3VOQA

Crystal structure of the pleckstrin homology domain of human sin1, a torc2 subunit
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
122
structure length
116
Chain Sequence
GAMATVQDMLSSHHYKSFKVSMIHRLRFTTDVQLGISGDKVEIDPVTKFWIKQKPISIDSDLLCACDLAEEKSPSHAIFKLTYLSNHDYKHLYFESDAATVNEIVLKVNYILESRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Target of rapamycin complex 2 subunit MAPKAP1
publication title Structures of the pleckstrin homology domain of Saccharomyces cerevisiae Avo1 and its human orthologue Sin1, an essential subunit of TOR complex 2
pubmed doi rcsb
source organism Homo sapiens
molecule tags Membrane protein
total genus 28
structure length 116
sequence length 122
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-01-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16979 SIN1_PH SAPK-interacting protein 1 (Sin1), Pleckstrin-homology
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 3voqA00
3MDBC 5JLJB 1U5DA 3P6AA 5D3YA 3WA0A 1U5EA 3U8ZA 1QQGA 1U27A 1X86A 1NU2A 1P5TA 1IRSA 1UNPA 1MKEA 4D0NB 2KUPA 2CAYA 3KY9A 1KZ7A 2ELAA 1SHCA 1WVHA 2D9YA 2DTCA 3AU5A 4YL8A 3UZTA 1DROA 4A6FB 1XX0A 5J3QA 3AJ4A 4Z2NA 4YONA 3PEGA 3DXDA 2AL6A 2K2JA 4DX90 2L2IA 2YVCA 1LB1A 1U29A 3ULCA 3HW2B 5KCVA 2P8VA 2LOZA 1ZVRA 1WI1A 3HQCA 1MIZB 2FJLA 2LULA 2M14A 3M1IB 1MAIA 3P7ZA 2J59M 1FB8A 1B55A 2Z0OA 2YRYA 1FOEA 5CLQB 1EGXA 3PVWA 3N7CA 2RUKB 5HE2A 1UPRA 3QBVB 2L1CA 2UZRA 1W1DA 1BTNA 4NSWA 2IYBA 1TJ6A 1MK7B 3NSUA 3ULBA 2YT1A 2Y8FA 2HE7A 1J0WA 5C5BA 3F0WA 2MFQA 4IFSA 1KI1B 4A6FA 2Q13A 5J3YA 3ODOA 4EJNA 2D9XA 5FI1A 2RSGA 4C0AA 1V89A 2YS3A 1U5FA 3A8PA 1EVHA 3T06A 4XWXA 1NI2A 1KZGA 3KRXA 4KHOA 4HB2B 1W1GA 3FM8C 1RRPB 2H7EA 1GC7A 2ROZB 4CYEA 2DLWA 2Y7BA 2BCJA 2UZSA 3TVVA 5FI0A 3D8DA 1M7EA 3KZ1A 3QWMA 1V5UA 5D3XA 1XODA 4GMXB 1FHXA 2RNRB 3PG7A 1MIXA 2D2QA 2OQBA 3U7DA 4EKUA 1TQZA 2COCA 1UEFA 2D11A 1Z87A 1K5DB 1OQNA 2YS5A 3VOQA 5JP4A 2YF0A 3PVLA 5DHAB 4BBKA 2DHKA 4TKNA 2RVBB 2MKRA 1PLSA 2NMBA 1OY2A 1ZC3B 2DYNA 1XCGA 4WVFB 4IAPA 2IFSA 4HDOA 1AQCA 2J0JA 4KHBB 4CHJA 1GG3A 2X18A 1UNRA 4HATB 2HTHB 1Y5OA 5D3WA 1ZC4B 4HB0B 5JHHA 2D9VA 1DDMA 3BJIA 3BINA 4F7HA 3PP2A 4H8SA 5D3VA 4KAXB 2R09A 2I1JA 1LW3A 2EC1A 3KRWA 5CLLB 4WJ7A 4B6HA 4ZRJA 3ODXA 1MK9B 5HE0A 1I7AA 1UNQA 1PFJA 1XKEA 3D8FA 3FSSA 3RCPA 2K2UA 2W2WA 3LJUX 5DI9B 5GOWB 2DKPA 2OTXA 4HAXB 4DXAB 1NTYA 1OMWA 4MT7A 1QC6A 1X1FA 3PSCA 4K2OA 2EJ8A 2J0KA 1X05A 2YS1A 3F5RA 1MPHA 1WJMA 3SV1A 5JHGA 3ZVRA 4MK0A 2LKOA 4PNKA 2GCLA 2LOXA 4ZRIA 3O96A 5DH9B 3TFMA 1X1GA 5KQ4A 4P7IA 5HE3A 2COFA 3A98B 1P6SA 4A6HA 1H10A 3OANA 2ZPYA 2RGNB 2V76A 1H4RA 2DN6A 1N3HA 2XQNM 2DX1A 3FEHA 2COAA 3TW1A 1UPQA 1XD4A 2VSZA 3IVFA 1DYNA 2VRWB 1V88A 2GJYA 3DXCA 4K2PA 5DIFB 2DHIA 4HB4B 5EFXA 1X11A 3PVUA 1XR0B 3TCAA 2E2XA 2Z0QA 3MPXA 5HE1A 4HAUB 2W2XD 3D8EA 3ODWA 1FGZA 1RJ2A 2DKQA 3SYXA 3GYOA 2UVMA 4K81A 4KVGB 2ROVA 1DDVA 4HAZB 4HAWB 2D9WA 4TYZA 1V5MA 1M7RA 3V5WA 1EAZA 1J19A 1AWEA 5C79A 2P0HA 1WJ1A 1U2BA 5C6RA 1I2HA 1ZSQA 1BAKA 1W1HA 4GXBA 2QKLA 1FAOA 1GC6A 1BWNA 3GYPA 2KGXB 4IOYX 5C5BB 2RLOA 2D10A 2P0FA 2DA0A 3X23A 4CHMA 3ML4A 2QKMA 1P3RA 1EF1A 2CODA 4F7UP 1DBHA 3SO6A 2K00A 3PZDA 2G35A 1NTVA 1U5GA 2LYDA 2W2XC 2EMSA 4HHVA 4Y94A 2R0DA 2NZ8B 1V61A 5DHFB 4HAVB 4K17A 3TO1A 4PQ0A 4Z2MB 4DBBA 2MWNB 4NY0A 2M38A 4HDQA 1BTKA 1ZM0A 2H7DA 4WSFA 2LG1A 1V5PA 2PZ1A 1FGYA 5LOPB 2N23A 3G9WA 3KSYA 1K5GB 2GCJA 1TXDA 4ZRKA 3DXEA 3QIJA 4KHAA 2N0YA 4HAYB 5KQ1A 2Y8GA 5LONB 2DFKA 1Y19B 2CY4A 2MDXA 4A6KA 2D4QA 2Z0PA 4DX8A 1FHOA 3VIAA 2ADZA 4GZUA 1Q67A 4GMVA 3ZDTA 4EMOA 3SUZA 1DDWA 2I5FA 3AU4A 4F7GA 2YT0A 3HK0A 2DX5A 3WYFB 1WGUA 4HB3B 4L6EA 2DYQA 2ELBA 4GPTB 1WG7A 5J3TA 4GN1A 5C16A 5L81A 1SGHA 1WGQA 2DHJA 1FHWA 2KCJA 2YSZA 3A8QA 5D27A 2VKIA 2GS0A 2D9ZA 2CRFA 2I1KA 2AEHA 4A5KA 1E5WA 4MY6A 2EMTA 2P0DA 3CXBB 2I5CA 1ISNA 2J0MA 2CY5A 1PMSA 3CIKA 3SNHA 2JP2A
chains in the Genus database with same CATH superfamily
3MDBC 3B77A 5JLJB 1U5DA 3P6AA 5D3YA 3WA0A 1U5EA 3U8ZA 4D6WA 1QQGA 2KR0A 1U27A 5I2MA 1X86A 1NU2A 1P5TA 1IRSA 1UNPA 1MKEA 4D0NB 2KUPA 2CAYA 3KY9A 1KZ7A 2ELAA 1SHCA 1WVHA 2D9YA 2DTCA 3U12A 1MI1A 3A58A 3AU5A 4YL8A 3UZTA 1DROA 4A6FB 1XX0A 5J3QA 3AJ4A 4Z2NA 4YONA 3PEGA 3DXDA 2AL6A 2K2JA 2YT2A 4DX90 2L2IA 2ZKMX 4OT1A 2YVCA 1LB1A 1U29A 2Z14A 3ULCA 3HW2B 5KCVA 2P8VA 2LOZA 1ZVRA 1WI1A 3HQCA 1MIZB 2FJLA 2LULA 2M14A 5M4YB 3M1IB 1MAIA 3P7ZA 2J59M 1FB8A 1B55A 2Z0OA 2YRYA 3NWDA 1FOEA 5CLQB 1EGXA 3PVWA 3N7CA 2RUKB 5HE2A 1UPRA 3QBVB 2L1CA 2UZRA 1W1DA 1BTNA 4NSWA 2IYBA 1TJ6A 2RRFA 1MK7B 3NSUA 3ULBA 2K8EA 2YT1A 1ZYIA 2Y8FA 1T77A 2HE7A 1J0WA 5C5BA 3F0WA 2MFQA 4IFSA 1KI1B 4A6FA 2Q13A 5J3YA 3ODOA 4EJNA 2D9XA 5FI1A 2RSGA 4C0AA 1V89A 2YS3A 1U5FA 3A8PA 1EVHA 3T06A 4XWXA 1NI2A 1KZGA 3KRXA 4KHOA 3NWFA 4HB2B 1W1GA 3FM8C 1RRPB 2H7EA 1GC7A 2KIEA 2ROZB 4CSQA 4CYEA 2DLWA 2Y7BA 2BCJA 2UZSA 3TVVA 5FI0A 3D8DA 1M7EA 3KZ1A 3QWMA 1V5UA 5D3XA 1XODA 4GMXB 1FHXA 2RNRB 3PG7A 1MIXA 2D2QA 2OQBA 3U7DA 4EKUA 1TQZA 2COCA 1UEFA 2D11A 2Z4DA 1Z87A 5I2SA 1K5DB 1OQNA 2YS5A 3VOQA 5JP4A 2YF0A 3PVLA 5DHAB 4BBKA 2DHKA 4TKNA 2RVBB 2MKRA 1PLSA 2NMBA 1OY2A 1ZC3B 2DYNA 1XCGA 4WVFB 4IAPA 2IFSA 4HDOA 1AQCA 3HIEA 2J0JA 4KHBB 3FVCA 4CHJA 1GG3A 2X18A 1UNRA 3OHMB 4HATB 2HTHB 1Y5OA 5D3WA 1ZC4B 4HB0B 5JHHA 2D9VA 1DDMA 3BJIA 3NW8A 3BINA 4F7HA 3PP2A 4H8SA 5D3VA 4KAXB 2R09A 2I1JA 1LW3A 2EC1A 3KRWA 5CLLB 4WJ7A 4B6HA 4ZRJA 3ODXA 1MK9B 5HE0A 1I7AA 4GOUA 1UNQA 1PFJA 1XKEA 3D8FA 3FSSA 3RCPA 2K2UA 2W2WA 3LJUX 4DIXA 5DI9B 5GOWB 2DKPA 2OTXA 4HAXB 4DXAB 1NTYA 1OMWA 4MT7A 2Z13A 1QC6A 1X1FA 3PSCA 4K2OA 2EJ8A 2R2YA 2J0KA 1X05A 2YS1A 3F5RA 1MPHA 4KHBA 1WJMA 3SV1A 4L1RA 5JHGA 3ZVRA 4MK0A 2LKOA 4PNKA 2GCLA 2LOXA 2NBVA 4ZRIA 4QJ4B 3O96A 5DH9B 3TFMA 2Z59A 1X1GA 2KIGA 5KQ4A 4P7IA 5HE3A 2COFA 3A98B 1P6SA 4A6HA 4QJ5B 1H10A 3OANA 2ZPYA 2RGNB 2V76A 1H4RA 2DN6A 1N3HA 2XQNM 2DX1A 3FEHA 2COAA 3TW1A 1UPQA 1XD4A 2VSZA 1DYNA 2VRWB 3IVFA 1V88A 2GJYA 3DXCA 4K2PA 5DIFB 2DHIA 4HB4B 5EFXA 1X11A 3PVUA 1XR0B 3TCAA 5IRSA 2E2XA 2Z0QA 3MPXA 5HE1A 4HAUB 2W2XD 3D8EA 3ODWA 1FGZA 1RJ2A 2DKQA 3SYXA 3GYOA 2UVMA 4K81A 4KVGB 2ROVA 1DDVA 4HAZB 4HAWB 2D9WA 4TYZA 1V5MA 1M7RA 3V5WA 1EAZA 1J19A 1AWEA 5C79A 2P0HA 1WJ1A 1U2BA 5C6RA 1I2HA 1ZSQA 1BAKA 1W1HA 4GXBA 2QKLA 1FAOA 1GC6A 5LG4B 1BWNA 3GYPA 2KGXB 4IOYX 5C5BB 2RLOA 2D10A 2P0FA 2DA0A 3X23A 4CHMA 3ML4A 2QKMA 1P3RA 1EF1A 2GUMA 2CODA 4F7UP 1DBHA 3SO6A 2K00A 3PZDA 2G35A 3DCXA 1NTVA 1U5GA 2LYDA 2W2XC 2EMSA 2K49A 4HHVA 4Y94A 2R0DA 2NZ8B 1V61A 5DHFB 4HAVB 4K17A 2FJUB 3TO1A 4PQ0A 4Z2MB 4DBBA 2MWNB 4NY0A 2M38A 4GNKB 3NWAA 4HDQA 1BTKA 1ZM0A 4QXAB 2H7DA 4WSFA 2LG1A 1V5PA 2PZ1A 1FGYA 5LOPB 4OSNA 2N23A 3G9WA 3KSYA 1K5GB 2GCJA 1TXDA 4ZRKA 3DXEA 3QIJA 4KHAA 2N0YA 4HAYB 5KQ1A 2KUQA 2Y8GA 5LONB 2DFKA 1Y19B 2CY4A 2MDXA 4A6KA 2D4QA 2Z0PA 4DX8A 1FHOA 3VIAA 2ADZA 4GZUA 3HSAA 1Q67A 4GMVA 3ZDTA 4EMOA 3SUZA 1DDWA 2I5FA 3AU4A 4F7GA 2YT0A 3HK0A 2DX5A 3WYFB 1WGUA 4HB3B 4L6EA 2DYQA 2ELBA 4GPTB 1WG7A 5J3TA 4GN1A 5C16A 5L81A 4HSIA 1SGHA 1WGQA 2DHJA 1FHWA 2KCJA 2YSZA 3A8QA 5D27A 2VKIA 2GS0A 2D9ZA 2CRFA 2I1KA 2AEHA 4A5KA 1E5WA 4MY6A 2EMTA 2P0DA 3CXBB 2I5CA 1ISNA 2J0MA 2CY5A 1PMSA 3CIKA 4QJ3B 3SNHA 2JP2A
chains in the Genus database with same CATH topology
3MDBC 5JLJB 1U5DA 3P6AA 5D3YA 3WA0A 1U5EA 3U8ZA 1QQGA 1U27A 1X86A 1NU2A 1P5TA 1IRSA 1UNPA 1MKEA 4D0NB 2KUPA 2CAYA 3KY9A 1KZ7A 2ELAA 1SHCA 1WVHA 2D9YA 2DTCA 3AU5A 4YL8A 3UZTA 1DROA 4A6FB 1XX0A 5J3QA 3AJ4A 4Z2NA 4YONA 3PEGA 3DXDA 2AL6A 2K2JA 4DX90 2L2IA 2YVCA 1LB1A 1U29A 3ULCA 3HW2B 5KCVA 2P8VA 2LOZA 1ZVRA 1WI1A 3HQCA 1MIZB 2FJLA 2LULA 2M14A 3M1IB 1MAIA 3P7ZA 2J59M 1FB8A 1B55A 2Z0OA 2YRYA 1FOEA 5CLQB 1EGXA 3PVWA 3N7CA 2RUKB 5HE2A 1UPRA 3QBVB 2L1CA 2UZRA 1W1DA 1BTNA 4NSWA 2IYBA 1TJ6A 1MK7B 3NSUA 3ULBA 2YT1A 2Y8FA 2HE7A 1J0WA 5C5BA 3F0WA 2MFQA 4IFSA 1KI1B 4A6FA 2Q13A 5J3YA 3ODOA 4EJNA 2D9XA 5FI1A 2RSGA 4C0AA 1V89A 2YS3A 1U5FA 3A8PA 1EVHA 3T06A 4XWXA 1NI2A 1KZGA 3KRXA 4KHOA 4HB2B 1W1GA 3FM8C 1RRPB 2H7EA 1GC7A 2ROZB 4CYEA 2DLWA 2Y7BA 2BCJA 2UZSA 3TVVA 5FI0A 3D8DA 1M7EA 3KZ1A 3QWMA 1V5UA 5D3XA 1XODA 4GMXB 1FHXA 2RNRB 3PG7A 1MIXA 2D2QA 2OQBA 3U7DA 4EKUA 1TQZA 2COCA 1UEFA 2D11A 1Z87A 1K5DB 1OQNA 2YS5A 3VOQA 5JP4A 2YF0A 3PVLA 5DHAB 4BBKA 2DHKA 4TKNA 2RVBB 2MKRA 1PLSA 2NMBA 1OY2A 1ZC3B 2DYNA 1XCGA 4WVFB 4IAPA 2IFSA 4HDOA 1AQCA 2J0JA 4KHBB 4CHJA 1GG3A 2X18A 1UNRA 4HATB 2HTHB 1Y5OA 5D3WA 1ZC4B 4HB0B 5JHHA 2D9VA 1DDMA 3BJIA 3BINA 4F7HA 3PP2A 4H8SA 5D3VA 4KAXB 2R09A 2I1JA 1LW3A 2EC1A 3KRWA 5CLLB 4WJ7A 4B6HA 4ZRJA 3ODXA 1MK9B 5HE0A 1I7AA 1UNQA 1PFJA 1XKEA 3D8FA 3FSSA 3RCPA 2K2UA 2W2WA 3LJUX 5DI9B 5GOWB 2DKPA 2OTXA 4HAXB 4DXAB 1NTYA 1OMWA 4MT7A 1QC6A 1X1FA 3PSCA 4K2OA 2EJ8A 2J0KA 1X05A 2YS1A 3F5RA 1MPHA 1WJMA 3SV1A 5JHGA 3ZVRA 4MK0A 2LKOA 4PNKA 2GCLA 2LOXA 4ZRIA 3O96A 5DH9B 3TFMA 1X1GA 5KQ4A 4P7IA 5HE3A 2COFA 3A98B 1P6SA 4A6HA 1H10A 3OANA 2ZPYA 2RGNB 2V76A 1H4RA 2DN6A 1N3HA 2XQNM 2DX1A 3FEHA 2COAA 3TW1A 1UPQA 1XD4A 2VSZA 3IVFA 1DYNA 2VRWB 1V88A 2GJYA 3DXCA 4K2PA 5DIFB 2DHIA 4HB4B 5EFXA 1X11A 3PVUA 1XR0B 3TCAA 2E2XA 2Z0QA 3MPXA 5HE1A 4HAUB 2W2XD 3D8EA 3ODWA 1FGZA 1RJ2A 2DKQA 3SYXA 3GYOA 2UVMA 4K81A 4KVGB 2ROVA 1DDVA 4HAZB 4HAWB 2D9WA 4TYZA 1V5MA 1M7RA 3V5WA 1EAZA 1J19A 1AWEA 5C79A 2P0HA 1WJ1A 1U2BA 5C6RA 1I2HA 1ZSQA 1BAKA 1W1HA 4GXBA 2QKLA 1FAOA 1GC6A 1BWNA 3GYPA 2KGXB 4IOYX 5C5BB 2RLOA 2D10A 2P0FA 2DA0A 3X23A 4CHMA 3ML4A 2QKMA 1P3RA 1EF1A 2CODA 4F7UP 1DBHA 3SO6A 2K00A 3PZDA 2G35A 1NTVA 1U5GA 2LYDA 2W2XC 2EMSA 4HHVA 4Y94A 2R0DA 2NZ8B 1V61A 5DHFB 4HAVB 4K17A 3TO1A 4PQ0A 4Z2MB 4DBBA 2MWNB 4NY0A 2M38A 4HDQA 1BTKA 1ZM0A 2H7DA 4WSFA 2LG1A 1V5PA 2PZ1A 1FGYA 5LOPB 2N23A 3G9WA 3KSYA 1K5GB 2GCJA 1TXDA 4ZRKA 3DXEA 3QIJA 4KHAA 2N0YA 4HAYB 5KQ1A 2Y8GA 5LONB 2DFKA 1Y19B 2CY4A 2MDXA 4A6KA 2D4QA 2Z0PA 4DX8A 1FHOA 3VIAA 2ADZA 4GZUA 1Q67A 4GMVA 3ZDTA 4EMOA 3SUZA 1DDWA 2I5FA 3AU4A 4F7GA 2YT0A 3HK0A 2DX5A 3WYFB 1WGUA 4HB3B 4L6EA 2DYQA 2ELBA 4GPTB 1WG7A 5J3TA 4GN1A 5C16A 5L81A 1SGHA 1WGQA 2DHJA 1FHWA 2KCJA 2YSZA 3A8QA 5D27A 2VKIA 2GS0A 2D9ZA 2CRFA 2I1KA 2AEHA 4A5KA 1E5WA 4MY6A 2EMTA 2P0DA 3CXBB 2I5CA 1ISNA 2J0MA 2CY5A 1PMSA 3CIKA 3SNHA 2JP2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MDB C;  5JLJ B;  1U5D A;  3P6A A;  5D3Y A;  3WA0 A;  1U5E A;  3U8Z A;  1QQG A;  1U27 A;  1X86 A;  1NU2 A;  1P5T A;  1IRS A;  1UNP A;  1MKE A;  4D0N B;  2KUP A;  2CAY A;  3KY9 A;  1KZ7 A;  2ELA A;  1SHC A;  1WVH A;  2D9Y A;  2DTC A;  3AU5 A;  4YL8 A;  3UZT A;  1DRO A;  4A6F B;  1XX0 A;  5J3Q A;  3AJ4 A;  4Z2N A;  4YON A;  3PEG A;  3DXD A;  2AL6 A;  2K2J A;  4DX9 0;  2L2I A;  2YVC A;  1LB1 A;  1U29 A;  3ULC A;  3HW2 B;  5KCV A;  2P8V A;  2LOZ A;  1ZVR A;  1WI1 A;  3HQC A;  1MIZ B;  2FJL A;  2LUL A;  2M14 A;  3M1I B;  1MAI A;  3P7Z A;  2J59 M;  1FB8 A;  1B55 A;  2Z0O A;  2YRY A;  1FOE A;  5CLQ B;  1EGX A;  3PVW A;  3N7C A;  2RUK B;  5HE2 A;  1UPR A;  3QBV B;  2L1C A;  2UZR A;  1W1D A;  1BTN A;  4NSW A;  2IYB A;  1TJ6 A;  1MK7 B;  3NSU A;  3ULB A;  2YT1 A;  2Y8F A;  2HE7 A;  1J0W A;  5C5B A;  3F0W A;  2MFQ A;  4IFS A;  1KI1 B;  4A6F A;  2Q13 A;  5J3Y A;  3ODO A;  4EJN A;  2D9X A;  5FI1 A;  2RSG A;  4C0A A;  1V89 A;  2YS3 A;  1U5F A;  3A8P A;  1EVH A;  3T06 A;  4XWX A;  1NI2 A;  1KZG A;  3KRX A;  4KHO A;  4HB2 B;  1W1G A;  3FM8 C;  1RRP B;  2H7E A;  1GC7 A;  2ROZ B;  4CYE A;  2DLW A;  2Y7B A;  2BCJ A;  2UZS A;  3TVV A;  5FI0 A;  3D8D A;  1M7E A;  3KZ1 A;  3QWM A;  1V5U A;  5D3X A;  1XOD A;  4GMX B;  1FHX A;  2RNR B;  3PG7 A;  1MIX A;  2D2Q A;  2OQB A;  3U7D A;  4EKU A;  1TQZ A;  2COC A;  1UEF A;  2D11 A;  1Z87 A;  1K5D B;  1OQN A;  2YS5 A;  3VOQ A;  5JP4 A;  2YF0 A;  3PVL A;  5DHA B;  4BBK A;  2DHK A;  4TKN A;  2RVB B;  2MKR A;  1PLS A;  2NMB A;  1OY2 A;  1ZC3 B;  2DYN A;  1XCG A;  4WVF B;  4IAP A;  2IFS A;  4HDO A;  1AQC A;  2J0J A;  4KHB B;  4CHJ A;  1GG3 A;  2X18 A;  1UNR A;  4HAT B;  2HTH B;  1Y5O A;  5D3W A;  1ZC4 B;  4HB0 B;  5JHH A;  2D9V A;  1DDM A;  3BJI A;  3BIN A;  4F7H A;  3PP2 A;  4H8S A;  5D3V A;  4KAX B;  2R09 A;  2I1J A;  1LW3 A;  2EC1 A;  3KRW A;  5CLL B;  4WJ7 A;  4B6H A;  4ZRJ A;  3ODX A;  1MK9 B;  5HE0 A;  1I7A A;  1UNQ A;  1PFJ A;  1XKE A;  3D8F A;  3FSS A;  3RCP A;  2K2U A;  2W2W A;  3LJU X;  5DI9 B;  5GOW B;  2DKP A;  2OTX A;  4HAX B;  4DXA B;  1NTY A;  1OMW A;  4MT7 A;  1QC6 A;  1X1F A;  3PSC A;  4K2O A;  2EJ8 A;  2J0K A;  1X05 A;  2YS1 A;  3F5R A;  1MPH A;  1WJM A;  3SV1 A;  5JHG A;  3ZVR A;  4MK0 A;  2LKO A;  4PNK A;  2GCL A;  2LOX A;  4ZRI A;  3O96 A;  5DH9 B;  3TFM A;  1X1G A;  5KQ4 A;  4P7I A;  5HE3 A;  2COF A;  3A98 B;  1P6S A;  4A6H A;  1H10 A;  3OAN A;  2ZPY A;  2RGN B;  2V76 A;  1H4R A;  2DN6 A;  1N3H A;  2XQN M;  2DX1 A;  3FEH A;  2COA A;  3TW1 A;  1UPQ A;  1XD4 A;  2VSZ A;  3IVF A;  1DYN A;  2VRW B;  1V88 A;  2GJY A;  3DXC A;  4K2P A;  5DIF B;  2DHI A;  4HB4 B;  5EFX A;  1X11 A;  3PVU A;  1XR0 B;  3TCA A;  2E2X A;  2Z0Q A;  3MPX A;  5HE1 A;  4HAU B;  2W2X D;  3D8E A;  3ODW A;  1FGZ A;  1RJ2 A;  2DKQ A;  3SYX A;  3GYO A;  2UVM A;  4K81 A;  4KVG B;  2ROV A;  1DDV A;  4HAZ B;  4HAW B;  2D9W A;  4TYZ A;  1V5M A;  1M7R A;  3V5W A;  1EAZ A;  1J19 A;  1AWE A;  5C79 A;  2P0H A;  1WJ1 A;  1U2B A;  5C6R A;  1I2H A;  1ZSQ A;  1BAK A;  1W1H A;  4GXB A;  2QKL A;  1FAO A;  1GC6 A;  1BWN A;  3GYP A;  2KGX B;  4IOY X;  5C5B B;  2RLO A;  2D10 A;  2P0F A;  2DA0 A;  3X23 A;  4CHM A;  3ML4 A;  2QKM A;  1P3R A;  1EF1 A;  2COD A;  4F7U P;  1DBH A;  3SO6 A;  2K00 A;  3PZD A;  2G35 A;  1NTV A;  1U5G A;  2LYD A;  2W2X C;  2EMS A;  4HHV A;  4Y94 A;  2R0D A;  2NZ8 B;  1V61 A;  5DHF B;  4HAV B;  4K17 A;  3TO1 A;  4PQ0 A;  4Z2M B;  4DBB A;  2MWN B;  4NY0 A;  2M38 A;  4HDQ A;  1BTK A;  1ZM0 A;  2H7D A;  4WSF A;  2LG1 A;  1V5P A;  2PZ1 A;  1FGY A;  5LOP B;  2N23 A;  3G9W A;  3KSY A;  1K5G B;  2GCJ A;  1TXD A;  4ZRK A;  3DXE A;  3QIJ A;  4KHA A;  2N0Y A;  4HAY B;  5KQ1 A;  2Y8G A;  5LON B;  2DFK A;  1Y19 B;  2CY4 A;  2MDX A;  4A6K A;  2D4Q A;  2Z0P A;  4DX8 A;  1FHO A;  3VIA A;  2ADZ A;  4GZU A;  1Q67 A;  4GMV A;  3ZDT A;  4EMO A;  3SUZ A;  1DDW A;  2I5F A;  3AU4 A;  4F7G A;  2YT0 A;  3HK0 A;  2DX5 A;  3WYF B;  1WGU A;  4HB3 B;  4L6E A;  2DYQ A;  2ELB A;  4GPT B;  1WG7 A;  5J3T A;  4GN1 A;  5C16 A;  5L81 A;  1SGH A;  1WGQ A;  2DHJ A;  1FHW A;  2KCJ A;  2YSZ A;  3A8Q A;  5D27 A;  2VKI A;  2GS0 A;  2D9Z A;  2CRF A;  2I1K A;  2AEH A;  4A5K A;  1E5W A;  4MY6 A;  2EMT A;  2P0D A;  3CXB B;  2I5C A;  1ISN A;  2J0M A;  2CY5 A;  1PMS A;  3CIK A;  3SNH A;  2JP2 A; 
#chains in the Genus database with same CATH topology
 3MDB C;  3B77 A;  5JLJ B;  1U5D A;  3P6A A;  5D3Y A;  3WA0 A;  1U5E A;  3U8Z A;  4D6W A;  1QQG A;  2KR0 A;  1U27 A;  5I2M A;  1X86 A;  1NU2 A;  1P5T A;  1IRS A;  1UNP A;  1MKE A;  4D0N B;  2KUP A;  2CAY A;  3KY9 A;  1KZ7 A;  2ELA A;  1SHC A;  1WVH A;  2D9Y A;  2DTC A;  3U12 A;  1MI1 A;  3A58 A;  3AU5 A;  4YL8 A;  3UZT A;  1DRO A;  4A6F B;  1XX0 A;  5J3Q A;  3AJ4 A;  4Z2N A;  4YON A;  3PEG A;  3DXD A;  2AL6 A;  2K2J A;  2YT2 A;  4DX9 0;  2L2I A;  2ZKM X;  4OT1 A;  2YVC A;  1LB1 A;  1U29 A;  2Z14 A;  3ULC A;  3HW2 B;  5KCV A;  2P8V A;  2LOZ A;  1ZVR A;  1WI1 A;  3HQC A;  1MIZ B;  2FJL A;  2LUL A;  2M14 A;  5M4Y B;  3M1I B;  1MAI A;  3P7Z A;  2J59 M;  1FB8 A;  1B55 A;  2Z0O A;  2YRY A;  3NWD A;  1FOE A;  5CLQ B;  1EGX A;  3PVW A;  3N7C A;  2RUK B;  5HE2 A;  1UPR A;  3QBV B;  2L1C A;  2UZR A;  1W1D A;  1BTN A;  4NSW A;  2IYB A;  1TJ6 A;  2RRF A;  1MK7 B;  3NSU A;  3ULB A;  2K8E A;  2YT1 A;  1ZYI A;  2Y8F A;  1T77 A;  2HE7 A;  1J0W A;  5C5B A;  3F0W A;  2MFQ A;  4IFS A;  1KI1 B;  4A6F A;  2Q13 A;  5J3Y A;  3ODO A;  4EJN A;  2D9X A;  5FI1 A;  2RSG A;  4C0A A;  1V89 A;  2YS3 A;  1U5F A;  3A8P A;  1EVH A;  3T06 A;  4XWX A;  1NI2 A;  1KZG A;  3KRX A;  4KHO A;  3NWF A;  4HB2 B;  1W1G A;  3FM8 C;  1RRP B;  2H7E A;  1GC7 A;  2KIE A;  2ROZ B;  4CSQ A;  4CYE A;  2DLW A;  2Y7B A;  2BCJ A;  2UZS A;  3TVV A;  5FI0 A;  3D8D A;  1M7E A;  3KZ1 A;  3QWM A;  1V5U A;  5D3X A;  1XOD A;  4GMX B;  1FHX A;  2RNR B;  3PG7 A;  1MIX A;  2D2Q A;  2OQB A;  3U7D A;  4EKU A;  1TQZ A;  2COC A;  1UEF A;  2D11 A;  2Z4D A;  1Z87 A;  5I2S A;  1K5D B;  1OQN A;  2YS5 A;  3VOQ A;  5JP4 A;  2YF0 A;  3PVL A;  5DHA B;  4BBK A;  2DHK A;  4TKN A;  2RVB B;  2MKR A;  1PLS A;  2NMB A;  1OY2 A;  1ZC3 B;  2DYN A;  1XCG A;  4WVF B;  4IAP A;  2IFS A;  4HDO A;  1AQC A;  3HIE A;  2J0J A;  4KHB B;  3FVC A;  4CHJ A;  1GG3 A;  2X18 A;  1UNR A;  3OHM B;  4HAT B;  2HTH B;  1Y5O A;  5D3W A;  1ZC4 B;  4HB0 B;  5JHH A;  2D9V A;  1DDM A;  3BJI A;  3NW8 A;  3BIN A;  4F7H A;  3PP2 A;  4H8S A;  5D3V A;  4KAX B;  2R09 A;  2I1J A;  1LW3 A;  2EC1 A;  3KRW A;  5CLL B;  4WJ7 A;  4B6H A;  4ZRJ A;  3ODX A;  1MK9 B;  5HE0 A;  1I7A A;  4GOU A;  1UNQ A;  1PFJ A;  1XKE A;  3D8F A;  3FSS A;  3RCP A;  2K2U A;  2W2W A;  3LJU X;  4DIX A;  5DI9 B;  5GOW B;  2DKP A;  2OTX A;  4HAX B;  4DXA B;  1NTY A;  1OMW A;  4MT7 A;  2Z13 A;  1QC6 A;  1X1F A;  3PSC A;  4K2O A;  2EJ8 A;  2R2Y A;  2J0K A;  1X05 A;  2YS1 A;  3F5R A;  1MPH A;  4KHB A;  1WJM A;  3SV1 A;  4L1R A;  5JHG A;  3ZVR A;  4MK0 A;  2LKO A;  4PNK A;  2GCL A;  2LOX A;  2NBV A;  4ZRI A;  4QJ4 B;  3O96 A;  5DH9 B;  3TFM A;  2Z59 A;  1X1G A;  2KIG A;  5KQ4 A;  4P7I A;  5HE3 A;  2COF A;  3A98 B;  1P6S A;  4A6H A;  4QJ5 B;  1H10 A;  3OAN A;  2ZPY A;  2RGN B;  2V76 A;  1H4R A;  2DN6 A;  1N3H A;  2XQN M;  2DX1 A;  3FEH A;  2COA A;  3TW1 A;  1UPQ A;  1XD4 A;  2VSZ A;  1DYN A;  2VRW B;  3IVF A;  1V88 A;  2GJY A;  3DXC A;  4K2P A;  5DIF B;  2DHI A;  4HB4 B;  5EFX A;  1X11 A;  3PVU A;  1XR0 B;  3TCA A;  5IRS A;  2E2X A;  2Z0Q A;  3MPX A;  5HE1 A;  4HAU B;  2W2X D;  3D8E A;  3ODW A;  1FGZ A;  1RJ2 A;  2DKQ A;  3SYX A;  3GYO A;  2UVM A;  4K81 A;  4KVG B;  2ROV A;  1DDV A;  4HAZ B;  4HAW B;  2D9W A;  4TYZ A;  1V5M A;  1M7R A;  3V5W A;  1EAZ A;  1J19 A;  1AWE A;  5C79 A;  2P0H A;  1WJ1 A;  1U2B A;  5C6R A;  1I2H A;  1ZSQ A;  1BAK A;  1W1H A;  4GXB A;  2QKL A;  1FAO A;  1GC6 A;  5LG4 B;  1BWN A;  3GYP A;  2KGX B;  4IOY X;  5C5B B;  2RLO A;  2D10 A;  2P0F A;  2DA0 A;  3X23 A;  4CHM A;  3ML4 A;  2QKM A;  1P3R A;  1EF1 A;  2GUM A;  2COD A;  4F7U P;  1DBH A;  3SO6 A;  2K00 A;  3PZD A;  2G35 A;  3DCX A;  1NTV A;  1U5G A;  2LYD A;  2W2X C;  2EMS A;  2K49 A;  4HHV A;  4Y94 A;  2R0D A;  2NZ8 B;  1V61 A;  5DHF B;  4HAV B;  4K17 A;  2FJU B;  3TO1 A;  4PQ0 A;  4Z2M B;  4DBB A;  2MWN B;  4NY0 A;  2M38 A;  4GNK B;  3NWA A;  4HDQ A;  1BTK A;  1ZM0 A;  4QXA B;  2H7D A;  4WSF A;  2LG1 A;  1V5P A;  2PZ1 A;  1FGY A;  5LOP B;  4OSN A;  2N23 A;  3G9W A;  3KSY A;  1K5G B;  2GCJ A;  1TXD A;  4ZRK A;  3DXE A;  3QIJ A;  4KHA A;  2N0Y A;  4HAY B;  5KQ1 A;  2KUQ A;  2Y8G A;  5LON B;  2DFK A;  1Y19 B;  2CY4 A;  2MDX A;  4A6K A;  2D4Q A;  2Z0P A;  4DX8 A;  1FHO A;  3VIA A;  2ADZ A;  4GZU A;  3HSA A;  1Q67 A;  4GMV A;  3ZDT A;  4EMO A;  3SUZ A;  1DDW A;  2I5F A;  3AU4 A;  4F7G A;  2YT0 A;  3HK0 A;  2DX5 A;  3WYF B;  1WGU A;  4HB3 B;  4L6E A;  2DYQ A;  2ELB A;  4GPT B;  1WG7 A;  5J3T A;  4GN1 A;  5C16 A;  5L81 A;  4HSI A;  1SGH A;  1WGQ A;  2DHJ A;  1FHW A;  2KCJ A;  2YSZ A;  3A8Q A;  5D27 A;  2VKI A;  2GS0 A;  2D9Z A;  2CRF A;  2I1K A;  2AEH A;  4A5K A;  1E5W A;  4MY6 A;  2EMT A;  2P0D A;  3CXB B;  2I5C A;  1ISN A;  2J0M A;  2CY5 A;  1PMS A;  3CIK A;  4QJ3 B;  3SNH A;  2JP2 A; 
#chains in the Genus database with same CATH homology
 3MDB C;  5JLJ B;  1U5D A;  3P6A A;  5D3Y A;  3WA0 A;  1U5E A;  3U8Z A;  1QQG A;  1U27 A;  1X86 A;  1NU2 A;  1P5T A;  1IRS A;  1UNP A;  1MKE A;  4D0N B;  2KUP A;  2CAY A;  3KY9 A;  1KZ7 A;  2ELA A;  1SHC A;  1WVH A;  2D9Y A;  2DTC A;  3AU5 A;  4YL8 A;  3UZT A;  1DRO A;  4A6F B;  1XX0 A;  5J3Q A;  3AJ4 A;  4Z2N A;  4YON A;  3PEG A;  3DXD A;  2AL6 A;  2K2J A;  4DX9 0;  2L2I A;  2YVC A;  1LB1 A;  1U29 A;  3ULC A;  3HW2 B;  5KCV A;  2P8V A;  2LOZ A;  1ZVR A;  1WI1 A;  3HQC A;  1MIZ B;  2FJL A;  2LUL A;  2M14 A;  3M1I B;  1MAI A;  3P7Z A;  2J59 M;  1FB8 A;  1B55 A;  2Z0O A;  2YRY A;  1FOE A;  5CLQ B;  1EGX A;  3PVW A;  3N7C A;  2RUK B;  5HE2 A;  1UPR A;  3QBV B;  2L1C A;  2UZR A;  1W1D A;  1BTN A;  4NSW A;  2IYB A;  1TJ6 A;  1MK7 B;  3NSU A;  3ULB A;  2YT1 A;  2Y8F A;  2HE7 A;  1J0W A;  5C5B A;  3F0W A;  2MFQ A;  4IFS A;  1KI1 B;  4A6F A;  2Q13 A;  5J3Y A;  3ODO A;  4EJN A;  2D9X A;  5FI1 A;  2RSG A;  4C0A A;  1V89 A;  2YS3 A;  1U5F A;  3A8P A;  1EVH A;  3T06 A;  4XWX A;  1NI2 A;  1KZG A;  3KRX A;  4KHO A;  4HB2 B;  1W1G A;  3FM8 C;  1RRP B;  2H7E A;  1GC7 A;  2ROZ B;  4CYE A;  2DLW A;  2Y7B A;  2BCJ A;  2UZS A;  3TVV A;  5FI0 A;  3D8D A;  1M7E A;  3KZ1 A;  3QWM A;  1V5U A;  5D3X A;  1XOD A;  4GMX B;  1FHX A;  2RNR B;  3PG7 A;  1MIX A;  2D2Q A;  2OQB A;  3U7D A;  4EKU A;  1TQZ A;  2COC A;  1UEF A;  2D11 A;  1Z87 A;  1K5D B;  1OQN A;  2YS5 A;  3VOQ A;  5JP4 A;  2YF0 A;  3PVL A;  5DHA B;  4BBK A;  2DHK A;  4TKN A;  2RVB B;  2MKR A;  1PLS A;  2NMB A;  1OY2 A;  1ZC3 B;  2DYN A;  1XCG A;  4WVF B;  4IAP A;  2IFS A;  4HDO A;  1AQC A;  2J0J A;  4KHB B;  4CHJ A;  1GG3 A;  2X18 A;  1UNR A;  4HAT B;  2HTH B;  1Y5O A;  5D3W A;  1ZC4 B;  4HB0 B;  5JHH A;  2D9V A;  1DDM A;  3BJI A;  3BIN A;  4F7H A;  3PP2 A;  4H8S A;  5D3V A;  4KAX B;  2R09 A;  2I1J A;  1LW3 A;  2EC1 A;  3KRW A;  5CLL B;  4WJ7 A;  4B6H A;  4ZRJ A;  3ODX A;  1MK9 B;  5HE0 A;  1I7A A;  1UNQ A;  1PFJ A;  1XKE A;  3D8F A;  3FSS A;  3RCP A;  2K2U A;  2W2W A;  3LJU X;  5DI9 B;  5GOW B;  2DKP A;  2OTX A;  4HAX B;  4DXA B;  1NTY A;  1OMW A;  4MT7 A;  1QC6 A;  1X1F A;  3PSC A;  4K2O A;  2EJ8 A;  2J0K A;  1X05 A;  2YS1 A;  3F5R A;  1MPH A;  1WJM A;  3SV1 A;  5JHG A;  3ZVR A;  4MK0 A;  2LKO A;  4PNK A;  2GCL A;  2LOX A;  4ZRI A;  3O96 A;  5DH9 B;  3TFM A;  1X1G A;  5KQ4 A;  4P7I A;  5HE3 A;  2COF A;  3A98 B;  1P6S A;  4A6H A;  1H10 A;  3OAN A;  2ZPY A;  2RGN B;  2V76 A;  1H4R A;  2DN6 A;  1N3H A;  2XQN M;  2DX1 A;  3FEH A;  2COA A;  3TW1 A;  1UPQ A;  1XD4 A;  2VSZ A;  3IVF A;  1DYN A;  2VRW B;  1V88 A;  2GJY A;  3DXC A;  4K2P A;  5DIF B;  2DHI A;  4HB4 B;  5EFX A;  1X11 A;  3PVU A;  1XR0 B;  3TCA A;  2E2X A;  2Z0Q A;  3MPX A;  5HE1 A;  4HAU B;  2W2X D;  3D8E A;  3ODW A;  1FGZ A;  1RJ2 A;  2DKQ A;  3SYX A;  3GYO A;  2UVM A;  4K81 A;  4KVG B;  2ROV A;  1DDV A;  4HAZ B;  4HAW B;  2D9W A;  4TYZ A;  1V5M A;  1M7R A;  3V5W A;  1EAZ A;  1J19 A;  1AWE A;  5C79 A;  2P0H A;  1WJ1 A;  1U2B A;  5C6R A;  1I2H A;  1ZSQ A;  1BAK A;  1W1H A;  4GXB A;  2QKL A;  1FAO A;  1GC6 A;  1BWN A;  3GYP A;  2KGX B;  4IOY X;  5C5B B;  2RLO A;  2D10 A;  2P0F A;  2DA0 A;  3X23 A;  4CHM A;  3ML4 A;  2QKM A;  1P3R A;  1EF1 A;  2COD A;  4F7U P;  1DBH A;  3SO6 A;  2K00 A;  3PZD A;  2G35 A;  1NTV A;  1U5G A;  2LYD A;  2W2X C;  2EMS A;  4HHV A;  4Y94 A;  2R0D A;  2NZ8 B;  1V61 A;  5DHF B;  4HAV B;  4K17 A;  3TO1 A;  4PQ0 A;  4Z2M B;  4DBB A;  2MWN B;  4NY0 A;  2M38 A;  4HDQ A;  1BTK A;  1ZM0 A;  2H7D A;  4WSF A;  2LG1 A;  1V5P A;  2PZ1 A;  1FGY A;  5LOP B;  2N23 A;  3G9W A;  3KSY A;  1K5G B;  2GCJ A;  1TXD A;  4ZRK A;  3DXE A;  3QIJ A;  4KHA A;  2N0Y A;  4HAY B;  5KQ1 A;  2Y8G A;  5LON B;  2DFK A;  1Y19 B;  2CY4 A;  2MDX A;  4A6K A;  2D4Q A;  2Z0P A;  4DX8 A;  1FHO A;  3VIA A;  2ADZ A;  4GZU A;  1Q67 A;  4GMV A;  3ZDT A;  4EMO A;  3SUZ A;  1DDW A;  2I5F A;  3AU4 A;  4F7G A;  2YT0 A;  3HK0 A;  2DX5 A;  3WYF B;  1WGU A;  4HB3 B;  4L6E A;  2DYQ A;  2ELB A;  4GPT B;  1WG7 A;  5J3T A;  4GN1 A;  5C16 A;  5L81 A;  1SGH A;  1WGQ A;  2DHJ A;  1FHW A;  2KCJ A;  2YSZ A;  3A8Q A;  5D27 A;  2VKI A;  2GS0 A;  2D9Z A;  2CRF A;  2I1K A;  2AEH A;  4A5K A;  1E5W A;  4MY6 A;  2EMT A;  2P0D A;  3CXB B;  2I5C A;  1ISN A;  2J0M A;  2CY5 A;  1PMS A;  3CIK A;  3SNH A;  2JP2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...