5KCVA

Crystal structure of allosteric inhibitor, arq 092, in complex with autoinhibited form of akt1
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
433
structure length
353
Chain Sequence
b'IVKEGWLHKRGEYITWRPRYFLLKNDGTFIGYKERPAPLNNFSVAQCQLMKTERPRPNTFIIRCLQWTTVIERTFHVETPEEREEWTTAIQRVTMNEFEYLKLLGKGTFGKVILVKEKATGRYYAMKILKKVLQNSRHPFLTALKYSFQTHDRLCFVMEYANGGELFFHLSRERVFSEDRARFYGAEIVSALDYLHSEKNVVYRDLKLENLMLDKDGHIKITDFGLCPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHEKLFELILMEEIRFPRTLGPEAKSLLSGLLKKDPKQRLGGGSEDAKEIMQHRFFAGIVWQHVYEKKLSPPFKPQVTSETDTRYF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RAC-alpha serine/threonine-protein kinase
publication title Discovery of 3-(3-(4-(1-Aminocyclobutyl)phenyl)-5-phenyl-3H-imidazo[4,5-b]pyridin-2-yl)pyridin-2-amine (ARQ 092): An Orally Bioavailable, Selective, and Potent Allosteric AKT Inhibitor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/inhibitor
total genus 90
structure length 353
sequence length 433
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2016-06-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
A PF00169 PH PH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 5kcvA03
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 5kcvA01
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 5kcvA02
5DIFB 4HCUA 5AV4A 3A4OX 3ZSHA 4DT8A 1Y91A 3OBGA 2X0GA 4JQ7A 2EC1A 4KHBB 1U54B 3AT3A 3KGAA 4ZSGA 5LJJA 5KKRC 3POOA 3ULIA 2ZM1A 4O27B 1QPJA 2HXQA 4OW8A 4RLLA 3R7UA 3DCVA 3GFWA 4RJ7A 5EK7A 5E92A 4YJQA 3UIMA 3R8UA 5AUTA 2R3GA 3NRMA 1F5QA 2ERKA 4IB1A 1REKA 2HY0A 5ANKA 5EI8A 3DXDA 3KY9A 2PU8A 4FEVA 3CTQA 4O0RA 4AOJA 3QAME 4EORA 3R9OA 4E4MA 4AP7A 5DR6A 1V5MA 1R39A 5IQFA 3A7HA 2K2JA 5M57A 3C1XA 5IA4A 3SNHA 1DM2A 1FB8A 2W9FB 4EONA 1XH7A 5C79A 3DV3A 4R7BA 4R8QA 4LYNA 4USDA 2J90A 2J0IA 4HAYB 4YUQA 2OZAB 5AUXA 3I4BA 5IPJA 3CE3A 3FBVA 1J91A 5CQWA 5K9IA 5LMKA 3NMUF 1O6KA 5CNOA 3H0ZA 5J5TA 4FTCA 3D7TB 3A7JA 4GVJA 3VBWA 3UC4A 4DEBA 4DINA 5KMOA 1UNRA 3SV1A 4H36A 1KE9A 5A46A 5I9WA 5GZAA 4RWIA 4NU1A 1NW1A 3UYSA 4YJTA 2FA2A 2RL5A 4YLKA 2PE0A 5FI0A 4YC3A 1MRYA 5CEQA 4AS0A 3C4XA 3S0OA 2X6DA 3PY1A 3QWJA 4O1PA 3PXRA 2YRYA 3KXNA 2W1HA 4KRDA 5IA3A 4MHAA 5K5NA 1P5EA 1SYKA 2VWVA 3TZ8A 2YIQA 4O96A 5JP4A 2OG8A 2UVZA 3HRBA 3JY9A 4DBXA 3UO4A 2R3HA 3NW5A 1I7AA 3IW5A 1T45A 3FE3A 4AGUA 1XO2B 3RKBA 3AOXA 3DNDA 5EI2A 2WAJA 3RM7A 4AZFA 5KCVA 5KZ0A 3CS9A 4EWQA 4F99A 4AXAA 4X3FA 2M38A 3E88A 5KBRA 2W1EA 4PV0A 4FI1A 4FA2A 2QOKA 2WGJA 1GZNA 3LCSA 3R30A 3I81A 3WZEA 4IAFA 3ZH8A 4HOKA 5CEKA 1IAHA 3VBXA 3VUGA 4F7LA 1MP8A 3T9IA 4U7ZA 4GN1A 1GIJA 4KA3A 4JR7A 3RI1A 2HWOA 4YSMA 1J19A 3IW7A 1KE8A 3GCQA 4FIFA 2PMIA 3CTHA 4YHFA 1IEPA 4F9YA 5K4JA 3DOGA 3QKLA 5M55A 4KIOA 4A4OA 3VVHA 4X0MA 1FVVA 4JQEA 1FHXA 5CY3A 5DFPA 3RK5A 3X23A 5FLFA 2ROZB 5I4NA 4BKYA 1IA8A 3HV5A 3LQ8A 1JPAA 3MY5A 4CTCA 3QZGA 3NUNA 4NIFA 3VHEA 5FBOA 2IZRA 2C6EA 4HGEA 1SGHA 2IG7A 4OTPA 2OSCA 4BDAA 2XS0A 4EH4A 3A61A 5EQEA 3B2TA 5C5BA 3CC6A 5B2KA 1H07A 1JQHA 5EW3A 4JS8A 4L01A 1BYGA 2CCIA 5HLWA 4XV3A 1Q62A 4TRLA 3ZRKA 4PDPA 1MRUA 2C6KA 4C37A 1A06A 3BJIA 5M07A 1B38A 2F7ZE 5BPYA 3TUBA 3BHYA 4M15A 4BDEA 5HD4A 4QT1A 3GT8A 5FTGA 5E7RA 3TJDA 4BIEA 3TZ7A 3UBDA 2XF0A 2DHJA 3V5QA 4PDYA 4O0UA 3BGPA 3BLRA 3QRUA 3HMNA 1MRVA 3C4EA 3DLZA 3SV0A 2WFYA 4ASXA 4FVQA 2CLXA 3VC4A 3RNYA 2R7BA 4E7WA 3ANQA 2VZ6A 3HKOA 1YOLA 4I21A 3U9NA 3C13A 4WJ7A 3DJ6A 5DBXA 4YZNA 2UZVA 3R0TA 3ZO2A 4J97A 1QQGA 1YOJA 2YLEA 3ORPA 4IOYX 1OITA 3GQIA 4X7QA 4AACA 4C3PA 3NSUA 2YZLA 3P4KA 3H9RA 3R1SA 4ZOGA 2K2UA 4FNWA 4UMRA 2B0QA 2RFDA 5KMLA 3E62A 3AC4A 3HUCA 5T6KA 4EKUA 5JN2A 2OK1A 1ZZLA 2OW3A 4AN2A 5E8VA 4FNXA 4NT4A 4RIOA 4B4LA 2OU7A 3IOPA 1U5QA 2W5AA 5D12A 3N4VA 1OI9A 4O84A 2OJGA 3EKNA 4ASDA 2BUJA 4UBAA 2GS6A 3F88A 5I9UA 3GC0A 3IPHA 2WTWA 2WOUA 4U43A 3LQ5A 1YW2A 4BGHA 2PVKA 5C16A 1UV5A 3DFAA 4XYFA 4ZTRA 2YABA 4JG6A 1P5TA 4GIIA 3QQGA 1BKXA 3U6IA 3OT8A 2NMBA 4DTAA 1AGWA 4RWJA 4X3FC 4FOCA 1W1GA 3TKUA 4A5KA 5AMNA 3R1NA 3MYGA 2IW6A 1Q3WA 4X3JA 2QOLA 3QQLA 1PYXA 3LHJA 2C30A 2Q13A 3R2YA 4EUUA 2YWVA 3NLBA 4G3CA 2Y8FA 4DFLA 3ML4A 3BYMA 4XRJA 1EH4A 3OUNB 3E3BX 1B39A 3E5AA 4WBOA 3HV6A 4IB3A 3GC8A 2UUEA 2ZV7A 5KHXA 3HVCA 1X1GA 2NZ8B 4V05A 4D28A 2ITWA 2H6DA 5IA5A 5B2LA 5BUEA 2UZEA 4HNIA 5DLSA 4C36A 4EMOA 3UO6A 2F57A 5J3QA 4FG8A 5HCXA 4TY1A 3BI6A 4FYNA 1V5UA 4NSTA 4HGSA 4GMVA 1FMKA 5HESA 2GMXA 1YWRA 4EOPA 3VIAA 3CXWA 4C62A 3TNPC 4CNHA 1V5PA 3C4FA 2YN8A 2J50A 3R28A 3ALNA 4FKTA 3DA6A 4FTNA 3A60A 5DEYA 2WEIA 3MI9A 4D9TA 4HJOA 5LXMA 4XP0A 2UZNA 3QLFA 4NJ3A 5FP5A 3TKIA 5A6OA 4NYEA 3SXRA 4WO5A 5H8BA 4M13A 3FMNA 2R09A 4HNFA 4LRJA 3W2CA 3CCNA 3ZTXA 4KIQA 5EM7A 5KNJA 3BZ3A 2Z7LA 3QTXA 5H9BA 4HB2B 2E9OA 4PPBA 1KUTA 3AGMA 5BMMA 3CY3A 3PVBA 1ZYLA 3ENMA 2VTOA 5IH6A 3QD0A 3GGFA 5D3XA 3Q4ZA 4KIKA 4YHJA 3OBJA 4EL9A 2V22A 2HENA 5EFXA 3U4WA 3FMJA 2D9YA 4X2FA 4AA5A 4CCUA 4DBNA 4JXFA 4G34A 4EHZA 2AEHA 4YBJA 5HNBA 3N7CA 2YIRA 3A8XA 4TXCA 2O65A 2PVRA 3GC7A 2DFKA 5KO1A 3GXLA 1WJMA 3G6GA 4D0WA 4RX8A 4O7NA 1J1BA 1UNLA 3MDBC 2X8IA 1H26A 4K2RA 5IDNA 1STCE 5BNJA 4DCAA 3TDWA 4XCUA 3GB2A 3PP0A 2ZDUA 1WGUA 3KXZA 3REPA 3O23A 5GJFA 2XK9A 3VUHA 3ROYA 4B99A 1U59A 3MH3A 3OG7A 4F9CA 4QMQA 4WSFA 3FSFA 3MGYA 2NO3A 2VNYA 4LRMA 5CSXA 3D5XA 4Q9SA 4C59A 5BVEA 1MIZB 2EJ8A 3D7TA 2J0MA 3DKGA 3FMHA 2FVDA 3SKCA 4CT2A 2O5KA 1Q97A 4FVPA 4I0SA 5DHFB 1KOBA 4D1ZA 4QP2A 2P2IA 5ANEA 1K3AA 5L2QA 4CZYB 2L1CA 5KHWA 2VN9A 3TN8A 3HRFA 3POZA 2R9SA 4ITJA 4PP7A 5IEVA 2ZDTA 4Y85A 3LCTA 3P7CA 4DH8A 1ZYDA 2XM9A 3R7IA 4MY6A 3OMVA 1FOTA 3TG1A 1VEBA 3ZMMA 4H3PA 3R83A 1MQ4A 2DHIA 2Q83A 3HV7A 3DK3A 1PW2A 4I3ZA 4QTCA 3C4CA 1OB3A 4YZ9A 1WFCA 4BIBA 4O91A 2B9JA 3P9JA 2DWBA 4FV3A 4CYEA 2XIYA 4JAIA 3CXBB 4JQ8A 2VSZA 5CLLB 2JKOA 4RIWB 5E8UA 5EYMA 1RJ2A 4BWKA 1WVXA 1ZVRA 1OKWA 2YJSA 5HVKA 1QPCA 4L67A 3G6HA 5JHHA 3BHVA 4MKCA 1OPJA 4FODA 3IDPA 4YJNA 1J7UA 2JP2A 4O7TA 1DI8A 2B1PA 3R8VA 3UODA 4Q5HA 4HPTE 4KHAA 2PUIA 4GH2A 1PYEA 5CLQB 3TNQB 4BR3A 3E8CA 2GNFA 2VTRA 5F95A 5LMAA 3ID6C 2W0JA 1OUKA 4F0IA 3IGOA 5ACBC 3U6JA 4IVAA 4KRCA 5HX8A 4FVRA 3KY2A 2D9ZA 1PXIA 3UG2A 2P0DA 4ZY6A 4DFXE 2VX0A 5F94A 1MK9B 4C4GA 1H08A 4UALA 4RC3A 4LV8A 3W2RA 2W06A 3PXYA 4PDOA 4EZ7A 4IE9A 3AXWA 3IW4A 3MFRA 3NCGA 2IZTA 4ZTNA 4QYHA 1YHVA 1NI2A 5DA3A 3Q2JA 2I5CA 3GP0A 4IB5A 1YHWA 4IZ5A 3PJCA 4P90A 2IW9A 3V8SA 2HZ0A 5IQIA 4Z9LA 1H28A 4ZMEA 4PMTA 5DEWA 4CZUA 4FV2A 4MXOA 5AJQA 3QKKA 3GCUA 2XBJA 3RP9A 3CD8A 4A9UA 4D1SA 2CKQA 2WQNA 1K9AA 4X2GA 2WTVA 1H8FA 2C0OA 3CLYA 1TJ6A 3C5UA 3HMMA 3Q6WA 3ZRMA 2JBPA 2OI4X 4FKLA 4FT3A 3SXFA 3OWJA 4PMPA 3ELJA 3DLSA 3QTUA 2D4QA 1YI3A 2UZRA 5M4IA 3R8MA 3IW6A 5AAEA 1JKKA 4FTTA 1Q8ZA 4L6EA 3HEGA 1GY3A 2R3QA 4NM3A 4U3ZA 3K3IA 4NTSA 2YACA 1XJDA 2UVXA 2UZDA 4FSMA 4BF2A 3NIZA 2EWAA 5IISA 3V8WA 3VS5A 3UOLA 2DYQA 3CJFA 1H4LA 3OTUA 3LFSA 4JJRA 3PVLA 3LXPA 1FMOE 2WMXA 4MH7A 2PMNX 3Q9YA 3V04A 3D14A 4LMUA 2VNWA 5CASA 4QMNA 1G3NA 3UYTA 4F63A 1X86A 4AW2A 4XBRA 3P7AA 3QUPA 4UMUA 4UV0A 3KF4A 3E7OA 2XCHA 2YCSA 4RZWA 5DI1A 3W18A 4ARKA 2I0EA 3COMA 5EHLA 3BINA 3KXXA 5E8TA 2W1DA 1X1FA 3I6UA 4C4EA 5HTCA 2C1BA 3BWFA 1OL1A 4E5BA 4J8NA 4A6HA 5E8YA 5C9CA 4E73A 4QYGA 4ZLZA 3GOKA 3G0FA 4J71A 5JZJA 4WNOA 3NUYA 5CZIA 4QMVA 3PTGA 4YBKA 1K5GB 4TNDA 2XKEA 5KMIA 4HYHA 3WARA 4CFXA 4D2TA 2E2BA 4JBVA 5BVOA 4ENYA 2RVBB 2VWXA 1U27A 4HZRA 4PPAA 4QOXA 4GU6A 4IMYA 3KVXA 2A4LA 2PZIA 1KOAA 3WBLA 4FK6A 4IHPA 4YONA 3LFQA 3MFUA 2Q0NA 4XUFA 3AJ4A 3FQEA 3AD4A 2OQBA 3L8VA 2Y9QA 4C02A 1ATPE 3PJ3A 5D3VA 2ITUA 3MESA 2JIUA 3FQHA 3EJ1A 4TW9A 4W8DA 4ZXTA 2MFQA 2XQNM 3ZC5A 2QHNA 3TV4A 2J4ZA 4FV8A 4G31A 1OBDA 5FUTA 5EM5A 2YDJA 4GSBA 4BKJA 4B7TA 5J79A 4KSQA 2C0TA 3R9RA 5ICPA 5CVFA 3U6HA 2IJMA 4HVDA 5HG9A 4FIEA 2QU5A 3ETAA 4GT5A 5AAGA 2YM5A 1GC6A 2AL6A 3F2NA 3HAMA 2PL0A 3QRKA 4NCTC 2J0JA 3LZBA 4UYAA 2FO0A 3EKKA 5AADA 4ZIMA 1QMZA 2ZYBA 3SUZA 2OIDA 3OD6X 4TWNA 4E3CA 3TCAA 4FGRA 4LOOA 3ZUVA 4C38A 2DTCA 3DBQA 4HGLA 2R3MA 4FZFB 3LW0A 3OF0A 3FWQA 4QNAA 4CYIA 1L3RE 4LOQA 5KMNA 4NZWB 5DMZA 3V8TA 3F5RA 3R7YA 1ZXEA 2QI8A 3AC2A 3QQFA 3ZO4A 3QTQA 1XH9A 3LJ2A 3VOQA 4ACDA 4F70A 3BHHA 3EFLA 4ZP5A 2JAVA 4BDKA 1M52A 3UMXA 5A4QA 1ND4A 3O17A 4QQJA 4FSTA 1E9HA 3QGWA 2GHLA 4NM5A 4JBPA 4FKRA 4QPSA 2BTRA 4R1YA 1ZMWA 4F6UA 2VKIA 5E8SA 2WHBA 1O9UA 5DR9A 2WXVA 3DBEA 4O6EA 4MF1A 4S33A 3LJUX 4R3CA 4DT9A 3BYUA 4S31A 2YIWA 1YXUA 3NX8A 4J7BA 4YJVA 5L8JA 2PWLA 3E64A 3FY0A 3KSYA 2ZMCA 4EH9A 1PXPA 5H2UA 5C8NA 3L8XA 3VJNA 1BUHA 3FXXA 1DDMA 4X2NA 3LCKA 5JH6A 3DPKA 4FG9A 3EYHA 4U81A 3SYXA 2R0DA 3V01A 3ZCLA 4L7FA 3LJ0A 4JRNA 2YM6A 4GIHA 4QMWA 1CKPA 4TKNA 2F49A 4FSYA 1YXXA 4H39A 4F08A 4FSNA 4IAAA 5FDXA 2G15A 2FH9A 3LKMA 4DFZE 4IIRA 1GZOA 5C03A 3CKXA 3VS2A 4D2WA 2VTTA 1FVRA 2BHEA 3QA0A 4WT6A 2LAVA 4Y94A 3Q4UA 3VBYA 3EQRA 4XG9A 5AR5A 2PK9A 4XWXA 3HRCA 4FT9A 3HV4A 4ID7A 3NZ0A 2J6MA 4LGHA 2R3NA 4UMQA 3LXNA 5LQFA 5GOWB 1Y6BA 2ITVA 1TQIA 3NYNA 2QLQA 4UYNA 4AA4A 4YSJA 2D9WA 2IN6A 1ZRZA 4AT5A 3UMWA 4HYIA 2ITXA 5GIPE 1F0QA 3RGFA 2Z0OA 2YA9A 4YHTA 3V5WA 2I5FA 2XIRA 3MPTA 1AQCA 5IMXA 2VX1A 2VTPA 2WMQA 3B8RA 2OXDA 2W99B 2W1ZA 1WI1A 4O21A 2W17A 1YVJA 3R01A 4ZTQA 4BI1A 4LGDA 4NM7A 5L81A 4L3PA 4E8AA 1GZKA 4F9WA 1JOWB 3PXQA 5AUWA 4LV5A 2Z7QA 5HU9A 3S1HA 5LOPB 4M14A 2GTMA 5LARA 4DC2A 1UKHA 2O64A 2XK7A 2QURA 3MA3A 3N4TA 4O7LA 2GNJA 4O7SA 3NR9A 3PIYA 3S4QA 4I1ZA 1WBNA 3D15A 4M67A 2B53A 4D2VA 3JVRA 4A7CA 3EFWA 4MX9A 1PMVA 2ETRA 1W0XC 2QOHA 4Q2AA 4X6QC 5AR4A 3T8OA 3UC3A 5J1VA 2AC3A 4XJ0A 1Q8YA 4O0TA 4G2FA 2UZTA 3TWJA 3NS9A 4C3FA 3CGOA 2XK4A 3MTFA 3AMBA 1WZYA 4FTMA 3MB7A 5IH4A 2WKMA 3UIXA 2YDIA 3QUDA 4L68A 5C1QB 5TR6A 3EN5A 3ZZEA 2R64A 3FDNA 1PJKA 2YSZA 1YRPA 3DTWA 3FZSA 5AUZA 2XNMA 3O2MA 1NVSA 4KS7A 3ZYAA 2N23A 5G6VA 4BCIA 4NL0A 5EG3A 5L8KA 2GS0A 3SO6A 2BALA 5CLPA 5J9YA 2C1AA 3KCKA 5DT4A 4JT3A 3R00A 4EOSA 5ITAA 2C5VA 1ZOGA 5AWMA 2W2XC 4ZRJA 5EKOA 3RWQA 4DX8A 4UMTA 4CXAA 2X2LA 2FJLA 3GU5A 3FI4A 4H3BA 4TZRA 2VUWA 3L1SA 4GL9A 2JAMA 4AZVA 2QLUA 5F9EA 5I9YA 4BI0A 1ZYSA 2REIA 4FTJA 2Z02A 1VR2A 4J53A 3OROA 4JG8A 3R7OA 1UNPA 5J8IA 3I7CA 4ERKA 3I0QA 3UQCA 4K33A 1IG1A 2R4BA 4YJRA 3KXHA 3WZUA 4CYJA 4AUAA 4BBKA 1ZSQA 4GKIA 4UWCA 1SM2A 3GU4A 4H1MA 4FTRA 4HGTA 1XBAA 2FGIA 2QKWB 3EQFA 1Q99A 4J98A 2CGVA 3UOJA 3C4ZA 2DYNA 2CKEA 2WU7A 1DS5A 2YCFA 3R04A 3SW7A 3UZTA 2C6TA 2UZSA 3TI1A 1BMKA 5HO7A 3ACJA 4IVBA 3UNJA 4AGWA 4FL3A 5CXHA 3QRJA 1ERKA 5CVGA 5AM6A 4R77A 2WIPA 4FZAB 4Y46A 4TL0A 4KBAA 1UPRA 1NA7A 4YTHA 3S95A 4DEGA 4GG7A 5AX3A 3FSSA 1OIYA 3OCGA 2ZOQA 5E1SA 3WZJA 4IJ9A 2HXLA 4BRXA 2BRGA 2N0YA 2BZHB 4I6BA 4PWNA 2JIIA 3QD2B 4BN1A 4GFOA 3DJ5A 1LW3A 3PZHA 4XX9A 2YM4A 4OBOA 2X4ZA 5CS6A 4FTQA 5HICA 5HE1A 5GINE 3RHKA 1DROA 3EL8A 3LIJA 3NPCA 4L8MA 3CKWA 3VAPA 3RK9A 2DS1A 5ANGA 5DVRA 4S32A 4K1BA 4QP3A 5IEXA 3L8PA 4YZDA 1V0PA 2G2FA 3EH9A 4NUSA 3ANRA 3BYSA 2AC5A 3OEZA 4O2ZA 4C7TA 4CSVA 4EHGA 5GNKA 2D9XA 1YDRE 1AQ1A 2EB3A 4RVTA 3VW6A 3LLTA 1PF8A 3Q5IA 4AN3A 1XWSA 2W1GA 5AV1A 2UZWE 4DG0E 4HAUB 3QTRA 4OGRA 2G9XA 3MVMA 4CMUA 1FGZA 3PLSA 1G5SA 2B9FA 4YPSA 2GHMA 4QP8A 3M2WA 3VNTA 3OWPA 5E90A 3MSSA 2H34A 1UNQA 4A9YA 1IA9A 2V62A 4QP9A 1Z9XA 4F9AA 3FC2A 1NTYA 2WZJA 4MXYA 4F6WA 5EDQA 2CRFA 5J5SA 4DE4A 5D27A 1ZY4A 4F0FA 2CKOA 1NY3A 1PMNA 2ZB1A 2GSFA 3PXKA 1OPKA 4IZAA 2UW3A 3Q9XA 3AQVA 5GJGA 3QTWA 4UXQA 2EXMA 4AOIA 5CU0A 3QYWA 2BFYA 4BDDA 1YOMA 3OCSA 3RAIA 1NVRA 3A8PA 4P7EA 4FKVA 3WE8A 4C2VA 2E9PA 1YI4A 3FZRA 3HDMA 5GJDA 1FGIA 4OTWA 4PP9A 4AZEA 4BBEA 1H27A 3GCVA 3TZMA 5BQ0A 3N9XA 3QWKA 1WAKA 2QNJA 3BHTA 3DKFA 4ITIA 4JAJA 1B6CB 4JBOA 3ZC6A 3BV3A 3JUHA 1HCLA 1URCA 4YMJA 3EN7A 5FEEA 2VTLA 2HK5A 2X81A 2C6MA 4YPDA 5CZHA 2Z0QA 3OHTA 2QHMA 1WVWA 1JWHA 3ZUTA 3PJ8A 3PE1A 2PVFA 4PL3A 4BCJA 4EK6A 4A6FB 3MN3A 5FG8A 2YDKA 2FSOX 2ZVAA 2PSQA 2E2XA 2W96B 3F3WA 5F20A 3ALOA 3UZPA 3S00A 2GU8A 4L53A 4BCNA 4D4YA 3RZBA 1SNXA 2H7DA 1UU3A 2AYPA 3NVKI 2COCA 1YWVA 5ANJA 4F7UP 1YXSA 2QODA 2RF9A 2VWIA 3CBLA 3O71A 5HOAA 1YHSA 2R3OA 5DN3A 3D8DA 3FMLA 3WF5A 4JDKA 4FE2A 4H1JA 5IQEA 2VGPA 5JQ5A 3AD5A 4F1OA 2IFSA 2YS3A 4XG4A 5CSWA 4KWPA 3JVSA 4G3EA 2K00A 3MY0A 3WA0A 4XMOA 4R5SA 3QWMA 2GHGA 4XG3A 4XV2A 4C61A 3NSZA 3PPKA 1B55A 2PVLA 4K81A 3I0OA 4CV8A 1Q8WA 3LFAA 4D55A 4I0TA 3DDPA 2IO6A 2VWBA 5DGZA 4B8MA 4AF3A 1PXNA 2Y6OA 3DK7A 1UU9A 3OW3A 4FZ6A 4AFJA 4EC8A 5CF5A 5M4UA 3TUDA 3DZQA 3LAUA 4A6KA 5HNGA 2BZJA 2UW8A 2VTAA 2PZPA 2YJRA 4HYSA 3RPOA 5EDRA 1X11A 3GI3A 4GU9A 1XR1A 4BVUA 4D2PA 3ODYX 3F2AA 4I6QA 4DXAB 3PJ2A 2PUPA 2PE2A 3CQEA 3U54A 3UTOA 4F0GA 3PDTA 3GOPA 3H3CA 2X7OA 3CQUA 3LFCA 4GV1A 2WMUA 5HE0A 2V0DA 3VBQA 4HAWB 3EQDA 5GIOE 2IW8A 3ZUUA 1YDTE 3BEGA 1K2PA 2Y0AA 1JSUA 5JGAA 3ZZWA 4AA0A 3HAVA 3PUPA 4O83A 2QKLA 2CNQA 2ZM4A 3QRTA 4GK4A 3D2IA 5D3WA 4QYEA 3R21A 2JD5A 4KD1A 1KZGA 4FV7A 2KTYA 2UW4A 4S2ZA 2NP8A 5EHOA 3PSDA 5CNNA 1UU8A 4GMXB 4P4CA 3PPJA 4V0GB 4AOTA 3ZDTA 2YAKA 4O86A 4R6VA 4QP1A 4A06A 3P7ZA 2HAKA 2IZSA 5M08A 2F9GA 2X4FA 3D5UA 3DQWA 4RIXB 3TVVA 2R2PA 3EZVA 1PMEA 4OBPA 4M84A 4UXLA 3HMPA 5EQPA 2H9VA 3VS4A 5CAVA 3K54A 4WG4A 3IW8A 1R3CA 3DK6A 3ENHA 5EM8A 3MH2A 3QZFA 3MH0A 2PYWA 2VRWB 3VQUA 2W05A 4YZBA 3GQLA 2VWZA 4GRBA 4B0GA 3RAKA 4BCOA 5HORA 3C4WA 1WGQA 2P8VA 2VTJA 4O1OA 1H00A 2B7AA 1V89A 3F5GA 3V6RA 2DX1A 3NVMB 4CZTA 4O82A 3KF7A 3UIUA 5A6NA 1H1PA 5FEQA 5ANOA 1RQQA 3PY3A 4K0YA 4MCVA 4U8ZA 3MY1A 2PVYA 3DAKA 5HG8A 2DA0A 5JGDA 4FTKA 3NNXA 2BKKA 5AP6A 4DLIA 2XIZA 3QRIA 4L45A 3DQXA 2DLWA 4PQNA 2DHKA 3O50A 4JR3A 2RG6A 4U5JA 3HECA 4I22A 4UB7A 3KC3A 2ITOA 4RWKA 3FJQE 4KAXB 2CN8A 3QX2A 4ANBA 4BCPA 1N3HA 4YL8A 2XKDA 3BGQA 1IR3A 4GYGA 5H3QA 1ZWSA 3K3JA 3E8DA 4JX7A 4F64A 4XOZA 2QR7A 5J1WA 4KNBA 2R3KA 3QTIA 3ZDUA 2P33A 2XZSA 4FIIA 4ANNA 5AUYA 4ANOA 4DEHA 3VQHA 4AWIA 3ZONA 5H8EA 4ZLOA 3SA0A 3BU6A 4FEQA 2OXXA 3HMIA 4JBQA 4M69B 4U3YA 5B0XA 4APCA 4AX8A 4K2PA 4IWDA 5EOBA 5AP5A 3UP7A 1WBOA 5J9LA 1M7EA 4Y83A 2UVMA 2XJ0A 3O96A 3R22A 1OKYA 1RW8A 4V01A 2QU6A 2UW0A 2Z8CA 3SD0A 2PE1A 2C6DA 4FTIA 4N4SA 4F7SA 1DAWA 3AT4A 4M68A 4WBBB 1SVHA 5JFXA 2HWPA 3PXZA 4QYYA 1UU7A 5JEBA 3TZ9A 2ROVA 3D8EA 1OUYA 5HGIA 3WF7A 1XR0B 5LONB 3PLAE 4IQ6A 4JDJA 5HTIA 2QOCA 5FGKA 4C0AA 1QPDA 3KRLA 3EFKA 4I6FA 1NVQA 3NGAA 4QP4A 5JZNA 3GCPA 3ZFYA 2J59M 1NXKA 3IG7A 2VTNA 3ORMA 4W9WA 5JQ8A 2HZNA 4I5HA 3OP5A 4N6ZA 1BI7A 3NUAA 3LMGA 3DFCB 4ZZMA 3E7VA 4GJ3A 4EH2A 4BY9E 2OLCA 1J3HA 4E4NA 2Y6MA 4O38A 4F1MA 1BWNA 2WMAA 3FPMA 4AT3A 4DX90 2UV2A 2W9ZB 1ZZ2A 4M3QA 4MBIA 4BC6A 4BDBA 2YVCA 2D9VA 1V0OA 4G3FA 3FKOA 4YP8A 4QYFA 5LOHA 4DGMA 1DYNA 2HZIA 5J3TA 4AAAA 2VO7A 1VYZA 4EQMA 2I1MA 2ITTA 3CJGA 2XNBA 1BL7A 4FEUA 2AUHA 3AC1A 1RJBA 3I60A 4K77A 4C4JA 1H24A 1LPUA 3MFTA 4JIKA 4CQGA 5IH5A 1CMKE 2W4JA 1ZYJA 3EQIA 1IASA 3UJGA 1U5DA 4PTCA 5GHVA 3MB6A 3H4JA 4F09A 4PL5A 4TNBA 5I9VA 2X1NA 4EHVA 2B9HA 4F7GA 3UVRA 5L3AA 2GQSA 3EIDA 3CPCA 4QTAA 2IWIA 3HP2A 3TL8A 1OL2A 1Y6AA 3P7BA 4FKPA 5EM6A 3R9DA 4C58A 2XEYA 5JSMA 5CYIA 4D4RA 3QXPA 2C3IB 5I5ZA 2RSVA 5A4TA 3P23A 3I5ZA 4BL1A 4DH7A 3R9NA 3TDVA 3GYOA 2G35A 2KGXB 2QOBA 3FL5A 4FT5A 4KAOA 1V0BA 4WOVA 5AP4A 2CDZA 1O6LA 1U54A 2FSLX 3UNZA 5E1EA 3QC9A 1GAGA 4FKSA 2I7QA 2XBAA 1VZOA 4EKLA 2F2CB 5E91A 4GZUA 3QALE 1Q24A 3MFSA 4GK2A 4XHKB 5IMEA 3TUCA 5DRBA 2XNPA 4EOLA 1UNGA 4UX9A 3MPXA 3QCXA 3TM0A 3PFQA 4EWHA 3FL4A 3O7LD 2XK3A 3NDMA 2XRWA 4MNEB 5M53A 4YLJA 3VUDA 3WF9A 5B2MA 1OIUA 3NUXA 4EK5A 5EQYA 3RZFA 3OT3A 1WJ1A 3DAJA 5HHWA 3TO1A 4S30A 3HL7A 3LQ3A 2OZAA 2YM8A 5AUUA 2C6IA 3C7QA 5T68A 2R3JA 5EFQA 4E4LA 1H0WA 3DT1A 1CTPE 2IZUA 4K2OA 3Q9WA 1XBBA 3QA8A 3QQHA 5AP7A 5FEDA 4A07A 2HTHB 4YTIA 3LJ1A 5IEYA 1FAOA 4KB8A 4TYGA 3DBFA 5IQHA 1Y57A 3OW4A 4KSPA 3F69A 4CQEA 4IXPA 4NKSA 3IK3A 3PIXA 2PVMA 3KVWA 3NEWA 2VTMA 1P2AA 5I3OA 4DH5A 4A6FA 2QR8A 2BRNA 3ET7A 2BROA 4CMTA 4ANSA 1TXDA 4RVKA 4WKQA 5KE0A 2BCJA 3FLQA 4QMXA 4PNKA 2QKMA 4ZJIA 1EAZA 3TNIA 2V7OA 3WI6A 1PKGA 4LMNA 5DYJA 3NCZA 3F5UA 5D9HA 3QHWA 4U6RA 4DFYA 4EBWA 4XLIA 2RFNA 4U41A 4ANLA 3ZM9A 4DA5A 3SVVA 4RJ8A 2YF0A 3DXCA 3PA5A 4QTEA 1H25A 3QQUA 4NCTA 4GVAA 3FUPA 4EZ3A 4NY0A 5KX8A 4YO6A 2HYYA 3SAYA 3EN9A 3L9MA 5CSPA 2PVHA 4IBMA 4EQUA 3RMFA 1GJOA 3EYGA 3HV3A 4HB0B 5IQDA 4TYZA 2YT1A 3LOKA 5JFVA 5DOSA 3DU8A 3IDCA 4PRJA 4AQCA 3R02A 2OBJA 5DR2A 5EI6A 5HG5A 2NRYA 3WYFB 2OIBA 2C6OA 3BHUA 3O0GA 2C4GA 5BVWA 5DT3A 2B4SB 4G6LA 1LEZA 2SRCA 2WELA 5FM2A 3VRYA 4U9AA 4FEWA 4YLLA 2Z7RA 3F82A 3L8SA 4HAZB 2QOFA 4J96A 5HQ0A 2ZJWA 5IDPA 4GT3A 4QP7A 1I44A 4HCVA 3FSKA 3IKAA 4B8LA 3ZU7A 3H10A 1E5WA 4DFUA 4CHJA 5C4LA 4FV0A 2WU6A 5TT7A 3TJCA 3ZS5A 1JLUE 5D1JA 1JSVA 5AEPA 5E9EA 1UNHA 2QOQA 2C3KA 3D2KA 3FZPA 4U97A 2X8DA 3II5A 4C34A 3FZOA 2VGOA 4IAZA 3ZHPC 3ZFXA 1E1VA 3IS5A 1CKIA 4RSSA 4KKGA 5HZNA 4U80A 2D11A 4GFGA 1ZC4B 5C4KA 3SG9A 5IZFA 1WBWA 2VWUA 4O0YA 3EN6A 3WILA 3ZDIA 1DI9A 1TVOA 2PPQA 3F6XA 1YQJA 2YIYA 4KINA 4ZTMA 4FKQA 1Q8TA 3AT2A 2VTSA 4EJNA 4ZSAA 5A9UA 4QMYA 4ITHA 3SLSA 4FTUA 2W4OA 3U9CA 4QRCA 4O0SA 4GEOA 2UZLA 3SRVB 5L6PA 4GKHA 3OUKA 3EMGA 5FXSA 5HEZA 4AW1A 4O22A 3CGFA 3S2PA 3UO5A 3VHKA 2H96A 1LB1A 1PRYA 4ZMFA 3IO7A 4TWCA 2X9EA 2X7FA 2KULA 4NFMA 4RPVA 4E6DA 5IA2A 3ORIA 1ZYCA 4XNEA 1R1WA 2QQ7A 2I0VA 4LUDA 1XH5A 1W1HA 3ZLSA 2C69A 3FHIA 4DHFA 4GJ2A 4P5QA 5H8GA 4FV4A 4I6HA 4J52A 4QTDA 3IDBA 2X8EA 5C01A 3D5WA 3DXNA 3BYVA 4QO9A 2R7IA 4KKHA 1RRPB 3QKMA 4OTFA 1LR4A 2X6EA 4YNOA 4G16A 5CF6A 4C35A 3CIKA 5FP6A 3QZHA 1LUFA 4HHVA 2H7EA 1IAJA 3HUBA 4Y8DA 5ETCA 4LM5A 4LRKA 3VO3A 3W2OA 2ADZA 2J2IB 2OH4A 2WQEA 4YTCA 1H4RA 4E6CA 3TKHA 2BVAA 3NIEA 2ZM3A 4WG3A 5KUPA 4QMSA 3CSVA 4EK3A 1V88A 2CLQA 2E9NA 3F61A 4Y72A 3EB0A 4O6LA 2BIYA 4U44A 3BQCA 4FV5A 1S9IA 2O0UA 2JGZA 4LUEA 5J7BA 3VW8A 3FLWA 3QCSA 4WSQA 3IVFA 4DBBA 4Z55A 5CU3A 2BZKB 4LL0A 3VWAA 4R7IA 1XODA 3HZTA 2JDVA 4CTBA 4RJ3A 1GNGA 4L3JA 4XLVA 1YXTA 3PG7A 3DXPA 4A9TA 3ORZA 4OAVB 3D9VA 4EOIA 2QCSA 3SQQA 2O3PA 5D11A 1XH4A 4WHZA 3E3PA 3RINA 3D83A 3VUMA 5K5XA 1YI6A 3AMYA 3HLLA 4JOAA 1O6YA 5AV0A 2GJYA 4HATB 4ZTLA 4EOQA 4K18A 4E6AA 3OFMA 2CKPA 2ITNA 4DYMA 5IUHA 1DBHA 4PDSA 3SDJA 4BZOA 4J8MA 2OXYA 2DQ7X 3QTZA 5BYZA 1HCKA 5KMJA 1PXLA 4FKUA 3ZVRA 3EZRA 3Q4CA 3QL8A 1Q8UA 2XMYA 3LE6A 3NUUA 3Q53A 4RX5A 3R8PA 1U4DA 2CY5A 2MKRA 2QOOA 5AR2A 3UGCA 4MBLA 3UQGA 2F7XE 1KE6A 2BAJA 4DG3E 3EN4A 4DN5A 3FLNC 4AG8A 3F9NA 3QC4A 2QO9A 3FXZA 1XX0A 3ODXA 3PG3A 3UVQA 3SG8A 3AU4A 3R2BA 4BDCA 4ORKA 4BCGA 4CHMA 5FD2A 4WIHA 4ZZNA 5LVNA 5JGBA 2J51A 4WA9A 4YO4A 2W2XD 3C51A 4IZYA 3E8NA 5J87A 2P3GX 3QYZA 1NU2A 1MIXA 4JL9A 1A48A 4NJDA 2HW7A 4HDQA 2VWWA 2WMWA 2JDRA 3RK7A 3W2QA 4F4PA 5BVFA 2L2IA 4R3PA 4XP3A 4DTBA 3A2CA 2XNNA 3U55A 5CF8A 3C50A 4OTHA 2NNWB 3Q5ZA 5CALA 5CSVA 1Z57A 3E63A 4WNPA 4HB3B 2YZAA 3NNVA 2PZ5A 5DHAB 4AW0A 4E26A 3PPZA 2F2UA 2B52A 5FI1A 1OBGA 2XB7A 2JKMA 4MK0A 3JS2A 3D7ZA 4YTFA 3F3ZA 3HDNA 2W7XA 4PL4A 3VJOA 3BV2A 5JKGA 5IQGA 3AMAA 4L00A 1M2PA 4TWPA 4N70A 1P4FA 3D0EA 4EC9A 4EH3A 1P6SA 3IQ7A 1IRKA 3OOGA 4RQVA 3PA4A 4RC4A 5HKMA 4G5JA 3HQCA 4H8SA 3Q4TA 4NIFB 3EQCA 3BYOA 3DDQA 4DLJA 4MNEA 2WQOA 4FGBA 4ZZOA 3ATSA 3PWYA 5FXQA 3FAAA 4ZTSA 3ODOA 1UWJA 3F3TA 5C5BB 1OL6A 1YDSE 3ORXA 2D10A 3QFVA 1K5DB 4XEYA 5DHJA 3VS7A 2WTIA 4XRLA 5HVYA 4D2RA 1JSTA 4RT7A 4FSUA 2H8HA 3TNWA 3LMHA 2WTJA 2A27A 4D2SA 2GQGA 4NW5A 3JYAA 3V5LA 4ALWA 3FM8C 3L9LA 3U87A 1UVRA 2RLOA 2B54A 4RBLA 3MS9A 3SXSA 4CCBA 5J7HA 2OTXA 3ORLA 4EEVA 3OY3A 4QPAA 4BHNA 4KBCA 2PTKA 4R7HA 1OQNA 4NKAA 4FICA 5FM3A 4MNFA 4W4XA 4KABA 4F1TA 3FPQA 4QP6A 4USFA 1U5FA 5AA9A 3GFEA 5T3QA 3COIA 3NUSA 4U45A 3C0IA 4ZS0A 4TTHB 5HG7A 4JRVA 2WB8A 4C2WA 4EQCA 2VTIA 2WMBA 2YT0A 2WTKB 3THBA 4RIWA 5CEOA 3ERKA 4IB0A 2DN6A 4DEIA 4I4FA 5LWNA 4IX3A 3QCYA 3K5UA 4ZSLA 3GU7A 3P08A 3QF9A 4ACGA 2JDOA 5HI2A 3F66A 4FKJA 3GC9A 3GU6A 5CU6A 3EFJA 4BICA 2I6LA 1APME 1A9UA 3MJ2A 4FKIA 5EOLA 3W8QA 3P78A 4GG5A 4K11A 2RUKB 4CD0A 5DH9B 4DF3A 5JHGA 2B9IA 2A1AB 4H05A 1I2HA 3ZSIA 2YM7A 1PFJA 1OECA 4RQKA 1OZ1A 3OC1A 2WMVA 3GENA 1YWNA 3HYHA 4GS6A 4QQCA 4L42A 4ALVA 3F5PA 4G1WA 4YNEA 3L9NA 4PY1A 4WRSA 4IC8A 5TE0A 3ZOSA 1L8TA 2D2QA 5HLNA 3O51A 4MD9E 5AIRA 3WOWA 3M11A 1ZM0A 1T46A 4ASZA 3I6WA 5I3RA 2ZB0A 5L4QA 3FY2A 1MUOA 2EU9A 5L2SA 3DZOA 3ZBXA 2PMOX 3OS3A 4RFYA 4EH7A 4O7WA 4HAXB 5IQCA 5JRQA 3TV6A 3V5PA 2ZV9A 5LCJA 3P6AA 5HU3A 4TWOA 2Y8OA 3OCBA 3RCJA 4XG7A 3EQBA 4BWXA 2CPKE 3PG1A 2XCKA 3G9NA 4K17A 1MKEA 3EWHA 5FRIA 4QMUA 4MQ1A 4ZJVA 1BI8A 4B6HA 2LGCA 3WF6A 2J0LA 3NW6A 4GFMA 2HOGA 2I0YA 3GUBA 3MVHA 3P0MA 4RG0A 2QOIA 3JXWA 2O8YA 3L9PA 2C3LA 5AR3A 4KHOA 1U2BA 1FHOA 1PXOA 2PZYA 3SX9A 3ZEWA 2PUNA 4M0ZA 2VO6A 3HX4A 4W4WA 3IONA 1OY2A 2Y7JA 4DFBA 1TQPA 3ORKA 3Q3BA 3A62A 3U8WA 1PXKA 1Y8GA 3F3UA 2FYSA 3VBVA 4E1ZA 1PKDA 2M14A 1U29A 5JRSA 2OKRA 3WYYA 3R8ZA 4ZY4A 5L2IA 4DEEA 3RCPA 4D0NB 3A7FA 3P86A 1EF1A 3H30A 5HIBA 1JKSA 4FKOA 2QKRA 5JK3A 4HAVB 2OWBA 4HCTA 5AP1A 2LKOA 2I1KA 4YC8A 3SRVA 3NNUA 5CANA 2OZOA 3G5DA 4D58A 2OF2A 4JG7A 4BKZA 2IVUA 4N0SA 2ITYA 2OIQA 3Q6UA 4XG2A 5M4FA 4QQTA 3A99A 2BILB 3ITZA 2B55A 1WVYA 4PPCA 4MXZA 4L46A 4IWPA 4FZ7A 2XA4A 5D7VA 5LWMA 1Q5KA 4Y5QA 5LVMA 1R0PA 3NUPA 1BX6A 4J95A 4D4SA 3KREA 2C6LA 3F2RA 2OJFE 5EW9A 1PLSA 4MT7A 4KIKB 4KVGB 4ANMA 4JNWA 4IX4A 3FMDA 3R71A 2IPXA 5IUGA 3Q60A 1XBCA 2GPHA 1JNKA 4FX3A 3K2LA 2PZRA 4WD5A 2W1CA 5KQ4A 2HE7A 3FHRA 1WBVA 5KZIA 4KS8A 4DFNA 3NWWA 1LEWA 5I9XA 3OANA 1UWHA 3BBWA 4P5ZA 4X2KA 2VO3A 4JX3A 4EOJA 2GCDA 4LG4A 4FSRA 4PMMA 3V6SA 2PVJA 4CKJA 2C68A 5A4EA 3R8LA 4AE6A 3HP5A 1XH6A 3MH1A 2CGXA 2RFSA 4NW6A 4YJSA 2CMWA 2WMTA 5FQDC 3RM6A 2WO6A 3CEKA 2J0MB 3LPBA 5DNRA 4O0WA 2V76A 3NAYA 3H0YA 4FKGA 3OXIA 4OTRA 5HCZA 5LVLA 3VUKA 4EBVA 4NH1A 5BX0A 1TQMA 4UWBA 2PY3A 5EYCA 1JVPP 3ZSGA 5L6OA 2PUUA 3AC5A 2BIKB 3D4QA 5ETIA 2GQRA 1X8BA 4IAKA 1ZAOA 3R7VA 3MPAA 3UPXA 3OVVA 3T06A 3QU0A 2JKKA 3OWLA 4IFSA 2BAQA 4L43A 2HELA 3QD3A 3SGCA 4FC0A 4QMPA 2CY4A 4CT1A 4LI5A 4R3RA 2VX3A 4OR5A 3U4UA 5DRDA 5E8ZA 2ITQA 3OWKA 3R73A 4BGGA 3AG9A 1Y19B 3F0WA 3QCQA 3BEAA 2JFMA 2Y4IB 1Q3DA 5DH3A 1GOLA 4A4XA 4YU2A 2X9FA 1REJA 4O0VA 1UEFA 3KRRA 1XD4A 2RKUA 1Z87A 2GCLA 2J0KA 3SW4A 4AE9A 4BTMA 4C4FA 3PVGA 4MD7E 5AP3A 3RPSA 4C33A 4MYGA 2RIOA 4RJ6A 5DWRA 2YHVA 3W1FA 4BCHA 2YWPA 2OO8X 4I23A 5C27A 1XCGA 4L7SA 5D41A 3QBNA 2XKCA 3I79A 2XNEA 3VBTA 4IANA 4Y5HA 3GYPA 4XG8A 4G3DA 2DYLA 3T3VA 4KUJA 5A3XA 2JLDA 3ODWA 2OICA 2YFXA 5AV2A 2X18A 1PHKA 2QONA 3KXGA 2BTSA 1KE7A 4GCJA 1KWPA 3CR0A 3FC1X 4TYHB 4WNKA 3ROCA 1H0VA 3W8LA 1ZMVA 4KBKA 2BHHA 3Q96A 3KQ7A 3ZFMA 2XYUA 2CGUA 3FI2A 2ERZE 3QLGA 4FKWA 5G1XA 3P79A 5FBNC 4AN9A 4BB4A 3QD4A 4CFFA 4J1RA 4GMYA 1JAMA 3Q2MA 4GYIA 4BBMA 3DAEA 1QPEA 3PRIA 4FIJA 4OTIA 3HNGA 1OIRA 5HO8A 1DDVA 3CPBA 2CNUA 3TXOA 2IVVA 5L6WL 1H1QA 2BFXA 2WEVA 3GU8A 3AGLA 2ACXA 2QD9A 5HBJA 3RCDA 2PVNA 2V5QA 3FV8A 5I9ZA 4D0XA 1SVEA 3KU2A 2C47A 5CXZA 5HX6A 3NW7A 1J1CA 3EQHA 4FSQA 4TPTA 4CFWA 4I5CA 3FZ1A 4G9RA 5J9ZA 2DKQA 3KMUA 3PVWA 4CFUA 5K4IA 2BKZA 1ZC3B 4BTJA 3QBVB 5A54A 4ZRKA 4LOPA 2OJ9A 3R7EA 4I5PA 3UIBA 4MTAA 1NTVA 2VD5A 3QIJA 2YISA 1TQZA 4HB4B 5CT0A 3FYKX 4NEUA 4TN6A 4CRSA 4G3GA 5IUIA 1Y5OA 3EQPA 4R5YA 2EXCX 1LP4A 5BVNA 4BHZA 4D5HA 5FTQA 1WVHA 4S34A 4ONAA 3PEGA 3QXOA 4XH6A 3LVPA 4NM0A 4RGJA 3VF8A 3VS6A 2WMSA 3D5VA 3Q32A 5DG5A 3A8QA 1PXJA 3FMEA 1XKKA 2I0HA 2O2UA 3BELA 3LXLA 3UZRA 3DS6A 4IAPA 2G01A 2QG7A 3PJ1A 4AT4A 3DXEA 5M09A 2BZIB 5CI7A 4I41A 3KZ1A 2XJ1A 3ATTA 1KE5A 2GFCA 1W98A 3G90X 4IADA 3C0GA 4IM0A 4MAOA 2G2HA 5ETFA 5HBEA 3W55A 3BPRA 3F5XA 5LMKC 3U8ZA 3FQSA 2Z60A 4IX5A 4IM3A 3A7GA 4RX7A 2W1IA 4DCEA 2JIVA 3ACKA 4FL1A 1M2QA 4QD6A 2ESMA 5I0BA 4ZRIA 1Q41A 4EOMA 5D10A 5ANIA 4L3LA 1VJYA 3AC3A 4M8TA 5DIAA 2XRUA 3O8PA 3O8UA 1FHWA 4BFMA 3ZLYA 3KEXA 4WVFB 4F7JA 4OUCA 5B7VA 1OKZA 3I7BA 1BAKA 4Z2MB 1OPLA 4GUBA 4WUNA 4KKEA 3UQFA 5AR8A 1P3RA 3ZM4A 2ELAA 1P4OA 2R0IA 4R1VA 2XM8A 4J99A 4OAUC 5KBQA 4KIPA 4N6YA 1OMWA 2JDTA 4NTTA 3HMOA 5AUVA 2VAGA 3P1AA 4FTOA 3ORTA 3PVUA 3MPMA 4RIYB 3VN9A 3ZEPA 4ENXA 4FL2A 3UNKA 4GPTB 5CSHA 4NSWA 3W33A 4EZ5A 1MQBA 4G9CA 2OH0E 2UW5A 2Y4PA 3AU5A 2A19B 4FV9A 1WG7A 3RVGA 2UZUE 1W83A 3FMKA 4FOBA 2C5OA 4JIAA 5CENA 3IGGA 3MWUA 3N51A 2HZ4A 5HE2A 5CAUA 5FXRA 4OTQA 1ISNA 2XIKA 3BLQA 3BU3A 3W2SA 5L2WA 3TFMA 3KRJA 3V51A 4BCQA 2I1JA 3RWPA 4OT6A 2Z2WA 3QGYA 4FK3A 1URWA 4Q9ZA 1X05A 2MDXA 4RMZA 4TYJA 1VYWA 2C5NA 3A8WA 2P4IA 3KK9A 3OXZA 4CLIA 1KZ7A 4O7RA 1CDKA 4OTDA 2E9UA 1U46A 3LCDA 4IACA 4Y95A 3VF9A 2Z7SA 2UW9A 2GFSA 1OKVA 4NK9A 5JFSA 3BKBA 4FNYA 4TKSA 3VS0A 4EUTA 2R3IA 5M4CA 2OF4A 1M7QA 2V55A 3BWJA 5ACKA 4BDJA 1TKIA 3FKLA 2GNIA 2KCJA 4IFCA 4O81A 2BRMA 5HNIX 3PWDA 4FEXA 2JDSA 2C0IA 4NWMA 4U0IA 4WRGA 5BUIA 1J0WA 1M2RA 4FT7A 1ZLTA 5BYLA 2X2MA 5CX9A 4BCKA 5JFWA 2XP2A 4E4XA 5C8KA 1SHCA 3HGKA 3R1YA 4I24A 5J95A 2BPMA 3TTIA 1IRSA 2CJMA 3ULZA 3M1IB 5EDPA 2CAYA 1KV2A 2W5HA 5HE3A 4BYIA 1GG3A 3MVJA 1ZY5A 3LM5A 4WSYA 3KK8A 4F7NA 1PMSA 1J7IA 3WZDA 1W84A 2X39A 5C26A 4RJ5A 2LULA 4BYJA 4FTLA 4ANQA 2LYDA 5LVPA 3CD3A 1M17A 1OGUA 4K6ZA 3R9HA 4BWPA 3U51A 4XS2A 4MVFA 5LVOA 4XV1A 1FPUA 3LLAA 2JEDA 5J3YA 4PQ0A 3FKNA 2VTHA 4DEAA 4RX9A 3KRWA 5EYKA 2WPAA 3RPVA 5BMSA 3MW1A 1H1WA 2BDFA 3ZLWA 5M51A 3TW1A 4ACHA 3MIAA 4BTKA 3P5KA 2CN5A 4FMQA 2J9MA 4PTGA 4QTBA 2XKFA 2BAKA 4TYEA 1EVHA 4MBJA 4W9XA 4ZK5A 2YS5A 4WUAA 4FF8A 2WTKC 3QTSA 3FLZA 3KMMA 1CM8A 3QZIA 5IKWA 1H1SA 3MTLA 4RFZA 4EI4A 1XKEA 5DE2A 3TNHA 5KKRB 3Q04A 5DI9B 1ZOHA 3FI8A 4CLJA 1ZMUA 1MPHA 5EHYA 3FXWA 4W4VA 3DXQA 3KFAA 3BE9A 1GZ8A 1SNUA 3TCPA 2XJ2A 3HA6A 1XHAA 4II5A 5M06A 5TO8A 2R3FA 2WNTA 1PXMA 1H01A 4EJ7A 5K3YA 4ZS4A 4C4IA 3WIKA 4Z3VA 3WIGA 1KI1B 4HYUA 4U40A 2EMTA 4HVIA 4MEDA 4ACCA 1HOWA 4E5WA 3DKCA 5E8WA 4YR8A 5BYYA 2RGPA 3SC1A 3RAWA 2FSTX 4YJPA 4ZSEA 3LFDA 1H1RA 5KQ1A 3F7ZA 3SOCA 4AGCA 5LMBA 1GC7A 4G6NA 1WBTA 2LOZA 4AU8A 2W5BA 4JDIA 5BUJA 2P2HA 3BX5A 1JKLA 4G6OA 4IAYA 2P0CA 4U79A 3LM0A 4GUEA 5HBHA 3WZKA 3D8FA 3BCEA 3T9TA 4ASEA 5AM7A 2XNGA 2EXEA 3S3IA 1U5EA 4MD8E 4I92A 4QMZA 5A4LA 4IDVA 5D3YA 4CMOA 2W1FA 3BRBA 4UWYA 2J7TA 4H3QA 4BCMA 4UMPA 2ITPA 3MA6A 4K8AA 4YJOA 3KL8A 3PRFA 4M7IA 5IA1A 3ULBA 5E4HA 1BL6A 2V7AA 3G0EA 4I4EA 5ANDA 3SHEA 4PF4A 3RBWA 3TT0A 2QVSE 4HVSA 3JPVA 1M14A 2JC6A 4H58A 3ORNA 4FZDB 1JBPE 1I09A 3MJ1A 4AGDA 1AD5A 3FZTA 3T3UA 5JLJB 4L9IA 4AW5A 1Z5MA 3DBCA 2A2AA 5EW8A 1FOEA 4RC2A 4FV1A 4XG6A 1U5GA 5AAFA 3IECA 4RJ4A 2XK6A 3W2PA 4UZHA 1Q67A 3V3VA 4RWLA 2G2IA 4F9BA 3DTCA 2RSGA 3ZLXA 1OL5A 4PNIA 4CFMA 2BDWA 2OGVA 2IVSA 4QMOA 4QQ5A 2PZ1A 4RA4A 4D5KA 3U7DA 3PSBA 4LL5A 4HVGA 2NPQA 3G9LX 4TYHA 2PULA 1ZOEA 4AZWA 3G9WA 2DX5A 2FUMA 3KA0A 4UZDA 5M56A 4V0GA 4Q5EA 3BGZA 4EOKA 3FI3A 2CCHA 3H9FA 3WF8A 2WTCA 5CVHA 4RIXA 1Y8YA 3KULB 3LXKA 4X6RA 4AZTA 4BDHA 4FNZA 4N57A 4R78A 3OZ6A 3R6XA 2WQMA 3VIDA 5IQBA 4PUZA 2C5XA 2EUFB 4FT0A 1NT2A 4DGOA 4CG8A 2WOTA 1YXVA 1W7HA 4LFIA 2OJIA 5IQAA 2HY81 5AA8A 3C9WA 5CWZA 4EH6A 3DNEA 4FUYA 4C8BA 5A4CA 2R0UA 4ERWA 2YCRA 3KKVA 2JBOA 4WNMA 3UDBA 4JI9A 3CQWA 3MVLA 5CU4A 2YM3A 4Z7GA 4IW0A 5FDPA 4USEA 2UVYA 4XV9A 2KUPA 4DH3A 4CVAA 1R78A 4TYIA 1H10A 5AV3A 4DTKA 3KXMA 1SMHA 2FSMX 3V5JA 1Q4LA 5GZ8A 2BRHA 1J7LA 4FR4A 4FYOA 3FYJX 3A4PA 2DKPA 4YZMA 1UKIA 4QMMA 2WMRA 5A14A 4LQMA 2OFUA 4M12A 5CTPA 2GCJA 3G15A 3KRXA 4I20A 2EB2A 3UE4A 5FWKK 1W82A 3EOCA 5HLPA 2RNRB 2VO0A 4MWHA 2FB8A 4CV9A 4HDOA 1G8SA 5BVDA 2WQBA 3VS1A 4EKKA 3H9OA 3AC8A 3COKA 3TV7A 4OTGA 3PP2A 3TEIA 3ULCA 4M69A 3G2FA 4CEGA 3GVUA 3RPYA 3IOKA 3GNIB 4IVCA 3KB7A 3LFFA 3NYVA 1GIHA 2R5TA 1R0EA 4FTAA 4IZ7A 3PE2A 4L44A 2J5FA 4IFGA 1KSWA 4PX6A 3BQRA 3GCSA 4I5MA 5DPVA 4X21A 5KMMA 1RE8A 4OT5A 3F7WA 4IAIA 3LFBA 1V1KA 2CSNA 2ZV8A 2UW6A 3UPZA 4FSZA 1CKJA 1BLXA 2COAA 3ZO3A 4DAWA 1OIQA 4CFVA 3RTPA 1W8CA 4L52A 5HIDA 4C57A 4ACMA 4O0XA 2QG5A 4ZJJA 3TACA 3DJ7A 5CAOA 4I0RA 1G8AA 3UG1A 5HCYA 3DBDA 2YITA 1CSNA 2Y4IC 3M1SA 3R7GA 5IF1A 5HO6A 4O7ZA 2E9VA 4M0YA 4MF0A 4QNYA 4YZCA 2CHLA 5CAQA 2CGWA 3G51A 5CEIA 5E8XA 3V5TA 4YGAA 1BTNA 2C3JA 3BU5A 3I5NA 3SOAA 1MAIA 2YLFA 4RRVA 2YIXA 4RIYA 2RG5A 1JKTA 2JITA 1M7NA 3CY2A 4PTEA 3TIZA 4BCFA 4XP2A 5TF9A 4G17A 3ZRLA 3QUEA 2W2WA 1OL7A 3CTJA 2BDJA 2MWNB 3F3VA 2PMLX 2XNOA 4IM2A 4BI2A 4ZY5A 3ZO1A 4ZSJA 2RGNB 3A7IA 1V61A 2RFEA 3PZDA 2ETKA 4MXXA 2ITZA 5CT7A 4B6LA 2XEZA 4CKRA 4GT4A 5TKDA 4EK8A 3E92A 2DUVA 5CU2A 5CEPA 4DGNA 2YERA 2UZOA 1WMKA 1FBNA 4PMSA 1WCCA 2GTNA 4TT7A 5AIKA 4X3FB 1QC6A 4BDFA 1OM1A 4RLKA 2ONLA 1ZARA 3HA8A 4HPUE 3W32A 3E93A 4BGQA 4O7VA 4HVHA 3JY0A 2WTDA 5BVKA 4AFEA 4C3RA 3WE4A 2Y7BA 3DGKA 3C5IA 2GNGA 3LCOA 1QCFA 3FLSA 5EKNA 5C8MA 1FVTA 4D1XA 1WBSA 4YJUA 2G1TA 4ZEGA 3JR1A 3C0HA 3HW2B 2HW6A 4DEDA 2YAAA 4A4LA 4DGLC 4O2PA 1PMUA 3MV5A 4IEBA 5KMKA 2P55A 2WD1A 3LFNA 3PZEA 1OVEA 2XUUA 3DB6A 4WG5A 4D4VA 4O7YA 3ZXTA 5F1ZA 5AP0A 3QQJA 4UN0C 3NAXA 4E20A 3RJCA 3A98B 5JT2A 4V04A 2GNHA 2R3RA 5D7AA 5K0KA 3FEHA 4EHEA 2XH5A 1W1DA 1SVGA 2X7GA 4F6SA 4FV6A 2CODA 2O63A 3UOKA 4C4HA 3RNIA 2WIHA 3BLHA 3VULA 5CQUA 4JVGA 5C6RA 4LGGA 2ETMA 3MDYA 3K5VA 4DG2E 4ZLYA 4CRLA 5CAPA 3R63A 4EH5A 3PP1A 3OCTA 4CFNA 3O8TA 2BMCA 4E6QA 1M7RA 2COFA 3LMIA 5DT0A 4XBUA 5CI6A 3VRZA 4FSWA 3PYYA 3OXTA 3OY1A 3PSCA 4BZDA 4UY9A 4YC6A 3EQGA 4MXCA 2R3LA 3B8QA 4L6QA 5F4NA 4C0TA 4DITA 3LFEA 1RDQE 4Y73A 4EYJA 2ZAZA 2OJJA 4MWIA 1UA2A 4XOYA 4DH1A 3HK0A 3KN6A 5EYDA 5CF4A 3GEQA 3PA3A 4I93A 2HIWA 2VWYA 4X2JA 4B9DA 4BTFA 1FINA 2Y8GA 3OTVA 2CNVA 3G33A 4A9RA 4U42A 3DY7A 4EK4A 3E8EA 3OOMA 5JMSA 4QMTA 3AD6A 3ODZX 2IYBA 5K0XA 2QO7A 1WBPA 4OBQA 4EYMA 4W4YA 3VUIA 3TIYA 3VS3A 4FIGA 3D94A 4Z7HA 2ELBA 1KV1A 2J5EA 3E87A 4MQ2A 3M42A 3N4UA 4ALUA 3EL7A 2XVDA 2EMSA 4FUXA 2XYNA 5HVJA 4NFNA 1FGYA 5HD7A 3RPRA 1DDWA 4RFMA 4APPA 4CGAA 2PHKA 4E93A 5M44A 2ZV2A 2IVTA 1XQZA 2X2KA 4K9YA 4A9SA 1PY5A 4RZVA 4QMLA 2BR1A 2R3PA 2W4KA 4CG9A 1FQ1B 4GK3A 4M66A 2C5YA 5CEMA 5L8LA 2LOXA 3Q9ZA 3W16A 3COHA 5AP2A 4BDGA 4MXAA 3CP9A 2VRXA 2XIXA 4I94A 5TOZA 4BIDA 4BZNA 1YKRA 4E5AX 5IG1A 5EH0A 4IDTA 4IX6A 5GZ9A 3QQKA 2JKQA 4FIHA 2YEXA 3FEGA 3FMMA 3R1QA 3UP2A 1MK7B 5AFVA 4F65A 5AR7A 2A0CX 4F7HA 3QX4A 3ZXZA 3Q52A 4ZAUA 2UW7A 4IH8A 2P0HA 4IVDA 4G5PA 4FG7A 4YURA 4BDIA 2BRBA 2OFVA 3RALA 3UVPA 3NYOA 2YS1A 2ONLC 2ZPYA 1S9JA 1FGKA 1Q61A 2NRUA 3PIZA 5IU2A 2EVAA 2QO2A 3KN5A 3NNWA 4GW8A 3KCFA 4IJPA 5AX9A 4QPMA 3DB8A 4HZSA 2JFLA 3PXFA 5L2TA 2VV9A 4EOOA 5HIEA 2XK8A 4FBXA 4P2KA 5IA0A 2F4JA 3VUTA 3NYXA 1BTKA 3RHXA 3ZBFA 2GDOA 4RA5A 1UPQA 2Q0BA 3TTJA 2LG1A 3BBTB 4OLIA 3KMWA 3QHRA 3WYXA 3KULA 4AZSA 1AWEA 4UEUA 4GXBA 2GS7A 3FLYA 4W8EA 4HW7A 5LCKA 4IWOA 3W10A 2P0FA 2Z0PA 2F7EE 3BIZA 2I40A 4D9UA 3GBZA 4JDHA 1E1XA 2UZBA 3EHAA 3DKOA 3UOHA 1F3MC 3BE2A 4ZTHA 4DGGA 3MIYA 2HCKA 4Z2NA 2GS2A 4IWQA 3OEFX 1QL6A 2VTQA 3RAHA 3B2WA 4M97A 4CKIA 2ZMDA 4RVMA 2YCQA 3PY0A 2VU3A 1GIIA 4EH8A 3I1AA 5HTBA 4P7IA 5FTOA 2GNLA 1P14A 4RVLA 4IC7A 5ETAA 1XH8A 3MBLA 1SZMA 4Z16A 1U5RA 4BBFA 1EGXA 1DAYA 3O7LB 2QC6A 4JLCA
chains in the Genus database with same CATH superfamily
5DIFB 4HCUA 5AV4A 3A4OX 3ZSHA 4DT8A 1Y91A 1G8JA 3OBGA 2X0GA 4JQ7A 2EC1A 4KHBB 1U54B 3AT3A 3KGAA 4ZSGA 5LJJA 5KKRC 3POOA 3ULIA 2ZM1A 4O27B 1QPJA 2HXQA 4OW8A 4RLLA 3R7UA 3DCVA 3GFWA 4RJ7A 5EK7A 5E92A 4YJQA 3UIMA 3R8UA 5AUTA 2R3GA 4GNKB 3NRMA 1F5QA 2ERKA 4IB1A 1REKA 2HY0A 5ANKA 5EI8A 3DXDA 3KY9A 2PU8A 4FEVA 3CTQA 4O0RA 4AOJA 3QAME 4EORA 3R9OA 4E4MA 4AP7A 5DR6A 1V5MA 1R39A 5IQFA 3A7HA 2K2JA 5M57A 3C1XA 5IA4A 3SNHA 1DM2A 1FB8A 2W9FB 4EONA 1XH7A 5C79A 3DV3A 4R7BA 4AXEA 4R8QA 2ZKMX 4LYNA 4USDA 2J90A 2J0IA 4HAYB 4YUQA 2OZAB 5AUXA 3I4BA 5IPJA 3CE3A 3FBVA 1J91A 5CQWA 5K9IA 5LMKA 3NMUF 1O6KA 5CNOA 3H0ZA 5J5TA 4FTCA 3D7TB 3A7JA 4GVJA 3VBWA 3UC4A 4DEBA 4DINA 5KMOA 1UNRA 3SV1A 4H36A 1KE9A 5A46A 5I9WA 5GZAA 4RWIA 4NU1A 1NW1A 3UYSA 4YJTA 2FA2A 2RL5A 4YLKA 2PE0A 5FI0A 4YC3A 1MRYA 5CEQA 4AS0A 3C4XA 3S0OA 2X6DA 3PY1A 3QWJA 4O1PA 3PXRA 3P5JC 2YRYA 3KXNA 2W1HA 4KRDA 5IA3A 4MHAA 5K5NA 1P5EA 1SYKA 2VWVA 3TZ8A 2YIQA 4O96A 5JP4A 2OG8A 2UVZA 3HRBA 3JY9A 4DBXA 3UO4A 2R3HA 3NW5A 1I7AA 3IW5A 1T45A 4CSQA 3FE3A 4AGUA 1XO2B 3RKBA 3AOXA 3DNDA 5EI2A 2WAJA 3RM7A 4AZFA 5KCVA 5KZ0A 3CS9A 4EWQA 4F99A 4AXAA 4X3FA 2M38A 3E88A 5KBRA 2W1EA 4PV0A 4FI1A 4FA2A 2QOKA 2WGJA 1GZNA 3LCSA 3R30A 3I81A 3WZEA 4IAFA 3ZH8A 4HOKA 5CEKA 1IAHA 3VBXA 3VUGA 4F7LA 1MP8A 3T9IA 4U7ZA 4GN1A 1GIJA 4KA3A 4JR7A 3RI1A 2HWOA 4YSMA 1J19A 3IW7A 1KE8A 3GCQA 4FIFA 2PMIA 3CTHA 4YHFA 1IEPA 4F9YA 5K4JA 3DOGA 3QKLA 5M55A 4KIOA 4A4OA 3VVHA 4X0MA 1FVVA 4JQEA 1FHXA 5CY3A 5DFPA 3RK5A 3X23A 5FLFA 2ROZB 5I4NA 4BKYA 1IA8A 3HV5A 3LQ8A 1JPAA 3MY5A 4CTCA 3QZGA 3NUNA 4NIFA 3VHEA 5FBOA 2IZRA 3NFGB 2C6EA 4HGEA 1SGHA 2IG7A 4OTPA 2OSCA 4BDAA 2XS0A 4EH4A 3A61A 5EQEA 3B2TA 5C5BA 3CC6A 5B2KA 1H07A 1JQHA 5EW3A 4JS8A 4L01A 1BYGA 2CCIA 5HLWA 4XV3A 1Q62A 4TRLA 3ZRKA 4PDPA 1MRUA 2C6KA 4C37A 1A06A 3BJIA 5M07A 1B38A 2F7ZE 5BPYA 3TUBA 3BHYA 4M15A 4BDEA 5HD4A 4QT1A 3GT8A 5FTGA 5E7RA 3TJDA 4BIEA 3TZ7A 3UBDA 2XF0A 2DHJA 3V5QA 4PDYA 4O0UA 3BGPA 3BLRA 3QRUA 3HMNA 1MRVA 3C4EA 3DLZA 3SV0A 2WFYA 4ASXA 4FRFA 2CLXA 4FVQA 3VC4A 3RNYA 2R7BA 4E7WA 3ANQA 2VZ6A 3HKOA 1YOLA 4I21A 3U9NA 3C13A 4WJ7A 5I2SA 3DJ6A 5DBXA 4YZNA 2UZVA 3R0TA 3ZO2A 1ST0A 4J97A 1QQGA 1YOJA 2YLEA 3ORPA 4IOYX 1OITA 3GQIA 4X7QA 4AACA 4C3PA 3NSUA 2YZLA 3P4KA 3H9RA 3R1SA 4ZOGA 2K2UA 3VONA 4FNWA 4UMRA 2B0QA 2RFDA 5KMLA 3E62A 3AC4A 3HUCA 5T6KA 4EKUA 5JN2A 2OK1A 1ZZLA 2OW3A 4AN2A 5E8VA 4FNXA 4NT4A 4RIOA 1ZYIA 4B4LA 2OU7A 3IOPA 1U5QA 2W5AA 5D12A 3N4VA 1OI9A 4O84A 2OJGA 3EKNA 4ASDA 2BUJA 4UBAA 2GS6A 3F88A 5I9UA 3GC0A 3IPHA 2WTWA 2WOUA 4U43A 3LQ5A 1YW2A 4BGHA 2PVKA 5C16A 1UV5A 3DFAA 4XYFA 4ZTRA 2YABA 4JG6A 1P5TA 4GIIA 3QQGA 1BKXA 3U6IA 1OGYA 3OT8A 2NMBA 4DTAA 1AGWA 4RWJA 4X3FC 4FOCA 1W1GA 3TKUA 4A5KA 5AMNA 3R1NA 3MYGA 2IW6A 1Q3WA 4X3JA 2QOLA 3QQLA 1PYXA 3LHJA 2C30A 2Q13A 3R2YA 4EUUA 2YWVA 3NLBA 4G3CA 2Y8FA 4DFLA 3ML4A 3BYMA 4XRJA 1EH4A 3OUNB 3E3BX 1B39A 3E5AA 4WBOA 3HV6A 4IB3A 3GC8A 2UUEA 2ZV7A 5KHXA 3HVCA 1X1GA 2NZ8B 4V05A 4D28A 2ITWA 2H6DA 5IA5A 5B2LA 5BUEA 2UZEA 4HNIA 5DLSA 4C36A 4EMOA 3UO6A 2F57A 5J3QA 4FG8A 5HCXA 4TY1A 3BI6A 4FYNA 1V5UA 4NSTA 4HGSA 4GMVA 1FMKA 5HESA 2GMXA 1YWRA 4EOPA 3VIAA 3CXWA 4C62A 3TNPC 4CNHA 1V5PA 3C4FA 2YN8A 2J50A 3R28A 3ALNA 4FKTA 3DA6A 4FTNA 3A60A 5DEYA 2WEIA 3MI9A 4D9TA 4HJOA 5LXMA 4XP0A 2UZNA 3QLFA 4NJ3A 5FP5A 3TKIA 5A6OA 4NYEA 3SXRA 4WO5A 5H8BA 4M13A 3FMNA 2R09A 4HNFA 4LRJA 3W2CA 3CCNA 3ZTXA 4KIQA 5EM7A 5KNJA 3BZ3A 2Z7LA 3QTXA 5H9BA 4HB2B 2E9OA 4PPBA 1KUTA 3AGMA 5BMMA 3CY3A 3PVBA 1ZYLA 3ENMA 2VTOA 5IH6A 4KHBA 3QD0A 3GGFA 5D3XA 3Q4ZA 4KIKA 4YHJA 3OBJA 4EL9A 2V22A 2HENA 5EFXA 3U4WA 3FMJA 2D9YA 4X2FA 4AA5A 4CCUA 4DBNA 4JXFA 4G34A 4EHZA 2AEHA 4YBJA 5HNBA 2Z14A 3N7CA 2YIRA 3A8XA 4TXCA 2O65A 2PVRA 3GC7A 2DFKA 5KO1A 3GXLA 1WJMA 3G6GA 4D0WA 4RX8A 4O7NA 1J1BA 1UNLA 3MDBC 2X8IA 1H26A 4K2RA 5IDNA 1STCE 5BNJA 4DCAA 3TDWA 4XCUA 3GB2A 3PP0A 2ZDUA 1WGUA 3KXZA 3REPA 3O23A 5GJFA 2XK9A 3VUHA 3ROYA 4B99A 1U59A 3MH3A 3OG7A 4F9CA 4QMQA 4WSFA 3FSFA 3MGYA 2NO3A 2VNYA 4LRMA 5CSXA 3D5XA 4Q9SA 4C59A 5BVEA 1MIZB 2EJ8A 3D7TA 2J0MA 3DKGA 3FMHA 2FVDA 3SKCA 4CT2A 2O5KA 1Q97A 4FVPA 4I0SA 5DHFB 1KOBA 4D1ZA 4QP2A 2P2IA 5ANEA 1K3AA 5L2QA 4CZYB 2L1CA 5KHWA 2VN9A 3TN8A 3HRFA 3POZA 2R9SA 4ITJA 2KIEA 4PP7A 5IEVA 2ZDTA 4Y85A 3LCTA 3P7CA 4DH8A 1ZYDA 2XM9A 3R7IA 4MY6A 3OMVA 1FOTA 3TG1A 1VEBA 3ZMMA 4H3PA 3R83A 1MQ4A 2DHIA 2Q83A 3HV7A 3DK3A 1PW2A 4I3ZA 4QTCA 3C4CA 1OB3A 4YZ9A 1WFCA 4BIBA 4O91A 2B9JA 3ML1A 3P9JA 2DWBA 4FV3A 4CYEA 2XIYA 4JAIA 3CXBB 4JQ8A 2VSZA 5CLLB 2JKOA 4RIWB 5E8UA 5EYMA 1RJ2A 4BWKA 1WVXA 1ZVRA 1OKWA 2YJSA 5HVKA 1QPCA 4L67A 3G6HA 5JHHA 3UDZA 3BHVA 4MKCA 1OPJA 4FODA 3IDPA 4YJNA 1J7UA 2JP2A 4O7TA 1DI8A 2B1PA 3R8VA 3UODA 4Q5HA 4HPTE 4KHAA 2PUIA 4GH2A 1PYEA 5CLQB 3TNQB 4BR3A 3E8CA 2GNFA 2VTRA 5F95A 5LMAA 3ID6C 2W0JA 1OUKA 4F0IA 3IGOA 5ACBC 3U6JA 4IVAA 4KRCA 5HX8A 4FVRA 3KY2A 2D9ZA 1PXIA 3UG2A 2P0DA 4ZY6A 4DFXE 2VX0A 5F94A 1MK9B 4C4GA 1H08A 4UALA 4RC3A 4LV8A 3W2RA 3W0RA 2W06A 3PXYA 4PDOA 4EZ7A 4IE9A 3AXWA 3IW4A 3MFRA 3NCGA 2IZTA 4ZTNA 3KIOC 4QYHA 1YHVA 1NI2A 4QXAB 5DA3A 3Q2JA 2I5CA 3GP0A 4IB5A 1YHWA 4IZ5A 3PJCA 4P90A 2IW9A 3V8SA 2HZ0A 5IQIA 4Z9LA 1H28A 4ZMEA 4PMTA 5DEWA 4CZUA 4FV2A 4MXOA 5AJQA 3QKKA 3GCUA 2XBJA 3RP9A 3CD8A 4A9UA 4D1SA 2CKQA 2WQNA 1K9AA 4X2GA 2WTVA 1H8FA 2C0OA 3CLYA 1TJ6A 3C5UA 3HMMA 3Q6WA 3ZRMA 2JBPA 2OI4X 4FKLA 4FT3A 3SXFA 3OWJA 4PMPA 3ELJA 3DLSA 3QTUA 2D4QA 1YI3A 2UZRA 5M4IA 3R8MA 3IW6A 5AAEA 1JKKA 4FTTA 1Q8ZA 4L6EA 3HEGA 1GY3A 2R3QA 4NM3A 4U3ZA 3K3IA 4NTSA 2YACA 1XJDA 2UVXA 2UZDA 4FSMA 4BF2A 3NIZA 2EWAA 5IISA 4DHZA 3V8WA 3VS5A 3UOLA 2DYQA 3CJFA 1H4LA 3OTUA 3LFSA 4JJRA 3PVLA 3LXPA 1FMOE 2WMXA 3A58A 4MH7A 2PMNX 3Q9YA 3V04A 3D14A 4LMUA 2VNWA 5CASA 4QMNA 1G3NA 3UYTA 4F63A 1X86A 4AW2A 4XBRA 3P7AA 3QUPA 4UMUA 4UV0A 3KF4A 3E7OA 2XCHA 2YCSA 4RZWA 5DI1A 3W18A 4ARKA 2I0EA 3COMA 5EHLA 3BINA 3KXXA 5E8TA 2W1DA 1X1FA 3I6UA 4C4EA 5HTCA 3W0SA 2C1BA 3BWFA 1OL1A 4E5BA 4J8NA 4A6HA 5E8YA 5C9CA 4E73A 4QYGA 4ZLZA 3GOKA 3G0FA 4J71A 5JZJA 4WNOA 3NUYA 5CZIA 4QMVA 3PTGA 4YBKA 1K5GB 4TNDA 2XKEA 5KMIA 4HYHA 3WARA 4CFXA 4D2TA 2E2BA 4JBVA 5BVOA 4ENYA 2RVBB 3AKLA 2VWXA 1U27A 4HZRA 4PPAA 4QOXA 4GU6A 4IMYA 3KVXA 2A4LA 2PZIA 1KOAA 3WBLA 4FK6A 4IHPA 4YONA 3LFQA 3MFUA 2Q0NA 4XUFA 3AJ4A 3FQEA 3AD4A 2OQBA 3L8VA 2Y9QA 4C02A 1ATPE 3PJ3A 5D3VA 2ITUA 3MESA 2JIUA 3FQHA 3EJ1A 4TW9A 4W8DA 4ZXTA 2MFQA 2XQNM 3ZC5A 2QHNA 3TV4A 2J4ZA 4FV8A 4G31A 1OBDA 5FUTA 5EM5A 2YDJA 4GSBA 4BKJA 4B7TA 5J79A 4KSQA 2C0TA 3R9RA 5ICPA 5CVFA 3U6HA 2IJMA 4HVDA 5HG9A 4FIEA 2QU5A 3ETAA 4GT5A 5AAGA 2FJUB 2YM5A 1GC6A 2AL6A 3F2NA 3HAMA 2PL0A 3QRKA 4NCTC 2J0JA 3LZBA 4UYAA 2FO0A 3EKKA 5AADA 4ZIMA 1QMZA 2ZYBA 3SUZA 2OIDA 3OD6X 4TWNA 4E3CA 3TCAA 4FGRA 4LOOA 3ZUVA 4C38A 2DTCA 3DBQA 4HGLA 2R3MA 4FZFB 3LW0A 3OF0A 3FWQA 4QNAA 4CYIA 3W0NA 1L3RE 4LOQA 5KMNA 4NZWB 5DMZA 3V8TA 3F5RA 3R7YA 1ZXEA 2QI8A 3AC2A 3QQFA 3ZO4A 3QTQA 1XH9A 3LJ2A 3VOQA 4ACDA 4F70A 3BHHA 3EFLA 4ZP5A 2JAVA 4BDKA 1M52A 4GOUA 3UMXA 5A4QA 1ND4A 3O17A 4QQJA 4FSTA 1E9HA 3QGWA 2GHLA 4NM5A 4JBPA 4FKRA 4QPSA 2BTRA 4R1YA 1ZMWA 4F6UA 2VKIA 5E8SA 2WHBA 1O9UA 5DR9A 2WXVA 3DBEA 4O6EA 4MF1A 4S33A 3LJUX 4R3CA 4DT9A 3BYUA 4S31A 2YIWA 1YXUA 3NX8A 4QDEA 4J7BA 4YJVA 5L8JA 2PWLA 2K8EA 3E64A 3FY0A 3KSYA 2ZMCA 4EH9A 1PXPA 5H2UA 5C8NA 3L8XA 3VJNA 1BUHA 3FXXA 1DDMA 4X2NA 3LCKA 5JH6A 3DPKA 4FG9A 3EYHA 4U81A 3SYXA 2GUMA 2R0DA 3V01A 3ZCLA 4L7FA 3LJ0A 4JRNA 2YM6A 4GIHA 4QMWA 1CKPA 4TKNA 2F49A 4FSYA 1YXXA 4H39A 4F08A 4FSNA 4IAAA 5FDXA 2G15A 2FH9A 3LKMA 4DFZE 4IIRA 1GZOA 5C03A 3CKXA 3VS2A 4D2WA 2VTTA 1FVRA 3OHMB 2BHEA 3QA0A 4WT6A 2LAVA 4Y94A 3Q4UA 3VBYA 3EQRA 4XG9A 5AR5A 2PK9A 4XWXA 3HRCA 4FT9A 3HV4A 4ID7A 3NZ0A 2J6MA 4LGHA 2R3NA 4UMQA 3LXNA 5LQFA 3NW8A 1Y6BA 2ITVA 1TQIA 5GOWB 3W0QA 3NYNA 2QLQA 4UYNA 4AA4A 4YSJA 2D9WA 4DDGA 2IN6A 1ZRZA 4AT5A 3UMWA 4HYIA 2ITXA 5GIPE 1F0QA 3RGFA 2Z0OA 2YA9A 4YHTA 3V5WA 2I5FA 2XIRA 3MPTA 1AQCA 5IMXA 2VX1A 2R2YA 2VTPA 2WMQA 3B8RA 2OXDA 2W99B 2W1ZA 1WI1A 4O21A 2W17A 1YVJA 3R01A 4ZTQA 4BI1A 4LGDA 4NM7A 5L81A 4L3PA 4E8AA 1GZKA 4F9WA 1JOWB 3PXQA 5AUWA 4LV5A 2Z7QA 5HU9A 3S1HA 5LOPB 4M14A 2GTMA 5LARA 4DC2A 1UKHA 2O64A 2XK7A 2QURA 3MA3A 3N4TA 4O7LA 2GNJA 4O7SA 3NR9A 4BJJA 3PIYA 3S4QA 4I1ZA 1WBNA 2AQXA 3D15A 2B53A 4M67A 4D2VA 3JVRA 4A7CA 3EFWA 4MX9A 1PMVA 2ETRA 1W0XC 2QOHA 4Q2AA 4X6QC 5AR4A 3T8OA 3UC3A 5J1VA 2AC3A 4XJ0A 1Q8YA 4O0TA 4G2FA 1XMLA 3DCXA 2UZTA 3TWJA 3NS9A 4C3FA 3CGOA 2XK4A 3MTFA 3AMBA 1WZYA 4FTMA 3MB7A 5IH4A 2WKMA 3UIXA 2YDIA 3QUDA 4L68A 5C1QB 5TR6A 4HSIA 3EN5A 3ZZEA 2R64A 3FDNA 1PJKA 2YSZA 1YRPA 3DTWA 3FZSA 5AUZA 2XNMA 3O2MA 1NVSA 4KS7A 3ZYAA 2N23A 5G6VA 4BCIA 4NL0A 5EG3A 5L8KA 2GS0A 3SO6A 2BALA 5CLPA 5J9YA 2C1AA 3KCKA 5DT4A 4JT3A 3R00A 4EOSA 5ITAA 2C5VA 1ZOGA 5AWMA 2W2XC 4ZRJA 5EKOA 3RWQA 4DX8A 4UMTA 4CXAA 2X2LA 2FJLA 4OT1A 3GU5A 3FI4A 4H3BA 4TZRA 2VUWA 3L1SA 4GL9A 2JAMA 4AZVA 2QLUA 5F9EA 5I9YA 4BI0A 1ZYSA 2REIA 4FTJA 2YT2A 1VR2A 2Z02A 4J53A 3OROA 4JG8A 3R7OA 1UNPA 5J8IA 3I7CA 4ERKA 3I0QA 3UQCA 4K33A 1IG1A 2R4BA 4YJRA 3KXHA 3WZUA 4CYJA 4AUAA 4BBKA 1ZSQA 4GKIA 4UWCA 1SM2A 3GU4A 4H1MA 4FTRA 4HGTA 1XBAA 2FGIA 2QKWB 3EQFA 1Q99A 4J98A 2CGVA 3UOJA 3C4ZA 3U12A 2DYNA 2CKEA 2WU7A 1DS5A 2YCFA 3R04A 3SW7A 3UZTA 2C6TA 2UZSA 3TI1A 1BMKA 5HO7A 3ACJA 4IVBA 3UNJA 4AGWA 4FL3A 5CXHA 3QRJA 1ERKA 5CVGA 5AM6A 4R77A 2WIPA 4FZAB 4Y46A 4TL0A 4KBAA 1UPRA 1NA7A 4YTHA 3S95A 4DEGA 4GG7A 5AX3A 3FSSA 1OIYA 3OCGA 1W2DA 2ZOQA 5E1SA 4IJ9A 3WZJA 2HXLA 4BRXA 2BRGA 2N0YA 2BZHB 4I6BA 4PWNA 2JIIA 3QD2B 4BN1A 4GFOA 3DJ5A 1LW3A 3PZHA 4XX9A 2YM4A 4OBOA 2X4ZA 5CS6A 4FTQA 5HICA 5HE1A 5GINE 3RHKA 1DROA 3EL8A 3LIJA 3NPCA 4L8MA 3CKWA 3VAPA 3RK9A 2DS1A 5ANGA 5DVRA 4S32A 4K1BA 4QP3A 5IEXA 3L8PA 4YZDA 3AKKA 1V0PA 2G2FA 3EH9A 4NUSA 3ANRA 3BYSA 2AC5A 3OEZA 4O2ZA 4O4BB 4C7TA 4CSVA 4EHGA 5GNKA 2D9XA 1YDRE 1AQ1A 2EB3A 4RVTA 3VW6A 3LLTA 1PF8A 3Q5IA 4AN3A 1XWSA 2W1GA 5AV1A 2UZWE 4DG0E 4HAUB 3QTRA 4OGRA 2G9XA 3MVMA 4CMUA 1FGZA 3PLSA 1G5SA 2B9FA 4YPSA 2GHMA 4QP8A 3M2WA 3VNTA 3OWPA 4QEBA 5E90A 3MSSA 2H34A 1UNQA 4A9YA 1IA9A 2V62A 4QP9A 1Z9XA 4F9AA 3FC2A 1NTYA 2WZJA 4MXYA 4F6WA 5EDQA 2CRFA 5J5SA 4DE4A 5D27A 1ZY4A 4F0FA 2CKOA 1NY3A 1PMNA 2ZB1A 2GSFA 3PXKA 1OPKA 4IZAA 2UW3A 3Q9XA 3AQVA 5GJGA 3QTWA 4UXQA 2EXMA 4AOIA 5CU0A 3QYWA 2BFYA 4BDDA 1YOMA 3OCSA 3RAIA 1NVRA 3A8PA 4AXDA 4P7EA 4FKVA 3WE8A 2KUQA 4C2VA 2E9PA 1YI4A 3FZRA 3HDMA 5GJDA 1FGIA 4OTWA 4PP9A 4AZEA 4BBEA 1H27A 3GCVA 3TZMA 5BQ0A 3N9XA 3QWKA 1WAKA 2QNJA 3BHTA 3DKFA 4ITIA 4JAJA 1B6CB 4JBOA 3ZC6A 3BV3A 3JUHA 1HCLA 1URCA 4YMJA 3EN7A 5FEEA 2VTLA 2HK5A 2X81A 2C6MA 4YPDA 5CZHA 2Z0QA 3OHTA 2QHMA 1WVWA 1JWHA 3ZUTA 3PJ8A 3PE1A 2PVFA 4PL3A 4BCJA 4EK6A 4A6FB 3MN3A 5FG8A 2YDKA 2FSOX 2ZVAA 2PSQA 2E2XA 2W96B 3F3WA 5F20A 3ALOA 3UZPA 3S00A 2GU8A 4L53A 4BCNA 4D4YA 3RZBA 1SNXA 2H7DA 1UU3A 2AYPA 3NVKI 2COCA 1YWVA 5ANJA 4F7UP 1YXSA 2QODA 2RF9A 3BL9A 2VWIA 3CBLA