5KCVA

Crystal structure of allosteric inhibitor, arq 092, in complex with autoinhibited form of akt1
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
433
structure length
353
Chain Sequence
IVKEGWLHKRGEYITWRPRYFLLKNDGTFIGYKERPAPLNNFSVAQCQLMKTERPRPNTFIIRCLQWTTVIERTFHVETPEEREEWTTAIQRVTMNEFEYLKLLGKGTFGKVILVKEKATGRYYAMKILKKVLQNSRHPFLTALKYSFQTHDRLCFVMEYANGGELFFHLSRERVFSEDRARFYGAEIVSALDYLHSEKNVVYRDLKLENLMLDKDGHIKITDFGLCPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHEKLFELILMEEIRFPRTLGPEAKSLLSGLLKKDPKQRLGGGSEDAKEIMQHRFFAGIVWQHVYEKKLSPPFKPQVTSETDTRYF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RAC-alpha serine/threonine-protein kinase
publication title Discovery of 3-(3-(4-(1-Aminocyclobutyl)phenyl)-5-phenyl-3H-imidazo[4,5-b]pyridin-2-yl)pyridin-2-amine (ARQ 092): An Orally Bioavailable, Selective, and Potent Allosteric AKT Inhibitor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/inhibitor
total genus 90
structure length 353
sequence length 433
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2016-06-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
A PF00169 PH PH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 5kcvA03
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 5kcvA01
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 5kcvA02
4E20A 4ANSA 1PF8A 4JXFA 3NUSA 4I0TA 4PDOA 4YJPA 4RJ5A 3F88A 4KSQA 3ZLWA 1UNQA 3FEHA 4FKRA 3BU5A 4FTTA 4CT1A 2UW8A 2CY5A 3FSKA 2DTCA 2BUJA 2EVAA 4AT4A 2M14A 1DI8A 5ANOA 4O81A 3ZU7A 4RWIA 2W1IA 3KEXA 5C9CA 5L8JA 5DMZA 1I44A 2O5KA 4R6VA 3SO6A 5HQ0A 3OD6X 4EOPA 2BDFA 3PXRA 4QYGA 5AR4A 3TZ9A 3OOGA 4OTGA 1CDKA 2ONLA 4L67A 3ZFXA 2J0KA 3CY3A 1H1PA 2O8YA 4LOQA 4R7BA 5M4FA 1NW1A 3GU7A 2BIKB 1YOJA 2WHBA 3UOJA 3RAIA 3OCTA 4E3CA 4Z7GA 1NU2A 4TKSA 2VTNA 2CDZA 2CKEA 3DDQA 3S00A 1DM2A 3G51A 4QT1A 2YWPA 5L2TA 3KY9A 3HL7A 4JBVA 4L00A 1WJMA 1Q8WA 1UNPA 5AAFA 3UVQA 3DCVA 3LCOA 4W8EA 1X1FA 4BB4A 3P79A 4W9XA 5HHWA 4I0RA 2D4QA 1ZYCA 5JFWA 3OUKA 5JZJA 3WIKA 1H07A 4QNAA 3RPYA 4ASXA 3TZ7A 5J95A 3Q3BA 3QCSA 4F70A 1H24A 3TZ8A 3VVHA 3JS2A 3QGYA 4K77A 5E91A 4B8LA 2I40A 5BQ0A 3FMJA 3TTJA 5A4CA 4FK6A 5DT4A 3R21A 5CF5A 4PNKA 1H8FA 3NEWA 3D8DA 5BYYA 2WOUA 4X2KA 2QKWB 1BX6A 1KZGA 2YDIA 3EQCA 3NZ0A 3EIDA 4XG7A 3OOMA 3QX2A 5JRQA 4RVTA 5KMKA 1NY3A 2PUIA 4V0GB 3ZTXA 3E5AA 4EKKA 2NMBA 3EQFA 3ZBFA 3WF5A 4A06A 4YJVA 2CGWA 3EQPA 1GAGA 1ZMWA 3V04A 5TR6A 5E8TA 3O23A 3RNYA 2B55A 5J9ZA 4XG9A 3G0EA 3QC9A 3DY7A 4ENYA 4O7RA 4G5JA 5CF8A 5T3QA 3OWJA 3ORPA 3D83A 2DS1A 5AUZA 1R0PA 4R78A 2GNLA 4J8NA 4LG4A 3H4JA 2J90A 5DT3A 4BI1A 2VWVA 3RPSA 2GJYA 3LAUA 2GDOA 3F5XA 2IZTA 2Z7SA 4MNEB 4WNKA 4CV8A 3BHTA 2XIYA 1U4DA 3COHA 1WVYA 4HVHA 3Q9YA 4L3PA 5CI7A 4YBJA 4CTCA 4I93A 4HYHA 2OF4A 1PXMA 5HE1A 5M53A 2WTKB 2GCLA 3RWPA 3CC6A 4B99A 2QLQA 3EN6A 3KXXA 5DE2A 4QQTA 5KMJA 4X6QC 3LKMA 2L1CA 1Z87A 4JQ8A 5F95A 4ZY6A 3VS2A 2PY3A 2XKCA 3EKNA 4IJ9A 5CI6A 3UQCA 4BDJA 3DAEA 3O8PA 3Q9ZA 3Q04A 1NTVA 2RG5A 4DHFA 5T6KA 2W1GA 3FZ1A 2VTMA 4I21A 4IX5A 2K2JA 4ZRJA 3SG9A 3CIKA 2P55A 3FEGA 3KN6A 4DFYA 3LCKA 2PMLX 3FZSA 4ITHA 1V0PA 4J52A 4WBOA 3GXLA 4ANLA 2MWNB 3R22A 1M17A 5K5NA 4HDOA 4F1MA 1OUYA 4ONAA 3DAKA 2EWAA 4ZLOA 3T06A 3DBDA 3MPAA 4U79A 5CEQA 5HCYA 5LVLA 3SRVB 2GQGA 4JG7A 5JHHA 4ZLZA 2ZVAA 4GEOA 3PA5A 3PWYA 5I3RA 1FMOE 4O84A 3A8WA 3QAME 3SXFA 5A46A 3AGLA 4TNDA 3MI9A 4BBMA 4BIBA 5CAUA 4V0GA 4XYFA 1Z5MA 2UV2A 2FSMX 2VTTA 2HZ4A 4EHGA 2FVDA 3FSSA 1G8AA 2IVTA 2P33A 3DU8A 4WSYA 1U5DA 5HIEA 1RRPB 1ZZLA 2ZV2A 2X2LA 5LQFA 3ORTA 4EJ7A 3D2IA 2AUHA 4YPSA 3A8QA 2AEHA 1JKKA 3PEGA 4LYNA 3ULCA 3F66A 3UC3A 4EZ7A 3D8EA 5LCKA 1REJA 3JUHA 3LCSA 4L68A 4RFYA 3NYXA 4K8AA 4MNEA 3VNTA 2BFXA 3C7QA 1PXIA 4P7IA 4KRCA 4NCTA 4MWIA 3R7VA 4IB3A 2VN9A 4UMPA 2EB3A 4R3CA 4TRLA 3KRWA 4V01A 1M14A 2XMYA 3R7EA 2H8HA 5AP2A 3O71A 2OU7A 4JDJA 3RMFA 1GY3A 3VJNA 3E8EA 2J5FA 4FNZA 4NWMA 3VULA 4DLJA 3FXZA 2UW0A 4I6HA 4O91A 4TWPA 4CGAA 4LL0A 5L4QA 1FB8A 5JGBA 4FUXA 4Z7HA 2Y8GA 5AJQA 3NCGA 4D2PA 1QPJA 2EMSA 5HTIA 2BRBA 3VN9A 3C51A 3ZSIA 3WILA 3FI3A 3ZVRA 4W9WA 2VU3A 2LG1A 4IZAA 4O21A 2JGZA 4LV8A 1T45A 3E7VA 4MK0A 3FYKX 1KV1A 3KC3A 3UQGA 4GVJA 3ZMMA 4MAOA 2QOLA 1MQ4A 5GIOE 5CQWA 5LVMA 5EQPA 1YDSE 4E6QA 2W4OA 3HW2B 4MD9E 3P7BA 4NM0A 2XCKA 3BU6A 3B8RA 4E5WA 5JGAA 3PJ2A 3FLSA 3WA0A 1KI1B 3KMUA 1IA9A 4KKEA 4XP0A 3SRVA 4IJPA 4D4SA 4AGCA 4RX7A 2KCJA 4XP2A 2I1MA 5DI9B 4H3BA 4O0SA 5CXZA 5I9YA 4NTSA 4GT3A 4L01A 3TNPC 4O0TA 3MGYA 2BAJA 2XJ2A 5IA0A 2PULA 3LQ8A 4C3FA 5L81A 1H0VA 4FT9A 3DS6A 3UPZA 3BHYA 2WQBA 4FV2A 3V8WA 3LOKA 4FV4A 4TL0A 5JKGA 1JSUA 5KBQA 3PLAE 2J9MA 1SVGA 2PZRA 4C35A 3EMGA 5AM6A 2ZV7A 4QMWA 3RINA 2P3GX 3MH0A 4E6CA 3O50A 5HO6A 3U6JA 3QQUA 3FY2A 3U51A 1PW2A 3ZYAA 1KE5A 3FC2A 1URWA 1SNXA 4EH5A 3D5VA 1PHKA 1WBWA 2J0MB 3OWKA 1DI9A 4IC7A 4S2ZA 3FI2A 4ZY5A 4UN0C 3ORKA 5B0XA 4GJ3A 2VO0A 2X7OA 3QWJA 3P6AA 1KE7A 5J8IA 4QMXA 4PMSA 5D3YA 3DT1A 2JIUA 1YXUA 4JRNA 2OO8X 4GU9A 2QKLA 4DTAA 4QQCA 2PMOX 3C4ZA 3I5ZA 4S30A 2JC6A 2WMWA 4GIHA 3VS3A 2COFA 4FEUA 2UZUE 4IAAA 4QMZA 3MN3A 3ZHPC 3L8XA 2UZRA 3PJ3A 5J3YA 3GCPA 2IYBA 4MKCA 4U3ZA 2RNRB 2CMWA 3KXHA 2ADZA 5EFQA 2BZIB 4BCNA 3BBWA 5BNJA 3EZRA 1Y6BA 3SW4A 3CTHA 3E88A 3QUEA 1SVEA 3UO4A 4AW1A 4QTAA 5FEQA 2F7ZE 2X6EA 4G3CA 4QYHA 4W4YA 3R7YA 3UODA 3QRUA 4FTKA 4C0AA 2G1TA 4JL9A 5AV2A 5HU3A 2A4LA 2ZM4A 4TYEA 5DA3A 3WF8A 2C47A 5E1SA 5M4UA 4MXOA 2G2HA 4YO6A 4V04A 3U9CA 3LFDA 5L3AA 1OB3A 3QIJA 1R3CA 5D3VA 4BTFA 4MNFA 4ERWA 3QCQA 1U46A 2E9VA 2ETRA 4JG6A 3WYFB 4X0MA 3VS7A 1OY2A 2FH9A 3D5UA 1ZLTA 1ZY5A 3NNVA 4BDFA 3DA6A 3I81A 1ZC3B 3IGOA 4KHAA 3B2WA 1YWNA 1VYZA 4I22A 2ETKA 4GN1A 4GMXB 1VYWA 3V8TA 3HZTA 2W05A 3L8VA 5E4HA 1BUHA 3IW8A 2I0EA 2JD5A 4QMTA 4F65A 3LE6A 2LOXA 4C36A 1KOAA 3EN9A 3UOKA 5DHFB 3C4EA 2PVJA 1GIIA 4FNXA 4B9DA 1VZOA 4AGWA 3R1QA 4D2RA 3PG3A 4FG9A 4X7QA 1FGZA 2YSZA 4LGGA 1CTPE 3N9XA 2XJ1A 2VTSA 3ZUTA 5HORA 1FAOA 2O64A 4EJNA 2UZVA 2ITNA 3D7TB 4WVFB 3MFUA 2W2WA 2B54A 1F0QA 4FG8A 3QRJA 5L8LA 4AGDA 2J0MA 3A60A 4H36A 1Y8GA 5HX8A 3AC4A 3DB6A 5IA5A 5BYZA 5F20A 4U3YA 3MSSA 2R3FA 1Q3DA 3PYYA 4CYIA 5EKNA 4IADA 5HEZA 1PLSA 3R9OA 2W7XA 4L3LA 2CAYA 3SD0A 1ZARA 2JKKA 4RQVA 4WA9A 4O7SA 4O7TA 2WEIA 2A1AB 2V55A 2R3GA 3DJ7A 4ZIMA 1OKVA 3ZDTA 1K3AA 4BHZA 3DDPA 5KX8A 2F9GA 2PVYA 3POZA 3PSDA 3KMMA 5CT0A 3R73A 4F1OA 1TXDA 1OIRA 2GS2A 2WD1A 3F3VA 4NJ3A 5HG7A 3VUGA 2CKOA 4CFWA 5B2KA 4AZSA 2BROA 1LB1A 2L2IA 4GXBA 3TM0A 4DE4A 3BYSA 2GFSA 4I6FA 5E8ZA 3W8LA 5FXRA 2C0IA 4H1MA 5HCZA 3MA3A 5AP1A 3ZFYA 2Y6OA 4ZSJA 4TZRA 3L8SA 4I3ZA 2BAKA 2GPHA 2CCIA 1B39A 2WNTA 4IEBA 3UO6A 2YFXA 4OTWA 1W1GA 4G16A 5EYCA 4O0WA 1P5EA 4TWCA 3I0QA 4JVGA 4YTIA 4N0SA 4XG2A 4C2WA 4J98A 3PY1A 4FKIA 4G17A 1V89A 5D27A 5E8WA 3DJ6A 4CFXA 4ZTQA 1H00A 2CN5A 3TWJA 1GIJA 4O2ZA 3DFCB 4CFVA 2R3PA 4BCMA 4GJ2A 4F1TA 3LMHA 4YJNA 3GB2A 1Q99A 5BVNA 4ACCA 3QTIA 5EFXA 3KXNA 1XKEA 2ZB0A 2GNIA 3E87A 1Q5KA 5I5ZA 4YJRA 1DDMA 4FSMA 3E3BX 4HAYB 3HQCA 2JFMA 4GT4A 2D10A 2C6MA 3MW1A 3KXMA 2EU9A 3Q32A 4MXYA 1YKRA 1VR2A 2DHIA 1OGUA 4I1ZA 3UGCA 4E4LA 2ZMDA 2XKEA 4DFZE 3GUBA 4ZTRA 5DNRA 2DFKA 5GZ8A 4C3RA 3D7TA 4E5BA 1J7LA 4BDBA 4IX4A 1OIYA 2B1PA 5M08A 3UVRA 3HV6A 2VSZA 3UMXA 4O7LA 3GYOA 1J3HA 5FEDA 2P2HA 2W1CA 5CSXA 3RCPA 2R5TA 2XM9A 5E7RA 5I9WA 5DWRA 5J9LA 3A7IA 4W4VA 3DQWA 3DQXA 4D0XA 4Z16A 3DV3A 5AUUA 5CTPA 4CKJA 3ZEWA 2O0UA 4IVBA 5AUYA 3PG7A 2X8EA 2HXLA 5L6OA 1MIXA 4K81A 3UIMA 3PSBA 4CD0A 3L9PA 4FIHA 5ETFA 5C01A 2OLCA 4AE9A 3MY5A 3W55A 2C3IB 3JVSA 5BMSA 1Z57A 2J5EA 4J95A 2EJ8A 5EI6A 3I60A 3EWHA 3NLBA 1SMHA 3AMYA 5DRBA 3O7LB 1YOLA 2MFQA 4EKUA 5CEMA 4Y73A 4G3DA 2WQNA 3OY3A 2H6DA 2YERA 3LW0A 3SXSA 4MEDA 1WBSA 4EL9A 2HOGA 4C0TA 2XNPA 2C6KA 4WSFA 4QTBA 3F5PA 3OCSA 4RIWB 4EYJA 5LCJA 2D2QA 2YM3A 5FM3A 1DBHA 3ANRA 4ZLYA 4MTAA 1B6CB 4XH6A 3W10A 5IA2A 5CAQA 3CTJA 4JG8A 4L52A 4HGTA 1NVQA 1KOBA 4IXPA 2Y8OA 4K11A 2ITTA 5B7VA 2WMBA 4BDIA 3RP9A 3KXZA 5M51A 4MXXA 4L6QA 1YXTA 1BL7A 4FX3A 4C4FA 2FSTX 1ZC4B 5M07A 4EK3A 4G6OA 5ITAA 2IPXA 4YJTA 3QTUA 1S9JA 3EN7A 4HYSA 4QMSA 1F3MC 4QNYA 4D2VA 5K4JA 3UBDA 3A62A 3F69A 4YUQA 4ASDA 4DBXA 3BBTB 3ROCA 4AZVA 5AUTA 3LIJA 3Q4TA 1YWVA 3U8WA 3BINA 4LRJA 4PPCA 5EM7A 3G5DA 2PVNA 3A8PA 2W0JA 1XH5A 4GCJA 4U44A 2WAJA 3DBFA 4EYMA 3AD6A 1WBVA 5F94A 5LWNA 4L3JA 3UTOA 2BTSA 4UEUA 2WGJA 4U80A 4YJOA 2VNYA 5JHGA 4OLIA 1BMKA 1NVSA 2R3NA 3PRFA 4RLLA 4UY9A 2V22A 4GT5A 4AA5A 3COMA 4FZFB 2YM7A 3LXKA 4TNBA 1ZOGA 4ACGA 5IG1A 5AV3A 2WFYA 1YW2A 4XV2A 4F0IA 1FMKA 1ZYLA 2WQOA 2Y4PA 5AV4A 4ZTHA 2C6EA 4ZTMA 4RWKA 1R1WA 3ORLA 4RSSA 3UOHA 5JSMA 2OH4A 2VUWA 4WRGA 4S31A 4DFLA 3E8DA 4NUSA 4F6WA 2ESMA 2R3OA 4C34A 1S9IA 1EF1A 2ELBA 3VOQA 4HAUB 2XNMA 1YDRE 3QC4A 4F9AA 4DT9A 2HZNA 3AD5A 3I6UA 3UC4A 4R77A 2Y7JA 2ZAZA 3R9HA 4O82A 5AUWA 3SDJA 4AUAA 5HU9A 2YA9A 4F7GA 4CMOA 1Y6AA 2XKFA 4IAYA 3EN4A 4LGDA 2BFYA 4PQNA 1J7UA 1UNRA 5IMEA 2VWBA 3HYHA 4RIWA 3SKCA 2EXMA 4AXAA 3TJCA 4PWNA 4NL0A 4BDHA 1YQJA 5CENA 4IAPA 3ZSHA 4GL9A 1TKIA 2F57A 5E1EA 4DFUA 2RG6A 1JAMA 4EOLA 2ZOQA 1H25A 3HKOA 1IEPA 4HNIA 4DG0E 4I92A 3G33A 3V6RA 4Q9ZA 1H28A 3D5XA 4CFUA 3GBZA 3FYJX 3Q2JA 3G2FA 5C27A 5EYKA 2HWOA 3TL8A 3BYMA 2C6IA 3D9VA 5CS6A 3CD3A 4II5A 5TE0A 2B9JA 5CXHA 4IOYX 3L9LA 5J5TA 3OP5A 4FTAA 2D9XA 5A9UA 3ZO1A 4AP7A 2VX3A 3NAYA 4Y72A 4AG8A 4G3GA 2XK8A 2COAA 1OL5A 2UW5A 3Q4ZA 3R7OA 3SHEA 3ZUUA 4IIRA 4DAWA 4YO4A 4UYNA 4A07A 2DN6A 2O65A 4K18A 4M8TA 2HE7A 2YS3A 1XODA 5IUIA 4A9TA 5CALA 2UZEA 2YIYA 2XK6A 4FGRA 4YMJA 3P9JA 2ELAA 4WHZA 1GZNA 1LEZA 2ZJWA 3FZOA 3LM5A 2PZ1A 4IWOA 1K5GB 2XEYA 4KABA 2YEXA 4FZDB 4O0YA 5L2QA 4CFFA 4PQ0A 1CM8A 4M68A 2E2XA 1YI6A 4UZHA 4YZDA 1AQ1A 4PL3A 3WZDA 4EUUA 3RAHA 4FL3A 2GNJA 4BYJA 3AC1A 2AC5A 3BWJA 4PNIA 5DVRA 3VW8A 3H30A 2QD9A 4LL5A 1EVHA 4GG7A 1Y8YA 3QTWA 3KF4A 4BTMA 1MPHA 4BYIA 4JIKA 3BEGA 5I3OA 3SVVA 4OR5A 1I2HA 2D9WA 3IECA 5KQ1A 3OHTA 4PTCA 3FMEA 4IB5A 4WG5A 3ODOA 2VTIA 2BKKA 3B2TA 2BILB 4D28A 5M09A 4Y94A 1EGXA 4YLLA 3DXNA 3UP2A 2BPMA 4KB8A 3GC0A 3BZ3A 4FSUA 4U97A 2AC3A 5IA4A 5KHWA 2D11A 4D1XA 4OTPA 4RLKA 3EFKA 4YZMA 5F4NA 5IQGA 5KUPA 1JNKA 5HE3A 3T3UA 3F3ZA 5DGZA 2PMNX 5M44A 2PZYA 1EAZA 3CTQA 5C79A 4KS7A 4XCUA 3ZC5A 2J7TA 2OSCA 4JIAA 4O7NA 4NY0A 4JX3A 1M7QA 1H10A 4FKOA 3QL8A 4GVAA 4M67A 4FTOA 3R8PA 3WE8A 2N23A 4U81A 3EQHA 3G90X 4GK2A 3IDPA 1J19A 1W1HA 5IQHA 1KWPA 4HB4B 3C0GA 3VS0A 1OI9A 4DX8A 3PPZA 4O7VA 5AP6A 3WF7A 3PJ8A 4YPDA 4WJ7A 1L3RE 3C13A 1R0EA 2PE2A 5DHJA 5BVEA 4KIOA 4C59A 1E1VA 3BYOA 3HRFA 3ALOA 4M3QA 4D0WA 4S32A 3BE2A 1PKDA 3QXPA 4O0XA 1OBGA 4TW9A 4FODA 3TVVA 4F64A 4BZDA 4APCA 1APME 2O63A 2QOIA 5GJFA 3MYGA 3PDTA 5CLLB 5FTGA 3QTRA 4EH7A 3PPJA 4C4GA 4XBRA 1ZOEA 3K5VA 4RG0A 3NSUA 1KUTA 4CHJA 4PMPA 3N51A 3UVPA 4EKLA 3OANA 3ZEPA 1OBDA 2HW6A 3FBVA 4PL5A 3R7IA 3S1HA 1X8BA 4XX9A 1M7NA 3ZO2A 1URCA 2YJRA 3QKMA 3NGAA 3COIA 2R3LA 4U40A 3VQUA 4H8SA 3FAAA 3OXTA 5HG5A 4TWOA 3FWQA 1PRYA 1Q4LA 3NVMB 3R9RA 2B9FA 3EQBA 3K2LA 2PK9A 1U5GA 3LFEA 4KKHA 3V6SA 4BDEA 3C4FA 3LMIA 5AADA 3QKLA 5LXMA 4K2OA 1MRUA 4Q2AA 3KRXA 3DKCA 2WMRA 3MTLA 4HGEA 3BQCA 5BVKA 5TKDA 1JLUE 3MDYA 5CSPA 2QKMA 2H96A 5L6WL 3V8SA 1PJKA 4P2KA 3HDNA 1ZM0A 1WGUA 1OMWA 3FQEA 3F7WA 1PXJA 4M13A 3TV6A 3W2OA 4E1ZA 2GU8A 2VNWA 3TI1A 2H34A 3KZ1A 3FJQE 3JY9A 3FPMA 2GS0A 1Q8UA 5ETIA 3RZFA 4FV0A 4H39A 1UU7A 4GK4A 2IZRA 2RFDA 1W7HA 3MJ2A 5HLWA 3OBGA 2XK7A 3QWKA 4W8DA 3GC8A 3W8QA 2QO7A 3VAPA 2Z8CA 4KIPA 4H05A 2QHMA 2Q0NA 2ZV9A 3OS3A 4EK8A 3TUBA 2BRNA 4JAJA 3ZRLA 3HP2A 4TWNA 4O7ZA 3RBWA 3VS4A 2COCA 5I9VA 2XYUA 1TQPA 3EQIA 3MVJA 2R3IA 5BMMA 1W0XC 5FDXA 1IAHA 2QNJA 3LCDA 3MIAA 3LZBA 4FKSA 4FTCA 4IWQA 3RZBA 4BN1A 5IMXA 5KCVA 4I5PA 3UIBA 2XK3A 1RDQE 1TQZA 5HIDA 3BEAA 4O1PA 2RGNB 1WAKA 1WVXA 1P2AA 3IW5A 5EH0A 5KMOA 1NA7A 2VV9A 4XHKB 5BVWA 4ZJIA 1XR0B 5H9BA 2K2UA 3ODYX 4CVAA 3ZBXA 1YVJA 2HY81 3WZJA 4ZTNA 1PKGA 3BE9A 3QZIA 1P4FA 4XRJA 2EC1A 3TNHA 3HA6A 5FDPA 1CMKE 1YDTE 4LRKA 4F09A 3D14A 1XO2B 2QU6A 4DYMA 5IUHA 5BVDA 5BYLA 2JAMA 4ORKA 2PMIA 4DC2A 3VBTA 2C6DA 1LR4A 2GSFA 2IJMA 2YZAA 4GYIA 5CY3A 3SUZA 3G9LX 5EI8A 5HVYA 3TT0A 4DITA 4TPTA 3R28A 3Q96A 1JWHA 4I0SA 1QCFA 4BCGA 4EHZA 4EWHA 3PVGA 3R8LA 4BI0A 3M1IB 3CQWA 4QMYA 5DR2A 3OXIA 4RA5A 2IWIA 3NDMA 3OT8A 4ITJA 3DOGA 4GSBA 1OUKA 4Q5HA 5M55A 4I6BA 2E9OA 3KXGA 3E8CA 3FKNA 3THBA 4DEEA 4F6UA 5HVKA 3WYXA 4DTKA 2YM6A 5BPYA 2CJMA 5BVOA 3GT8A 1Y91A 2GNFA 3GCUA 3S3IA 3ULBA 3IK3A 5G6VA 1XHAA 1Q41A 2HYYA 5CU4A 4C4HA 2KTYA 4RMZA 4DFBA 5EQYA 2YT0A 5FUTA 5L2SA 3U9NA 1IR3A 1RJBA 4L9IA 4FKJA 4FIJA 4ZJJA 4FSTA 4ZS4A 2FUMA 4ASEA 4EWQA 4FIGA 4GU6A 2R3HA 2GHMA 3TKHA 3SXRA 4FF8A 5CQUA 4FG7A 3OY1A 4LUEA 2Q0BA 3V51A 4KKGA 4BKYA 4YL8A 1IAJA 3FI8A 2IW8A 4FSYA 3UPXA 1PMUA 3V5TA 2VZ6A 2W2XD 4QO9A 5BUIA 2P0DA 4RJ7A 2C3JA 5HE2A 3LM0A 3AT2A 3QCYA 5IH4A 1W1DA 2DKPA 4RIYB 1NXKA 2JP2A 5DYJA 3OEZA 1OL6A 1WBTA 1CKJA 2Y6MA 1QC6A 3QBVB 2GNHA 3R01A 5DIAA 4MD8E 4YSJA 3QQLA 4AOTA 4A6HA 5C4LA 3FHIA 3R8UA 3QYWA 3TXOA 4PTGA 4X6RA 4UV0A 3S4QA 4BDDA 1A06A 4CT2A 4D2TA 4DCEA 3UO5A 3CBLA 4BDGA 4AOJA 4GH2A 4MBLA 3ANQA 4Z9LA 2HAKA 2WTIA 4KNBA 2DWBA 3BGZA 3W16A 1Y57A 3ZM4A 4NT4A 5HICA 4DH5A 5GJDA 2WMSA 3KVWA 2ROVA 3MPTA 2QOQA 4CLJA 2WELA 3AD4A 5ACBC 2FGIA 3Q6UA 5JRSA 2EB2A 3AU5A 3CQEA 4FEXA 2ITWA 4FSZA 3VBYA 1DS5A 1LP4A 4GZUA 3HA8A 4FYNA 5AEPA 1U59A 3ZS5A 4DGGA 2I5CA 3HAMA 3PSCA 2YWVA 2CNUA 2R0DA 4CG8A 2R3JA 3BV3A 2FB8A 4XOYA 3LXPA 3BJIA 4B6HA 4AZTA 2XP2A 2A0CX 1OM1A 1PXKA 2E9NA 2X6DA 2UW3A 4RZWA 4IM0A 3TDWA 2G15A 3DTCA 4C37A 4CNHA 4EK4A 4O1OA 3N7CA 3F3WA 3MY1A 4YJQA 2QVSE 3ERKA 3UNZA 3IW7A 3CE3A 4YLKA 4NU1A 2Z7QA 1PY5A 4M15A 3ZDUA 5IQAA 5KHXA 1ZVRA 2KULA 3MFRA 1ZMVA 3MVLA 4YHTA 3TCPA 1H27A 1GJOA 5BUJA 2WTJA 2UVMA 2WKMA 2ETMA 2WMAA 2GNGA 4KS8A 2W96B 3POOA 2HW7A 4FKGA 4W4WA 4N4SA 2X2KA 4QTCA 3TNWA 4TY1A 3NW6A 2RGPA 4FTJA 5KMLA 2IZUA 4NM5A 3HECA 2RFSA 5LVPA 3P7ZA 2CCHA 3ATSA 3LFNA 3LPBA 2ITUA 3FMDA 1QPCA 4YTHA 2PVKA 4MCVA 2W5HA 2OXYA 2XIXA 3VO3A 1ZRZA 4KBAA 3ZZWA 3O51A 3C4WA 4RIYA 4A4XA 3P0MA 5TOZA 2F2CB 2W1DA 1REKA 4HW7A 5FP6A 4CQGA 2D9YA 2PVMA 4Y83A 3QUPA 3F5GA 1A48A 2UW6A 5I4NA 4BCHA 1H1SA 2OJIA 1YI3A 4L7FA 2XUUA 3ZONA 4O6EA 1TJ6A 4UMRA 5CSWA 3DKFA 4JAIA 4YZNA 1V0OA 4BDAA 4CZTA 4QTEA 5FBOA 2J59M 4MQ2A 1XQZA 4XG8A 4HAXB 3PA4A 5IQCA 3T9TA 1UU8A 1UU9A 2YM4A 5A14A 1M7RA 4CXAA 2K00A 1JSTA 3CCNA 3TIYA 2ACXA 5FM2A 4E8AA 4C61A 5L2WA 2UZWE 3BPRA 3UIUA 3LJ0A 2UUEA 5J9YA 4FVPA 4HCUA 2DQ7X 4HGSA 4QOXA 4RWLA 3JR1A 2C4GA 2ONLC 3SG8A 4FOBA 4M12A 4XLVA 3W18A 5JLJB 4DEGA 5CLQB 3HMPA 3TO1A 2UZOA 2JKMA 4A9UA 4BHNA 2J4ZA 1XH4A 2WPAA 3L9MA 2OZOA 3MDBC 2VD5A 4I5CA 3UJGA 3ULIA 4PF4A 2JKQA 2PE0A 4ASZA 1R39A 4KAXB 1WGQA 4RFZA 5CEIA 2FJLA 5D41A 3CGFA 5D1JA 3O17A 1UEFA 3HMOA 1PXPA 2W1HA 4I5HA 3PE2A 4F63A 5HBJA 2NP8A 2RSVA 2CLQA 4CQEA 3ZM9A 1AWEA 4NYEA 4XV9A 3OTVA 4OTFA 4TXCA 4LOOA 3UZPA 4Y95A 4HVDA 4NKAA 4R7HA 4EH3A 5LMBA 5A6NA 3UZRA 4N70A 4KUJA 1OITA 1V0BA 4O22A 2ZMCA 4QYEA 1CKIA 2B9IA 2VTHA 3RHKA 4D9TA 4CCBA 3DBEA 3MPXA 5KKRB 2Y4IB 3T3VA 3BELA 3OCGA 4K1BA 5EHYA 1FHWA 1UVRA 1H1QA 1O6YA 2C0OA 3KQ7A 4I41A 3HNGA 3TG1A 3ZSGA 1RE8A 5J7BA 5CZIA 2PVRA 5K3YA 5FP5A 4KA3A 1SHCA 5C8NA 2Q83A 1FOTA 2WMVA 4JBPA 5T68A 4WSQA 3ZDIA 1WFCA 4N57A 5DR6A 4GV1A 2VKIA 2I5FA 2JBPA 3HP5A 4L44A 4C57A 5EM5A 3ORNA 2XIZA 4G3FA 3IKAA 4NW5A 4PX6A 5LMAA 4YJSA 3QFVA 5HD4A 5HKMA 4FVQA 2C69A 5AP3A 4CTBA 4CZYB 1HOWA 3HX4A 4DEBA 5LOHA 4CRSA 2YDKA 5DHAB 4R1VA 2JKOA 4YZCA 2JDOA 2R7IA 2XRUA 3IOKA 2F7XE 4JT3A 4RX8A 3UOLA 4OTDA 3SV1A 3QCXA 4FGBA 4I4EA 4ZSAA 3ENHA 3N4TA 5DOSA 4Y5QA 5D11A 4D5KA 5M57A 4E6DA 2C1AA 1PMEA 5HOAA 5CF4A 4FIIA 2Q13A 2E9UA 4GYGA 3DXCA 2C5YA 4J7BA 3D7ZA 4AW2A 1UKHA 4CYJA 4RWJA 3NUAA 2IN6A 4NJDA 4E5AX 4QMUA 4EH2A 3FMNA 1MK7B 2I0VA 4BL1A 4PP7A 3GFWA 5HE0A 3MFTA 1VJYA 1MK9B 3R7GA 2XB7A 3BHUA 2DX1A 5HIBA 4X3FB 3MIYA 3LQ5A 4MXCA 2WO6A 2YCQA 3M1SA 3DNDA 3O8UA 3QD2B 4LOPA 5K0XA 3KK9A 3K5UA 2BR1A 4DH7A 4DH3A 4F9YA 4MVFA 5C5BB 3COKA 2CSNA 5CZHA 4FKQA 4XV3A 1RJ2A 3CR0A 3H10A 4RVKA 4JOAA 3O96A 1W84A 4QP1A 2VGOA 3LFQA 1XBBA 3A7FA 3PTGA 1RQQA 5AAEA 3PVLA 5EYDA 1PMNA 2C68A 2QOHA 3V5WA 2BKZA 4C2VA 3PXYA 4JBQA 3AC5A 5IUGA 4WT6A 1V5MA 3C9WA 2BALA 2R3MA 3W2RA 1KZ7A 3A98B 2VTOA 2OH0E 3BCEA 3OVVA 4OW8A 2Z02A 3VBXA 3MJ1A 4S34A 3TIZA 4A9SA 3PXQA 1U5RA 3ZXTA 4Z2NA 2XVDA 4FTNA 1FOEA 4RIOA 5EDRA 4FV5A 3NIEA 3FV8A 4DFNA 2OIQA 4MYGA 4USDA 3ULZA 3UNKA 4ANOA 3EOCA 4DGOA 3D15A 3A61A 1V5PA 2PVFA 4O0VA 4HAZB 5M06A 2I6LA 1P14A 5L2IA 4O7YA 3BLRA 1ND4A 5DI1A 2MKRA 3DJ5A 2R2PA 1UKIA 5IEVA 3LQ3A 4O83A 5A4TA 3O7LD 1JQHA 3KCKA 3FZTA 2ZM1A 3OWPA 3A2CA 3PG1A 2YLEA 3NRMA 3KRJA 5DRDA 4BCIA 3SA0A 3CXWA 1FHOA 2XS0A 5CAPA 5AR8A 4GG5A 2BZKB 2OG8A 4DA5A 3GVUA 2BHEA 4IDTA 1H4RA 2I1KA 2WIPA 2VWYA 2NRUA 4FV3A 3M2WA 4QQ5A 3S0OA 3KRRA 4IQ6A 4NCTC 5HO7A 2X1NA 3FMHA 4AZWA 4ZMFA 4RVLA 4RRVA 5JFSA 4AW0A 2VTJA 3CGOA 2WTKC 4DN5A 4X21A 3HEGA 5C8MA 1AD5A 2QQ7A 4FK3A 4Y5HA 5A3XA 3TNIA 4CZUA 2B0QA 1ATPE 1Q67A 2MDXA 1P5TA 4AW5A 3O2MA 4IZ5A 3ZOSA 3H9RA 5C26A 3PVBA 5E8VA 3WE4A 3ZZEA 1LUFA 4IVDA 1OKYA 1X05A 1XCGA 4ANNA 2RLOA 3GI3A 4DF3A 3Q2MA 3OEFX 3JYAA 4FICA 4E6AA 3GC7A 1ZSQA 5I9XA 3NUYA 3QTXA 3EQGA 2WU7A 4X3FA 3D0EA 4QPAA 1FGYA 2BTRA 4AF3A 3HRCA 5CU6A 2CKQA 3Q9WA 4KWPA 4MWHA 5DH9B 4OTIA 2B4SB 3K3IA 5IA3A 5C5BA 4C7TA 5J3QA 3NYNA 4JDKA 3EFWA 3WYYA 3IO7A 3Q52A 3RI1A 5H2UA 4KSPA 2JIVA 4RZVA 3OCBA 3VUIA 1BI7A 4HPUE 5FBNC 3TKIA 5GZ9A 2UZNA 3G0FA 3TTIA 3RPVA 4BKJA 4D9UA 4NIFB 3QZHA 3QLFA 4C8BA 4F0GA 1Q3WA 2LAVA 3OG7A 2Z0QA 1DAWA 1LPUA 5J87A 5JZNA 1OPLA 3GENA 2FYSA 3EYGA 2XNBA 3MPMA 3Q60A 4YNOA 5IQBA 4TYZA 3QKKA 5DR9A 4G5PA 2B9HA 3GGFA 5FLFA 3RK7A 4FI1A 5FTOA 4HZSA 3PZDA 3QRKA 1OKWA 2PVLA 4JRVA 3SGCA 5FXQA 2WZJA 3QLGA 2UW9A 3QD0A 3P1AA 3AC3A 3EYHA 3FE3A 3R1NA 2WQEA 4WOVA 4CV9A 3VJOA 4EH8A 3DXDA 4HB3B 4FSRA 5FGKA 3D2KA 3UQFA 4NSWA 2Z7RA 4BWKA 4AA4A 3W2SA 3HV3A 4O2PA 1IRKA 5I0BA 5JFXA 2CKPA 4NK9A 4OTQA 3HVCA 5IPJA 3A4PA 3VWAA 3GOKA 2OFUA 3EQRA 3KB7A 1GC7A 3MA6A 5IH5A 4TN6A 2D9VA 4R7IA 4IX6A 3RNIA 2W2XC 5J79A 4UWBA 4W4XA 2VWXA 3PPKA 1Y5OA 3DK6A 3WBLA 1M2RA 5AX3A 4EK5A 4F7NA 5EW8A 4QD6A 1IG1A 2I0HA 4I23A 5E90A 3VHKA 1U5QA 1AGWA 2V7OA 3SC1A 3FZPA 2RF9A 4ZRKA 3E93A 2YHVA 4HGLA 4BVUA 5I9UA 1RW8A 3QUDA 4IHPA 4RC4A 4AN9A 4BGGA 5CAVA 3GCVA 3NMUF 2ZV8A 4FV1A 4IAZA 4DG3E 4L43A 4R3PA 1M7EA 4HB2B 1CKPA 1YRPA 4FKWA 2JITA 3AGMA 2RKUA 4H3PA 4QMVA 4IWPA 5EOLA 3QQKA 3EFJA 4EQCA 1MAIA 4IANA 1SVHA 3ALNA 3ROYA 3PXKA 3IVFA 4QP4A 4ALUA 2LULA 4GFOA 2JDRA 3F2AA 5J1WA 2WMXA 3JPVA 3LCTA 4RIXB 5EHLA 3RJCA 5AAGA 4EBWA 4HZRA 3A7HA 5EDPA 3NYOA 4EOKA 2YM5A 3HMIA 4RGJA 4OT6A 4O7WA 3OFMA 3HLLA 1W8CA 4NIFA 2A19B 3RK9A 3PFQA 5AUXA 1H26A 3OF0A 4IZ7A 1PXOA 3NUUA 4OUCA 3E64A 2PWLA 5HBEA 3UYSA 3VF8A 1OQNA 3WARA 3RHXA 2RUKB 1SM2A 3DPKA 2CNVA 2WB8A 4B4LA 4PMMA 4RJ6A 3P23A 5IKWA 5GZAA 4EOOA 4GPTB 4F7HA 3NUNA 2BDJA 3IS5A 3QRIA 4J99A 4CKIA 4IC8A 3U55A 4FKUA 4U45A 3ZO4A 4A6KA 4BCQA 5GINE 3TZMA 3GQLA 4R8QA 3WOWA 5C4KA 2Z7LA 3A7JA 5KZIA 4PDSA 5HG8A 2X8IA 2YN8A 1GZ8A 1NI2A 2YVCA 5AR5A 4YSMA 3F61A 5IZFA 4KAOA 2HTHB 2ITOA 2BZJA 2PUPA 4N6ZA 4E4XA 3FHRA 5LWMA 3GFEA 3G9NA 2F49A 4YC6A 2HENA 1M2QA 4G3EA 5E92A 1V88A 3LFFA 3RVGA 1UV5A 4BCJA 4C4JA 5DBXA 2B7AA 4WO5A 2LGCA 5AWMA 1ZXEA 2YACA 3LJ2A 3ORXA 5HLPA 4UWYA 5FQDC 3U87A 1FQ1B 2X18A 1WZYA 4YC3A 2J0JA 3GCQA 3R04A 4G6NA 4WUAA 3F5RA 4ZTLA 1E5WA 1CSNA 4P4CA 3IDBA 4IVCA 1UPQA 5CX9A 5D12A 3QA0A 3NWWA 4WRSA 3SNHA 2NO3A 5IEYA 3AMAA 3RPRA 4TYIA 2VWWA 4RVMA 2VWIA 3MVMA 2OXXA 4QTDA 1EH4A 4NKSA 3FY0A 4U0IA 1P4OA 4M14A 3VUTA 4BRXA 3UG2A 2XKDA 4ZJVA 4D55A 5J1VA 2BRGA 4JS8A 4F9BA 4RC3A 1OIUA 2I0YA 4FZ6A 4IW0A 3VC4A 4O27B 5CWZA 3W1FA 5LMKA 2DLWA 2YAKA 3BRBA 3NYVA 1MKEA 4EK6A 3ACKA 3E92A 1XKKA 2UZDA 2XNOA 4XG6A 4ZXTA 2CODA 4JDIA 4NFMA 3LMGA 3QX4A 4RIXA 1UPRA 5C03A 3P7CA 3I79A 4PTEA 4M66A 5C6RA 3BGQA 2UW7A 3U6HA 2YCRA 2AYPA 4YTCA 5D3WA 2ITYA 5H8BA 2VO7A 4FEVA 3II5A 3CPCA 3JY0A 2YCSA 4C3PA 4XP3A 1Q61A 2WIHA 4IB0A 1QPEA 3MS9A 4YP8A 3L9NA 1FVVA 2J2IB 3PXZA 3VQHA 1WJ1A 4Z2MB 5LOPB 3QBNA 3R71A 4IX3A 3P08A 3IG7A 2OICA 2F7EE 3EL8A 3OW4A 4YGAA 5KNJA 3RK5A 3KREA 4FZ7A 2GQSA 3KU2A 2P0CA 3NX8A 4G9CA 4KD1A 5AR3A 4GKIA 2X9FA 4BCFA 3VW6A 4TT7A 5A4QA 4YJUA 4RX9A 5CLPA 3G15A 3I4BA 3V5LA 4N6YA 3BYVA 2IO6A 4PRJA 2ROZB 5KZ0A 4BF2A 2BDWA 3C0HA 1OPKA 2IVUA 4RX5A 3BU3A 4X2NA 1O9UA 4FUYA 3Q6WA 4QQJA 3PY0A 4OGRA 1XBAA 3EHAA 3OXZA 5BX0A 2G2FA 5KBRA 2OTXA 3LVPA 4YBKA 2V5QA 3MFSA 3C4CA 4WBBB 3BWFA 3UE4A 2G2IA 3I5NA 4ITIA 4AN3A 4QMMA 4D1SA 3ZLYA 3P7AA 4DINA 3F2NA 3BLHA 3KULB 3HUBA 3DZQA 5AP5A 1DDVA 5CVGA 2GHLA 3QF9A 4BBEA 3KA0A 4UXQA 4AFJA 2G35A 2D9ZA 3FZRA 2XNNA 4TKNA 4EOQA 3CSVA 5AMNA 1GIHA 3TFMA 4P5QA 2XYNA 3SX9A 4LRMA 1BTNA 4LUDA 2GTMA 4GMVA 1ZYJA 2CGVA 4ZK5A 5ANGA 2QOOA 3QTSA 4CCUA 2HCKA 4FL1A 5AV0A 1J1BA 4QP6A 1J0WA 3PE1A 3ZFMA 3PP2A 1UNHA 5LVOA 4QMLA 2XCHA 4Q9SA 5IDNA 3HAVA 4BWXA 5AR7A 4QP7A 3V5PA 2OK1A 4IAFA 2QG7A 3CS9A 3AT3A 4QP9A 4YLJA 3U8ZA 4RT7A 5IISA 4BY9E 4C02A 3ZH8A 4D2WA 1V1KA 1L8TA 1JKLA 4A9YA 3QHRA 5DT0A 5JFVA 2C5OA 1G8SA 3IPHA 2YF0A 1GNGA 2OBJA 4DBBA 5EW3A 2OIBA 2X8DA 3ORMA 3Q5ZA 4FV8A 3ODXA 2PYWA 3WF9A 3NPCA 2PTKA 2Z60A 4E93A 1OZ1A 3ENMA 2BAQA 1K5DB 4KIKB 5AA9A 1B55A 4LI5A 2QOKA 2OWBA 4U43A 2X4FA 4AZFA 5JH6A 2W4KA 1I7AA 4EHEA 3FPQA 2G01A 4PV0A 2R3RA 2W5AA 3DGKA 1ZMUA 3CQUA 2KGXB 1WBNA 4GW8A 3TKUA 2YRYA 4FTLA 2Z0OA 1XH8A 4I20A 2IZSA 4ACDA 3MBLA 5B2LA 3U6IA 4DLIA 5KMIA 4MXAA 3IOPA 2FO0A 3C0IA 4XOZA 4M0YA 5ICPA 5EM6A 2XZSA 3OTUA 2M38A 5HD7A 2QI8A 1U29A 3R9DA 1OL2A 4UMQA 3ET7A 5AP0A 3MESA 3MY0A 3PVWA 3QQHA 3UP7A 5F9EA 2YT1A 4RJ4A 3F3TA 1MQBA 1QQGA 3VS1A 3R2BA 2OIDA 4KIQA 3A8XA 4TYHB 3KULA 3NCZA 4AAAA 3DLSA 2GCDA 2UZLA 2OJJA 2Y9QA 5M4IA 1N3HA 5HI2A 3TN8A 4L8MA 1U5EA 4Y8DA 4IAIA 4FKPA 4NEUA 3H9OA 4HB0B 3VBQA 5CAOA 4IAKA 3R30A 4A4OA 1JOWB 3RM7A 5IF1A 4K9YA 1V5UA 3CXBB 4KBCA 3CJFA 2WXVA 1GZOA 2GFCA 1STCE 4FBXA 2CPKE 2HY0A 2CGXA 3BKBA 4MY6A 1OVEA 3G6HA 2W06A 3P5KA 4OAUC 4G1WA 2Z2WA 3KSYA 3QQGA 3D8FA 3FL5A 3BLQA 4FA2A 1Q8YA 5HBHA 4F7LA 4EI4A 4BR3A 1GZKA 3ZCLA 4X2JA 4D5HA 2HWPA 4DH1A 2LYDA 2NRYA 3FDNA 1FVRA 3FMLA 2C1BA 3NNUA 4J97A 4ZOGA 4BWPA 5IU2A 2ZPYA 5EYMA 4K17A 4EC9A 4U42A 4ZY4A 4USEA 5BUEA 5AR2A 5JN2A 4AZEA 2C5NA 1YXVA 4D2SA 3I7BA 3L8PA 3RKBA 1JPAA 3TV7A 4ACMA 2GMXA 3FLYA 2J50A 5LVNA 1YXSA 3DK7A 3R63A 4KIKA 4MBIA 4D0NB 2YIXA 4QRCA 5HVJA 3P4KA 4MX9A 4EH4A 4EC8A 2NZ8B 2E2BA 5LARA 4BICA 1ZY4A 3LLAA 4FT7A 2Y7BA 3E3PA 3CPBA 1M2PA 3I7CA 3LLTA 3C4XA 1WCCA 2UVZA 4BBKA 3PVUA 4OBOA 4ZAUA 4BC6A 4UX9A 2C6LA 4DX90 2NNWB 2RL5A 4FNWA 4IDVA 3WF6A 2B53A 1Q24A 3G9WA 3ETAA 3HGKA 2IG7A 3GU8A 4ZSEA 5IA1A 5CT7A 5GJGA 2PZ5A 2QOCA 2QR8A 3Q4CA 4LM5A 5DN3A 2W5BA 1ZYSA 2JIIA 3SYXA 1W98A 2LOZA 2JDSA 2O2UA 4M0ZA 2ITPA 4FTIA 1K9AA 2VTPA 3DB8A 5EDQA 3WI6A 2ERKA 5CU0A 1FINA 3CJGA 4BCKA 4EH9A 3JVRA 1O6KA 5LMKC 4U7ZA 4HOKA 2VRXA 4TYHA 3KF7A 5AM7A 1KE9A 4F9CA 4QPMA 1UNLA 3UG1A 4EORA 2G9XA 4L53A 4XNEA 4YHJA 5HESA 3R00A 3VHEA 2QHNA 4JI9A 4NM7A 3JXWA 3QQFA 4LFIA 4XMOA 4FTUA 1H4LA 3T9IA 2JLDA 3MH1A 3TV4A 4FC0A 1PFJA 3DFAA 4UXLA 2VO3A 4O86A 5GOWB 3PIZA 4E26A 5ANKA 5A4EA 2GQRA 2WEVA 4AS0A 3KCFA 4H3QA 4HJOA 4U6RA 4FIEA 4LV5A 1GC6A 1FPUA 5CVFA 3LJUX 4E73A 2XF0A 4L46A 4AGUA 2HIWA 2QO9A 3PZEA 2XA4A 5HLNA 2XIRA 4F6SA 4PP9A 1G3NA 2C3KA 4JBOA 4FYOA 4MH7A 3VIAA 5DH3A 1BI8A 4AU8A 3AG9A 5HO8A 2I1JA 2QC6A 5KQ4A 5HNIX 4K6ZA 4XBUA 2W9ZB 3PA3A 5AV1A 4YZ9A 3B8QA 4P5ZA 4XRLA 3IW4A 4AE6A 2W1ZA 3DKGA 3QZFA 2OZAB 5CEKA 1M52A 4FE2A 3TUCA 2GHGA 3K54A 3QD4A 2RSGA 2WOTA 4D1ZA 3EB0A 3Q4UA 2EMTA 3NNWA 2WMTA 1ISNA 4R5YA 3VUDA 4C38A 2X7GA 2YAAA 5EM8A 2HK5A 4I5MA 1BYGA 1GOLA 3DXQA 3EZVA 5HG9A 5CU3A 4E4MA 2W99B 1PMVA 3QRTA 4UMTA 5IQFA 1G5SA 1BKXA 4FZAB 4JR3A 4D4RA 4QP3A 4O0RA 3DBQA 2YZLA 3I6WA 3MV5A 4MD7E 2X2MA 3F5UA 4RBLA 5CSVA 3ZC6A 2JEDA 2JDTA 5C16A 4O0UA 3F3UA 4I4FA 3DZOA 3OZ6A 4HCVA 4BKZA 2X7FA 4JDHA 4F0FA 4ACHA 1WVHA 3EQDA 4FT0A 2W9FB 2WTDA 3DXPA 3E8NA 2PUNA 2A27A 3GC9A 3LFBA 4OBPA 4S33A 3MB7A 5M4CA 5M56A 5EOBA 2N0YA 1DROA 3PUPA 4RFMA 1XD4A 3A99A 3MB6A 5GIPE 4GFGA 5FXSA 3BYUA 3BX5A 3DBCA 4IM2A 4DEDA 2X81A 2OJFE 4CKRA 3TUDA 4FMQA 4KRDA 3I1AA 1I09A 3EL7A 4LQMA 4O6LA 3R8MA 4JX7A 3NUXA 3AC8A 4ZP5A 4ZTSA 4C4EA 2EXCX 1FBNA 4DGMA 2XK9A 3GU6A 3KY2A 1GG3A 3E63A 2WU6A 3SQQA 4K2PA 4WNPA 4FEQA 4EOSA 4EUTA 4Z3VA 4PDPA 4JQ7A 2UVYA 3GQIA 4WD5A 5E8SA 3UIXA 1H01A 5CANA 2OW3A 3HUCA 3KL8A 4DT8A 2A2AA 4AOIA 3NNXA 2YM8A 3RM6A 3W2CA 1P3RA 3PXFA 3TACA 3QXOA 4ZRIA 1IA8A 4JNWA 5FRIA 1PXLA 2W17A 4NH1A 3ZLXA 2HXQA 4YU2A 3H0ZA 3DK3A 5DFPA 3V5JA 2CLXA 3FKLA 3UNJA 2VGPA 3TW1A 4A5KA 2OZAA 4AQCA 1X86A 4R5SA 2QG5A 1JVPP 4I6QA 5AP7A 4FL2A 3PIXA 3D4QA 4HYUA 2CHLA 3F6XA 4F9WA 4UALA 2DHJA 3O0GA 2DYQA 4CHMA 3FLNC 3R02A 5IQDA 3CKXA 5LJJA 4F7UP 2BZHB 4CFNA 4XV1A 5GNKA 4ZZNA 2VWUA 2RIOA 2HELA 2J0LA 1QPDA 2YABA 4B0GA 3DXEA 5FI1A 5E9EA 4WUNA 3UYTA 1J7IA 3BV2A 4QMQA 2P8VA 3BHHA 4APPA 1BLXA 3GU5A 1ERKA 3D5WA 4MT7A 2REIA 4IACA 1XH9A 1E9HA 2ITQA 2QO2A 5FTQA 1KV2A 2P2IA 4BDCA 4DFXE 2OJGA 4AX8A 3F9NA 3ODZX 4Q5EA 4USFA 3SOAA 3DTWA 2X39A 4WNMA 3SLSA 4IZYA 3U4UA 4HVGA 4PY1A 3HK0A 2PZPA 2QU5A 2CN8A 4FEWA 4BDKA 2X4ZA 2VWZA 2F2UA 3E62A 3EH9A 2PUUA 3P86A 1NTYA 4CG9A 3M42A 2QURA 4L7SA 4FV7A 2QR7A 4K33A 4UZDA 4D4YA 5CEOA 2EXEA 3CY2A 2QOFA 2X0GA 2PU8A 1OECA 1YWRA 3AOXA 2VTRA 2XH5A 4FV9A 5AFVA 4EOMA 2R9SA 3HDMA 4IM3A 2BVAA 4M7IA 1Q8ZA 2CY4A 2FSOX 5HNGA 5H8EA 3QWMA 5J3TA 2DYLA 3ELJA 1BWNA 4ZEGA 4BFMA 2UVXA 4ZMEA 3NUPA 4E4NA 1B38A 1MRYA 3HV4A 3QGWA 4MBJA 3ID6C 2XEZA 2IFSA 4HNFA 3ZXZA 4NW6A 4FTRA 4CRLA 1OL1A 2XM8A 4EQUA 2SRCA 3QQJA 2R3QA 3NW7A 3FLZA 5GHVA 1H1WA 4LGHA 5TT7A 1Q62A 3RCDA 5KMNA 5EK7A 2W1FA 2Y8FA 4V05A 5HGIA 1Q97A 2XBJA 1MP8A 3NS9A 4J8MA 4HPTE 4IBMA 5KMMA 5FI0A 2UZSA 2JAVA 4AWIA 1ZWSA 3R1YA 1VEBA 3PJCA 1YHVA 4BCPA 5HTBA 2WMUA 4A4LA 4AA0A 4TYJA 4G31A 2YCFA 3LFSA 4J71A 3GOPA 3MH2A 3PIYA 5DEWA 5E8XA 5EG3A 5CEPA 4BI2A 5KO1A 5IH6A 2BIYA 3BHVA 4QYFA 4WIHA 2PE1A 3FMMA 3IW6A 4FIFA 1MUOA 4JR7A 3SW7A 1FGIA 2JDVA 5EQEA 2RFNA 2H7DA 3U54A 4E7WA 3C50A 4B8MA 2EUFB 4GK3A 2ZM3A 3V3VA 3KFAA 1UA2A 4XUFA 2YITA 4ZSLA 1TQMA 3QD3A 2YLFA 3NIZA 1BTKA 2J0IA 2ZB1A 3W33A 4EEVA 3Q9XA 3IQ7A 4TTHB 3OBJA 4EH6A 4UB7A 3TCAA 3QA8A 5EHOA 3L1SA 2AL6A 1ZZ2A 1YOMA 4NTTA 4PL4A 2JBOA 5K9IA 4HYIA 4J96A 4K2RA 4UMUA 4EOIA 4X2FA 2CRFA 4AT3A 3ACJA 3GNIB 3FMKA 3QHWA 4UWCA 4WG3A 5TO8A 5D7AA 2JFLA 4GFMA 4F99A 1Q8TA 4NSTA 3MH3A 1U27A 3BIZA 5E8UA 3ODWA 3HRBA 5CNOA 3WZUA 4HHVA 5CVHA 4C62A 5ANEA 5L6PA 4F7SA 3PZHA 3GU4A 2ZDUA 3D94A 4P7EA 4EZ3A 4HAVB 3QU0A 4ZZMA 4BGQA 4FTQA 4PUZA 1Z9XA 1KSWA 4RC2A 3KGAA 3OW3A 1ZAOA 4L45A 2P0HA 2QODA 4BIEA 4FT3A 4J53A 4YHFA 2R7BA 4GMYA 3LXLA 2GS6A 5AP4A 5AA8A 4IVAA 3RWQA 2GTNA 2DHKA 3U4WA 2R3KA 1YXXA 1SYKA 3VF9A 4KBKA 3RAWA 1YI4A 3QZGA 5DPVA 1JBPE 5E8YA 3O8TA 4KINA 5AUVA 4ZZOA 4IFSA 4BZOA 3FXWA 1HCKA 5K4IA 3AMBA 2BHHA 1QL6A 3CEKA 3FQHA 3KKVA 3R0TA 4GRBA 4EOJA 2CNQA 3BGPA 3FSFA 3TDVA 2C0TA 5JMSA 3REPA 4HVSA 2RVBB 4AT5A 4CMUA 1R78A 3LXNA 4G9RA 5BVFA 5L8KA 4OAVB 4DEIA 2ZDTA 4DGNA 2C3LA 5JQ8A 1WI1A 2W1EA 1Y19B 5ETCA 5JT2A 2DKQA 2PL0A 3LFAA 4IFCA 4A6FB 5ETAA 3ML4A 1H0WA 5A6OA 3R6XA 5LONB 2C30A 4DEAA 4H1JA 4MF1A 2IVVA 2R4BA 3QTZA 2OFVA 2YIRA 3R1SA 2XBAA 3AT4A 4FNYA 5HNBA 4DCAA 5DLSA 2BCJA 2V7AA 3QTQA 3R8VA 1A9UA 1K2PA 3WZKA 4A7CA 3W32A 2ERZE 4U5JA 4JLCA 1OL7A 1ZYDA 4X2GA 3TEIA 3VIDA 4M69B 3KVXA 4R3RA 3TNQB 3FKOA 1YHWA 4L42A 2OXDA 3OWLA 2H9VA 4GIIA 4OBQA 2V0DA 3R83A 1DAYA 3A4OX 4HAWB 4KHBB 2YISA 3NAXA 2IVSA 4WKQA 4WNOA 4Z55A 4ERKA 3FC1X 3PRIA 3HV5A 4EZ5A 5FEEA 2BRHA 2IW9A 3DLZA 5IEXA 4Y85A 2C5XA 2QOBA 1WMKA 4FTMA 2UZBA 4QPSA 1AQCA 1X1GA 4YONA 2VAGA 3HMMA 5DEYA 4QMPA 5IQIA 3IONA 2E9PA 1XH7A 5H3QA 4BIDA 1DDWA 4IH8A 5EKOA 5D7VA 3FM8C 3ZLSA 1WBOA 3NW5A 2R64A 4GUEA 5D9HA 4BZNA 5I9ZA 4L6EA 2R0IA 3GYPA 4ALWA 4ANQA 1DYNA 1H08A 4U8ZA 4KHOA 4YZBA 1MRVA 3MVHA 3W2QA 1U5FA 2OGVA 3LJ1A 4G2FA 4DGLC 4ENXA 1T46A 4Y46A 3CKWA 4ALVA 4IE9A 2QCSA 3AU4A 1SGHA 4B6LA 1U54B 3F0WA 5F1ZA 3OMVA 3UDBA 2YS5A 5D3XA 4I24A 4C33A 5DIFB 4WG4A 3RPOA 1XWSA 1XBCA 3PP1A 4C58A 4D4VA 3EJ1A 5IQEA 3ZRKA 2WMQA 4DH8A 4F4PA 2VX0A 3EFLA 3GP0A 4YURA 5B2MA 3SV0A 4FSQA 2RFEA 1XJDA 5CSHA 3HMNA 3GCSA 3AJ4A 5ANJA 3PWDA 3RAKA 3MTFA 3G6GA 2GCJA 4A6FA 3QALE 4U41A 2HZ0A 3OROA 1OPJA 5AX9A 1J91A 3V5QA 2Z0PA 2UW4A 4DXAB 4EMOA 4NFNA 4DEHA 3CLYA 5DG5A 4PPAA 3VUKA 5HZNA 2LKOA 4KVGB 3BI6A 1IRSA 1F5QA 3NVKI 1UWJA 3A7GA 4DBNA 3K3JA 2BRMA 2IW6A 1PYEA 2J51A 2QLUA 4YNEA 3W2PA 1OKZA 2VX1A 4FSNA 3WIGA 4HVIA 5A54A 2KUPA 2OKRA 4IWDA 3P78A 3PLSA 2VTAA 4I94A 5ACKA 4M69A 3UZTA 2XIKA 4UBAA 4P90A 3PP0A 2ITXA 3H3CA 2V62A 4DTBA 3UMWA 4FR4A 3KK8A 4BTKA 4FKVA 3R2YA 1XR1A 4XLIA 4CLIA 5JEBA 4FSWA 3WZEA 4YR8A 3PY3A 5FD2A 3ORIA 1P6SA 3C1XA 2OI4X 4ANBA 3ZUVA 1UU3A 4OTRA 2DYNA 4K0YA 3FI4A 4NM3A 5ANDA 1LEWA 3GEQA 4MQ1A 4XEYA 1FHXA 3KRLA 1UNGA 4FOCA 4O38A 4XG3A 3F7ZA 1JSVA 3DAJA 4ZS0A 3NR9A 5FG8A 3TJDA 1OIQA 5A4LA 1JKSA 2OF2A 5C1QB 3H9FA 5D10A 4OTHA 5J5SA 2H7EA 1UWHA 2ITZA 2XNEA 4EQMA 3OC1A 4ZSGA 4R1YA 4YTFA 2O3PA 3C5IA 4QP2A 4RQKA 2ZYBA 2PZIA 3EKKA 3R9NA 1PYXA 2PSQA 5HX6A 2XRWA 5K0KA 2P0FA 1FVTA 2PHKA 2WTCA 4M84A 3SAYA 4X3JA 4HATB 4B7TA 3KN5A 5ANIA 2R0UA 5CF6A 4QYYA 1U54A 1TVOA 5HCXA 2WQMA 3H0YA 4CSVA 5JGDA 2UZTA 3KMWA 2F4JA 3ZRMA 3ORZA 5H8GA 4BBFA 4D58A 2BMCA 5KKRC 2Y4IC 4YC8A 1PXNA 5JK3A 2J6MA 1WBPA 1BL6A 2HZIA 2QONA 3VBVA 2DX5A 3HV7A 3VRYA 2WTWA 2QKRA 4M97A 4OT5A 4U9AA 5CU2A 3FL4A 4FKTA 4HCTA 4NZWB 4F7JA 2WTVA 1MIZB 1XH6A 1NT2A 4FT5A 1IASA 3C5UA 5KE0A 5HTCA 3LHJA 1LW3A 3BQRA 4RJ8A 2YS1A 2YDJA 3VBWA 5FWKK 2FA2A 2GS7A 4AN2A 2R09A 3CD8A 3MWUA 4RA4A 3VRZA 2XNGA 5EI2A 3OUNB 4QMOA 3U7DA 2NPQA 3AC2A 5AIKA 3RTPA 3RGFA 1YHSA 1U2BA 4ARKA 2VRWB 3N4VA 4RJ3A 1V61A 3VUMA 5CASA 3FLWA 3X23A 5IDPA 5C8KA 4XWXA 2VTQA 3SOCA 4AACA 4JQEA 2XJ0A 2C5VA 5EW9A 3CP9A 4HDQA 4AFEA 3VUHA 4QMNA 4LMUA 3Q53A 1H1RA 4IB1A 3QYZA 4UYAA 3RCJA 4EONA 5J7HA 2B52A 5AIRA 3FLQA 3AXWA 3I0OA 4EBVA 3FUPA 3AQVA 1XX0A 1QMZA 4FV6A 3ZO3A 3Q5IA 1KE8A 4PDYA 1SZMA 1FGKA 4ID7A 2DUVA 3T8OA 1SNUA 1W83A 2ITVA 1KE6A 1ZOHA 2FSLX 2Y0AA 4O96A 2PVHA 4FVRA 1E1XA 4G34A 4LMNA 2C6TA 3V01A 2DA0A 4JJRA 5CYIA 2I7QA 4DG2E 3ATTA 3PJ1A 1X11A 3DKOA 1WVWA 2CGUA 3LFCA 2YIQA 1NVRA 4GUBA 3FXXA 2X9EA 5JQ5A 4QP8A 1W82A 2YJSA 4X3FC 2VTLA 5JP4A 2P4IA 3OT3A 2VO6A 3NSZA 1JKTA 4A9RA 2OJ9A 3S2PA 4CYEA 3F2RA 3IGGA 3R8ZA 2XK4A 3EN5A 4RPVA 4GKHA 3VS5A 1TQIA 4TYGA 4CMTA 4CFMA 1PMSA 2PPQA 3R7UA 3IDCA 4C4IA 4ANMA 4MHAA 4MF0A 4XG4A 4GS6A 3RALA 1HCLA 3E7OA 4IFGA 4CEGA 1J1CA 3DNEA 2W4JA 3M11A 2C6OA 2V76A 2YIWA 4F08A 3ITZA 1WG7A 4MXZA 4XS2A 3N4UA 2OQBA 4J1RA 1BAKA 4H58A 5G1XA 5K5XA 4FKLA 4G6LA 4XJ0A 3F82A 3S95A 3VS6A 2XQNM 1O6LA 4IMYA 4PMTA 4PPBA 3FQSA 4EHVA 4BGHA 5CNNA 4BCOA 5TF9A 4BTJA
chains in the Genus database with same CATH superfamily
4E20A 4ANSA 1PF8A 4JXFA 3NUSA 4I0TA 4PDOA 4YJPA 4RJ5A 3F88A 4KSQA 3ZLWA 1UNQA 3FEHA 4FKRA 3BU5A 4FTTA 4CT1A 2UW8A 2CY5A 3FSKA 2DTCA 2BUJA 2EVAA 4AT4A 2M14A 1DI8A 5ANOA 4O81A 3ZU7A 4RWIA 2W1IA 3KEXA 5C9CA 5L8JA 5DMZA 1I44A 2O5KA 4R6VA 3SO6A 5HQ0A 3OD6X 4EOPA 2BDFA 3PXRA 4QYGA 5AR4A 3TZ9A 3O5AA 3OOGA 4OTGA 1CDKA 2ONLA 4L67A 3ZFXA 2J0KA 3CY3A 1H1PA 2O8YA 4LOQA 4R7BA 5M4FA 1NW1A 3GU7A 2BIKB 1YOJA 2WHBA 3UOJA 3RAIA 3OCTA 4E3CA 4Z7GA 1NU2A 4TKSA 2VTNA 2CDZA 2CKEA 3DDQA 3S00A 1DM2A 3G51A 4QT1A 2YWPA 5L2TA 3KY9A 3HL7A 4JBVA 4L00A 1WJMA 1Q8WA 1UNPA 5AAFA 3UVQA 3DCVA 3LCOA 4W8EA 1X1FA 4BB4A 3P79A 4W9XA 5HHWA 4I0RA 2D4QA 1ZYCA 5JFWA 3OUKA 5JZJA 3WIKA 1H07A 4QNAA 3RPYA 4ASXA 3TZ7A 5J95A 3Q3BA 3QCSA 4F70A 1H24A 3TZ8A 3VVHA 3JS2A 3QGYA 4K77A 5E91A 4B8LA 2I40A 5BQ0A 3FMJA 3TTJA 5A4CA 4FK6A 5DT4A 3R21A 5CF5A 4PNKA 1H8FA 3NEWA 3D8DA 5BYYA 2WOUA 4X2KA 2QKWB 1BX6A 1KZGA 2YDIA 3EQCA 3NZ0A 3EIDA 4XG7A 3OOMA 3QX2A 5JRQA 4RVTA 5KMKA 1NY3A 2PUIA 4V0GB 3ZTXA 2NBVA 3E5AA 4EKKA 2NMBA 3EQFA 3ZBFA 3WF5A 4A06A 4YJVA 2CGWA 3EQPA 1GAGA 1ZMWA 3V04A 5TR6A 5E8TA 3O23A 3RNYA 2B55A 5J9ZA 4XG9A 3G0EA 3QC9A 3DY7A 4ENYA 4O7RA 4G5JA 5CF8A 5T3QA 3OWJA 3ORPA 3D83A 2DS1A 5AUZA 1R0PA 4R78A 2GNLA 4J8NA 4LG4A 3H4JA 2J90A 5DT3A 4BI1A 2VWVA 3RPSA 2GJYA 3LAUA 2GDOA 3F5XA 2IZTA 2Z7SA 4MNEB 4WNKA 4CV8A 3BHTA 2XIYA 1U4DA 3COHA 1WVYA 4HVHA 3Q9YA 4L3PA 5CI7A 4YBJA 4CTCA 1TFFA 4I93A 4HYHA 2OF4A 1PXMA 5HE1A 5M53A 2WTKB 2GCLA 3RWPA 3CC6A 4B99A 2QLQA 3EN6A 3KXXA 5DE2A 4QQTA 5KMJA 4X6QC 3LKMA 2L1CA 1Z87A 4JQ8A 5F95A 4ZY6A 3VS2A 2PY3A 2XKCA 3EKNA 4IJ9A 5CI6A 3DCXA 3UQCA 4BDJA 3DAEA 3O8PA 3Q9ZA 3Q04A 1NTVA 2RG5A 4DHFA 5T6KA 2W1GA 3FZ1A 2VTMA 4I21A 4IX5A 2K2JA 4ZRJA 3SG9A 3CIKA 2P55A 3FEGA 3KN6A 4DFYA 3LCKA 2PMLX 3FZSA 4ITHA 1V0PA 4J52A 4WBOA 3GXLA 4ANLA 2MWNB 3R22A 1M17A 5K5NA 2KR0A 4HDOA 4F1MA 1OUYA 4ONAA 3DAKA 2EWAA 4ZLOA 3T06A 3DBDA 3MPAA 4U79A 5CEQA 5HCYA 5LVLA 3SRVB 2GQGA 4JG7A 4FJVA 5JHHA 4ZLZA 2ZVAA 4GEOA 3PA5A 3PWYA 5I3RA 1FMOE 4O84A 3A8WA 3QAME 3SXFA 5A46A 3AGLA 4TNDA 3MI9A 4BBMA 4BIBA 5CAUA 4V0GA 4XYFA 1Z5MA 2UV2A 2FSMX 2VTTA 2HZ4A 4EHGA 2FVDA 3FSSA 1G8AA 2IVTA 2P33A 3DU8A 4WSYA 1U5DA 5HIEA 1RRPB 1ZZLA 2ZV2A 2X2LA 5LQFA 3ORTA 4EJ7A 3D2IA 2AUHA 4YPSA 3A8QA 2AEHA 1JKKA 3PEGA 4LYNA 3ULCA 3F66A 3UC3A 4EZ7A 3D8EA 5LCKA 1REJA 3JUHA 3LCSA 4L68A 4RFYA 3NYXA 4K8AA 4MNEA 3VNTA 2BFXA 3C7QA 1PXIA 4P7IA 4KRCA 4NCTA 4MWIA 3R7VA 4IB3A 2VN9A 4UMPA 2EB3A 4R3CA 4TRLA 3KRWA 4V01A 1M14A 2XMYA 3R7EA 2H8HA 5AP2A 3O71A 2OU7A 4JDJA 3RMFA 1GY3A 3VJNA 3E8EA 2J5FA 4FNZA 4NWMA 3VULA 4DLJA 3FXZA 2UW0A 4I6HA 4O91A 4TWPA 4CGAA 4LL0A 5L4QA 1FB8A 5JGBA 4FUXA 4Z7HA 2Y8GA 5AJQA 3NCGA 4D2PA 1QPJA 2EMSA 5HTIA 2BRBA 3VN9A 3C51A 3ZSIA 3WILA 3FI3A 3ZVRA 4W9WA 2VU3A 2LG1A 4IZAA 4O21A 2JGZA 4LV8A 1T45A 3E7VA 4MK0A 3FYKX 1KV1A 3KC3A 3UQGA 4GVJA 3ZMMA 4MAOA 2QOLA 1MQ4A 5GIOE 5CQWA 5LVMA 5EQPA 1YDSE 4E6QA 2W4OA 3HW2B 4MD9E 3P7BA 4NM0A 2XCKA 3BU6A 3B8RA 4E5WA 5JGAA 3PJ2A 3FLSA 3WA0A 1KI1B 3KMUA 1IA9A 4KKEA 4XP0A 3SRVA 4IJPA 4D4SA 4AGCA 1W2DA 4RX7A 2KCJA 4XP2A 2I1MA 5DI9B 4H3BA 4O0SA 5CXZA 5I9YA 4NTSA 4GT3A 4L01A 3TNPC 2XALA 4O0TA 3MGYA 2BAJA 2XJ2A 5IA0A 2PULA 3LQ8A 4C3FA 5L81A 1H0VA 4FT9A 3DS6A 3UPZA 3BHYA 2WQBA 4FV2A 3V8WA 3LOKA 4FV4A 4TL0A 5JKGA 1JSUA 5KBQA 3PLAE 2J9MA 1SVGA 2PZRA 4C35A 3EMGA 5AM6A 2ZV7A 4QMWA 3RINA 2P3GX 3MH0A 4E6CA 3O50A 5HO6A 3U6JA 3QQUA 3FY2A 3U51A 1PW2A 3ZYAA 1KE5A 3FC2A 1URWA 1SNXA 4EH5A 2K8EA 3D5VA 1PHKA 1WBWA 2J0MB 3OWKA 1DI9A 4IC7A 4S2ZA 3FI2A 4ZY5A 4UN0C 3ORKA 5B0XA 4GJ3A 2VO0A 2X7OA 3QWJA 3P6AA 1KE7A 5J8IA 4QMXA 4PMSA 5D3YA 3DT1A 2JIUA 1YXUA 4JRNA 2OO8X 4GU9A 2QKLA 4DTAA 4QQCA 2PMOX 3C4ZA 3I5ZA 4S30A 2JC6A 2WMWA 4GIHA 3VS3A 2COFA 4FEUA 2UZUE 4IAAA 4QMZA 3MN3A 3ZHPC 3L8XA 2UZRA 3PJ3A 5J3YA 3GCPA 2IYBA 4MKCA 4U3ZA 2RNRB 2CMWA 3KXHA 2ADZA 5EFQA 2BZIB 4BCNA 3BBWA 5BNJA 3EZRA 1Y6BA 3SW4A 3CTHA 3E88A 3QUEA 1SVEA 3UO4A 4AW1A 4QTAA 5FEQA 2F7ZE 2X6EA 4G3CA 4QYHA 4W4YA 3R7YA 3UODA 3QRUA 4FTKA 4C0AA 2G1TA 4JL9A 5AV2A 5HU3A 2A4LA 2ZM4A 4TYEA 5DA3A 3WF8A 2C47A 5E1SA 5M4UA 4MXOA 2G2HA 4YO6A 4V04A 3U9CA 3LFDA 5L3AA 1OB3A 3QIJA 1R3CA 5D3VA 4BTFA 4MNFA 4ERWA 3QCQA 1U46A 2E9VA 2ETRA 4JG6A 3WYFB 4X0MA 3VS7A 1OY2A 2FH9A 3D5UA 1ZLTA 1ZY5A 3NNVA 4BDFA 3DA6A 3I81A 1ZC3B 2XARA 3IGOA 4KHAA 3B2WA 1YWNA 1VYZA 4I22A 2ETKA 4GN1A 4GMXB 1VYWA 3V8TA 3HZTA 2W05A 3L8VA 5E4HA 1BUHA 3IW8A 2I0EA 2JD5A 4QMTA 4F65A 3LE6A 2LOXA 4C36A 1KOAA 3EN9A 3UOKA 5DHFB 3C4EA 2PVJA 1GIIA 4FNXA 4B9DA 1VZOA 4AGWA 3R1QA 4D2RA 3PG3A 4FG9A 4X7QA 1FGZA 2YSZA 4LGGA 1CTPE 3N9XA 2XJ1A 2VTSA 3ZUTA 5HORA 1FAOA 2O64A 4EJNA 2UZVA 2ITNA 3D7TB 4WVFB 3MFUA 2W2WA 2B54A 1F0QA 4QDEA 4FG8A 3QRJA 5L8LA 4AGDA 2J0MA 3A60A 4H36A 1Y8GA 5HX8A 3AC4A 3DB6A 5IA5A 5BYZA 5F20A 4U3YA 3MSSA 2R3FA 1Q3DA 3PYYA 4CYIA 5EKNA 4IADA 5HEZA 1PLSA 3R9OA 2W7XA 4L3LA 2CAYA 3SD0A 1ZARA 2JKKA 4RQVA 4WA9A 3U12A 4O7SA 4O7TA 2WEIA 2A1AB 2V55A 2R3GA 3DJ7A 4ZIMA 1OKVA 2Z59A 1K3AA 3ZDTA 4BHZA 3DDPA 5KX8A 2F9GA 2PVYA 3POZA 3PSDA 3KMMA 5CT0A 3R73A 4F1OA 1TXDA 1OIRA 2GS2A 2WD1A 3F3VA 4NJ3A 5HG7A 3VUGA 3NWAA 2CKOA 4CFWA 5B2KA 4AZSA 2BROA 1LB1A 2L2IA 4GXBA 3TM0A 4DE4A 3BYSA 2GFSA 4I6FA 5E8ZA 3W8LA 5FXRA 3NWDA 2C0IA 4H1MA 5HCZA 3MA3A 5AP1A 3ZFYA 2Y6OA 4ZSJA 4TZRA 3L8SA 4I3ZA 2BAKA 2GPHA 2CCIA 1B39A 2WNTA 4IEBA 3UO6A 2YFXA 4OTWA 1W1GA 4G16A 5EYCA 4O0WA 1P5EA 4TWCA 3I0QA 4JVGA 4YTIA 4N0SA 4XG2A 4C2WA 4J98A 3PY1A 4FKIA 4G17A 1V89A 5D27A 5E8WA 3DJ6A 4CFXA 4ZTQA 1H00A 2CN5A 3TWJA 1GIJA 4O2ZA 3DFCB 4CFVA 2R3PA 4BCMA 4GJ2A 4F1TA 3LMHA 4YJNA 3GB2A 1Q99A 5BVNA 4ACCA 3QTIA 5EFXA 3KXNA 1XKEA 2ZB0A 2GNIA 3E87A 1Q5KA 5I5ZA 4YJRA 3KIOC 1DDMA 4FSMA 3E3BX 4HAYB 3HQCA 2JFMA 4GT4A 2D10A 2C6MA 3MW1A 3KXMA 2EU9A 3Q32A 4MXYA 1YKRA 1VR2A 2DHIA 1OGUA 4I1ZA 3UGCA 4E4LA 2ZMDA 2XKEA 4DFZE 3GUBA 4ZTRA 1MI1A 5DNRA 2DFKA 5GZ8A 4C3RA 3D7TA 4E5BA 1J7LA 4BDBA 4IX4A 1OIYA 2B1PA 5M08A 3UVRA 3HV6A 2VSZA 3UMXA 4O7LA 3GYOA 1J3HA 5FEDA 2P2HA 2W1CA 5CSXA 3RCPA 2R5TA 2XM9A 5E7RA 5I9WA 5DWRA 5J9LA 3A7IA 4W4VA 3DQWA 3DQXA 4D0XA 2A98A 3DV3A 4Z16A 5AUUA 5CTPA 4CKJA 3ZEWA 2O0UA 4IVBA 5AUYA 3PG7A 2X8EA 2HXLA 5L6OA 1MIXA 4K81A 3UIMA 4OSNA 3PSBA 4CD0A 3L9PA 4AXCA 4FIHA 5ETFA 5C01A 2OLCA 4AE9A 3MY5A 3W55A 2C3IB 3JVSA 5BMSA 1Z57A 2J5EA 4J95A 2EJ8A 5EI6A 3I60A 3EWHA 3NLBA 1SMHA 3AMYA 5DRBA 3O7LB 1YOLA 2MFQA 4EKUA 5CEMA 4Y73A 4G3DA 2WQNA 3OY3A 2H6DA 2YERA 3LW0A 3SXSA 4MEDA 1WBSA 4EL9A 2HOGA 4C0TA 2XNPA 2C6KA 4WSFA 4QTBA 3F5PA 3OCSA 4RIWB 4EYJA 5LCJA 2D2QA 2YM3A 5FM3A 1DBHA 3ANRA 4ZLYA 4MTAA 1B6CB 4XH6A 3W10A 5IA2A 5CAQA 3CTJA 4JG8A 4L52A 5I2SA 4HGTA 1NVQA 1KOBA 4IXPA 2Y8OA 4K11A 2ITTA 5B7VA 2WMBA 4BDIA 3RP9A 3KXZA 5M51A 4MXXA 4L6QA 1YXTA 1BL7A 4FX3A 4C4FA 2FSTX 1ZC4B 3NW8A 4EK3A 5M07A 4G6OA 5ITAA 2IPXA 4YJTA 3QTUA 1S9JA 3EN7A 4HYSA 4QMSA 1F3MC 4QNYA 4D2VA 5K4JA 3UBDA 3A62A 3F69A 4YUQA 4ASDA 2XANA 3BBTB 3ROCA 4DBXA 4AZVA 5AUTA 3LIJA 3Q4TA 1YWVA 3U8WA 3BINA 4LRJA 4PPCA 5EM7A 3G5DA 2PVNA 3A8PA 2W0JA 1XH5A 4GCJA 4U44A 2WAJA 3DBFA 4EYMA 3AD6A 1WBVA 5F94A 5LWNA 4L3JA 3UTOA 2BTSA 4UEUA 2WGJA 4U80A 4YJOA 2VNYA 5JHGA 4OLIA 1BMKA 1NVSA 2R3NA 3PRFA 4MUQA 4RLLA 4QDVA 3NFFB 4UY9A 2V22A 4GT5A 4AA5A 3COMA 4FZFB 2YM7A 3LXKA 4TNBA 1ZOGA 4ACGA 5IG1A 5AV3A 2WFYA 1YW2A 4XV2A 4F0IA 1FMKA 1ZYLA 2WQOA 2Y4PA 5AV4A 4ZTHA 2C6EA 4ZTMA 4RWKA 1R1WA 3ORLA 4RSSA 3UOHA 5JSMA 2OH4A 2VUWA 4WRGA 4S31A 4DFLA 3E8DA 4NUSA 4F6WA 2ESMA 2R3OA 4C34A 1S9IA 1EF1A 2ELBA 3VOQA 4HAUB 2XNMA 1YDRE 3QC4A 4F9AA 4DT9A 2HZNA 3AD5A 3I6UA 3UC4A 4R77A 2Y7JA 2ZAZA 3R9HA 4O82A 5AUWA 3SDJA 4AUAA 5HU9A 2YA9A 4F7GA 4CMOA 1Y6AA 2XKFA 4IAYA 3EN4A 5I2MA 4LGDA 2BFYA 4PQNA 1J7UA 1UNRA 5IMEA 2VWBA 3HYHA 4RIWA 3SKCA 2EXMA 4AXAA 3TJCA 4PWNA 4NL0A 4BDHA 1YQJA 5CENA 4IAPA 3ZSHA 4GL9A 1TKIA 2F57A 5E1EA 4DFUA 2RG6A 1JAMA 4EOLA 1ST0A 2ZOQA 1H25A 3HKOA 1IEPA 4HNIA 4DG0E 4I92A 3G33A 3V6RA 4Q9ZA 1H28A 3D5XA 4CFUA 3GBZA 3FYJX 3Q2JA 3G2FA 5C27A 5EYKA 2HWOA 3TL8A 3BYMA 2C6IA 3D9VA 5CS6A 3CD3A 4II5A 5TE0A 2B9JA 5CXHA 4IOYX 3L9LA 5J5TA 3OP5A 4FTAA 2D9XA 5A9UA 3ZO1A 4AP7A 2VX3A 3NAYA 4Y72A 4AG8A 4G3GA 2XK8A 2COAA 1OL5A 2UW5A 3Q4ZA 3R7OA 3SHEA 3ZUUA 4IIRA 4DAWA 4YO4A 4UYNA 4A07A 2DN6A 2O65A 4K18A 4M8TA 2HE7A 2YS3A 1XODA 5IUIA 4A9TA 4LDTA 5CALA 2UZEA 2YIYA 2XK6A 4FGRA 4YMJA 3P9JA 2ELAA 4WHZA 1GZNA 1LEZA 2ZJWA 3FZOA 3LM5A 2PZ1A 4IWOA 1K5GB 2XEYA 4KABA 2YEXA 4FZDB 4O0YA 5L2QA 4CFFA 4PQ0A 1CM8A 4M68A 2E2XA 2IF8A 1YI6A 4UZHA 4YZDA 1AQ1A 4PL3A 3WZDA 4EUUA 3RAHA 4FL3A 2GNJA 4BYJA 4I6LA 4F78A 3AC1A 2AC5A 3BWJA 4PNIA 5DVRA 3VW8A 3H30A 2QD9A 4LL5A 1EVHA 4GG7A 1Y8YA 3QTWA 3KF4A 4BTMA 1MPHA 4BYIA 4JIKA 4O4DA 3BEGA 5I3OA 3SVVA 4OR5A 1I2HA 2D9WA 3IECA 5KQ1A 3OHTA 4PTCA 3FMEA 4IB5A 4WG5A 3ODOA 2VTIA 2BKKA 3B2TA 2BILB 4D28A 5M09A 4Y94A 1EGXA 4YLLA 3DXNA 3UP2A 2KIGA 2BPMA 4KB8A 3GC0A 3BZ3A 4FSUA 4U97A 2AC3A 5IA4A 5KHWA 2D11A 4D1XA 4OTPA 4RLKA 3EFKA 4YZMA 5F4NA 5IQGA 5KUPA 1JNKA 5HE3A 3T3UA 3F3ZA 5DGZA 2PMNX 5M44A 2PZYA 1EAZA 3CTQA 5C79A 4KS7A 4XCUA 3ZC5A 2J7TA 2OSCA 4JIAA 4LV7A 4O7NA 4NY0A 4JX3A 1M7QA 1H10A 4FKOA 3QL8A 4GVAA 4M67A 4FTOA 3R8PA 4DHJA 3WE8A 2N23A 4U81A 3EQHA 3G90X 4GK2A 3IDPA 1J19A 1W1HA 5IQHA 1KWPA 4HB4B 3C0GA 3VS0A 1OI9A 4DX8A 3PPZA 4O7VA 5AP6A 3WF7A 3PJ8A 4YPDA 4WJ7A 1L3RE 3C13A 1R0EA 2PE2A 5DHJA 5BVEA 4KIOA 4C59A 1E1VA 3BYOA 3HRFA 3ALOA 4M3QA 4D0WA 4S32A 3BE2A 1PKDA 3QXPA 4O0XA 1OBGA 4TW9A 4FODA 3TVVA 4F64A 4BZDA 4APCA 1APME 2O63A 2QOIA 5GJFA 3MYGA 3PDTA 5CLLB 5FTGA 3QTRA 4EH7A 3PPJA 4C4GA 4XBRA 1ZOEA 3K5VA 4RG0A 3NSUA 1KUTA 4CHJA 4PMPA 3N51A 3UVPA 4EKLA 3W0QA 3OANA 3ZEPA 1OBDA 2HW6A 3FBVA 4PL5A 3R7IA 3S1HA 3W0OA 1X8BA 4XX9A 1M7NA 3ZO2A 1URCA 2YJRA 3QKMA 3NGAA 3COIA 2R3LA 4U40A 3VQUA 4H8SA 3FAAA 3OXTA 5HG5A 4TWOA 3FWQA 1PRYA 1Q4LA 3NVMB 3R9RA 2B9FA 3EQBA 3K2LA 2PK9A 1U5GA 3LFEA 4KKHA 3V6SA 4BDEA 3C4FA 3LMIA 5AADA 3QKLA 5LXMA 4K2OA 1MRUA 4Q2AA 3KRXA 3DKCA 2WMRA 3MTLA 4HGEA 3BQCA 5BVKA 5TKDA 1JLUE 3MDYA 5CSPA 2QKMA 2H96A 5L6WL 3V8SA 1PJKA 4P2KA 3HDNA 1ZM0A 1WGUA 1OMWA 3FQEA 3F7WA 1PXJA 4M13A 3TV6A 3W2OA 4E1ZA 2GU8A 2VNWA 3TI1A 2H34A 3KZ1A 3FJQE 3JY9A 3FPMA 2GS0A 1Q8UA 5ETIA 3RZFA 4FV0A 4H39A 1UU7A 4GK4A 2IZRA 2RFDA 1W7HA 3MJ2A 5HLWA 3OBGA 2XK7A 3QWKA 4W8DA 3GC8A 3W8QA 4AXEA 2QO7A 3VAPA 2Z8CA 4KIPA 4H05A 2QHMA 2Q0NA 2ZV9A 3OS3A 4EK8A 3TUBA 2BRNA 4JAJA 3ZRLA 3HP2A 4TWNA 4O7ZA 3RBWA 3VS4A 2COCA 5I9VA 2XYUA 1TQPA 3EQIA 3MVJA 2R3IA 5BMMA 1W0XC 5FDXA 1IAHA 2QNJA 3LCDA 3MIAA 3LZBA 4FKSA 4FTCA 4IWQA 3RZBA 4BN1A 5IMXA 5KCVA 4GOUA 4I5PA 3UIBA 2XK3A 1RDQE 1TQZA 5HIDA 3BEAA 4O1PA 2RGNB 1WAKA 1ST4A 1WVXA 1P2AA 3IW5A 5EH0A 5KMOA 1NA7A 2VV9A 4XHKB 5BVWA 4ZJIA 1XR0B 5H9BA 2K2UA 3ODYX 4CVAA 3ZBXA 1YVJA 2HY81 3WZJA 4ZTNA 1PKGA 3BE9A 3QZIA 1P4FA 4XRJA 2EC1A 4AAYA 3TNHA 3HA6A 5FDPA 1CMKE 1YDTE 4LRKA 4F09A 3D14A 1XO2B 2QU6A 4HSIA 4DYMA 5IUHA 5BVDA 5BYLA 2JAMA 4ORKA 2PMIA 4DC2A 3VBTA 2C6DA 1LR4A 2GSFA 2IJMA 2YZAA 4GYIA 5CY3A