5KCVA

Crystal structure of allosteric inhibitor, arq 092, in complex with autoinhibited form of akt1
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
433
structure length
353
Chain Sequence
IVKEGWLHKRGEYITWRPRYFLLKNDGTFIGYKERPAPLNNFSVAQCQLMKTERPRPNTFIIRCLQWTTVIERTFHVETPEEREEWTTAIQRVTMNEFEYLKLLGKGTFGKVILVKEKATGRYYAMKILKKVLQNSRHPFLTALKYSFQTHDRLCFVMEYANGGELFFHLSRERVFSEDRARFYGAEIVSALDYLHSEKNVVYRDLKLENLMLDKDGHIKITDFGLCPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHEKLFELILMEEIRFPRTLGPEAKSLLSGLLKKDPKQRLGGGSEDAKEIMQHRFFAGIVWQHVYEKKLSPPFKPQVTSETDTRYF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Discovery of 3-(3-(4-(1-Aminocyclobutyl)phenyl)-5-phenyl-3H-imidazo[4,5-b]pyridin-2-yl)pyridin-2-amine (ARQ 092): An Orally Bioavailable, Selective, and Potent Allosteric AKT Inhibitor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/inhibitor
molecule keywords RAC-alpha serine/threonine-protein kinase
total genus 90
structure length 353
sequence length 433
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2016-06-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
A PF00169 PH PH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 5kcvA03
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 5kcvA01
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 5kcvA02
2WQBA 5G1XA 3B8QA 3E7VA 4EC8A 2PVKA 4JS8A 3QQHA 3ANQA 4O0VA 4OTIA 2WQNA 3UOJA 4XH6A 2VTOA 1OL7A 3FZRA 5CYIA 2D2QA 4O7TA 5I0BA 4FKJA 4ID7A 5HBHA 2ROVA 4AU8A 4B0GA 1VJYA 2B9IA 3E3BX 3UMXA 1GIJA 4M0YA 2FO0A 2VO3A 4IADA 4CZUA 3D8FA 3QWKA 1ZM0A 3F3UA 4F99A 4EH5A 5E1SA 3QCQA 4ACCA 3Q2MA 1H1WA 2YLFA 2R09A 3DKGA 2XB7A 3F3ZA 3P0MA 3E64A 4MAOA 4XV2A 3HRCA 3C5IA 2Y0AA 2X1NA 5E8YA 3O23A 3AD5A 3RCDA 1PKGA 3BEGA 4GSBA 3NRMA 4IX6A 4DG0E 3U6HA 2M38A 3DB6A 2BZJA 2W1CA 4Q9SA 2Y8GA 3SC1A 2CN8A 1APME 3ETAA 3OC1A 3Q6UA 4UX9A 4A9RA 3PSDA 3FMKA 2WMWA 3AC2A 3EQBA 1I7AA 3IK3A 5CEQA 2OJGA 3OCTA 3EN9A 4BBMA 4EK3A 5CU2A 5FI1A 1BLXA 2WQMA 5CVGA 5DLSA 4DEEA 4UZHA 3EN5A 4R6VA 5DR2A 2YIQA 4FBXA 3AC5A 4I24A 4MQ2A 4X21A 2QLQA 3FMMA 5CT7A 5ANGA 5DT3A 4CV9A 3HZTA 3QRIA 2CLQA 2OI4X 3R6XA 3IG7A 4EYMA 3QKMA 2G15A 1WBSA 2I0YA 2QHMA 2UW5A 3F3WA 4KIKB 4M0ZA 3ZSGA 2W5AA 4B6LA 4G9RA 5HIDA 4E8AA 2C4GA 4O0UA 5CS6A 2P8VA 3T3UA 3G9WA 2BALA 4AGWA 3PEGA 2DS1A 3P6AA 1EF1A 2FSLX 2WMRA 1B55A 2YITA 1YOJA 1OI9A 4RRVA 1V61A 5CXZA 2CAYA 2R3NA 4R8QA 3RPOA 3NEWA 3HLLA 4R3PA 4A5KA 4QP3A 2VX0A 5HQ0A 3VIAA 2OICA 5HG8A 3NVMB 4HGEA 1PMSA 2XIKA 4NKAA 2GNGA 1DYNA 4BVUA 4ZZOA 4TZRA 3BELA 3F5GA 1OB3A 3GBZA 5JHGA 2CKQA 2I6LA 5I9WA 3QQFA 3QQUA 4D9TA 3ZLSA 2VX1A 1ZYCA 4EOSA 2ZAZA 3TV4A 4YUQA 1PMVA 3R8LA 1PY5A 1X8BA 1ZZLA 3CBLA 2EC1A 4CTBA 4X6QC 5A4TA 4YJPA 5C6RA 3KMMA 4YHFA 4IZ5A 3QQKA 3ZRLA 3TZ9A 4EH7A 1OIRA 4FI1A 3BHUA 2C6DA 4F7NA 3IPHA 4BTKA 4BKYA 4HATB 3G2FA 3PWYA 2BAQA 4U79A 4QMQA 2PMOX 2EXMA 5GJDA 3LFEA 4PUZA 2PVYA 2W4JA 4IAKA 4ACHA 2CCIA 2E9OA 5T68A 3UIMA 4BKZA 4M69B 2E9VA 4FV9A 3LFNA 4WOVA 4F9WA 4FT5A 4MBLA 2CCHA 1OMWA 4CFXA 2YZLA 3MPXA 5AP4A 4YJRA 4G2FA 3ZM4A 4QTEA 2W5HA 3OROA 3TN8A 3GCQA 4FEUA 4WG5A 1ZYSA 4L00A 5EG3A 4AZEA 4YPDA 3VRYA 1XR0B 4GFOA 3R7UA 4I0TA 2R7IA 3GCUA 2WIPA 3EQPA 3I81A 3VWAA 2N0YA 1NVQA 4DEIA 2E2XA 4YL8A 1G8AA 1U5FA 4J96A 2H7EA 1URCA 1KOBA 1H28A 4H1JA 4F1MA 4K0YA 4AT4A 2IZRA 3HP2A 4GH2A 1OL5A 2VWVA 4LV8A 4EH4A 2PL0A 3IVFA 3ORNA 1ZRZA 3EKKA 3OBJA 2I0HA 2WTKC 2EVAA 4QMSA 5CU4A 5E8VA 4BGQA 2BRNA 1JSVA 4GIIA 2X6EA 3QXPA 2IWIA 3REPA 3WIGA 1YHSA 3A98B 4K2PA 3HV4A 4IVAA 4DH1A 3QBNA 5J79A 1ZOGA 4XG9A 2WFYA 4BIEA 4NJ3A 1ZZ2A 4KHAA 1UNLA 5FWKK 3LE6A 3FXZA 1WI1A 2DHKA 4IFSA 3LFCA 5FQDC 2PVHA 5E1EA 4PPAA 4U80A 2WMXA 2A1AB 1O9UA 1V0PA 3HV5A 4BZDA 2OJIA 1ZYLA 3FQHA 3G5DA 4O7YA 4WO5A 4XLIA 4C4FA 2GJYA 1M14A 3A2CA 4FSRA 3MDBC 3VUMA 4FTNA 2IW8A 1LR4A 3NSZA 5JGBA 4WBOA 4AG8A 4E4XA 3F5UA 3L1SA 2Z7LA 3R2YA 4BB4A 4BCOA 4Z2MB 2WMVA 4IZ7A 3RM7A 4OAVB 5FTGA 1OQNA 2QO7A 3SA0A 3CPCA 3Q4UA 3HKOA 3KKVA 2XK4A 4L9IA 1JOWB 4GT4A 4AX8A 3MV5A 4QQJA 3QQLA 2QCSA 4FEQA 1KV1A 3MB7A 2UZLA 4M15A 4R5SA 3VIDA 2MDXA 2YCRA 3VAPA 3M1SA 3TUBA 4PMSA 4H3BA 2YVCA 4HCVA 2I1JA 2VTIA 2XMYA 4TWOA 4KVGB 4XOZA 3TCAA 1ZLTA 4U5JA 4DFUA 3EWHA 3R71A 3ULZA 5KZIA 2YWPA 3UC3A 4BF2A 3U8WA 3D14A 2YJSA 3AC3A 3D7ZA 3KRLA 3NW5A 5HCXA 5C5BA 2YACA 4GG5A 3FHRA 1M7EA 2QKMA 5AP2A 4KA3A 4RJ6A 5BVKA 3U9CA 5BVOA 3FZTA 2XVDA 3RK5A 3CS9A 4IB5A 4IANA 3ZFMA 4QMVA 5BVWA 5FGKA 2OH4A 4I6QA 3E8DA 2W06A 3R30A 1YOLA 4X2FA 5FBNC 1BI7A 4U45A 5CLQB 4YU2A 2W0JA 2W9ZB 4MH7A 4KIKA 5IU2A 3PRFA 5L6OA 3WYFB 3NNUA 4J8NA 4KKEA 3Q4ZA 4OLIA 4JXFA 3OXZA 5JMSA 4HDQA 2YDKA 3Q5ZA 5J8IA 3GI3A 5AAFA 4O0YA 4UYAA 4YTHA 3VBYA 2C3KA 4ASDA 2CHLA 5GIPE 3BIZA 3KA0A 4F6UA 4MXOA 4L8MA 1X1GA 2GS0A 1M17A 4FSTA 4I20A 3FV8A 4WG4A 5ANKA 2RFEA 4DGNA 1WAKA 1CDKA 3VNTA 1OKWA 2W2XC 3M1IB 3BU3A 2FH9A 3ATSA 3A99A 2R3PA 1GAGA 4IIRA 2JGZA 3LJUX 4FVPA 5ANJA 2IVSA 2HOGA 5IA2A 4RIXA 4EH9A 2YSZA 3EL8A 5DVRA 3WYYA 4ZMFA 3RM6A 1V5MA 2X4ZA 4PQNA 3TW1A 2R3IA 3KN5A 3DJ5A 4D58A 5CQUA 5ANOA 2W1HA 2X8IA 5HTBA 1X1FA 2R3GA 2QVSE 2P0DA 2GPHA 2XYUA 3IDBA 3GFEA 2BR1A 3QKKA 4U97A 2Y6OA 2RL5A 3LXKA 5BQ0A 3AQVA 4GFGA 4EK4A 2RFSA 3FEGA 5FDPA 2C6KA 5DGZA 3EN6A 5HBEA 2J51A 2WMUA 3W32A 2PMIA 3QRKA 1BAKA 3E92A 3F7WA 5HOAA 2UZWE 4OTPA 4L6EA 1AGWA 4QP4A 3S4QA 5AIRA 2H8HA 3VF8A 4O0TA 1T46A 2PZYA 3AC1A 3GU8A 4FNXA 3ZYAA 4CCUA 3MGYA 4GS6A 3BQCA 4DTKA 4FF8A 3CXWA 3QD2B 5CSHA 1FPUA 4D4YA 5IA4A 2OZAA 4QP1A 1PFJA 4JIKA 4NFMA 5J3TA 5IG1A 4DLJA 5DIAA 2R3HA 2M14A 3C13A 2IYBA 4JR3A 1F5QA 1XJDA 3WE8A 4O81A 2O5KA 4WNOA 1SZMA 4XV1A 1PXIA 1UNGA 1JSUA 3THBA 3GC9A 1OGUA 5AWMA 1LP4A 3I79A 5JZNA 4BIBA 1WBTA 2PY3A 4F0FA 4ANBA 2QOOA 5CY3A 4R7IA 5FEDA 3ODWA 3GC8A 1PHKA 3OW3A 3BLQA 3RHKA 1YWNA 5CT0A 3IW4A 3H0ZA 1SVHA 3PY0A 2WZJA 3ITZA 4K8AA 4PL4A 4X3JA 4JQ8A 4A9YA 2YT0A 4ZTLA 2IO6A 2RG6A 5HE3A 5M4FA 3N51A 3HUCA 2B4SB 4FZ7A 5ETCA 1UWJA 5DT4A 3SAYA 1M2PA 3FEHA 4YONA 4RZWA 2QG7A 5HGIA 4L67A 4I23A 4O27B 3FMJA 3MPAA 4Y46A 1KE5A 3QXOA 3FYJX 4O0RA 5AP7A 2HZIA 3R8MA 4U8ZA 1QPDA 4CTCA 1QC6A 4F70A 3BE2A 4RVTA 4QYEA 3NUAA 4TYJA 4EBWA 5IA0A 1OIYA 2Q0NA 4X2JA 4S34A 3P7AA 5EQYA 4I22A 3BE9A 4AWIA 4DITA 5C8KA 3ZLXA 1A48A 2VTPA 3AMBA 3OCBA 4AZWA 2ADZA 2A2AA 5A4LA 1EH4A 4QQCA 2E9PA 2VD5A 1NW1A 2OJFE 4M7IA 2HK5A 3M2WA 4GK4A 4FV0A 1YDRE 4U3YA 4V0GB 2EB2A 4ZZNA 2R0DA 4KIPA 3OOMA 4PTEA 3FJQE 4YJTA 2QURA 1TKIA 4BDJA 3LQ8A 4CT1A 2O63A 4JG7A 2O0UA 3PY3A 1YI3A 4JAIA 3FI8A 5EHLA 1R1WA 5C26A 3PG7A 2J0JA 3TDVA 3VC4A 3LJ1A 1WBNA 2Y6MA 4KS8A 4TXCA 5HLWA 5LVNA 3OZ6A 4KWPA 4J1RA 3FQSA 3PA4A 3CD8A 4KRCA 1UPRA 4D4SA 4I0SA 4MY6A 3AMAA 5IH4A 1OPLA 4JDIA 4NM7A 2C6OA 4UN0C 2VZ6A 3U6IA 5D41A 4AOJA 3ZDIA 3QTUA 3POZA 4BCKA 2EB3A 4FTIA 5M51A 4RWIA 1MIZB 4PDYA 2DFKA 3CQEA 3VOQA 4LUEA 4AE9A 3R0TA 2X7OA 4RIOA 4AFJA 4KNBA 2BIKB 3BBTB 3LIJA 5DHJA 1Z9XA 4L42A 3NX8A 3CP9A 3FKOA 5GZ8A 4UMQA 4O6EA 4XP2A 2GTNA 2LG1A 4HVGA 2VO6A 3TDWA 4FSWA 4NW6A 5DPVA 4U81A 4JX3A 4AW1A 4BWXA 1NT2A 3O8PA 3PVUA 4DEHA 1H4LA 1PXLA 2CJMA 3I60A 4IAPA 3MH3A 1JKKA 4XRLA 2IW9A 4EH8A 3FBVA 5HZNA 4ANSA 4DTBA 2NPQA 2WU6A 2B53A 4ZY6A 1REKA 2JDRA 3ZS5A 3O7LD 1ZMVA 3F5XA 4EOMA 2JKMA 2CGXA 3KGAA 2HCKA 2XZSA 3GUBA 4AN3A 2I5CA 2WMSA 5CAOA 2ITNA 4EOQA 3UO5A 3V6RA 3MN3A 3KVWA 2WHBA 1FGZA 4C4GA 2D9VA 2PUNA 4LRKA 2Y9QA 1Y91A 3D94A 2ZV8A 3P79A 1P14A 5K4IA 3AXWA 1MP8A 4RIXB 1V1KA 2OQBA 3PDTA 4BZOA 4EZ7A 4HB2B 2P3GX 2BHHA 3TUCA 3SGCA 4JRVA 4I5HA 3C0HA 1H26A 2UVYA 3HMNA 5EKOA 5ANDA 2V62A 5LMKC 5M06A 4CZYB 4ACMA 1O6YA 5IQEA 2HYYA 4M14A 3PIXA 3VS1A 1H0VA 3JPVA 2BFXA 3KXNA 2DHJA 3NCGA 3TXOA 3LM0A 4X3FA 2K00A 4D5HA 1XKEA 3T9TA 2JLDA 3P23A 4H58A 3EFKA 4XS2A 1M7RA 2W4OA 4FR4A 4XG7A 4BDIA 2WXVA 4P4CA 4WSFA 1YDSE 2GQRA 4FL2A 4J7BA 4DEBA 4JLCA 4ZTSA 4CLJA 4PP7A 2OZAB 3TZ8A 2BILB 4ERKA 3RCPA 5IQFA 3QZGA 1EGXA 1OM1A 4KHBB 4I6FA 2IVVA 4F4PA 4IW0A 5BNJA 1O6LA 1XBBA 5IPJA 1FHWA 5I9XA 1UU9A 2ZPYA 4IC7A 5EI8A 1DDMA 2PWLA 3OEFX 5L4QA 4P5QA 3BHTA 4RJ4A 4ZY4A 4O7ZA 3P08A 4G6NA 4FICA 4KKGA 2VTQA 3FMDA 4L45A 3ODYX 3OVVA 2X81A 2VTNA 4FZ6A 1MUOA 2VV9A 3ZXZA 2XIRA 3QLGA 4LYNA 2C5NA 2R3QA 3KXMA 3QTIA 4W4VA 4E6DA 2VN9A 4F9BA 4PMTA 4R5YA 4EONA 5GJGA 1ZOEA 4IWOA 2GFSA 5T3QA 5KBRA 2OW3A 5HO6A 4APCA 5DFPA 1H1QA 4ENYA 2BRMA 2UW0A 4W4YA 3PP2A 3DCVA 2XJ0A 3O8TA 5I3OA 2ITZA 3BHVA 3KXGA 4OBOA 4GT5A 4LRMA 1XH4A 4OTFA 4RPVA 5JSMA 2DWBA 1K9AA 3QGYA 4OTQA 3WF9A 5CF5A 1OBGA 2V55A 4QMLA 3MYGA 4CEGA 3HQCA 3MA3A 2R3FA 5L6WL 2YN8A 4BCNA 4CV8A 3QC4A 3DXNA 4LRJA 3EQDA 5CSWA 3ZMMA 5IISA 5KKRB 2D9XA 2CKPA 4ZLZA 5KMNA 5CALA 1GG3A 4FIEA 4XP0A 2E9NA 2CY5A 5AIKA 3W1FA 2G1TA 1GZKA 4ALVA 3CEKA 4IEBA 4V0GA 2J4ZA 5ACBC 4GYGA 3NAYA 4EJ7A 2OXDA 2VTHA 5LXMA 3PLAE 1B38A 2VWIA 5EKNA 4GVAA 3IONA 2MFQA 2OTXA 3QUEA 2B0QA 2XK8A 2YAKA 2Y4PA 4GKHA 1YXTA 4JR7A 4ZSGA 3TKIA 3TTJA 4TWPA 4ZRJA 4EJNA 2X2LA 1CTPE 3HMIA 3FY2A 4O7WA 1H1RA 4BCMA 4R78A 2HW7A 2XEYA 2XNOA 4FG7A 3PYYA 3W18A 2FSOX 3DKCA 2PSQA 4DBXA 4YC3A 2QLUA 3MFTA 3QD4A 3RWQA 3HK0A 1Q41A 1UU8A 3ZDTA 4EOJA 4XV3A 3TEIA 4O86A 5A6OA 2WGJA 5K3YA 3L8SA 4J71A 2JD5A 3ZEWA 4DC2A 3O51A 1OPJA 4IZAA 5F94A 3TCPA 1B39A 3MH2A 3RP9A 2J0LA 4AFEA 5CSPA 4IVBA 2X6DA 2KUPA 3FWQA 5KMMA 4CRSA 2ACXA 5HG7A 2ROZB 2YDJA 3DGKA 3H30A 2P4IA 2RKUA 3MY0A 2YS3A 1SNUA 3BZ3A 4WUNA 5FDXA 4II5A 5LOHA 4IFCA 3WOWA 5KCVA 4Y85A 4A9SA 5BVFA 2Y8OA 4S32A 3QWJA 4IAZA 2IG7A 5ICPA 2RF9A 2OJJA 5TT7A 3C4ZA 5L8LA 4FK3A 4UMRA 3ROCA 2VKIA 1ZY5A 4N70A 3PJ8A 3LLAA 3QD3A 4RC2A 2PHKA 4JBOA 3U7DA 4Y8DA 4RZVA 3R9HA 4HVHA 1IAJA 4GCJA 3DB8A 4LGDA 5AR3A 3KRWA 2YCQA 4G3FA 1YRPA 3P86A 3FE3A 2Y4IC 3ERKA 2I40A 4BDAA 1ZVRA 3HP5A 3LXLA 1W98A 2WELA 3O2MA 3KF4A 3TNQB 3CQWA 2X8DA 1R3CA 2WEIA 3GU7A 3OFMA 3CKWA 3D2KA 5F95A 3LFBA 2XK3A 1E9HA 2XIZA 2WTIA 3NUNA 1JVPP 1U59A 1J91A 3NAXA 4L3LA 3R8VA 3UIXA 3V5TA 5J95A 5EW3A 3L9MA 4G34A 4BICA 4E6CA 3SVVA 2Z0QA 3NYVA 2RSVA 3L9LA 4A9UA 4MF1A 4CYEA 3UO6A 4JDKA 1J1CA 1AQCA 1LPUA 1W83A 4CVAA 1TVOA 4IC8A 2CKOA 4H05A 3B2WA 3LCOA 1CKPA 4B99A 4OTRA 4AZTA 4MBIA 2CY4A 5BYZA 2UW8A 3KN6A 4I5CA 5DBXA 3VS5A 3OP5A 4W4XA 3TKUA 4I0RA 1VEBA 2WTWA 3W2RA 1NTVA 5EYKA 1UNPA 1IA8A 2YZAA 3DKOA 1XWSA 1IRSA 1DI8A 3HV7A 5E4HA 4X3FC 4FSYA 4FSMA 4GIHA 2O2UA 3VUHA 4A4XA 4KKHA 2VAGA 5DOSA 5AAGA 1CKJA 2ITYA 3OD6X 3ORLA 4TNDA 1B6CB 3QL8A 4KIQA 4RJ3A 3SKCA 2XF0A 3FL5A 4DF3A 4CHJA 3LFFA 4QPSA 4QMXA 3R9OA 3FLQA 3H9OA 3DS6A 4USDA 5HI2A 5JFSA 4TYZA 3TZ7A 5EDQA 1H07A 4AOTA 4ALUA 5M08A 4L3JA 5H8GA 4HAWB 2XM8A 4FL3A 4O96A 3UQGA 2HZ0A 4V01A 4D0WA 3HRFA 3NDMA 3MWUA 2XEZA 3UE4A 3MIYA 4HZRA 3RZFA 5TKDA 3UYSA 4ANNA 4BHZA 3UNJA 2QOIA 4FTCA 4FZAB 2CODA 2QR8A 3BPRA 2X8EA 1YXXA 3RKBA 1LB1A 1GZOA 2RLOA 4GMVA 4HNIA 3QTRA 2FB8A 5J9LA 4RX8A 3A4OX 1PLSA 3OXIA 4P7EA 2QC6A 5GHVA 3JR1A 3Q2JA 5FLFA 3DLSA 5AUXA 1F0QA 1RRPB 5JLJB 4MNFA 3E5AA 4O2ZA 1FGKA 2XNGA 2UVXA 4RIWB 4AAAA 1PXPA 3NW7A 3ZONA 2X2KA 4HB0B 4WVFB 4QP7A 4Z3VA 1G5SA 2BFYA 4YLJA 3LFSA 1UVRA 4LI5A 2PVNA 4RA5A 5H2UA 1XQZA 4EQUA 1TQZA 4ZXTA 2E2BA 3WI6A 3ZLYA 3BU6A 3AGLA 4KSQA 4FX3A 4KD1A 4O0SA 3DFAA 4ZSLA 4YZNA 2QKRA 5AP1A 1BI8A 2KTYA 3IOKA 4FT7A 4FUXA 1GIIA 4XBRA 1OY2A 1ATPE 4DGLC 4FT3A 3OOGA 2QI8A 3EN4A 3DAJA 4QTBA 4WA9A 3SXRA 5HNIX 2F4JA 4RJ8A 5EYCA 3UP2A 4NIFB 4K9YA 4FGRA 4TYIA 3MFSA 5CZHA 3CGFA 3RMFA 5AUUA 3OWJA 4XG8A 4RIYA 4J97A 3KB7A 4NW5A 4E3CA 4CFUA 2ZVAA 3HECA 5KNJA 1XBCA 1ZC4B 5JRSA 3T9IA 1W1GA 3TNWA 2COCA 3W55A 2H9VA 4PDSA 3AG9A 3ORIA 4EWHA 2D9YA 2QOHA 1PXJA 4O0XA 3ZBXA 5KQ1A 2GCJA 3CJFA 3UVPA 2E9UA 3Q32A 4ACGA 2GCLA 4CSVA 3OMVA 3AD6A 2QU5A 5D9HA 3TT0A 2UZNA 2ZV2A 4D2TA 2F2UA 5BMSA 3TUDA 3ZLWA 3GOKA 2Z02A 3MTFA 3MPMA 4CFMA 3GEQA 4BGGA 4TYGA 2WMAA 4L43A 4O2PA 3NCZA 4ZRIA 4FGBA 2J2IB 3KL8A 4LL0A 4I94A 3GCSA 4FIFA 4MHAA 3VUKA 3QCSA 4V04A 3WZDA 5FXRA 3S1HA 1WGUA 2VSZA 2X9EA 4CFNA 3R1QA 4TYHA 3G6HA 3RK9A 3ZUVA 2DYNA 5DA3A 2DHIA 5CU0A 4ZSEA 2Z8CA 3HYHA 1J7IA 2OGVA 4GKIA 3G9LX 3PG1A 5CAQA 4X2KA 1P2AA 2WKMA 3BU5A 3FQEA 4IMYA 4M69A 3W2CA 4FV3A 5GZ9A 3DAEA 2YIXA 3R8ZA 3UNKA 4FODA 3U8ZA 2W99B 4FKPA 3NNVA 4UMUA 3K3JA 1K3AA 3AC8A 4DGOA 2LOZA 4FTAA 3FZPA 4DGMA 5EM7A 4I6BA 3UP7A 4F64A 4GL9A 4WIHA 5FEQA 3FM8C 1E1VA 5CEKA 4AXAA 5TE0A 2HTHB 1NA7A 2W1GA 3QRUA 3F2AA 4WG3A 3IW8A 2EJ8A 4DCEA 5HHWA 3WZEA 5EW8A 4XWXA 3RBWA 2J50A 5BVDA 3DK3A 2XKFA 3K3IA 5EHYA 4AQCA 3DLZA 3W8LA 2I0VA 1PXKA 5J5TA 5KHWA 5L81A 4FC0A 1OUYA 2XBAA 4FK6A 4S30A 4OAUC 4RVKA 4D1SA 3BX5A 1LEWA 1M52A 2GHGA 4M84A 4UWBA 4BI0A 4MCVA 4XNEA 2GS2A 5CZIA 2X7FA 5HCZA 2OO8X 4Z7HA 4V05A 5AUTA 4KS7A 5CF4A 1TJ6A 4L7SA 4BI2A 2EXCX 5FG8A 3CGOA 3F69A 4QNAA 3UGCA 5LVMA 4FKWA 5CASA 1WZYA 2ZB0A 3O0GA 3I4BA 5GJFA 3TM0A 3EQGA 3F3TA 3ZRMA 4FTTA 1BL6A 5E8TA 2F9GA 2UZVA 2OF2A 4YURA 1MRYA 2ERKA 4QNYA 4QMYA 4AF3A 2QKLA 1FBNA 1WMKA 5ETAA 4WUAA 3TWJA 5FBOA 2Y4IB 4PNKA 1Q99A 3PPJA 5EK7A 3WE4A 1W7HA 1STCE 2J90A 4ZY5A 3NUPA 3OY3A 4PPCA 4KBCA 4QTCA 3BLRA 4YZMA 5JT2A 3UPZA 2PVFA 1Y6BA 2ZV7A 1SYKA 4FTOA 4NSTA 5K5NA 2KCJA 2XNBA 3GP0A 2CNQA 3LMIA 3ZEPA 4NYEA 4HGSA 4I4EA 4O82A 2VTLA 4CFFA 2XP2A 4OUCA 4EKUA 2Z60A 3FKNA 4L6QA 4UMTA 5CXHA 5HKMA 1URWA 4LOQA 5LMKA 2PU8A 2ITOA 3F5RA 4GVJA 2CGUA 4PPBA 5JRQA 2DUVA 3JVRA 3O71A 4BFMA 4M67A 3OS3A 5AUZA 1DS5A 3WIKA 5EOLA 4C4IA 3F3VA 3ORMA 2NO3A 5FD2A 5EQPA 5C5BB 4DEDA 2JKKA 4GMYA 4I3ZA 4QMUA 3VVHA 4EH2A 5HO7A 4YBKA 4BN1A 5IA1A 5IEXA 4DBBA 3OWLA 4FUYA 3PJ3A 5FRIA 1P5EA 5E7RA 4PMPA 2D4QA 4DXAB 2GQSA 3BEAA 2UW9A 1RW8A 2P0CA 3ZO2A 2Z2WA 4LOOA 4U42A 4AN2A 2YAAA 2YABA 4DFLA 5IEVA 2UZDA 1K5DB 3BHHA 2IVUA 1JAMA 3RAWA 1XH9A 3QD0A 4C4JA 3DZQA 5B0XA 1WJMA 3CD3A 2JIUA 1I2HA 2VNWA 2WIHA 4P90A 2COFA 4RMZA 1Z87A 4DX8A 2WTKB 4U7ZA 3ORKA 5BX0A 2FJLA 4GUBA 3C9WA 4BKJA 4IB1A 4DFBA 4NFNA 4CMTA 4EHVA 1X05A 2DLWA 3KEXA 5CTPA 5KE0A 2DQ7X 2JEDA 1NVRA 2W96B 5AM7A 3COMA 1JKLA 3BQRA 2Z7QA 4GUEA 4NIFA 4YO6A 3S3IA 4BTMA 1P6SA 4BZNA 3DAKA 5DT0A 3SO6A 3FL4A 4G6LA 4QP2A 1KE7A 4IAAA 4RIYB 1GY3A 1WBPA 3EQHA 4IVDA 2YEXA 5HD7A 2CKEA 4RVMA 4TKSA 4F7SA 3D5WA 2UW7A 4KRDA 4BBEA 5CI7A 1Y8YA 4YC8A 1OPKA 3P9JA 4N57A 2C0IA 1Q97A 3IDCA 2UZOA 1OITA 3G33A 2G2HA 3QA8A 1ZSQA 3ZOSA 3Q4CA 3U87A 1YKRA 3HDMA 3PSCA 3MH0A 3Q04A 2P0FA 2P33A 4MX9A 4UXLA 1MK7B 2IZUA 3AC4A 3ANRA 5L6PA 3FC1X 5AV2A 4OR5A 3F0WA 5AA8A 1RJ2A 1YI4A 1YWRA 1ZMWA 4NL0A 1H1PA 5T6KA 4IJPA 1ND4A 3N4VA 1ZARA 4WNPA 4F7HA 5LOPB 1L8TA 5HE2A 1EVHA 3FDNA 5DNRA 3EYHA 4TYHB 1P4OA 3LAUA 4G3GA 4RLKA 4QP6A 4TRLA 2WB8A 4AZSA 3QX2A 4DYMA 4EOPA 2K2JA 2BRGA 4N6YA 1Q8UA 3QYWA 3TTIA 2CNVA 2B9JA 4XBUA 3FPMA 4NJDA 2OIDA 4G5JA 4JJRA 3O17A 4AW2A 5M09A 4GZUA 5IH6A 2ZJWA 4Q2AA 4QMNA 2OBJA 4C4EA 1W8CA 1U27A 2C6TA 3FMEA 3U4WA 2BUJA 2X39A 3Q52A 5EDRA 5EOBA 1UKHA 4ASEA 1XD4A 4HOKA 1U5EA 3CLYA 3NLBA 5BUEA 1Q67A 2J5FA 3ORPA 2NZ8B 4K33A 1U5GA 3KY9A 3W2QA 1J1BA 1KE9A 3SLSA 4RX5A 3P7BA 2RNRB 3DXCA 3A60A 2RGNB 5M56A 2CGWA 2NP8A 4FOCA 4A7CA 5L2QA 4D2WA 1AD5A 2JITA 4RQKA 1W84A 3KRXA 4L01A 5D10A 3IOPA 2VUWA 1V89A 3SUZA 5I3RA 4DCAA 3BCEA 4AA5A 3FPQA 3R8UA 3CY3A 3AU5A 2CN5A 3R1NA 4Y94A 2ETMA 4D28A 2QOQA 2PZ5A 3Q5IA 2BDWA 3C4EA 1OZ1A 1SNXA 3LXNA 4UYNA 4RA4A 1F3MC 4N4SA 4QQTA 3Q9XA 4JX7A 2HXLA 4IAFA 4S33A 3C1XA 3C5UA 3MBLA 4C38A 5EFXA 5HE1A 4Z55A 2D9WA 3W16A 2F49A 2OH0E 2VU3A 4AGUA 5A46A 4WHZA 1GC7A 2WTJA 2WU7A 3RPRA 4A06A 1RJBA 4AW0A 3EJ1A 4F0GA 1MPHA 3QRTA 4ENXA 2C0TA 2JDTA 2JDSA 5JGDA 4OTWA 4BCQA 4BR3A 4ZAUA 2AUHA 4K6ZA 4K17A 1LUFA 4X2GA 2WNTA 3TG1A 1PMEA 1EAZA 5IQBA 3R73A 1SHCA 4FMQA 2BZHB 3BGQA 2GCDA 1MQ4A 4CQGA 4USFA 4I93A 4K77A 3LQ3A 5IQAA 3CC6A 2ELBA 4AT3A 3TVVA 2P55A 5KMKA 2VTRA 4EZ3A 3B8RA 2R3KA 3TV6A 1WJ1A 4YSMA 1M7NA 2YM7A 4GRBA 3UBDA 5HO8A 3ZC5A 3RPYA 1PF8A 3P1AA 3D9VA 3C4FA 2R0UA 1GZ8A 3HEGA 4HCTA 2L2IA 3HAVA 1XBAA 1CSNA 3ODZX 4ITJA 3ZUUA 3VN9A 4FKIA 4BCIA 3EOCA 4C0TA 1NXKA 3ZH8A 3ZBFA 2R3LA 4TYEA 1QPJA 3R00A 2F57A 1KOAA 2GFCA 4ZJIA 4A4LA 2PVMA 2DKPA 3EL7A 2QO2A 4FIJA 4X0MA 1XKKA 3KULB 3QUPA 3NSUA 3MDYA 1UU7A 5E8WA 3V5PA 3KK8A 1V88A 5HVYA 4TL0A 4F0IA 5L3AA 3KCFA 4AW5A 2V5QA 4D2SA 5DI9B 1FVRA 2W9FB 2OKRA 3ZZWA 5L2SA 3R9RA 4Q5HA 3GC0A 3V6SA 5IF1A 3DBFA 4TW9A 2FA2A 3R1SA 3MJ1A 3Q60A 5D12A 3GU4A 4FKRA 3A8PA 3D0EA 2RUKB 4QTDA 3RZBA 4C58A 4EUTA 1X86A 1MRVA 1Z57A 3MFUA 5ANEA 1JBPE 3FLSA 5LVPA 4B7TA 5KQ4A 2BDFA 4O6LA 2R3RA 3A62A 4ITHA 3OWPA 2PVLA 1WCCA 2G2FA 3QA0A 4IQ6A 5EM5A 4BL1A 4DH5A 3HW2B 1REJA 2VRWB 4CFVA 2Y7BA 3GYOA 4H8SA 2R64A 5LWNA 4FT0A 3R1YA 2YM5A 4IAIA 3MH1A 3PXQA 2XRUA 2UW4A 3ZU7A 3E3PA 3KXHA 3P7CA 3PXYA 3V3VA 2ONLC 4FIGA 4NK9A 4JG8A 4C3PA 5HLPA 1SVEA 5FM2A 4FNZA 5GNKA 3FZSA 4BDKA 4FV1A 4JDJA 1Y19B 2BZKB 3NPCA 1U4DA 3BYMA 4EZ5A 3NVKI 3E8NA 4FNWA 4AGCA 4U3ZA 2WTDA 4QYGA 3TI1A 2XNPA 3BYOA 3C51A 3KQ7A 4EOKA 4ORKA 5IH5A 3C4CA 5EM6A 3VS2A 4CMOA 4CRLA 4FKSA 4ZTHA 3E63A 4ZLYA 5DRBA 5K0KA 2RFDA 3GT8A 4D2RA 4X3FB 1J0WA 4GYIA 5C4KA 1GNGA 3ML4A 2WQEA 4ZTRA 5BMMA 3DQWA 4I92A 5E91A 1S9IA 4R7HA 3BGZA 3FAAA 4RC4A 4EI4A 1FHOA 2YJRA 2W2WA 5KO1A 3R9NA 3ROYA 3RCJA 3RGFA 3DK6A 4D4VA 5E9EA 4BWPA 2YIRA 5J7HA 3QCYA 3U4UA 3TACA 5JGAA 4RLLA 1KV2A 1UNHA 3FLNC 5HVJA 2XJ1A 1OKVA 4CZTA 4QOXA 1H1SA 5D3WA 2ELAA 3ENMA 2GDOA 3NUYA 4ASXA 1I09A 3HMPA 4MXYA 1V5UA 2VWBA 4FIIA 1BWNA 4H36A 4MF0A 5BYYA 2CRFA 4ANOA 4WRSA 4BWKA 4ZJVA 3HAMA 1Q4LA 2RVBB 2HIWA 4QD6A 2FSMX 3BWFA 2J5EA 2Z7SA 5AEPA 4GN1A 5B7VA 2GS7A 3ULCA 3RAHA 4I5PA 3WILA 3DQXA 4XEYA 2JAMA 2B9HA 4B6HA 3RK7A 4JDHA 3PP1A 3OF0A 4EOIA 4F7UP 5CNOA 4YJSA 3PUPA 1DBHA 3R7GA 1Z5MA 5DR6A 4A6FA 5KX8A 4E5AX 3NYOA 4DINA 1OECA 4CKJA 2BMCA 2BDJA 3FLYA 1WBOA 4W9WA 5A3XA 3V5WA 1BMKA 2H34A 2XNNA 2BKKA 5EQEA 4FKTA 4PL5A 5J9YA 2BTRA 3RNYA 4GPTB 5IQHA 1Q62A 4PY1A 3WF5A 4BIDA 2ETKA 4W8DA 4MK0A 3D5UA 5D1JA 2CMWA 5IUIA 5DHFB 4I4FA 4GMXB 3VBQA 3NS9A 5D27A 4QMWA 2XS0A 4JRNA 3VO3A 1Q24A 1MAIA 3OY1A 5CEIA 2C5VA 4FZFB 1ZC3B 3CXBB 4AE6A 4RBLA 5C01A 3UJGA 4YTCA 4H39A 1FAOA 3HA6A 4DN5A 1PW2A 3ULIA 4QMZA 3QALE 5CU3A 5C8NA 3AU4A 1FQ1B 1GOLA 3LQ5A 4BCHA 1U54A 1K5GB 5AR5A 4D0NB 1BL7A 1I44A 4ZOGA 3H9FA 4APPA 3AT2A 3B2TA 4YLLA 2ZB1A 3A7IA 3LFQA 2PVJA 4CNHA 2PMLX 2IJMA 4RJ7A 3PVWA 3WYXA 3WF6A 1J7UA 3Q9ZA 3BRBA 3UPXA 1BTNA 1Y57A 5LCJA 1QL6A 5JQ5A 4JL9A 5AADA 4O83A 3VUGA 5JN2A 4E5WA 4HVSA 3KK9A 3R63A 3T06A 4TY1A 1OBDA 3GB2A 1CMKE 3VS6A 1SMHA 2OSCA 3W2OA 4U0IA 2OIBA 3ZXTA 4U43A 4JVGA 3LJ2A 4O7NA 2IVTA 3R02A 5HG5A 4E4NA 4AZVA 4LGHA 4E6QA 2XKEA 2DTCA 3A61A 4M13A 1V5PA 4L68A 2VGPA 3PZHA 3SXSA 5KKRC 4TN6A 2ITVA 4DH7A 1NY3A 3A8QA 5K9IA 3CTJA 1KE8A 3PP0A 3TZMA 2OLCA 4CYJA 5FI0A 5AAEA 2VRXA 1FOTA 1JQHA 4Z9LA 4HNFA 1WVWA 5H9BA 2YF0A 4CYIA 2ZYBA 3TNPC 4BTJA 5HCYA 4FKLA 4R1VA 1OKZA 4PV0A 4XV9A 2ERZE 3QGWA 4IWDA 5L2IA 1G3NA 2YDIA 4CLIA 4DGGA 3EQRA 4FTRA 2XNMA 2GSFA 1UNRA 3G51A 2HZ4A 4XG4A 2H7DA 4LM5A 4ZRKA 2OF4A 5HBJA 3BI6A 2Z0PA 2YCFA 4QPAA 5KZ0A 3AT3A 2J0KA 4ZSAA 2EU9A 3QTWA 4DH3A 3LM5A 3E7OA 3UMWA 2OFUA 2YHVA 3NUXA 4F1OA 4IZYA 2GQGA 4GK2A 1TQMA 2H6DA 2ZM3A 3UZTA 3HV6A 2RG5A 3ET7A 3JYAA 2R9SA 3I6UA 4HB4B 4XOYA 4HAUB 2QR7A 2B55A 3LJ0A 2JIIA 5H8BA 3E93A 3SV0A 3V8TA 4E7WA 3DJ7A 5DWRA 1U2BA 4ARKA 4DLIA 4W4WA 4O7RA 2WPAA 5AV3A 4HGLA 3NIEA 1PMNA 4I41A 5G6VA 4G16A 1U46A 3LCTA 4RX7A 3PZEA 5H3QA 3R7VA 4BDHA 3SG9A 3SRVB 3DTWA 2G01A 3FLZA 3G9NA 1JSTA 4WNMA 3QU0A 4D1ZA 2V76A 3D8EA 3DK7A 3PSBA 4WBBB 2K2UA 2W7XA 5E92A 2G2IA 1MKEA 1JKTA 3ORZA 3WF8A 2JFMA 4D0XA 2C3JA 2UVZA 4P2KA 3R7IA 4F9CA 4C0AA 3TV7A 3QWMA 2DX5A 3V8WA 4U40A 1RE8A 2FYSA 3H3CA 3M42A 4EHZA 1FMOE 4F08A 3ALOA 2O65A 4EHEA 2PYWA 4FTKA 4K2OA 4GJ3A 2YM8A 3BV2A 4IM3A 1GZNA 1DM2A 1JLUE 2B52A 3MW1A 4ZTQA 3W33A 4A4OA 2PZ1A 4KAXB 3PXFA 2VTSA 4NWMA 3FHIA 5LMBA 4D2PA 5CQWA 4S31A 5LMAA 3LFAA 4C4HA 3GXLA 5B2MA 1IG1A 3OEZA 3GC7A 3LFDA 4K81A 5DHAB 2C6IA 1H25A 5CAVA 3TO1A 2C1AA 2ONLA 2YM6A 4UY9A 3QZFA 3LW0A 2VGOA 1GJOA 4WSQA 4MVFA 2R4BA 3WARA 1VR2A 1LW3A 4HB3B 2R0IA 3VS0A 4MYGA 4FL1A 5J87A 3VBWA 1UPQA 5J7BA 3FMHA 3SQQA 2XK7A 5AR4A 3ULBA 2C1BA 2SRCA 1OUKA 3UIUA 1BUHA 2BCJA 4AUAA 2BAKA 3VS3A 3L9PA 5LVLA 1YXUA 2JKOA 2OFVA 3W2SA 5CVHA 3S0OA 1XODA 1U29A 4BBKA 3HVCA 3R2BA 3E88A 2J0MA 5BVEA 4JAJA 4C62A 4TTHB 4IJ9A 4C57A 4DEGA 4RIWA 5CENA 3WZUA 3Q4TA 2GNIA 3HNGA 3Q96A 4G3EA 4NU1A 4O7VA 4FVRA 4C59A 2VTJA 5TR6A 2I5FA 4C34A 3KF7A 4Z16A 3C4WA 3EZVA 4OGRA 1U54B 2OK1A 3TIYA 4BDGA 4E4LA 3MI9A 2BPMA 3VRZA 3KU2A 4YTFA 2DX1A 3KXXA 2PZIA 1WBWA 4MD8E 3TJCA 5FEEA 1H08A 2XNEA 3GQLA 2QG5A 4IWPA 4NTTA 2D11A 4QMPA 2W1EA 3A4PA 4ZP5A 4I21A 5AM6A 5JH6A 2FVDA 2YIWA 4FSNA 4RWKA 4E1ZA 2GTMA 2JDOA 2XA4A 1PXMA 4NH1A 1FGIA 4NEUA 1FGYA 5FXSA 2GS6A 2HW6A 2VTTA 3V5LA 4FYOA 4OTDA 1PKDA 3OTVA 3TKHA 4FTMA 3Q9WA 2WO6A 1J19A 5M57A 2X0GA 4RC3A 4E4MA 5K4JA 2BROA 4WRGA 4NY0A 2XIYA 5JHHA 1ZYJA 4K18A 2BVAA 3ZZEA 2PUPA 3UVQA 2V7OA 4U41A 4YZ9A 3V01A 4DT9A 1YQJA 1OIUA 2W1IA 5CF8A 2XK9A 3II5A 3IO7A 2OIQA 2QOCA 3PA3A 5EI2A 4DEAA 4FEVA 2CDZA 2D9ZA 3HA8A 3FSKA 2QOLA 5J3YA 5CNNA 2YLEA 3KC3A 3ACKA 3GVUA 5EFQA 4PDPA 5E8ZA 5LCKA 1G8SA 3R04A 4BTFA 5JFXA 4NM0A 3DOGA 2UV2A 2HZNA 4KAOA 1XH7A 2R7BA 4M68A 5DN3A 4GJ2A 4MD9E 2BAJA 3PFQA 1YVJA 4CHMA 2FSTX 2OJ9A 2WOTA 4FSUA 1V0OA 4NM3A 4FKOA 3UDBA 3GYPA 3AMYA 3NUSA 1FHXA 2C5XA 3C7QA 2X9FA 3LCDA 3BBWA 4FT9A 1GIHA 4FVQA 5H8EA 5IMXA 3NUUA 3RPVA 1E1XA 3PXKA 3LPBA 1FB8A 1ZY4A 2GU8A 4IE9A 4IVCA 3N4TA 2Z7RA 3CPBA 3KRJA 1KZGA 1AQ1A 2VO7A 2XYNA 3AGMA 3OCGA 5ANIA 3I0OA 3PRIA 2NNWB 4CCBA 1YI6A 4G3DA 1QPCA 2IZSA 1FVVA 3X23A 3DXPA 4EH6A 4YHTA 2BTSA 3GFWA 2JBPA 4M12A 2PZPA 5FXQA 3R7OA 1WVHA 5GOWB 4BGHA 2KULA 5BUIA 4XMOA 2RSGA 4FE2A 1BX6A 4O21A 4DG2E 4Y95A 5E8XA 4CKIA 1P4FA 4NT4A 4QP9A 4LGGA 5JFVA 1ZAOA 1U5RA 5C03A 1N3HA 4CXAA 2HWOA 3N4UA 2CNUA 1M2RA 2B7AA 2BIYA 3A7FA 4YNEA 4GU6A 3UOHA 3NW6A 4B9DA 5DRDA 3ZO3A 4IDVA 1UKIA 4G9CA 4XYFA 4QP8A 3AJ4A 2GHLA 3WA0A 1AWEA 3DFCB 3QFVA 3OW4A 5BVNA 4MXXA 2NRYA 2PULA 2QKWB 3SG8A 3LHJA 4FYNA 4R1YA 3FKLA 2VWYA 3DBQA 1R0EA 4FTJA 5EYDA 4PMMA 4EK5A 3F9NA 2YISA 2I1MA 4FIHA 3CTQA 3I6WA 3UO4A 2C5OA 3PVGA 3COKA 3CY2A 2XBJA 1Q3DA 3EZRA 3P78A 2UUEA 4BCJA 5KMIA 3G15A 3KZ1A 2GNLA 2GMXA 2ITXA 3HMOA 3G90X 3BYUA 1PMUA 5J5SA 2HXQA 3QAME 4CKRA 3LMHA 5ETIA 2JBOA 3M11A 4FV6A 3AD4A 5DEWA 4A07A 4BCGA 4BDEA 3SW4A 3FI2A 4FV7A 4ACDA 4FZDB 5CVFA 1OIQA 3D8DA 4L52A 4EEVA 2MKRA 3VF9A 3L9NA 3DV3A 3F2RA 4TPTA 3QLFA 2JKQA 3FXWA 4BDDA 4E6AA 4R3CA 3IS5A 3O96A 5AX9A 3P4KA 3FMNA 3SHEA 1H24A 3MSSA 2ITQA 1YXVA 3R7YA 2ZOQA 4C8BA 3LMGA 4UV0A 5A9UA 4OT5A 3COIA 4TNBA 5F9EA 1DDVA 5C16A 4ZMEA 5CI6A 4D1XA 5DG5A 2O64A 3EHAA 3MY5A 4MEDA 5AP3A 5FTQA 3KREA 3DXQA 4YSJA 5AR8A 4ZS4A 4KBAA 4FG8A 4YJUA 3BKBA 5TO8A 1H00A 3SD0A 2UZEA 3G6GA 3ODXA 5J1VA 5AUWA 3SYXA 4IXPA 1ZXEA 4HJOA 1NVSA 4EOOA 3CCNA 5IUGA 2UZBA 2R3MA 3RWPA 4Y5HA 1IA9A 2YM3A 3JUHA 3OBGA 4CFWA 1H27A 5EH0A 2BHEA 3A7GA 5IUHA 1FOEA 2J7TA 1OL2A 1R39A 3UOLA 5I4NA 1Q8WA 3A7HA 4RG0A 4O7LA 2I1KA 1FMKA 5TF9A 5HG9A 4JOAA 4DFYA 3DBDA 3C0IA 3F66A 3V8SA 3VS7A 5J1WA 4NSWA 3ZDUA 2YFXA 2GHMA 4HGTA 3W8QA 1WG7A 2ZMCA 5HU9A 4DFZE 3ZSHA 3OXTA 4M97A 4LMNA 4BCFA 2VTMA 2QD9A 4FA2A 4IOYX 3D83A 1UEFA 3EQCA 3EFLA 1YDTE 3WBLA 4G17A 3G0EA 5BYLA 4M8TA 4XJ0A 3VULA 4HHVA 4H3QA 2HENA 3R01A 1IEPA 3PIZA 4MXCA 3CQUA 5AJQA 4EK6A 4HYIA 4UWCA 5CAUA 3QX4A 2YT1A 2YRYA 3LKMA 2WOUA 4N0SA 3Q9YA 3BV3A 3NZ0A 3SXFA 2YIYA 4RFZA 1WVXA 4EH3A 3GGFA 5L2TA 3CE3A 2VWWA 4OT6A 4U6RA 5EI6A 2DA0A 1CKIA 1R78A 5M55A 2PVRA 4GFMA 5FM3A 3R8PA 4FNYA 3RAIA 4BYIA 3DU8A 4Z2NA 4IBMA 5JZJA 3PTGA 4BRXA 4KBKA 2C30A 4EHGA 4PQ0A 3HMMA 2OU7A 2OXXA 3K5VA 5IDPA 1O6KA 2JP2A 3ORTA 4O22A 3S00A 2UZUE 4AACA 4YR8A 4O38A 4IX4A 2XRWA 1OVEA 1PXNA 1YXSA 2PE2A 2XH5A 4WD5A 2ITPA 1U5QA 4MTAA 2N23A 2IPXA 3UNZA 3VW6A 1FINA 3K5UA 4QQ5A 5AV1A 5CSXA 2DYQA 1KSWA 5IA3A 1BKXA 4HPUE 3C50A 4MNEA 4YLKA 3F6XA 3V51A 5CSVA 2YS1A 4F7GA 4DAWA 4PP9A 3QUDA 3DY7A 5M07A 3E87A 4LFIA 1YWVA 3BWJA 3FZ1A 4C3RA 2WQOA 1S9JA 4OTHA 4XX9A 1XCGA 1WGQA 3AOXA 5DYJA 4U44A 1DAYA 4X2NA 2HY0A 4X6RA 4C2WA 4L46A 2XKDA 3PZDA 1UWHA 3PJ2A 4LQMA 3UQFA 5M44A 2WMTA 5B2LA 5JK3A 3GNIB 4MD7E 3LZBA 3PJ1A 4E5BA 4FEWA 4GU9A 4MBJA 1PXOA 3UIBA 4RQVA 3BLHA 2ITWA 5EYMA 4F9AA 5HTIA 3A7JA 2F7XE 2F2CB 3ALNA 3DNDA 4QYFA 4RJ5A 3UVRA 3U9NA 1QQGA 1OL6A 4YZDA 3OT3A 5DI1A 2REIA 2CSNA 4QT1A 3F2NA 3KMUA 4O91A 1U5DA 5AFVA 3ZM9A 5C4LA 4M3QA 5J3QA 2D10A 2PE0A 3D5VA 3QF9A 4A6KA 4GG7A 3TNHA 3BYVA 3VBXA 3WZKA 4JBVA 4DT8A 3U6JA 2ZV9A 3T3VA 4K11A 5LJJA 4FG9A 3V5JA 3PG3A 2ESMA 1UA2A 4ZTNA 4ZEGA 3TIZA 2XK6A 3QCXA 2KGXB 2VWUA 3ACJA 4IACA 3ZO4A 3RVGA 5A14A 3U55A 5HICA 5AUVA 3MJ2A 3OTUA 3HV3A 3QYZA 3TL8A 2YERA 1XHAA 2AL6A 4YTIA 4FKQA 4YJVA 3PE2A 3VUDA 2UZTA 4YO4A 5KBQA 2ZDUA 4HAYB 4B4LA 2LKOA 1XX0A 4L53A 3FI3A 5C8MA 1DROA 2QOFA 3NWWA 2W1FA 5TOZA 2LULA 5IEYA 3VJNA 2P2IA 3CTHA 4YZCA 5D3VA 1BYGA 5IKWA 2VNYA 3NIZA 4JBPA 3W2PA 3CSVA 4QMMA 1MRUA 3QQJA 2AC5A 4IH8A 3RALA 4R7BA 1CM8A 1Q3WA 4IWQA 3UZPA 3JXWA 4ITIA 4JNWA 4A9TA 4WJ7A 3PPKA 4HDOA 5FTOA 2WMQA 3DT1A 5ETFA 2DKQA 5FUTA 3D2IA 4Q9ZA 5JFWA 1ZMUA 4MXZA 5AMNA 3KMWA 3ZFYA 5KMJA 1DAWA 1WBVA 4FOBA 3R7EA 1RDQE 5A54A 5I9ZA 2J59M 3ZRKA 1H01A 4LMUA 2DN6A 3I7BA 2WTVA 2X2MA 2XIXA 3IQ7A 3KULA 2W05A 2RIOA 3OUNB 3R21A 4XG6A 4BDFA 3SX9A 2XCHA 2YS5A 3PY1A 2YWVA 5AR7A 1OL1A 4ALWA 2XKCA 1YOMA 4PNIA 3MIAA 4HZSA 3ZCLA 4K1BA 4Y83A 1VYZA 2JDVA 3QRJA 2DYLA 3DBCA 3U51A 4CGAA 2WD1A 3F7ZA 3TFMA 3JY0A 3IECA 3V5QA 4GXBA 1SGHA 4F9YA 2A4LA 2HAKA 4XHKB 1RQQA 2V22A 2JIVA 3LCSA 5DMZA 3VW8A 5HTCA 4C3FA 4IAYA 3IW7A 1IR3A 2FGIA 2B9FA 4PRJA 2VO0A 3QZHA 5CX9A 5HE0A 4WKQA 4GW8A 5CEMA 5L2WA 3FSSA 4A6HA 4DFNA 3L8XA 2UVMA 3MTLA 4HVDA 3OANA 4IX3A 4O1OA 4PF4A 4YJOA 3O50A 5M53A 2HY81 4TT7A 2OXYA 4OBPA 4ZZMA 2G9XA 4QMOA 4B8LA 1W0XC 4YNOA 5CEOA 2W2XD 4FSZA 3I7CA 4EK8A 4ZLOA 3KSYA 4CG8A 3MS9A 4PTCA 4NCTA 3DDPA 3H4JA 4P5ZA 3ORXA 2WEVA 3OG7A 1GC6A 4FEXA 2QNJA 2PTKA 2L1CA 2RFNA 4HYHA 3PPZA 4KIOA 3R83A 4F7LA 3QBVB 2Q83A 1MQBA 4NZWB 4FTLA 3H0YA 4W9XA 5DR9A 3HGKA 1HCKA 3ZC6A 4MNEB 3ZO1A 2ITUA 4R3RA 5HLNA 4JI9A 3NYNA 4IDTA 1KI1B 1DI9A 4E93A 5J9ZA 1QPEA 2XUUA 3NR9A 4J98A 2WTCA 4WT6A 5DIFB 3MA6A 5EM8A 2Q13A 4IHPA 4EWQA 3ZTXA 4G3CA 4HW7A 2P0HA 1YHVA 1T45A 2W5BA 3KFAA 4EORA 2LOXA 4O7SA 4OBQA 2RGPA 3I0QA 4MWHA 4QYHA 5L8KA 4RSSA 4G31A 3I5ZA 5FP6A 3EN7A 4EMOA 4CT2A 4D2VA 3GOPA 5DH9B 4XRJA 2C69A 5C27A 3VUTA 5LWMA 2F7ZE 2GNHA 3KCKA 4ONAA 4UWYA 1XH8A 4J52A 4TWNA 4BCPA 4E26A 3EMGA 2VWZA 3K2LA 4KUJA 2LYDA 4JIAA 3LXPA 3A8WA 4G6OA 4DHFA 3N7CA 4G1WA 4K2RA 3P5KA 2I7QA 4LOPA 1NU2A 3MVJA 5D7AA 5HEZA 4BI1A 1TXDA 3FUPA 2R5TA 1Y5OA 5C79A 4F65A 5K5XA 4A6FB 2OWBA 5JP4A 2R2PA 4GV1A 3VHKA 4NUSA 4UBAA 5HU3A 2C6LA 4YHJA 1XH6A 3UG1A 2XJ2A 3BJIA 4MWIA 5DH3A 4ERWA 3EQFA 3GU5A 4E73A 4YBJA 3D7TB 3VBVA 1BTKA 3OWKA 4EL9A 1XR1A 1ZWSA 3EQIA 4PX6A 4C7TA 4FV4A 3S95A 3MPTA 2YM4A 1H8FA 4C2VA 1H10A 3SNHA 4YJQA 3CKXA 3SDJA 5C1QB 4OW8A 4QO9A 3RTPA 5A4EA 3LVPA 2GNJA 2C5YA 3PXRA 4L44A 4DFXE 5A4QA 5I9VA 2PPQA 1H0WA 4I6HA 3MESA 5D3YA 2W4KA 4ANMA 2NMBA 3IGOA 3MVHA 4LL5A 4PWNA 4FSQA 3UOKA 4O1PA 3F5PA 4C61A 4XCUA 4MT7A 2CLXA 3PA5A 2UW3A 4GK3A 5AP0A 5AP6A 2V7AA 2A19B 3NGAA 3EB0A 1Q5KA 4F6WA 5A4CA 5KUPA 4EYJA 2R3OA 2UZRA 1Q8ZA 1W82A 2J6MA 5CU6A 4YMJA 2I0EA 5IQDA 4J8MA 3HRBA 3RPSA 4W8EA 1W1DA 2VX3A 2QU6A 2QOKA 3NNWA 1J7LA 4Z7GA 2IW6A 3FSFA 4DX90 3WZJA 5HX8A 1NTYA 2C47A 2PUIA 1TQPA 4NM5A 5KMOA 4IB3A 1H4RA 4ZS0A 3RI1A 4QTAA 5EW9A 1UV5A 1KWPA 4EUUA 4F09A 5LVOA 4L3PA 3EYGA 2OZOA 3FC2A 3BINA 3ENHA 3COHA 4GEOA 4YJNA 3D5XA 1ISNA 3HL7A 3VS4A 1Y6AA 4F7JA 5CAPA 3CIKA 4QMTA 2UW6A 3RNIA 3QHRA 4UB7A 2C68A 3QTXA 4AZFA 3ZSIA 2EUFB 3BGPA 4AP7A 2ZMDA 3Q3BA 4EKKA 1WVYA 1A06A 3DKFA 4BDBA 2FUMA 4F1TA 4RX9A 2EMTA 3SW7A 4XLVA 3RAKA 4B8MA 4KINA 5HX6A 3VBTA 3E62A 4C37A 3QTSA 3DZOA 5DEYA 5HORA 3JVSA 1W1HA 1SVGA 4FKUA 3I1AA 4YGAA 4DA5A 3HUBA 3KRRA 3PIYA 3POOA 4YZBA 4KSPA 5E8SA 3F88A 5IA5A 2VTAA 3JY9A 1X11A 3RHXA 2P2HA 3ELJA 4D9UA 2XCKA 2X4FA 3PWDA 4EQMA 3CJGA 5A6NA 1PJKA 3BHYA 1JPAA 2ZM4A 3FXXA 2EMSA 1PRYA 2Y7JA 1XO2B 5CANA 3QHWA 1E5WA 4O84A 1WFCA 3RJCA 3ZHPC 2R3JA 4FV5A 3OCSA 1QMZA 1ZOHA 5F4NA 5AP5A 5JEBA 4LUDA 4ZJJA 3W10A 4C02A 4BY9E 4BHNA 5M4IA 5GZAA 1JWHA 3EFWA 3D4QA 2W1DA 4FTUA 2F7EE 1IASA 1UNQA 5HNBA 2YCSA 1JNKA 3BYSA 5CLPA 1LEZA 3T8OA 2PMNX 3GENA 4D55A 4UZDA 2UZSA 3D15A 5M4CA 3U54A 4UALA 5JQ8A 3OUKA 4CQEA 4HAZB 1K2PA 4WSYA 4Y72A 2COAA 4GT3A 4RFYA 4P7IA 3SRVA 3IKAA 4YPSA 4D4RA 4DG3E 2LGCA 3VQHA 3QKLA 4ZTMA 4IFGA 2QO9A 2ITTA 1Q61A 4TWCA 5I9UA 5I9YA 1XH5A 3QTZA 1PYEA 3HX4A 2A27A 2A0CX 3KY2A 5AUYA 3OHTA 2VWXA 2ETRA 4Y5QA 2B54A 4HYUA 4H1MA 5GIOE 4LV5A 4USEA 3EKNA 4FKGA 2CGVA 3TNIA 3VJOA 4AOIA 3LLTA 3DXDA 3FYKX 3ZVRA 4J99A 4DH8A 3EFJA 4NTSA 3ZFXA 3L8VA 2J0IA 4RWLA 4DE4A 5E8UA 4NKSA 1KZ7A 4S2ZA 5D7VA 1P3RA 5KMLA 2HELA 3QZIA 4FKVA 2LAVA 4EKLA 2AYPA 4RVLA 3NMUF 4JQEA 5IZFA 5I5ZA 2JAVA 4AN9A 5BUJA 1V0BA 2BRBA 3UG2A 3Q6WA 4UMPA 3N9XA 4HAXB 5EHOA 3DXEA 3C0GA 4E20A 4EC9A 1TQIA 1MK9B 3QTQA 3GU6A 3D7TA 4XP3A 1Q8YA 3E8CA 4L7FA 4EQCA 1IAHA 4ANQA 2EWAA 1UU3A 4D5KA 1VZOA 5LARA 4UXQA 1KE6A 3EH9A 2OG8A 4JG6A 4PDOA 4RFMA 3V04A 4RT7A 3VHEA 3O7LB 2J0MB 3QC9A 2GNFA 1HCLA 2AC3A 3PE1A 4BC6A 4QRCA 1P5TA 4I1ZA 5AV4A 3PVLA 3VUIA 4UEUA 5CLLB 4HVIA 1R0PA 4DBNA 3IW6A 1J3HA 3MVLA 1YHWA 3G0FA 2HWPA 5C9CA 4KHOA 2JC6A 3PLSA 4FTQA 3OT8A 3VQUA 3FMLA 4J53A 4RGJA 1KUTA 4ZSJA 4EBVA 3S2PA 3H10A 3SV1A 2PZRA 1MIXA 4TKNA 4HPTE 3RINA 2EXEA 1A9UA 4MKCA 4O0WA 3PJCA 1ZYDA 3R22A 3NNXA 5ITAA 3R28A 5CWZA 5AV0A 3PVBA 5AX3A 5HNGA 3DPKA 3LOKA 3UODA 5FP5A 2X18A 3UYTA 4ZK5A 2Z0OA 3QQGA 4F63A 5AR2A 4HCUA 2QODA 1Y8GA 2AEHA 5HD4A 3ODOA 2PE1A 4FV8A 3O8UA 4N6ZA 5CF6A 2C0OA 4RWJA 2B1PA 3MVMA 4C36A 3NYXA 2IZTA 3I5NA 4NCTC 3CR0A 3LCKA 2G35A 2QONA 1YW2A 4HYSA 4BYJA 5GINE 4CMUA 3IGGA 2W17A 2V0DA 4AA4A 3DJ6A 4AGDA 4ZIMA 2C6MA 2WMBA 4PL3A 3MFRA 5EDPA 3ZUTA 3FLWA 5ACKA 3H9RA 2XM9A 4M66A 3UC4A 5AA9A 2C3LA 5IQCA 5LQFA 3K54A 4KB8A 2NRUA 5E90A 4ASZA 4R77A 4XUFA 5HIBA 1HOWA 4OTGA 4XG2A 2O8YA 3SOCA 4C35A 4C33A 4I5MA 5KHXA 2C6EA 3KVXA 3UTOA 5CEPA 2IN6A 3E8EA 3F82A 4IM2A 4U9AA 4PTGA 4X7QA 3MY1A 3DBEA 4IX5A 4JBQA 3IW5A 4JQ7A 2X7GA 4KABA 4LG4A 3TJDA 1QCFA 2HE7A 1NI2A 4AA0A 3P7ZA 2WAJA 5F1ZA 3KXZA 2O3PA 4QPMA 2PK9A 3FY0A 4AT5A 2IFSA 4YC6A 2QOBA 4BDCA 5LONB 2JFLA 2W1ZA 4F6SA 4CG9A 4BBFA 4MQ1A 2BZIB 4MXAA 3DA6A 1M2QA 3AT4A 4DTAA 3FI4A 5IQGA 3DDQA 5IQIA 3GCVA 5IDNA 2QHNA 4IB0A 4EOLA 4J95A 3DTCA 5DE2A 3JS2A 4Q5EA 3PXZA 2ZDTA 4YP8A 1IRKA 1DDWA 2YA9A 2QQ7A 3F61A 1SM2A 5B2KA 2ZM1A 1FVTA 3SOAA 5D11A 4QYYA 4G5PA 1ERKA 5BPYA 3DNEA 4AS0A 5HIEA 5F20A 5HESA 1M7QA 2CPKE 3GCPA 2C3IB 4JT3A 3WF7A 4HAVB 1PYXA 3UZRA 3R9DA 2BKZA 3IDPA 3EIDA 5M4UA 2Y8FA 3L8PA 2PUUA 4FV2A 5HVKA 1VYWA 5K0XA 3UQCA 4CD0A 4XG3A 5JKGA 1JKSA 5D3XA 2H96A 3GQIA 2BRHA 1OKYA 2J9MA 4IM0A 3QIJA 3FZOA 4H3PA 3C4XA 2Q0BA 2XQNM 1L3RE 3Q53A 2MWNB 4ANLA 3A8XA 3HDNA 4Y73A 1Q8TA 3MB6A 3ID6C 5IMEA 4WNKA 3ATTA 5L8JA
chains in the Genus database with same CATH superfamily
2WQBA 4I6LA 5G1XA 3B8QA 3E7VA 4EC8A 4MUQA 2PVKA 4JS8A 3QQHA 3ANQA 4O0VA 4OTIA 2WQNA 3UOJA 4XH6A 2VTOA 1OL7A 3FZRA 5CYIA 2D2QA 4O7TA 5I0BA 4FKJA 4ID7A 5HBHA 2ROVA 4AU8A 4B0GA 1VJYA 2B9IA 3E3BX 3UMXA 1GIJA 4M0YA 2FO0A 2VO3A 4IADA 4CZUA 3D8FA 4DIXA 3QWKA 1ZM0A 3F3UA 4F99A 4EH5A 5E1SA 3QCQA 4ACCA 3Q2MA 1H1WA 2YLFA 2R09A 3DKGA 2XB7A 3F3ZA 3P0MA 3E64A 4MAOA 4XV2A 3HRCA 3C5IA 2Y0AA 2X1NA 4FJVA 5E8YA 3O23A 4AAYA 3AD5A 3RCDA 1PKGA 3BEGA 4GSBA 3NRMA 4IX6A 4DG0E 3U6HA 2M38A 3DB6A 2BZJA 2W1CA 4Q9SA 2Y8GA 3SC1A 2CN8A 1APME 3ETAA 3OC1A 3Q6UA 4UX9A 4A9RA 3PSDA 3FMKA 2WMWA 3AC2A 3EQBA 1I7AA 3IK3A 5CEQA 2OJGA 3OCTA 3EN9A 4BBMA 4EK3A 5CU2A 4OT1A 5FI1A 1BLXA 2WQMA 5CVGA 5DLSA 4DEEA 4UZHA 3EN5A 4R6VA 5DR2A 2YIQA 4FBXA 3AC5A 4I24A 4MQ2A 4X21A 2QLQA 3FMMA 5CT7A 5ANGA 5DT3A 4CV9A 3HZTA 3QRIA 2CLQA 2OI4X 3R6XA 3IG7A 4EYMA 3QKMA 2G15A 1WBSA 2I0YA 2QHMA 2UW5A 3F3WA 4KIKB 4M0ZA 3ZSGA 2W5AA 4B6LA 4G9RA 5HIDA 4E8AA 2C4GA 4O0UA 5CS6A 2P8VA 3T3UA 3G9WA 2BALA 4AGWA 3PEGA 2DS1A 3P6AA 1EF1A 2FSLX 2WMRA 1B55A 2YITA 1YOJA 1OI9A 4RRVA 1V61A 5CXZA 2CAYA 2R3NA 4R8QA 3RPOA 3NEWA 3HLLA 4R3PA 4A5KA 4QP3A 2VX0A 5HQ0A 3VIAA 2OICA 5HG8A 3NVMB 4HGEA 1PMSA 2XIKA 4NKAA 2GNGA 1DYNA 4BVUA 4ZZOA 4TZRA 3BELA 3F5GA 1OB3A 3GBZA 5JHGA 2CKQA 2I6LA 5I9WA 3QQFA 3QQUA 4D9TA 3ZLSA 2VX1A 1ZYCA 4EOSA 2ZAZA 3TV4A 5LG4B 4YUQA 1PMVA 3R8LA 1PY5A 1X8BA 1ZZLA 3CBLA 2EC1A 4CTBA 4X6QC 5A4TA 4YJPA 5C6RA 3KMMA 4YHFA 4IZ5A 3QQKA 3ZRLA 3TZ9A 4EH7A 1OIRA 4FI1A 3BHUA 2C6DA 4F7NA 3IPHA 4BTKA 4BKYA 4HATB 3G2FA 3PWYA 2BAQA 4U79A 4QMQA 2PMOX 2EXMA 5GJDA 3LFEA 4PUZA 2PVYA 2W4JA 4IAKA 4ACHA 2CCIA 2E9OA 5T68A 3UIMA 4BKZA 4M69B 2E9VA 4FV9A 3LFNA 4WOVA 4F9WA 4FT5A 4MBLA 2CCHA 1OMWA 4CFXA 2YZLA 3MPXA 5AP4A 4YJRA 4G2FA 3ZM4A 4QTEA 2W5HA 3OROA 3TN8A 4QDVA 3W0MA 3GCQA 4FEUA 4WG5A 1ZYSA 2IEWA 4L00A 5EG3A 4AZEA 4YPDA 3VRYA 1XR0B 4GFOA 3R7UA 4I0TA 2R7IA 3GCUA 2WIPA 3EQPA 3I81A 3VWAA 2N0YA 1NVQA 4DEIA 2E2XA 4YL8A 1G8AA 1U5FA 4J96A 2H7EA 1URCA 1KOBA 1H28A 4H1JA 4F1MA 4K0YA 4AT4A 2IZRA 1ZYIA 3HP2A 4GH2A 1OL5A 2VWVA 4LV8A 4EH4A 2PL0A 3IVFA 3ORNA 1ZRZA 3EKKA 3OBJA 2I0HA 2WTKC 2EVAA 4QMSA 5CU4A 5E8VA 4BGQA 2BRNA 1JSVA 4GIIA 2X6EA 3QXPA 2IWIA 3REPA 4QDEA 3WIGA 3BL7A 1YHSA 3A98B 4K2PA 3HV4A 4IVAA 4DH1A 3QBNA 5J79A 1ZOGA 4XG9A 2WFYA 4BIEA 4NJ3A 1ZZ2A 4KHAA 1UNLA 5FWKK 3LE6A 3FXZA 1WI1A 2DHKA 4IFSA 3LFCA 2AQXA 2PVHA 5FQDC 5E1EA 4PPAA 4U80A 2WMXA 2A1AB 1O9UA 1V0PA 3HV5A 4BZDA 2OJIA 1ZYLA 3FQHA 3G5DA 4O7YA 4WO5A 4XLIA 4C4FA 2GJYA 1M14A 3A2CA 4FSRA 3MDBC 3VUMA 4FTNA 2IW8A 1LR4A 3NSZA 5JGBA 4WBOA 4AG8A 4E4XA 3F5UA 3L1SA 2Z7LA 3R2YA 4BB4A 4BCOA 4Z2MB 2WMVA 4IZ7A 3RM7A 4OAVB 5FTGA 1OQNA 2QO7A 3SA0A 3CPCA 3Q4UA 3HKOA 3KKVA 2XK4A 4L9IA 1JOWB 4GT4A 4AX8A 3MV5A 4QQJA 3QQLA 2QCSA 4FEQA 1KV1A 3MB7A 2UZLA 4M15A 4R5SA 3VIDA 2MDXA 2YCRA 3VAPA 3M1SA 3TUBA 4PMSA 4H3BA 2YVCA 4HCVA 2I1JA 2ZKMX 2VTIA 2XMYA 4TWOA 4KVGB 4XOZA 3TCAA 1ZLTA 4U5JA 4DFUA 3EWHA 3R71A 3ULZA 5KZIA 3NWFA 2YWPA 3UC3A 4BF2A 3U8WA 3D14A 2YJSA 3AC3A 3D7ZA 5KQ4A 3KRLA 3NW5A 5HCXA 5C5BA 2YACA 4GG5A 3FHRA 1M7EA 2QKMA 5AP2A 4KA3A 4RJ6A 5BVKA 3U9CA 5BVOA 3FZTA 2XVDA 3RK5A 3CS9A 4IB5A 4IANA 3ZFMA 4QMVA 5BVWA 5FGKA 2OH4A 4I6QA 3E8DA 2W06A 3R30A 1YOLA 4X2FA 5FBNC 1BI7A 4U45A 5CLQB 3NFGB 4YU2A 2W0JA 2W9ZB 4MH7A 4KIKA 5IU2A 3PRFA 5L6OA 3WYFB 3NNUA 4J8NA 4KKEA 3Q4ZA 4OLIA 4JXFA 4DDGA 3OXZA 5JMSA 4HDQA 2YDKA 3Q5ZA 5J8IA 3GI3A 5AAFA 4O0YA 4UYAA 4YTHA 3VBYA 2C3KA 4ASDA 2CHLA 5GIPE 3BIZA 3KA0A 4F6UA 4MXOA 4L8MA 1X1GA 2GS0A 3HIEA 1M17A 4FSTA 4I20A 3FV8A 4WG4A 5ANKA 2RFEA 4DGNA 1WAKA 1CDKA 3VNTA 1OKWA 2W2XC 3M1IB 3BU3A 2FH9A 2AEGA 3ATSA 3A99A 2R3PA 1GAGA 4IIRA 2JGZA 3LJUX 4FVPA 5ANJA 2IVSA 2HOGA 5IA2A 4RIXA 4EH9A 2YSZA 3EL8A 5DVRA 3WYYA 4ZMFA 3RM6A 1V5MA 2X4ZA 4PQNA 3TW1A 2R3IA 3KN5A 3DJ5A 4D58A 5CQUA 5ANOA 2W1HA 2X8IA 5HTBA 1X1FA 2R3GA 2QVSE 2P0DA 2GPHA 2XYUA 3IDBA 3GFEA 2BR1A 3QKKA 4U97A 2Y6OA 2RL5A 3LXKA 5BQ0A 3AQVA 4GFGA 4EK4A 2RFSA 3FEGA 5FDPA 2C6KA 5DGZA 3EN6A 5HBEA 2J51A 2WMUA 3W32A 2PMIA 3QRKA 1BAKA 3E92A 3F7WA 5HOAA 2UZWE 4OTPA 4L6EA 1AGWA 4QP4A 3S4QA 5AIRA 2H8HA 3VF8A 4O0TA 1T46A 2PZYA 3AC1A 3GU8A 4FNXA 3ZYAA 4CCUA 3MGYA 4GS6A 3BQCA 4DTKA 4FF8A 3CXWA 3QD2B 5CSHA 1FPUA 4D4YA 5IA4A 2OZAA 4QP1A 1PFJA 4JIKA 4NFMA 5J3TA 5IG1A 4DLJA 1ST0A 5DIAA 2R3HA 3DCXA 2M14A 3C13A 2IYBA 4JR3A 1F5QA 1XJDA 3WE8A 4O81A 2O5KA 4WNOA 1SZMA 4XV1A 1PXIA 1UNGA 1JSUA 3THBA 3GC9A 1OGUA 5AWMA 1LP4A 3I79A 5JZNA 4BIBA 1WBTA 2PY3A 4F0FA 4ANBA 2QOOA 5CY3A 4R7IA 5FEDA 3ODWA 3GC8A 1PHKA 3OW3A 3BLQA 3RHKA 1YWNA 5CT0A 3IW4A 3H0ZA 1SVHA 3PY0A 2Z4DA 2WZJA 3ITZA 4K8AA 4PL4A 4X3JA 4JQ8A 4A9YA 2YT0A 4ZTLA 2IO6A 2RG6A 5HE3A 5M4FA 3N51A 3HUCA 2B4SB 4FZ7A 5ETCA 1UWJA 5DT4A 3SAYA 1M2PA 3FEHA 4YONA 4RZWA 2QG7A 2XAMA 5HGIA 4L67A 4I23A 4O27B 3FMJA 3MPAA 4Y46A 1KE5A 3QXOA 3FYJX 4O0RA 5AP7A 2HZIA 3R8MA 4U8ZA 1QPDA 4CTCA 1QC6A 4F70A 3BE2A 4RVTA 4QYEA 3NUAA 4TYJA 4EBWA 5IA0A 1OIYA 2Q0NA 4X2JA 4S34A 3P7AA 5EQYA 4I22A 3BE9A 4AWIA 4DITA 5C8KA 3ZLXA 4QJ5B 1A48A 2VTPA 3AMBA 3OCBA 4AZWA 2ADZA 2A2AA 5A4LA 1EH4A 4QQCA 2E9PA 2VD5A 1NW1A 2OJFE 4M7IA 2HK5A 3M2WA 4GK4A 4FV0A 1YDRE 4U3YA 4V0GB 2EB2A 4ZZNA 2R0DA 4KIPA 3OOMA 4PTEA 3FJQE 4YJTA 2QURA 1TKIA 4BDJA 3LQ8A 4CT1A 2O63A 4JG7A 2O0UA 3PY3A 1YI3A 4JAIA 3FI8A 5EHLA 1R1WA 5C26A 3PG7A 2J0JA 2K49A 3TDVA 3VC4A 1G8JA 3LJ1A 1WBNA 2Y6MA 4KS8A 4TXCA 5HLWA 5LVNA 3OZ6A 4KWPA 4J1RA 3FQSA 3PA4A 3CD8A 4KRCA 4O4DA 1UPRA 4D4SA 4I0SA 4MY6A 3AMAA 5IH4A 1OPLA 4JDIA 4NM7A 2C6OA 4UN0C 2VZ6A 3U6IA 5D41A 4AOJA 3ZDIA 3QTUA 3POZA 4BCKA 2EB3A 4FTIA 5M51A 4RWIA 1MIZB 4PDYA 2DFKA 3CQEA 3VOQA 4LUEA 4AE9A 3R0TA 2X7OA 4RIOA 4AFJA 4KNBA 2BIKB 3BBTB 3LIJA 5DHJA 1Z9XA 4L42A 2Z59A 3NX8A 3CP9A 3FKOA 5GZ8A 4UMQA 4O6EA 4XP2A 2GTNA 2LG1A 4AXCA 4HVGA 2VO6A 3TDWA 4FSWA 4NW6A 5DPVA 4U81A 4JX3A 4AW1A 4BWXA 1NT2A 3O8PA 3PVUA 4DEHA 1H4LA 1PXLA 2CJMA 3I60A 4IAPA 3MH3A 1JKKA 4XRLA 2IW9A 4EH8A 3FBVA 5HZNA 4ANSA 4DTBA 2NPQA 2WU6A 2B53A 4ZY6A 1REKA 2JDRA 3ZS5A 3O7LD 1ZMVA 3F5XA 4EOMA 2JKMA 2CGXA 3KGAA 2HCKA 2XZSA 3GUBA 4AN3A 2I5CA 2WMSA 4HSIA 5CAOA 2ITNA 4EOQA 3UO5A 3V6RA 3MN3A 3KVWA 2WHBA 1FGZA 4C4GA 2D9VA 2PUNA 4LRKA 2Y9QA 1Y91A 3D94A 2ZV8A 3P79A 1P14A 5K4IA 3AXWA 1MP8A 4RIXB 1V1KA 2OQBA 3PDTA 1VLRA 4BZOA 4EZ7A 4HB2B 2P3GX 2BHHA 3TUCA 3SGCA 4JRVA 4I5HA 3C0HA 1H26A 2UVYA 3HMNA 5EKOA 5ANDA 2V62A 5LMKC 5M06A 4CZYB 4ACMA 1O6YA 5IQEA 2HYYA 4M14A 3PIXA 3VS1A 1H0VA 3JPVA 2BFXA 3KXNA 2DHJA 3NCGA 4QJ3B 3TXOA 3LM0A 4X3FA 2K00A 4D5HA 1XKEA 3P5JC 3T9TA 2JLDA 3P23A 4H58A 3EFKA 4XS2A 1M7RA 2W4OA 4FR4A 4XG7A 4BDIA 2WXVA 4P4CA 4WSFA 1YDSE 2GQRA 4FL2A 4J7BA 4DEBA 4JLCA 4ZTSA 4CLJA 4PP7A 2OZAB 3TZ8A 2BILB 4ERKA 3RCPA 5IQFA 3QZGA 1EGXA 1OM1A 4KHBB 4I6FA 2IVVA 4F4PA 4IW0A 5BNJA 1O6LA 1XBBA 5IPJA 1FHWA 5I9XA 1UU9A 2ZPYA 4IC7A 5EI8A 1DDMA 2PWLA 3OEFX 5L4QA 4P5QA 3BHTA 4RJ4A 4ZY4A 4O7ZA 3P08A 4G6NA 4FICA 4KKGA 2VTQA 3FMDA 4L45A 3ODYX 3OVVA 2X81A 2VTNA 4FZ6A 1MUOA 3UDTA 2VV9A 3ZXZA 2XIRA 3QLGA 4LYNA 2C5NA 2R3QA 3KXMA 3QTIA 4W4VA 4E6DA 2VN9A 4F9BA 4PMTA 4R5YA 4EONA 5GJGA 1ZOEA 4IWOA 2GFSA 5T3QA 5KBRA 2OW3A 5HO6A 4APCA 5DFPA 1H1QA 4ENYA 2BRMA 2UW0A 4W4YA 3PP2A 3DCVA 2XJ0A 3O8TA 5I3OA 2ITZA 3BHVA 3KXGA 4OBOA 4GT5A 4LRMA 1XH4A 2X0OA 4OTFA 4RPVA 2DWBA 1K9AA 3QGYA 4OTQA 3WF9A 5CF5A 5JSMA 1OBGA 2V55A 4QMLA 3MYGA 4CEGA 3HQCA 2GUMA 3MA3A 2R3FA 5L6WL 3W0OA 2YN8A 4BCNA 4CV8A 3QC4A 3DXNA 4LRJA 3EQDA 5CSWA 3ZMMA 5IISA 5KKRB 2D9XA 2CKPA 4ZLZA 5KMNA 5CALA 1GG3A 4FIEA 4XP0A 2E9NA 2CY5A 5AIKA 3W1FA 2G1TA 1GZKA 4CSQA 4ALVA 3CEKA 4IEBA 4V0GA 2J4ZA 5ACBC 4GYGA 3NAYA 4EJ7A 2OXDA 2VTHA 5LXMA 3PLAE 1B38A 2VWIA 5EKNA 4GVAA 3IONA 2MFQA 2OTXA 3QUEA 2B0QA 2XK8A 2YAKA 2Y4PA 4GKHA 1YXTA 4JR7A 4ZSGA 3TKIA 3TTJA 4TWPA 4ZRJA 4EJNA 2X2LA 1CTPE 3HMIA 3FY2A 4O7WA 1H1RA 4BCMA 4R78A 2HW7A 2XEYA 2XNOA 4FG7A 3PYYA 3W18A 2FSOX 3DKCA 2PSQA 4DBXA 4YC3A 2QLUA 3MFTA 3QD4A 3RWQA 3HK0A 1Q41A 1UU8A 3ZDTA 4EOJA 4XV3A 3TEIA 4O86A 5A6OA 2WGJA 5K3YA 3L8SA 4J71A 2JD5A 3ZEWA 4DC2A 3O51A 1OPJA 4IZAA 5F94A 3TCPA 1B39A 3MH2A 3RP9A 4OSNA 2J0LA 4AFEA 5CSPA 4IVBA 2X6DA 2KUPA 3FWQA 5KMMA 3W0NA 4CRSA 2ACXA 5HG7A 2ROZB 2YDJA 3DGKA 3H30A 2P4IA 2RKUA 3MY0A 2YS3A 1SNUA 3BZ3A 4WUNA 5FDXA 4II5A 5LOHA 2RRFA 4IFCA 3WOWA 5KCVA 4Y85A 4A9SA 5BVFA 2Y8OA 4S32A 3QWJA 4IAZA 2IG7A 5ICPA 2RF9A 2OJJA 5TT7A 3C4ZA 5L8LA 4FK3A 4UMRA 3ROCA 2VKIA 1ZY5A 3W0SA 4N70A 3PJ8A 3LLAA 3QD3A 4RC2A 2PHKA 4JBOA 3U7DA 4Y8DA 4RZVA 3R9HA 4HVHA 1IAJA 4GCJA 3DB8A 4LGDA 5AR3A 3KRWA 2YCQA 4G3FA 1YRPA 3P86A 3FE3A 2Y4IC 3ERKA 2I40A 3NWDA 4BDAA 1ZVRA 3HP5A 3LXLA 1W98A 2WELA 3O2MA 3KF4A 3TNQB 3CQWA 2X8DA 1R3CA 2WEIA 3GU7A 3OFMA 5M4YB 3CKWA 3D2KA 5F95A 3LFBA 2XK3A 1E9HA 2XIZA 2WTIA 3NUNA 1JVPP 1U59A 1J91A 3NAXA 4L3LA 3R8VA 3UIXA 3V5TA 5J95A 5EW3A 3L9MA 4G34A 4BICA 4E6CA 3SVVA 2Z0QA 3NYVA 2RSVA 3L9LA 4A9UA 4MF1A 3NW8A 3UO6A 4CYEA 4JDKA 1J1CA 1AQCA 1LPUA 1W83A 4CVAA 1TVOA 4IC8A 2CKOA 4H05A 3B2WA 3LCOA 1CKPA 4B99A 4OTRA 4AZTA 4MBIA 2CY4A 5BYZA 2UW8A 3KN6A 4I5CA 5DBXA 3VS5A 3OP5A 4W4XA 3TKUA 4DHZA 4I0RA 4DHJA 1VEBA 2WTWA 3W2RA 1NTVA 5EYKA 1UNPA 1IA8A 2YZAA 3DKOA 1XWSA 1IRSA 1DI8A 3HV7A 5E4HA 4X3FC 4FSYA 4FSMA 4GIHA 2O2UA 3VUHA 4A4XA 4KKHA 2VAGA 5DOSA 5AAGA 1CKJA 2ITYA 3OD6X 3ORLA 4TNDA 1B6CB 3QL8A 4KIQA 4RJ3A 3SKCA 2XF0A 2NYAA 3FL5A 4DF3A 2KIEA 4CHJA 3LFFA 4QPSA 4QMXA 3R9OA 3FLQA 3H9OA 3DS6A 4USDA 5HI2A 5JFSA 4TYZA 3TZ7A 5EDQA 1H07A 4AOTA 4ALUA 5M08A 4L3JA 5H8GA 4HAWB 2XM8A 4FL3A 4O96A 3UQGA 2HZ0A 4V01A 4D0WA 3HRFA 3NDMA 3MWUA 2XEZA 3UE4A 3MIYA 4HZRA 3RZFA 5TKDA 3UYSA 4ANNA 4BHZA 3UNJA 2QOIA 4FTCA 4FZAB 2CODA 3UDSA 4GOUA 2QR8A 3BPRA 2X8EA 1YXXA 3RKBA 1LB1A 1GZOA 2RLOA 4GMVA 4HNIA 4FRFA 3QTRA 2FB8A 5J9LA 4RX8A 3A4OX 1PLSA 3OXIA 4P7EA 2QC6A 5GHVA 3JR1A 3Q2JA 5FLFA 3DLSA 5AUXA 1F0QA 1RRPB 5JLJB 4MNFA 3E5AA 4O2ZA 1FGKA 2XNGA 2UVXA 4RIWB 4AAAA 1PXPA 3NW7A 3ZONA 2X2KA 4HB0B 4WVFB 4QP7A 4Z3VA 1G5SA 2BFYA 4YLJA 3LFSA 1UVRA 4LI5A 2PVNA 4RA5A 5H2UA 1XQZA 4EQUA 1TQZA 4ZXTA 2E2BA 3WI6A 3ZLYA 3BU6A 2NBVA 3AGLA 4KSQA 4FX3A 4KD1A 2A98A 4O0SA 3DFAA 4ZSLA 4YZNA 2QKRA 5AP1A 1BI8A 2KTYA 3IOKA 4FT7A 4FUXA 1GIIA 4XBRA 1OY2A 1ATPE 4DGLC 4FT3A 3OOGA 2QI8A 3EN4A 3DAJA 4QTBA 4WA9A 3SXRA 5HNIX 2F4JA 4RJ8A 5EYCA 3UP2A 4NIFB 4K9YA 4FGRA 4TYIA 3MFSA 5CZHA 3CGFA 3RMFA 5AUUA 3OWJA 4XG8A 4RIYA 4J97A 3KB7A 4NW5A 4E3CA 4CFUA 2ZVAA 3HECA 5KNJA 1XBCA 1ZC4B 5JRSA 3T9IA 1W1GA 3TNWA 2COCA 3W55A 2H9VA 4PDSA 3AG9A 3ORIA 4EWHA 2D9YA 2QOHA 1PXJA 4O0XA 3ZBXA 5KQ1A 2GCJA 3CJFA 3UVPA 2Z14A 2E9UA 3Q32A 4ACGA 2GCLA 4CSVA 3OMVA 3AD6A 2QU5A 5D9HA 3TT0A 2UZNA 2ZV2A 4D2TA 2F2UA 5BMSA 3TUDA 3ZLWA 3GOKA 2Z02A 3MTFA 3MPMA 4CFMA 3GEQA 4BGGA 4TYGA 1W2DA 2WMAA 4L43A 4O2PA 3NCZA 4ZRIA 4FGBA 2J2IB 3KL8A 4LL0A 4I94A 1ST4A 3GCSA 4FIFA 4MHAA 3VUKA 3QCSA 4V04A 3WZDA 5FXRA 3S1HA 1WGUA 2VSZA 2X9EA 4CFNA 3R1QA 4TYHA 3G6HA 3RK9A 3ZUVA 2DYNA 5DA3A 2DHIA 5CU0A 4ZSEA 2Z8CA 3HYHA 1J7IA 2OGVA 4GKIA 3G9LX 3PG1A 5CAQA