A;  3CXB B;  1DDV A;  1Y19 B;  2W2X C;  2Z14 A;  3ULC A;  4DX8 A;  4QJ3 B;  3MDB C;  5C6R A;  4HDQ A;  1EAZ A;  2Z4D A;  1XOD A;  5I2M A;  2X18 A;  2VSZ A;  2I1J A;  2K2J A;  3PG7 A;  4OT1 A;  5DH9 B;  1W1H A;  4GXB A;  3HIE A;  3X23 A;  2KUP A;  5HE1 A;  3PVW A;  2Y8F A;  3KSY A;  3SNH A;  1H10 A;  2J0M A;  2Q13 A;  5JHH A;  3ODW A;  1ZC3 B;  4F7H A;  1MI1 A;  4EMO A;  1Q67 A;  2DKP A;  3QBV B;  2D9V A;  2GJY A;  4KHB A;  2IFS A;  2D11 A;  2DYN A;  3MPX A;  2FJL A;  1MK9 B;  1XCG A;  3ZDT A;  2EJ8 A;  4A5K A;  1BTN A;  3TCA A;  2ADZ A;  2UZR A;  2MFQ A;  5L81 A;  3NWF A;  1Z87 A;  2Y7B A;  1OY2 A;  1KZG A;  1P5T A;  2Z59 A;  3DXC A;  1WGQ A;  4MY6 A;  2N0Y A;  2J0K A;  5D3V A;  5DHA B;  2LKO A;  3NW8 A;  3PP2 A;  1X11 A;  2GCJ A;  1TQZ A;  4K17 A;  1DDW A;  2DA0 A;  2MKR A;  1OQN A;  4GN1 A;  2KUQ A;  5IRS A;  1ZYI A;  1UPQ A;  3KRX A;  3ZVR A;  1ZC4 B;  3NWA A;  4Y94 A;  2D10 A;  3U12 A;  2EC1 A;  4YON A;  3WYF B;  2YT1 A;  4P7I A;  1PLS A;  4DX9 0;  3P6A A;  2I1K A;  5C5B A;  1U5G A;  4BBK A;  1X1G A;  3GYP A;  1U29 A;  1DRO A;  4ZRK A;  4XWX A;  2K00 A;  1ZVR A;  4TYZ A;  1LW3 A;  4GMV A;  4GOU A;  3D8F A;  2H7D A;  3U7D A;  3KY9 A;  2YT2 A;  2AEH A;  5I2S A;  1XKE A;  1FHO A;  1SHC A;  2ELA A;  5J3T A;  2ELB A;  5EFX A;  4WJ7 A;  2R09 A;  3TVV A;  5M4Y B;  4A6F B;  3PZD A;  5JP4 A;  3V5W A;  2I5F A;  2COF A;  1NTV A;  2CY5 A;  1AQC A;  2K49 A;  1V88 A;  1MIX A;  3O96 A;  4HAY B;  2NMB A;  2DHJ A;  4NY0 A;  2W2W A;  2YSZ A;  4F7G A;  2EMT A;  2RUK B;  2Z0P A;  2D9Z A;  1WJM A;  3AU4 A;  3RCP A;  5DI9 B;  2CRF A;  1BWN A;  2DX5 A;  3BJI A;  2LYD A;  2KIE A;  1J0W A;  1H4R A;  2K2U A;  1NU2 A;  2YF0 A;  4DXA B;  4QJ4 B;  3TO1 A;  3ODX A;  4DBB A;  3A8P A;  2QKM A;  3KZ1 A;  2DN6 A;  3TW1 A;  4B6H A;  5GOW B;  2D2Q A;  1FAO A;  3DXE A;  3D8D A;  3U8Z A;  2JP2 A;  2RSG A;  3QWM A;  2RGN B;  4CHJ A;  3SV1 A;  3VIA A;  2KIG A;  1K5D B;  3FVC A;  1WVH A;  2E2X A;  1U2B A;  1U5E A;  1V5P A;  1I2H A;  2DFK A;  5FI1 A;  4MT7 A;  1I7A A;  1FGZ A;  4QXA B;  3G9W A;  4K2O A;  1GC6 A;  4KAX B;  3AJ4 A;  1DBH A;  2L2I A;  3A8Q A;  3NSU A;  2N23 A;  1BTK A;  3PVL A;  4KVG B;  3PVU A;  4HB4 B;  4KHB B;  4PNK A;  2FJU B;  3F5R A;  2VRW B;  3UZT A;  4CYE A;  3GYO A;  2P0F A;  3ML4 A;  2AL6 A;  2Z0O A;  4GPT B;  5KQ4 A;  1P3R A;  3SUZ A;  3SYX A;  3WA0 A;  1E5W A;  2D9X A;  1EVH A;  1N3H A;  4C0A A;  1KI1 B;  2OTX A;  1XD4 A;  2COA A;  2QKL A;  2P0H A;  1FGY A;  1V5M A;  2YS3 A;  4MK0 A;  5LOP B;  3AU5 A;  2Z13 A;  1RRP B;  3ODO A;  5JLJ B;  1U5D A;  2YS1 A;  3A58 A;  3M1I B;  4K81 A;  1GG3 A;  1Y5O A;  2LUL A;  5LG4 B;  5HE3 A;  1GC7 A;  3B77 A;  3KRW A;  4HAX B;  4F7U P;  1X1F A;  1K5G B;  4NSW A;  1W1G A;  5CLQ B;  4HAV B;  3HQC A;  4D6W A;  5J3Y A;  1FOE A;  4HB3 B;  3TFM A;  1ISN A;  5C5B B;  1W1D A;  3T06 A;  2KGX B;  3HK0 A;  2COC A;  3PSC A;  1TXD A;  4L1R A;  1UEF A;  3SO6 A;  5J3Q A;  2HTH B;  2ZKM X;  3OHM B;  4HAZ B;  4IFS A;  4IAP A;  3ULB A;  2NZ8 B;  4KHA A;  2G35 A;  3VOQ A;  3P7Z A;  4GZU A;  5DIF B;  2RVB B;  3QIJ A;  4GNK B;  4GMX B;  2D9Y A;  3NWD A;  1BAK A;  1EF1 A;  1RJ2 A;  3CIK A;  1KZ7 A;  3IVF A;  2YT0 A;  1B55 A;  2H7E A;  2UZS A;  1MPH A;  1UNR A;  1QQG A;  3HW2 B;  4HAW B;  4A6K A;  1IRS A;  4WSF A;  3F0W A;  4HSI A;  2J59 M;  2L1C A;  4HHV A;  3FM8 C;  2R0D A;  5C79 A;  2VKI A;  1V61 A;  2XQN M;  1PMS A;  4CHM A;  1XR0 B;  3DXD A;  2DHK A;  1X86 A;  1NI2 A;  4DIX A;  2M14 A;  1MK7 B;  2HE7 A;  3D8E A;  1EGX A;  2MWN B;  2GCL A;  4TKN A;  2DHI A;  5DHF B;  2J0J A;  1MKE A;  2W2X D;  2DKQ A;  1TJ6 A;  2YS5 A;  4D0N B;  4CSQ A;  1U5F A;  2BCJ A;  2I5C A;  2RRF A;  4HB2 B;  2D9W A;  1M7E A;  3DCX A;  2RLO A;  4H8S A;  1WJ1 A;  4OSN A;  4ZRJ A;  1ZM0 A;  2LOX A;  1X05 A;  2DYQ A;  5D3Y A;  4HAT B;  4QJ5 B;  2DTC A;  2P0D A;  1OMW A;  2P8V A;  2R2Y A;  3OAN A;  2EMS A;  2YVC A;  1J19 A;  2PZ1 A; 
#chains in the Genus database with same CATH homology
 2GS0 A;  2RNR B;  2DX1 A;  2V76 A;  4HDO A;  1MIZ B;  2Z0Q A;  2MDX A;  1UPR A;  2CY4 A;  1DYN A;  5HE0 A;  1M7R A;  5KQ1 A;  5KCV A;  2ZPY A;  1P6S A;  3FEH A;  1FHX A;  5D3X A;  3LJU X;  1WI1 A;  1UNQ A;  4KHO A;  2M38 A;  2LG1 A;  1V5U A;  4L6E A;  5D3W A;  4ZRI A;  4IOY X;  2COD A;  5HE2 A;  2CAY A;  1XX0 A;  5CLL B;  1V89 A;  2ROV A;  2KCJ A;  4PQ0 A;  2DLW A;  1FHW A;  4Z2N A;  4HAU B;  3PEG A;  5D27 A;  1AWE A;  1SGH A;  1LB1 A;  3N7C A;  1PFJ A;  1NTY A;  1U27 A;  4YL8 A;  1MAI A;  2UVM A;  4EJN A;  4A6F A;  1WG7 A;  1ZSQ A;  4K2P A;  2OQB A;  2LOZ A;  5FI0 A;  4Z2M B;  4A6H A;  4WVF B;  1DDM A;  3FSS A;  5JHG A;  2ROZ B;  3BIN A;  1QC6 A;  4EKU A;  3A98 B;  4HB0 B;  5C16 A;  2Y8G A;  2YRY A;  2D4Q A;  1FB8 A;  1WGU A;  1UNP A;  5LON B;  2IYB A;  3CXB B;  1DDV A;  1Y19 B;  2W2X C;  3ULC A;  4DX8 A;  3MDB C;  5C6R A;  4HDQ A;  1EAZ A;  1XOD A;  2X18 A;  2VSZ A;  2I1J A;  2K2J A;  3PG7 A;  5DH9 B;  1W1H A;  4GXB A;  3X23 A;  2KUP A;  5HE1 A;  3PVW A;  2Y8F A;  3KSY A;  3SNH A;  1H10 A;  2J0M A;  2Q13 A;  5JHH A;  3ODW A;  1ZC3 B;  4F7H A;  4EMO A;  1Q67 A;  2DKP A;  3QBV B;  2D9V A;  2GJY A;  2IFS A;  2D11 A;  2DYN A;  3MPX A;  2FJL A;  1MK9 B;  1XCG A;  3ZDT A;  2EJ8 A;  4A5K A;  1BTN A;  3TCA A;  2ADZ A;  2UZR A;  2MFQ A;  5L81 A;  1Z87 A;  2Y7B A;  1OY2 A;  1KZG A;  1P5T A;  3DXC A;  1WGQ A;  4MY6 A;  2N0Y A;  2J0K A;  5D3V A;  5DHA B;  2LKO A;  3PP2 A;  1X11 A;  2GCJ A;  1TQZ A;  4K17 A;  1DDW A;  2DA0 A;  2MKR A;  1OQN A;  4GN1 A;  1UPQ A;  3KRX A;  3ZVR A;  1ZC4 B;  4Y94 A;  2D10 A;  2EC1 A;  4YON A;  3WYF B;  2YT1 A;  4P7I A;  1PLS A;  4DX9 0;  3P6A A;  2I1K A;  5C5B A;  1U5G A;  4BBK A;  1X1G A;  3GYP A;  1U29 A;  1DRO A;  4ZRK A;  4XWX A;  2K00 A;  1ZVR A;  4TYZ A;  1LW3 A;  4GMV A;  3D8F A;  2H7D A;  3U7D A;  3KY9 A;  2AEH A;  1XKE A;  1FHO A;  1SHC A;  2ELA A;  5J3T A;  2ELB A;  5EFX A;  4WJ7 A;  2R09 A;  3TVV A;  4A6F B;  3PZD A;  5JP4 A;  3V5W A;  2I5F A;  2COF A;  1NTV A;  2CY5 A;  1AQC A;  1V88 A;  1MIX A;  3O96 A;  4HAY B;  2NMB A;  2DHJ A;  4NY0 A;  2W2W A;  2YSZ A;  4F7G A;  2EMT A;  2RUK B;  2Z0P A;  2D9Z A;  1WJM A;  3AU4 A;  3RCP A;  5DI9 B;  2CRF A;  1BWN A;  2DX5 A;  3BJI A;  2LYD A;  1J0W A;  1H4R A;  2K2U A;  1NU2 A;  2YF0 A;  4DXA B;  3TO1 A;  3ODX A;  4DBB A;  3A8P A;  2QKM A;  3KZ1 A;  2DN6 A;  3TW1 A;  4B6H A;  5GOW B;  2D2Q A;  1FAO A;  3DXE A;  3D8D A;  3U8Z A;  2JP2 A;  2RSG A;  3QWM A;  2RGN B;  4CHJ A;  3SV1 A;  3VIA A;  1K5D B;  1WVH A;  2E2X A;  1U2B A;  1U5E A;  1V5P A;  1I2H A;  2DFK A;  5FI1 A;  4MT7 A;  1I7A A;  1FGZ A;  3G9W A;  4K2O A;  1GC6 A;  4KAX B;  3AJ4 A;  1DBH A;  2L2I A;  3A8Q A;  3NSU A;  2N23 A;  1BTK A;  3PVL A;  4KVG B;  3PVU A;  4HB4 B;  4KHB B;  4PNK A;  3F5R A;  2VRW B;  3UZT A;  4CYE A;  3GYO A;  2P0F A;  3ML4 A;  2AL6 A;  2Z0O A;  4GPT B;  5KQ4 A;  1P3R A;  3SUZ A;  3SYX A;  3WA0 A;  1E5W A;  2D9X A;  1EVH A;  1N3H A;  4C0A A;  1KI1 B;  2OTX A;  1XD4 A;  2COA A;  2QKL A;  2P0H A;  1FGY A;  1V5M A;  2YS3 A;  4MK0 A;  5LOP B;  3AU5 A;  1RRP B;  3ODO A;  5JLJ B;  1U5D A;  2YS1 A;  3M1I B;  4K81 A;  1GG3 A;  1Y5O A;  2LUL A;  5HE3 A;  1GC7 A;  3KRW A;  4HAX B;  4F7U P;  1X1F A;  1K5G B;  4NSW A;  1W1G A;  5CLQ B;  4HAV B;  3HQC A;  5J3Y A;  1FOE A;  4HB3 B;  3TFM A;  1ISN A;  5C5B B;  1W1D A;  3T06 A;  2KGX B;  3HK0 A;  2COC A;  3PSC A;  1TXD A;  1UEF A;  3SO6 A;  5J3Q A;  2HTH B;  4HAZ B;  4IFS A;  4IAP A;  3ULB A;  2NZ8 B;  4KHA A;  2G35 A;  3VOQ A;  3P7Z A;  4GZU A;  5DIF B;  2RVB B;  3QIJ A;  4GMX B;  2D9Y A;  1BAK A;  1EF1 A;  1RJ2 A;  3CIK A;  1KZ7 A;  3IVF A;  2YT0 A;  1B55 A;  2H7E A;  2UZS A;  1MPH A;  1UNR A;  1QQG A;  3HW2 B;  4HAW B;  4A6K A;  1IRS A;  4WSF A;  3F0W A;  2J59 M;  2L1C A;  4HHV A;  3FM8 C;  2R0D A;  5C79 A;  2VKI A;  1V61 A;  2XQN M;  1PMS A;  4CHM A;  1XR0 B;  3DXD A;  2DHK A;  1X86 A;  1NI2 A;  2M14 A;  1MK7 B;  2HE7 A;  3D8E A;  1EGX A;  2MWN B;  2GCL A;  4TKN A;  2DHI A;  5DHF B;  2J0J A;  1MKE A;  2W2X D;  2DKQ A;  1TJ6 A;  2YS5 A;  4D0N B;  1U5F A;  2BCJ A;  2I5C A;  4HB2 B;  2D9W A;  1M7E A;  2RLO A;  4H8S A;  1WJ1 A;  4ZRJ A;  1ZM0 A;  2LOX A;  1X05 A;  2DYQ A;  5D3Y A;  4HAT B;  2DTC A;  2P0D A;  1OMW A;  2P8V A;  3OAN A;  2EMS A;  2YVC A;  1J19 A;  2PZ1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...