3VOQA

Crystal structure of the pleckstrin homology domain of human sin1, a torc2 subunit
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
122
structure length
116
Chain Sequence
b'GAMATVQDMLSSHHYKSFKVSMIHRLRFTTDVQLGISGDKVEIDPVTKFWIKQKPISIDSDLLCACDLAEEKSPSHAIFKLTYLSNHDYKHLYFESDAATVNEIVLKVNYILESRA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Target of rapamycin complex 2 subunit MAPKAP1
publication title Structures of the pleckstrin homology domain of Saccharomyces cerevisiae Avo1 and its human orthologue Sin1, an essential subunit of TOR complex 2
pubmed doi rcsb
source organism Homo sapiens
molecule tags Membrane protein
total genus 28
structure length 116
sequence length 122
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-01-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16979 SIN1_PH SAPK-interacting protein 1 (Sin1), Pleckstrin-homology
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 3voqA00
3SV1A 1SGHA 1UPRA 2J0KA 3ODOA 4HDOA 1P5TA 3KSYA 4MK0A 4B6HA 3FSSA 2XQNM 4NY0A 2GJYA 1EVHA 4GPTB 2MKRA 3ODWA 2X18A 3KZ1A 1NI2A 2W2XD 4GZUA 3QWMA 3PVLA 4CYEA 1W1GA 1DYNA 2RSGA 4TKNA 1U5EA 1MIXA 1X05A 2K2UA 3KRXA 4HATB 3PG7A 3AU4A 1EGXA 1MKEA 1LW3A 2LULA 1OMWA 1QQGA 4K2OA 1ZSQA 1J0WA 5GOWB 3GYOA 4HAUB 5C79A 3BINA 4HAWB 4CHMA 1RRPB 2H7EA 2I5FA 1PMSA 4K81A 1XODA 5CLLB 5DHFB 1MPHA 5FI0A 1BAKA 4ZRIA 2J0MA 3F5RA 1Q67A 3RCPA 1H10A 4CHJA 2COCA 2P8VA 4YL8A 4EKUA 2I5CA 4GXBA 2DKPA 4YONA 4IFSA 2UZSA 4XWXA 3N7CA 5FI1A 1IRSA 4WVFB 2MFQA 2DHKA 1Y5OA 1GC7A 3U7DA 1N3HA 4IAPA 1AQCA 1TJ6A 1BTKA 1K5GB 4GMXB 5D27A 1UNRA 2CY4A 3F0WA 2YF0A 4D0NB 2GS0A 3A98B 2Z0QA 2E2XA 2YT1A 1V61A 2Z0OA 3FM8C 2I1KA 5JLJB 1FOEA 4MT7A 2RVBB 4HB4B 1W1HA 1K5DB 2W2WA 3D8DA 4PNKA 2YS1A 2DA0A 4IOYX 3DXDA 3DXEA 1ISNA 1V5MA 3P6AA 4A5KA 3TCAA 2YS5A 3HK0A 2GCLA 1SHCA 4HAZB 5HE3A 1B55A 4HDQA 4A6FA 1FHWA 4WJ7A 5C5BA 2P0DA 2HE7A 2DN6A 2Z0PA 2N23A 1XX0A 3NSUA 4L6EA 1XR0B 1V5PA 2MWNB 3HQCA 2KGXB 1X11A 5DHAB 2OTXA 4WSFA 1M7RA 2KUPA 1FAOA 1J19A 3SYXA 4NSWA 2NZ8B 1V5UA 2G35A 1XCGA 1UNQA 3VIAA 3ML4A 4MY6A 1TQZA 1WJ1A 2W2XC 1ZVRA 3IVFA 1WGQA 2D4QA 2NMBA 2D9VA 1DDVA 2H7DA 3P7ZA 5DI9B 4H8SA 1X1GA 3MDBC 5KCVA 1WG7A 3A8QA 2P0FA 2K00A 1X1FA 4EJNA 4Y94A 5C16A 1EF1A 2ADZA 1WJMA 1XD4A 2R0DA 3HW2B 5EFXA 3QIJA 1E5WA 2D2QA 3PZDA 2D10A 1FHXA 4HB0B 2ROZB 2AL6A 4A6FB 2DHIA 5C5BB 2MDXA 2LG1A 2DTCA 2FJLA 3U8ZA 1AWEA 4Z2MB 4Z2NA 5JHGA 2UVMA 2P0HA 1DDMA 3AU5A 1I2HA 1I7AA 2UZRA 1LB1A 3OANA 2EMSA 3A8PA 3TO1A 3SUZA 3PVUA 3G9WA 3D8EA 2YVCA 1FHOA 1UPQA 4C0AA 3FEHA 2DFKA 5JHHA 1NU2A 1TXDA 1PFJA 3X23A 4TYZA 2VRWB 1MIZB 3CIKA 4F7UP 1EAZA 2L1CA 1X86A 1DDWA 1ZC4B 1V88A 2QKLA 3ZVRA 5DIFB 5C6RA 5J3TA 3QBVB 5D3WA 5J3QA 2KCJA 2YT0A 1KI1B 1UNPA 2IFSA 2VSZA 5D3YA 4K2PA 2N0YA 2LKOA 3ODXA 1KZGA 5LONB 2DLWA 1U29A 4KHBB 1MAIA 2DKQA 3DXCA 3M1IB 2I1JA 2LYDA 3WA0A 2RGNB 2LOXA 4DX8A 1UEFA 1V89A 3KY9A 3WYFB 1KZ7A 2LOZA 4DBBA 1QC6A 2ELAA 5HE1A 4HAXB 2D9ZA 1U5FA 1WGUA 4ZRKA 2J59M 3SO6A 5D3VA 2DX5A 5JP4A 3VOQA 3CXBB 4BBKA 1DBHA 3AJ4A 2IYBA 1H4RA 2COAA 4HB3B 3PEGA 1W1DA 4KAXB 2YSZA 2CODA 4DXAB 2CY5A 3O96A 3D8FA 2RLOA 2RUKB 4GN1A 1GG3A 2CRFA 1DROA 3ULBA 1BWNA 4A6HA 2K2JA 3ZDTA 3PSCA 2ELBA 2QKMA 1NTVA 1XKEA 4HB2B 3UZTA 2L2IA 2HTHB 5LOPB 1FGYA 3LJUX 1Z87A 3KRWA 2BCJA 2EC1A 2R09A 2D9YA 1MK7B 1ZM0A 4EMOA 4KHAA 3ULCA 2COFA 2D11A 3T06A 1U2BA 4PQ0A 2V76A 4GMVA 5D3XA 2EMTA 2PZ1A 4K17A 4F7HA 2RNRB 3SNHA 2Y8GA 3TFMA 1U5GA 2DX1A 3BJIA 1GC6A 2DHJA 4DX90 2Q13A 2AEHA 2GCJA 3TVVA 1OY2A 3V5WA 1PLSA 4HAYB 1P6SA 1WI1A 4A6KA 4KVGB 2DYQA 4HHVA 1U27A 1FGZA 2D9WA 4HAVB 4F7GA 1BTNA 3PP2A 5L81A 5KQ4A 3TW1A 5HE2A 1Y19B 2OQBA 3GYPA 1P3RA 4P7IA 1NTYA 2EJ8A 2D9XA 5DH9B 5CLQB 2ZPYA 1MK9B 2ROVA 5J3YA 2YRYA 1ZC3B 1FB8A 2VKIA 2JP2A 2M38A 3MPXA 2Y8FA 1M7EA 1U5DA 4KHOA 2DYNA 2YS3A 1WVHA 2M14A 3PVWA 4ZRJA 5KQ1A 2CAYA 1OQNA 1RJ2A 2Y7BA 5HE0A 2J0JA
chains in the Genus database with same CATH superfamily
3SV1A 1SGHA 1UPRA 2J0KA 3ODOA 4HDOA 1P5TA 3KSYA 4MK0A 4B6HA 3FSSA 2XQNM 4NY0A 2GJYA 1EVHA 4GPTB 2MKRA 3ODWA 2X18A 3KZ1A 1NI2A 2W2XD 4GZUA 3QWMA 3PVLA 4OSNA 4CYEA 1W1GA 1DYNA 2RSGA 4TKNA 1U5EA 4GOUA 1MIXA 1X05A 2K2UA 3KRXA 4HATB 3PG7A 3AU4A 1EGXA 1MKEA 1LW3A 2LULA 1OMWA 3NWAA 1QQGA 4K2OA 1ZSQA 1J0WA 5GOWB 3GYOA 4HAUB 5C79A 3BINA 4HAWB 2KUQA 4CHMA 2Z13A 1RRPB 2H7EA 2I5FA 1PMSA 4K81A 4QJ3B 1XODA 5CLLB 5DHFB 1MPHA 5FI0A 1BAKA 4ZRIA 2J0MA 3F5RA 1Q67A 3RCPA 1H10A 4CHJA 2COCA 2P8VA 4YL8A 4EKUA 2I5CA 4GXBA 2DKPA 4YONA 4IFSA 2UZSA 4XWXA 3N7CA 5FI1A 1IRSA 4WVFB 2MFQA 2DHKA 1Y5OA 1GC7A 3U7DA 1N3HA 4IAPA 1AQCA 1TJ6A 1BTKA 1K5GB 4GMXB 5D27A 1UNRA 2CY4A 3F0WA 2YF0A 4D0NB 2GS0A 3A98B 2Z0QA 2E2XA 2YT1A 1V61A 2Z0OA 3FM8C 2I1KA 5JLJB 1FOEA 4MT7A 2KIEA 2RVBB 4HB4B 1W1HA 1K5DB 2W2WA 3D8DA 4PNKA 2YS1A 2DA0A 4IOYX 3DXDA 4HSIA 4OT1A 2KIGA 3DXEA 1ISNA 1V5MA 3P6AA 2Z14A 4A5KA 3TCAA 2YS5A 3HK0A 2GCLA 3NW8A 1SHCA 4HAZB 5HE3A 1B55A 4HDQA 4L1RA 1ZYIA 5M4YB 2KR0A 4A6FA 1FHWA 4WJ7A 5C5BA 2P0DA 2HE7A 2DN6A 2Z0PA 2N23A 1XX0A 3NSUA 4L6EA 1XR0B 1V5PA 2MWNB 3HQCA 3A58A 2KGXB 1X11A 5DHAB 2OTXA 4WSFA 1M7RA 2KUPA 1FAOA 1J19A 3SYXA 4NSWA 4QJ4B 2NZ8B 1V5UA 2G35A 1XCGA 1UNQA 2Z59A 3VIAA 3ML4A 2K49A 3NWFA 4MY6A 1TQZA 1WJ1A 2W2XC 3NWDA 1ZVRA 3B77A 3IVFA 1WGQA 2D4QA 2NMBA 2D9VA 1DDVA 2H7DA 3P7ZA 4GNKB 5DI9B 4H8SA 1X1GA 2YT2A 3MDBC 5KCVA 1WG7A 3A8QA 5I2MA 2P0FA 2K00A 1X1FA 4EJNA 4Y94A 5C16A 1EF1A 2ADZA 1WJMA 1XD4A 2R0DA 3HW2B 5EFXA 3HSAA 3QIJA 1E5WA 2D2QA 3PZDA 2D10A 1FHXA 4HB0B 2ROZB 2AL6A 4A6FB 2DHIA 5C5BB 2MDXA 2LG1A 2DTCA 2FJLA 3U8ZA 1AWEA 4Z2MB 4Z2NA 5JHGA 2UVMA 2P0HA 1DDMA 3AU5A 1I2HA 1I7AA 2UZRA 1LB1A 3OANA 2EMSA 3A8PA 3TO1A 3SUZA 2K8EA 2ZKMX 3HIEA 3PVUA 1MI1A 3G9WA 3D8EA 2YVCA 1FHOA 1UPQA 4C0AA 3FEHA 2DFKA 4QXAB 5JHHA 1NU2A 1TXDA 2Z4DA 1PFJA 3X23A 4TYZA 2VRWB 1MIZB 3CIKA 4F7UP 1EAZA 2L1CA 1X86A 1DDWA 1ZC4B 1V88A 2QKLA 3ZVRA 5DIFB 5C6RA 5J3TA 3QBVB 5D3WA 5J3QA 2KCJA 2YT0A 1KI1B 1UNPA 2IFSA 2VSZA 5D3YA 4K2PA 2N0YA 2LKOA 3ODXA 1KZGA 3OHMB 5LONB 5IRSA 2DLWA 1U29A 4KHBB 1MAIA 2DKQA 3DXCA 3M1IB 2I1JA 2LYDA 3WA0A 2RGNB 2LOXA 4DX8A 1UEFA 1V89A 3KY9A 4DIXA 3WYFB 1KZ7A 2LOZA 4DBBA 1QC6A 2ELAA 5HE1A 4HAXB 2D9ZA 1U5FA 1WGUA 4ZRKA 2J59M 3SO6A 1T77A 5D3VA 2DX5A 2NBVA 5JP4A 3VOQA 3DCXA 4D6WA 3CXBB 4BBKA 1DBHA 3AJ4A 2IYBA 1H4RA 2COAA 4HB3B 3PEGA 1W1DA 4KAXB 2RRFA 2R2YA 2YSZA 2CODA 4DXAB 2CY5A 4KHBA 3O96A 3D8FA 2RLOA 2RUKB 4GN1A 1GG3A 2CRFA 1DROA 3ULBA 1BWNA 4A6HA 2K2JA 3ZDTA 3PSCA 2ELBA 2QKMA 1NTVA 1XKEA 4HB2B 3UZTA 2L2IA 2HTHB 5LOPB 1FGYA 3LJUX 1Z87A 3KRWA 2BCJA 2EC1A 2R09A 2D9YA 1MK7B 1ZM0A 4EMOA 4KHAA 3ULCA 2COFA 2D11A 3T06A 1U2BA 4PQ0A 2V76A 4GMVA 5D3XA 2EMTA 2PZ1A 4QJ5B 4K17A 4F7HA 2RNRB 3SNHA 2Y8GA 3TFMA 1U5GA 2DX1A 3BJIA 1GC6A 2DHJA 4DX90 2Q13A 2AEHA 2GCJA 3TVVA 1OY2A 3V5WA 1PLSA 4HAYB 1P6SA 3U12A 1WI1A 4A6KA 4KVGB 2DYQA 2GUMA 4HHVA 1U27A 1FGZA 2D9WA 4CSQA 4HAVB 4F7GA 1BTNA 3PP2A 5L81A 5KQ4A 3TW1A 2FJUB 5HE2A 1Y19B 2OQBA 3GYPA 1P3RA 4P7IA 1NTYA 2EJ8A 2D9XA 5DH9B 5CLQB 2ZPYA 1MK9B 2ROVA 5J3YA 2YRYA 1ZC3B 1FB8A 3FVCA 2VKIA 2JP2A 2M38A 3MPXA 2Y8FA 1M7EA 1U5DA 4KHOA 2DYNA 2YS3A 5I2SA 5LG4B 1WVHA 2M14A 3PVWA 4ZRJA 5KQ1A 2CAYA 1OQNA 1RJ2A 2Y7BA 5HE0A 2J0JA
chains in the Genus database with same CATH topology
3SV1A 1SGHA 1UPRA 2J0KA 3ODOA 4HDOA 1P5TA 3KSYA 4MK0A 4B6HA 3FSSA 2XQNM 4NY0A 2GJYA 1EVHA 4GPTB 2MKRA 3ODWA 2X18A 3KZ1A 1NI2A 2W2XD 4GZUA 3QWMA 3PVLA 4CYEA 1W1GA 1DYNA 2RSGA 4TKNA 1U5EA 1MIXA 1X05A 2K2UA 3KRXA 4HATB 3PG7A 3AU4A 1EGXA 1MKEA 1LW3A 2LULA 1OMWA 1QQGA 4K2OA 1ZSQA 1J0WA 5GOWB 3GYOA 4HAUB 5C79A 3BINA 4HAWB 4CHMA 1RRPB 2H7EA 2I5FA 1PMSA 4K81A 1XODA 5CLLB 5DHFB 1MPHA 5FI0A 1BAKA 4ZRIA 2J0MA 3F5RA 1Q67A 3RCPA 1H10A 4CHJA 2COCA 2P8VA 4YL8A 4EKUA 2I5CA 4GXBA 2DKPA 4YONA 4IFSA 2UZSA 4XWXA 3N7CA 5FI1A 1IRSA 4WVFB 2MFQA 2DHKA 1Y5OA 1GC7A 3U7DA 1N3HA 4IAPA 1AQCA 1TJ6A 1BTKA 1K5GB 4GMXB 5D27A 1UNRA 2CY4A 3F0WA 2YF0A 4D0NB 2GS0A 3A98B 2Z0QA 2E2XA 2YT1A 1V61A 2Z0OA 3FM8C 2I1KA 5JLJB 1FOEA 4MT7A 2RVBB 4HB4B 1W1HA 1K5DB 2W2WA 3D8DA 4PNKA 2YS1A 2DA0A 4IOYX 3DXDA 3DXEA 1ISNA 1V5MA 3P6AA 4A5KA 3TCAA 2YS5A 3HK0A 2GCLA 1SHCA 4HAZB 5HE3A 1B55A 4HDQA 4A6FA 1FHWA 4WJ7A 5C5BA 2P0DA 2HE7A 2DN6A 2Z0PA 2N23A 1XX0A 3NSUA 4L6EA 1XR0B 1V5PA 2MWNB 3HQCA 2KGXB 1X11A 5DHAB 2OTXA 4WSFA 1M7RA 2KUPA 1FAOA 1J19A 3SYXA 4NSWA 2NZ8B 1V5UA 2G35A 1XCGA 1UNQA 3VIAA 3ML4A 4MY6A 1TQZA 1WJ1A 2W2XC 1ZVRA 3IVFA 1WGQA 2D4QA 2NMBA 2D9VA 1DDVA 2H7DA 3P7ZA 5DI9B 4H8SA 1X1GA 3MDBC 5KCVA 1WG7A 3A8QA 2P0FA 2K00A 1X1FA 4EJNA 4Y94A 5C16A 1EF1A 2ADZA 1WJMA 1XD4A 2R0DA 3HW2B 5EFXA 3QIJA 1E5WA 2D2QA 3PZDA 2D10A 1FHXA 4HB0B 2ROZB 2AL6A 4A6FB 2DHIA 5C5BB 2MDXA 2LG1A 2DTCA 2FJLA 3U8ZA 1AWEA 4Z2MB 4Z2NA 5JHGA 2UVMA 2P0HA 1DDMA 3AU5A 1I2HA 1I7AA 2UZRA 1LB1A 3OANA 2EMSA 3A8PA 3TO1A 3SUZA 3PVUA 3G9WA 3D8EA 2YVCA 1FHOA 1UPQA 4C0AA 3FEHA 2DFKA 5JHHA 1NU2A 1TXDA 1PFJA 3X23A 4TYZA 2VRWB 1MIZB 3CIKA 4F7UP 1EAZA 2L1CA 1X86A 1DDWA 1ZC4B 1V88A 2QKLA 3ZVRA 5DIFB 5C6RA 5J3TA 3QBVB 5D3WA 5J3QA 2KCJA 2YT0A 1KI1B 1UNPA 2IFSA 2VSZA 5D3YA 4K2PA 2N0YA 2LKOA 3ODXA 1KZGA 5LONB 2DLWA 1U29A 4KHBB 1MAIA 2DKQA 3DXCA 3M1IB 2I1JA 2LYDA 3WA0A 2RGNB 2LOXA 4DX8A 1UEFA 1V89A 3KY9A 3WYFB 1KZ7A 2LOZA 4DBBA 1QC6A 2ELAA 5HE1A 4HAXB 2D9ZA 1U5FA 1WGUA 4ZRKA 2J59M 3SO6A 5D3VA 2DX5A 5JP4A 3VOQA 3CXBB 4BBKA 1DBHA 3AJ4A 2IYBA 1H4RA 2COAA 4HB3B 3PEGA 1W1DA 4KAXB 2YSZA 2CODA 4DXAB 2CY5A 3O96A 3D8FA 2RLOA 2RUKB 4GN1A 1GG3A 2CRFA 1DROA 3ULBA 1BWNA 4A6HA 2K2JA 3ZDTA 3PSCA 2ELBA 2QKMA 1NTVA 1XKEA 4HB2B 3UZTA 2L2IA 2HTHB 5LOPB 1FGYA 3LJUX 1Z87A 3KRWA 2BCJA 2EC1A 2R09A 2D9YA 1MK7B 1ZM0A 4EMOA 4KHAA 3ULCA 2COFA 2D11A 3T06A 1U2BA 4PQ0A 2V76A 4GMVA 5D3XA 2EMTA 2PZ1A 4K17A 4F7HA 2RNRB 3SNHA 2Y8GA 3TFMA 1U5GA 2DX1A 3BJIA 1GC6A 2DHJA 4DX90 2Q13A 2AEHA 2GCJA 3TVVA 1OY2A 3V5WA 1PLSA 4HAYB 1P6SA 1WI1A 4A6KA 4KVGB 2DYQA 4HHVA 1U27A 1FGZA 2D9WA 4HAVB 4F7GA 1BTNA 3PP2A 5L81A 5KQ4A 3TW1A 5HE2A 1Y19B 2OQBA 3GYPA 1P3RA 4P7IA 1NTYA 2EJ8A 2D9XA 5DH9B 5CLQB 2ZPYA 1MK9B 2ROVA 5J3YA 2YRYA 1ZC3B 1FB8A 2VKIA 2JP2A 2M38A 3MPXA 2Y8FA 1M7EA 1U5DA 4KHOA 2DYNA 2YS3A 1WVHA 2M14A 3PVWA 4ZRJA 5KQ1A 2CAYA 1OQNA 1RJ2A 2Y7BA 5HE0A 2J0JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SV1 A;  1SGH A;  1UPR A;  2J0K A;  3ODO A;  4HDO A;  1P5T A;  3KSY A;  4MK0 A;  4B6H A;  3FSS A;  2XQN M;  4NY0 A;  2GJY A;  1EVH A;  4GPT B;  2MKR A;  3ODW A;  2X18 A;  3KZ1 A;  1NI2 A;  2W2X D;  4GZU A;  3QWM A;  3PVL A;  4CYE A;  1W1G A;  1DYN A;  2RSG A;  4TKN A;  1U5E A;  1MIX A;  1X05 A;  2K2U A;  3KRX A;  4HAT B;  3PG7 A;  3AU4 A;  1EGX A;  1MKE A;  1LW3 A;  2LUL A;  1OMW A;  1QQG A;  4K2O A;  1ZSQ A;  1J0W A;  5GOW B;  3GYO A;  4HAU B;  5C79 A;  3BIN A;  4HAW B;  4CHM A;  1RRP B;  2H7E A;  2I5F A;  1PMS A;  4K81 A;  1XOD A;  5CLL B;  5DHF B;  1MPH A;  5FI0 A;  1BAK A;  4ZRI A;  2J0M A;  3F5R A;  1Q67 A;  3RCP A;  1H10 A;  4CHJ A;  2COC A;  2P8V A;  4YL8 A;  4EKU A;  2I5C A;  4GXB A;  2DKP A;  4YON A;  4IFS A;  2UZS A;  4XWX A;  3N7C A;  5FI1 A;  1IRS A;  4WVF B;  2MFQ A;  2DHK A;  1Y5O A;  1GC7 A;  3U7D A;  1N3H A;  4IAP A;  1AQC A;  1TJ6 A;  1BTK A;  1K5G B;  4GMX B;  5D27 A;  1UNR A;  2CY4 A;  3F0W A;  2YF0 A;  4D0N B;  2GS0 A;  3A98 B;  2Z0Q A;  2E2X A;  2YT1 A;  1V61 A;  2Z0O A;  3FM8 C;  2I1K A;  5JLJ B;  1FOE A;  4MT7 A;  2RVB B;  4HB4 B;  1W1H A;  1K5D B;  2W2W A;  3D8D A;  4PNK A;  2YS1 A;  2DA0 A;  4IOY X;  3DXD A;  3DXE A;  1ISN A;  1V5M A;  3P6A A;  4A5K A;  3TCA A;  2YS5 A;  3HK0 A;  2GCL A;  1SHC A;  4HAZ B;  5HE3 A;  1B55 A;  4HDQ A;  4A6F A;  1FHW A;  4WJ7 A;  5C5B A;  2P0D A;  2HE7 A;  2DN6 A;  2Z0P A;  2N23 A;  1XX0 A;  3NSU A;  4L6E A;  1XR0 B;  1V5P A;  2MWN B;  3HQC A;  2KGX B;  1X11 A;  5DHA B;  2OTX A;  4WSF A;  1M7R A;  2KUP A;  1FAO A;  1J19 A;  3SYX A;  4NSW A;  2NZ8 B;  1V5U A;  2G35 A;  1XCG A;  1UNQ A;  3VIA A;  3ML4 A;  4MY6 A;  1TQZ A;  1WJ1 A;  2W2X C;  1ZVR A;  3IVF A;  1WGQ A;  2D4Q A;  2NMB A;  2D9V A;  1DDV A;  2H7D A;  3P7Z A;  5DI9 B;  4H8S A;  1X1G A;  3MDB C;  5KCV A;  1WG7 A;  3A8Q A;  2P0F A;  2K00 A;  1X1F A;  4EJN A;  4Y94 A;  5C16 A;  1EF1 A;  2ADZ A;  1WJM A;  1XD4 A;  2R0D A;  3HW2 B;  5EFX A;  3QIJ A;  1E5W A;  2D2Q A;  3PZD A;  2D10 A;  1FHX A;  4HB0 B;  2ROZ B;  2AL6 A;  4A6F B;  2DHI A;  5C5B B;  2MDX A;  2LG1 A;  2DTC A;  2FJL A;  3U8Z A;  1AWE A;  4Z2M B;  4Z2N A;  5JHG A;  2UVM A;  2P0H A;  1DDM A;  3AU5 A;  1I2H A;  1I7A A;  2UZR A;  1LB1 A;  3OAN A;  2EMS A;  3A8P A;  3TO1 A;  3SUZ A;  3PVU A;  3G9W A;  3D8E A;  2YVC A;  1FHO A;  1UPQ A;  4C0A A;  3FEH A;  2DFK A;  5JHH A;  1NU2 A;  1TXD A;  1PFJ A;  3X23 A;  4TYZ A;  2VRW B;  1MIZ B;  3CIK A;  4F7U P;  1EAZ A;  2L1C A;  1X86 A;  1DDW A;  1ZC4 B;  1V88 A;  2QKL A;  3ZVR A;  5DIF B;  5C6R A;  5J3T A;  3QBV B;  5D3W A;  5J3Q A;  2KCJ A;  2YT0 A;  1KI1 B;  1UNP A;  2IFS A;  2VSZ A;  5D3Y A;  4K2P A;  2N0Y A;  2LKO A;  3ODX A;  1KZG A;  5LON B;  2DLW A;  1U29 A;  4KHB B;  1MAI A;  2DKQ A;  3DXC A;  3M1I B;  2I1J A;  2LYD A;  3WA0 A;  2RGN B;  2LOX A;  4DX8 A;  1UEF A;  1V89 A;  3KY9 A;  3WYF B;  1KZ7 A;  2LOZ A;  4DBB A;  1QC6 A;  2ELA A;  5HE1 A;  4HAX B;  2D9Z A;  1U5F A;  1WGU A;  4ZRK A;  2J59 M;  3SO6 A;  5D3V A;  2DX5 A;  5JP4 A;  3VOQ A;  3CXB B;  4BBK A;  1DBH A;  3AJ4 A;  2IYB A;  1H4R A;  2COA A;  4HB3 B;  3PEG A;  1W1D A;  4KAX B;  2YSZ A;  2COD A;  4DXA B;  2CY5 A;  3O96 A;  3D8F A;  2RLO A;  2RUK B;  4GN1 A;  1GG3 A;  2CRF A;  1DRO A;  3ULB A;  1BWN A;  4A6H A;  2K2J A;  3ZDT A;  3PSC A;  2ELB A;  2QKM A;  1NTV A;  1XKE A;  4HB2 B;  3UZT A;  2L2I A;  2HTH B;  5LOP B;  1FGY A;  3LJU X;  1Z87 A;  3KRW A;  2BCJ A;  2EC1 A;  2R09 A;  2D9Y A;  1MK7 B;  1ZM0 A;  4EMO A;  4KHA A;  3ULC A;  2COF A;  2D11 A;  3T06 A;  1U2B A;  4PQ0 A;  2V76 A;  4GMV A;  5D3X A;  2EMT A;  2PZ1 A;  4K17 A;  4F7H A;  2RNR B;  3SNH A;  2Y8G A;  3TFM A;  1U5G A;  2DX1 A;  3BJI A;  1GC6 A;  2DHJ A;  4DX9 0;  2Q13 A;  2AEH A;  2GCJ A;  3TVV A;  1OY2 A;  3V5W A;  1PLS A;  4HAY B;  1P6S A;  1WI1 A;  4A6K A;  4KVG B;  2DYQ A;  4HHV A;  1U27 A;  1FGZ A;  2D9W A;  4HAV B;  4F7G A;  1BTN A;  3PP2 A;  5L81 A;  5KQ4 A;  3TW1 A;  5HE2 A;  1Y19 B;  2OQB A;  3GYP A;  1P3R A;  4P7I A;  1NTY A;  2EJ8 A;  2D9X A;  5DH9 B;  5CLQ B;  2ZPY A;  1MK9 B;  2ROV A;  5J3Y A;  2YRY A;  1ZC3 B;  1FB8 A;  2VKI A;  2JP2 A;  2M38 A;  3MPX A;  2Y8F A;  1M7E A;  1U5D A;  4KHO A;  2DYN A;  2YS3 A;  1WVH A;  2M14 A;  3PVW A;  4ZRJ A;  5KQ1 A;  2CAY A;  1OQN A;  1RJ2 A;  2Y7B A;  5HE0 A;  2J0J A; 
#chains in the Genus database with same CATH topology
 3SV1 A;  1SGH A;  1UPR A;  2J0K A;  3ODO A;  4HDO A;  1P5T A;  3KSY A;  4MK0 A;  4B6H A;  3FSS A;  2XQN M;  4NY0 A;  2GJY A;  1EVH A;  4GPT B;  2MKR A;  3ODW A;  2X18 A;  3KZ1 A;  1NI2 A;  2W2X D;  4GZU A;  3QWM A;  3PVL A;  4OSN A;  4CYE A;  1W1G A;  1DYN A;  2RSG A;  4TKN A;  1U5E A;  4GOU A;  1MIX A;  1X05 A;  2K2U A;  3KRX A;  4HAT B;  3PG7 A;  3AU4 A;  1EGX A;  1MKE A;  1LW3 A;  2LUL A;  1OMW A;  3NWA A;  1QQG A;  4K2O A;  1ZSQ A;  1J0W A;  5GOW B;  3GYO A;  4HAU B;  5C79 A;  3BIN A;  4HAW B;  2KUQ A;  4CHM A;  2Z13 A;  1RRP B;  2H7E A;  2I5F A;  1PMS A;  4K81 A;  4QJ3 B;  1XOD A;  5CLL B;  5DHF B;  1MPH A;  5FI0 A;  1BAK A;  4ZRI A;  2J0M A;  3F5R A;  1Q67 A;  3RCP A;  1H10 A;  4CHJ A;  2COC A;  2P8V A;  4YL8 A;  4EKU A;  2I5C A;  4GXB A;  2DKP A;  4YON A;  4IFS A;  2UZS A;  4XWX A;  3N7C A;  5FI1 A;  1IRS A;  4WVF B;  2MFQ A;  2DHK A;  1Y5O A;  1GC7 A;  3U7D A;  1N3H A;  4IAP A;  1AQC A;  1TJ6 A;  1BTK A;  1K5G B;  4GMX B;  5D27 A;  1UNR A;  2CY4 A;  3F0W A;  2YF0 A;  4D0N B;  2GS0 A;  3A98 B;  2Z0Q A;  2E2X A;  2YT1 A;  1V61 A;  2Z0O A;  3FM8 C;  2I1K A;  5JLJ B;  1FOE A;  4MT7 A;  2KIE A;  2RVB B;  4HB4 B;  1W1H A;  1K5D B;  2W2W A;  3D8D A;  4PNK A;  2YS1 A;  2DA0 A;  4IOY X;  3DXD A;  4HSI A;  4OT1 A;  2KIG A;  3DXE A;  1ISN A;  1V5M A;  3P6A A;  2Z14 A;  4A5K A;  3TCA A;  2YS5 A;  3HK0 A;  2GCL A;  3NW8 A;  1SHC A;  4HAZ B;  5HE3 A;  1B55 A;  4HDQ A;  4L1R A;  1ZYI A;  5M4Y B;  2KR0 A;  4A6F A;  1FHW A;  4WJ7 A;  5C5B A;  2P0D A;  2HE7 A;  2DN6 A;  2Z0P A;  2N23 A;  1XX0 A;  3NSU A;  4L6E A;  1XR0 B;  1V5P A;  2MWN B;  3HQC A;  3A58 A;  2KGX B;  1X11 A;  5DHA B;  2OTX A;  4WSF A;  1M7R A;  2KUP A;  1FAO A;  1J19 A;  3SYX A;  4NSW A;  4QJ4 B;  2NZ8 B;  1V5U A;  2G35 A;  1XCG A;  1UNQ A;  2Z59 A;  3VIA A;  3ML4 A;  2K49 A;  3NWF A;  4MY6 A;  1TQZ A;  1WJ1 A;  2W2X C;  3NWD A;  1ZVR A;  3B77 A;  3IVF A;  1WGQ A;  2D4Q A;  2NMB A;  2D9V A;  1DDV A;  2H7D A;  3P7Z A;  4GNK B;  5DI9 B;  4H8S A;  1X1G A;  2YT2 A;  3MDB C;  5KCV A;  1WG7 A;  3A8Q A;  5I2M A;  2P0F A;  2K00 A;  1X1F A;  4EJN A;  4Y94 A;  5C16 A;  1EF1 A;  2ADZ A;  1WJM A;  1XD4 A;  2R0D A;  3HW2 B;  5EFX A;  3HSA A;  3QIJ A;  1E5W A;  2D2Q A;  3PZD A;  2D10 A;  1FHX A;  4HB0 B;  2ROZ B;  2AL6 A;  4A6F B;  2DHI A;  5C5B B;  2MDX A;  2LG1 A;  2DTC A;  2FJL A;  3U8Z A;  1AWE A;  4Z2M B;  4Z2N A;  5JHG A;  2UVM A;  2P0H A;  1DDM A;  3AU5 A;  1I2H A;  1I7A A;  2UZR A;  1LB1 A;  3OAN A;  2EMS A;  3A8P A;  3TO1 A;  3SUZ A;  2K8E A;  2ZKM X;  3HIE A;  3PVU A;  1MI1 A;  3G9W A;  3D8E A;  2YVC A;  1FHO A;  1UPQ A;  4C0A A;  3FEH A;  2DFK A;  4QXA B;  5JHH A;  1NU2 A;  1TXD A;  2Z4D A;  1PFJ A;  3X23 A;  4TYZ A;  2VRW B;  1MIZ B;  3CIK A;  4F7U P;  1EAZ A;  2L1C A;  1X86 A;  1DDW A;  1ZC4 B;  1V88 A;  2QKL A;  3ZVR A;  5DIF B;  5C6R A;  5J3T A;  3QBV B;  5D3W A;  5J3Q A;  2KCJ A;  2YT0 A;  1KI1 B;  1UNP A;  2IFS A;  2VSZ A;  5D3Y A;  4K2P A;  2N0Y A;  2LKO A;  3ODX A;  1KZG A;  3OHM B;  5LON B;  5IRS A;  2DLW A;  1U29 A;  4KHB B;  1MAI A;  2DKQ A;  3DXC A;  3M1I B;  2I1J A;  2LYD A;  3WA0 A;  2RGN B;  2LOX A;  4DX8 A;  1UEF A;  1V89 A;  3KY9 A;  4DIX A;  3WYF B;  1KZ7 A;  2LOZ A;  4DBB A;  1QC6 A;  2ELA A;  5HE1 A;  4HAX B;  2D9Z A;  1U5F A;  1WGU A;  4ZRK A;  2J59 M;  3SO6 A;  1T77 A;  5D3V A;  2DX5 A;  2NBV A;  5JP4 A;  3VOQ A;  3DCX A;  4D6W A;  3CXB B;  4BBK A;  1DBH A;  3AJ4 A;  2IYB A;  1H4R A;  2COA A;  4HB3 B;  3PEG A;  1W1D A;  4KAX B;  2RRF A;  2R2Y A;  2YSZ A;  2COD A;  4DXA B;  2CY5 A;  4KHB A;  3O96 A;  3D8F A;  2RLO A;  2RUK B;  4GN1 A;  1GG3 A;  2CRF A;  1DRO A;  3ULB A;  1BWN A;  4A6H A;  2K2J A;  3ZDT A;  3PSC A;  2ELB A;  2QKM A;  1NTV A;  1XKE A;  4HB2 B;  3UZT A;  2L2I A;  2HTH B;  5LOP B;  1FGY A;  3LJU X;  1Z87 A;  3KRW A;  2BCJ A;  2EC1 A;  2R09 A;  2D9Y A;  1MK7 B;  1ZM0 A;  4EMO A;  4KHA A;  3ULC A;  2COF A;  2D11 A;  3T06 A;  1U2B A;  4PQ0 A;  2V76 A;  4GMV A;  5D3X A;  2EMT A;  2PZ1 A;  4QJ5 B;  4K17 A;  4F7H A;  2RNR B;  3SNH A;  2Y8G A;  3TFM A;  1U5G A;  2DX1 A;  3BJI A;  1GC6 A;  2DHJ A;  4DX9 0;  2Q13 A;  2AEH A;  2GCJ A;  3TVV A;  1OY2 A;  3V5W A;  1PLS A;  4HAY B;  1P6S A;  3U12 A;  1WI1 A;  4A6K A;  4KVG B;  2DYQ A;  2GUM A;  4HHV A;  1U27 A;  1FGZ A;  2D9W A;  4CSQ A;  4HAV B;  4F7G A;  1BTN A;  3PP2 A;  5L81 A;  5KQ4 A;  3TW1 A;  2FJU B;  5HE2 A;  1Y19 B;  2OQB A;  3GYP A;  1P3R A;  4P7I A;  1NTY A;  2EJ8 A;  2D9X A;  5DH9 B;  5CLQ B;  2ZPY A;  1MK9 B;  2ROV A;  5J3Y A;  2YRY A;  1ZC3 B;  1FB8 A;  3FVC A;  2VKI A;  2JP2 A;  2M38 A;  3MPX A;  2Y8F A;  1M7E A;  1U5D A;  4KHO A;  2DYN A;  2YS3 A;  5I2S A;  5LG4 B;  1WVH A;  2M14 A;  3PVW A;  4ZRJ A;  5KQ1 A;  2CAY A;  1OQN A;  1RJ2 A;  2Y7B A;  5HE0 A;  2J0J A; 
#chains in the Genus database with same CATH homology
 3SV1 A;  1SGH A;  1UPR A;  2J0K A;  3ODO A;  4HDO A;  1P5T A;  3KSY A;  4MK0 A;  4B6H A;  3FSS A;  2XQN M;  4NY0 A;  2GJY A;  1EVH A;  4GPT B;  2MKR A;  3ODW A;  2X18 A;  3KZ1 A;  1NI2 A;  2W2X D;  4GZU A;  3QWM A;  3PVL A;  4CYE A;  1W1G A;  1DYN A;  2RSG A;  4TKN A;  1U5E A;  1MIX A;  1X05 A;  2K2U A;  3KRX A;  4HAT B;  3PG7 A;  3AU4 A;  1EGX A;  1MKE A;  1LW3 A;  2LUL A;  1OMW A;  1QQG A;  4K2O A;  1ZSQ A;  1J0W A;  5GOW B;  3GYO A;  4HAU B;  5C79 A;  3BIN A;  4HAW B;  4CHM A;  1RRP B;  2H7E A;  2I5F A;  1PMS A;  4K81 A;  1XOD A;  5CLL B;  5DHF B;  1MPH A;  5FI0 A;  1BAK A;  4ZRI A;  2J0M A;  3F5R A;  1Q67 A;  3RCP A;  1H10 A;  4CHJ A;  2COC A;  2P8V A;  4YL8 A;  4EKU A;  2I5C A;  4GXB A;  2DKP A;  4YON A;  4IFS A;  2UZS A;  4XWX A;  3N7C A;  5FI1 A;  1IRS A;  4WVF B;  2MFQ A;  2DHK A;  1Y5O A;  1GC7 A;  3U7D A;  1N3H A;  4IAP A;  1AQC A;  1TJ6 A;  1BTK A;  1K5G B;  4GMX B;  5D27 A;  1UNR A;  2CY4 A;  3F0W A;  2YF0 A;  4D0N B;  2GS0 A;  3A98 B;  2Z0Q A;  2E2X A;  2YT1 A;  1V61 A;  2Z0O A;  3FM8 C;  2I1K A;  5JLJ B;  1FOE A;  4MT7 A;  2RVB B;  4HB4 B;  1W1H A;  1K5D B;  2W2W A;  3D8D A;  4PNK A;  2YS1 A;  2DA0 A;  4IOY X;  3DXD A;  3DXE A;  1ISN A;  1V5M A;  3P6A A;  4A5K A;  3TCA A;  2YS5 A;  3HK0 A;  2GCL A;  1SHC A;  4HAZ B;  5HE3 A;  1B55 A;  4HDQ A;  4A6F A;  1FHW A;  4WJ7 A;  5C5B A;  2P0D A;  2HE7 A;  2DN6 A;  2Z0P A;  2N23 A;  1XX0 A;  3NSU A;  4L6E A;  1XR0 B;  1V5P A;  2MWN B;  3HQC A;  2KGX B;  1X11 A;  5DHA B;  2OTX A;  4WSF A;  1M7R A;  2KUP A;  1FAO A;  1J19 A;  3SYX A;  4NSW A;  2NZ8 B;  1V5U A;  2G35 A;  1XCG A;  1UNQ A;  3VIA A;  3ML4 A;  4MY6 A;  1TQZ A;  1WJ1 A;  2W2X C;  1ZVR A;  3IVF A;  1WGQ A;  2D4Q A;  2NMB A;  2D9V A;  1DDV A;  2H7D A;  3P7Z A;  5DI9 B;  4H8S A;  1X1G A;  3MDB C;  5KCV A;  1WG7 A;  3A8Q A;  2P0F A;  2K00 A;  1X1F A;  4EJN A;  4Y94 A;  5C16 A;  1EF1 A;  2ADZ A;  1WJM A;  1XD4 A;  2R0D A;  3HW2 B;  5EFX A;  3QIJ A;  1E5W A;  2D2Q A;  3PZD A;  2D10 A;  1FHX A;  4HB0 B;  2ROZ B;  2AL6 A;  4A6F B;  2DHI A;  5C5B B;  2MDX A;  2LG1 A;  2DTC A;  2FJL A;  3U8Z A;  1AWE A;  4Z2M B;  4Z2N A;  5JHG A;  2UVM A;  2P0H A;  1DDM A;  3AU5 A;  1I2H A;  1I7A A;  2UZR A;  1LB1 A;  3OAN A;  2EMS A;  3A8P A;  3TO1 A;  3SUZ A;  3PVU A;  3G9W A;  3D8E A;  2YVC A;  1FHO A;  1UPQ A;  4C0A A;  3FEH A;  2DFK A;  5JHH A;  1NU2 A;  1TXD A;  1PFJ A;  3X23 A;  4TYZ A;  2VRW B;  1MIZ B;  3CIK A;  4F7U P;  1EAZ A;  2L1C A;  1X86 A;  1DDW A;  1ZC4 B;  1V88 A;  2QKL A;  3ZVR A;  5DIF B;  5C6R A;  5J3T A;  3QBV B;  5D3W A;  5J3Q A;  2KCJ A;  2YT0 A;  1KI1 B;  1UNP A;  2IFS A;  2VSZ A;  5D3Y A;  4K2P A;  2N0Y A;  2LKO A;  3ODX A;  1KZG A;  5LON B;  2DLW A;  1U29 A;  4KHB B;  1MAI A;  2DKQ A;  3DXC A;  3M1I B;  2I1J A;  2LYD A;  3WA0 A;  2RGN B;  2LOX A;  4DX8 A;  1UEF A;  1V89 A;  3KY9 A;  3WYF B;  1KZ7 A;  2LOZ A;  4DBB A;  1QC6 A;  2ELA A;  5HE1 A;  4HAX B;  2D9Z A;  1U5F A;  1WGU A;  4ZRK A;  2J59 M;  3SO6 A;  5D3V A;  2DX5 A;  5JP4 A;  3VOQ A;  3CXB B;  4BBK A;  1DBH A;  3AJ4 A;  2IYB A;  1H4R A;  2COA A;  4HB3 B;  3PEG A;  1W1D A;  4KAX B;  2YSZ A;  2COD A;  4DXA B;  2CY5 A;  3O96 A;  3D8F A;  2RLO A;  2RUK B;  4GN1 A;  1GG3 A;  2CRF A;  1DRO A;  3ULB A;  1BWN A;  4A6H A;  2K2J A;  3ZDT A;  3PSC A;  2ELB A;  2QKM A;  1NTV A;  1XKE A;  4HB2 B;  3UZT A;  2L2I A;  2HTH B;  5LOP B;  1FGY A;  3LJU X;  1Z87 A;  3KRW A;  2BCJ A;  2EC1 A;  2R09 A;  2D9Y A;  1MK7 B;  1ZM0 A;  4EMO A;  4KHA A;  3ULC A;  2COF A;  2D11 A;  3T06 A;  1U2B A;  4PQ0 A;  2V76 A;  4GMV A;  5D3X A;  2EMT A;  2PZ1 A;  4K17 A;  4F7H A;  2RNR B;  3SNH A;  2Y8G A;  3TFM A;  1U5G A;  2DX1 A;  3BJI A;  1GC6 A;  2DHJ A;  4DX9 0;  2Q13 A;  2AEH A;  2GCJ A;  3TVV A;  1OY2 A;  3V5W A;  1PLS A;  4HAY B;  1P6S A;  1WI1 A;  4A6K A;  4KVG B;  2DYQ A;  4HHV A;  1U27 A;  1FGZ A;  2D9W A;  4HAV B;  4F7G A;  1BTN A;  3PP2 A;  5L81 A;  5KQ4 A;  3TW1 A;  5HE2 A;  1Y19 B;  2OQB A;  3GYP A;  1P3R A;  4P7I A;  1NTY A;  2EJ8 A;  2D9X A;  5DH9 B;  5CLQ B;  2ZPY A;  1MK9 B;  2ROV A;  5J3Y A;  2YRY A;  1ZC3 B;  1FB8 A;  2VKI A;  2JP2 A;  2M38 A;  3MPX A;  2Y8F A;  1M7E A;  1U5D A;  4KHO A;  2DYN A;  2YS3 A;  1WVH A;  2M14 A;  3PVW A;  4ZRJ A;  5KQ1 A;  2CAY A;  1OQN A;  1RJ2 A;  2Y7B A;  5HE0 A;  2J0J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...