5KCVA

Crystal structure of allosteric inhibitor, arq 092, in complex with autoinhibited form of akt1
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
433
structure length
353
Chain Sequence
IVKEGWLHKRGEYITWRPRYFLLKNDGTFIGYKERPAPLNNFSVAQCQLMKTERPRPNTFIIRCLQWTTVIERTFHVETPEEREEWTTAIQRVTMNEFEYLKLLGKGTFGKVILVKEKATGRYYAMKILKKVLQNSRHPFLTALKYSFQTHDRLCFVMEYANGGELFFHLSRERVFSEDRARFYGAEIVSALDYLHSEKNVVYRDLKLENLMLDKDGHIKITDFGLCPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHEKLFELILMEEIRFPRTLGPEAKSLLSGLLKKDPKQRLGGGSEDAKEIMQHRFFAGIVWQHVYEKKLSPPFKPQVTSETDTRYF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Discovery of 3-(3-(4-(1-Aminocyclobutyl)phenyl)-5-phenyl-3H-imidazo[4,5-b]pyridin-2-yl)pyridin-2-amine (ARQ 092): An Orally Bioavailable, Selective, and Potent Allosteric AKT Inhibitor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/inhibitor
molecule keywords RAC-alpha serine/threonine-protein kinase
total genus 90
structure length 353
sequence length 433
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2016-06-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
A PF00169 PH PH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 5kcvA03
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 5kcvA01
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 5kcvA02
3KULA 3UPZA 3SOAA 3QLGA 3WF9A 1TQZA 2XKCA 3G6GA 4NJ3A 4O27B 5L6PA 2EWAA 4EH2A 4I0TA 2V5QA 4LUDA 1H0WA 4EI4A 3GI3A 5HO7A 3DQXA 2UVMA 4HAXB 4XX9A 3MA6A 1YWRA 4FSYA 4FTTA 4KSQA 3WIKA 5HNIX 1AQCA 5AP6A 4JR3A 1QMZA 3BI6A 4WG4A 3GXLA 1FGIA 4RLLA 4G3GA 1FHXA 4CRSA 1P5TA 4WNMA 1Q99A 5CF4A 4IB5A 2VTHA 4QQ5A 3T06A 2QQ7A 1BMKA 3DKFA 3DGKA 4AW5A 3UTOA 2PSQA 3ORIA 1PXOA 3NUPA 4TT7A 1WJMA 4D5KA 2NMBA 2UVZA 4V04A 4FBXA 4TY1A 4XG2A 4C4HA 3LMHA 3SXRA 4KIOA 2UW3A 5A46A 2XYNA 4BICA 4E5BA 1V5PA 5C6RA 5D3VA 4GK4A 2W0JA 4FC0A 4FL1A 4LOOA 4DEEA 1E1VA 4YZDA 2C0OA 3ZFMA 4W4WA 3LFSA 4GFGA 4R8QA 3FI2A 4NM0A 5FDXA 1DYNA 2PE0A 3II5A 4ZOGA 3GC9A 3QKLA 2D4QA 4CFUA 3MFTA 5D11A 3V3VA 3VBTA 4UN0C 1YRPA 4KWPA 4GG5A 5HD4A 4QMWA 2YWVA 3LXNA 4FSUA 2XRWA 3V01A 3C13A 5GJFA 5HIEA 2LOZA 2WQNA 2C1BA 4MNEB 5JQ5A 1OUYA 4AZFA 1ZYLA 2CMWA 1M2PA 4ACHA 2D9VA 2OXDA 3D5VA 2VD5A 5L81A 4BDGA 1GIJA 4OTRA 3NUSA 5DRBA 5KMOA 2RUKB 1IAJA 3HMMA 4GH2A 2R3QA 5HX8A 3DTWA 5BX0A 4E6QA 4IVAA 1YDSE 1JWHA 2Z7QA 1JKKA 2ITXA 1SVGA 3RALA 1M7NA 3N51A 3T9TA 1OUKA 2GU8A 3PWDA 3O7LB 2E2BA 2IG7A 4FEXA 3R2BA 2YS1A 3FSFA 3QA8A 3GQLA 4QYFA 4JG7A 4W8EA 1REKA 3NW6A 3ZUTA 4A9SA 4EOPA 3TACA 1GAGA 2R3IA 3WA0A 1HOWA 4QPAA 4IIRA 3IKAA 4LL0A 3V5WA 2YCRA 3CCNA 4BTFA 5BMSA 3FMJA 2XIZA 4A9RA 2C5VA 2JD5A 1OKYA 2G2HA 2XP2A 4P5ZA 2PVRA 4ANQA 2IVSA 1PMEA 2DYQA 5ANIA 2AYPA 3HP2A 2X8IA 4MBLA 2I7QA 2WU7A 3HMNA 5AM6A 3OFMA 3OEFX 4YZ9A 5T68A 5IQIA 2E9OA 3FMNA 2YF0A 2IVTA 5BVOA 2G15A 5D12A 4RFZA 3Q4UA 4GPTB 2UVXA 3K54A 4OTPA 2WTCA 5IA5A 3U87A 4QO9A 4QQJA 3VS7A 1X11A 4D2WA 4YJVA 3IS5A 2PVLA 4WRGA 1M7RA 2WQMA 4S2ZA 3V8TA 4EJ7A 4UALA 4ACGA 1G8AA 3P23A 4ACDA 1OITA 1YXUA 4FT9A 3FC1X 2VWVA 3U7DA 3LFAA 4TWCA 1MIXA 4IFGA 3QYWA 4KBKA 2IW6A 5HE3A 5K0KA 3AGMA 3BINA 5C01A 1PHKA 3ZOSA 5DT0A 3R0TA 1CKJA 4S34A 2D9ZA 5TT7A 5J8IA 3I7CA 1PXMA 4M12A 5IZFA 4N6YA 2LAVA 3LFEA 4BDEA 4GT3A 3VS6A 4CMOA 1R78A 4HYUA 3IW8A 5LVOA 3ULZA 2BHEA 4R1VA 4K2OA 3WYXA 5KKRC 4X3FA 2Y8FA 3Q6UA 4CKRA 3F69A 5FGKA 1N3HA 1DAWA 2YJRA 4FTRA 4ZTQA 2I0EA 4M13A 4RLKA 4YJUA 5HVYA 3FI3A 4IX3A 4K0YA 5CSVA 5CASA 5HLNA 5JHGA 3GU7A 3O50A 5I3RA 2FB8A 2QO9A 1PJKA 2XBAA 2PVKA 2WTWA 3OC1A 3PFQA 1JQHA 3GCSA 3F0WA 1DDMA 5F4NA 4AN2A 3QZGA 4FIFA 3U6JA 4DFXE 3QRJA 4GYIA 5FDPA 5FUTA 5CAPA 4IX6A 5FEQA 2VU3A 3N9XA 2C0TA 3BZ3A 4P5QA 4IWPA 5M4IA 4AZVA 2VTMA 5E92A 1B38A 2GMXA 4TXCA 1BL7A 5HO8A 3TV4A 4BDHA 2PE2A 4J8MA 2C5OA 3ERKA 3AU5A 4H3PA 5FQDC 5K0XA 3OBGA 1NY3A 2WB8A 4EHGA 3FQHA 1OVEA 1UV5A 2YM4A 4YJSA 1XH9A 2XKFA 1UA2A 3A7GA 4CEGA 3R04A 1Y5OA 4IAFA 1SM2A 4I6FA 3PXFA 5EFQA 4AQCA 2I6LA 5E8SA 3IDBA 4I0SA 4O0TA 3UNZA 5GZAA 3R63A 2G2IA 3QTZA 4XV9A 4O7VA 3Q9YA 4EQMA 2F57A 2RL5A 4DX8A 5AJQA 1UKHA 3VBVA 3W2RA 3CS9A 5HCXA 1FHOA 1U46A 5L2QA 4QMSA 2GQSA 3CD3A 3JPVA 1BKXA 2V62A 2WD1A 3EQRA 3VAPA 4AT4A 5ETCA 3ZEWA 5LXMA 5M4UA 2C69A 2FSTX 2QG5A 4OTFA 1RE8A 1YHVA 2GFCA 2WOTA 1IA8A 3C5UA 2BDJA 5CU2A 1YWNA 5HD7A 3ZTXA 4FA2A 4YURA 2COAA 3F5RA 2J5FA 4XG3A 4XMOA 1R39A 3BKBA 4YLJA 3EN9A 3NYVA 3UIXA 5HKMA 2CLXA 2WMUA 1B6CB 2YM6A 3C4FA 4I1ZA 2W1GA 5T6KA 4AGCA 1OBDA 4BBMA 4KBCA 4O1OA 2RSGA 4QTDA 3FZPA 5CI6A 2IVUA 4CVAA 3T3VA 2CKPA 3UBDA 3RTPA 4FYNA 3FZ1A 3PSCA 5M4CA 3EL7A 1O9UA 3GEQA 3JS2A 1J19A 3DK7A 4RJ7A 1EAZA 2PVFA 5LONB 4XOZA 4IDTA 4IB1A 5AV2A 3W2CA 3MS9A 5BVNA 3DBEA 2BFXA 2RFDA 4QMPA 3SX9A 5FD2A 3OW3A 3TEIA 4JDJA 1Q3DA 4B6LA 2RGNB 2BTSA 3AD4A 4AP7A 5CU0A 4D2PA 4FUYA 2VNYA 2AC3A 3UQFA 4FODA 4E4MA 3LCKA 5AWMA 2PY3A 2JIVA 4XS2A 3R8VA 1Q62A 3U6IA 3AJ4A 2VTAA 1FGKA 5JGAA 3FXXA 2CKEA 3DPKA 4MXCA 1NVRA 4C59A 2D9WA 3QWJA 3TJDA 2YDKA 4PL5A 3MFRA 1FMOE 5A4QA 1BI8A 5LVPA 4BCKA 2WTVA 2Y4PA 5LQFA 4FOCA 5IQGA 3Q2MA 4MBJA 2RIOA 2QURA 4U5JA 5HE1A 4JDKA 3TKUA 3VQUA 4TYIA 4RVKA 2BRGA 3MTFA 2B9JA 4F1MA 3H9RA 4IZAA 4JVGA 5D1JA 3D14A 4C58A 1UPRA 4YONA 4YZCA 1ZYJA 3OTVA 4APCA 2D11A 4A9TA 1V89A 3ZBFA 1K5DB 2JKQA 4WNOA 4E7WA 4I5MA 2JKKA 4U40A 2YSZA 3IECA 3UOHA 5EKOA 1ISNA 2DHKA 2YDIA 1QCFA 3RNYA 3QX2A 3OT8A 1J7LA 4MNFA 1H24A 2E9PA 2GPHA 5TF9A 1WVXA 4PPCA 5HVKA 5I0BA 1OPJA 3G90X 2WMTA 3DOGA 4IVCA 1H1QA 3P5KA 4X6QC 4KS8A 3FZRA 3K3IA 3NUXA 4MQ1A 3VF8A 3VS4A 1K9AA 2Y8GA 3D8FA 1LR4A 4TYEA 3RK9A 4RIWA 4JNWA 3REPA 3DA6A 3G51A 3VO3A 4O0VA 5DMZA 2W4KA 3QA0A 1YXSA 3OS3A 3BIZA 4F08A 3A4OX 3ZHPC 4FGRA 3BQCA 1H1SA 5IH5A 2B4SB 1GC7A 1V0OA 2ONLA 4A06A 3LPBA 3F9NA 3KXGA 5CLLB 4ZY6A 3COKA 3EKKA 2GCJA 4NUSA 2P2HA 4A6HA 4WRSA 2E9NA 4R3PA 4B7TA 4FKGA 5AR3A 4HVDA 4EZ3A 2JGZA 3WF6A 4FKUA 3JY0A 3ZDUA 1J1BA 1M7EA 5IU2A 3QUDA 4U6RA 4DH1A 3BE9A 2YT0A 4R7BA 5JFSA 1V0BA 4FKPA 4H36A 2XNGA 5A4CA 2M38A 4ENYA 1GIIA 4KD1A 3M11A 4ZSLA 5I9XA 3QKKA 3UOKA 1Y8YA 4G5PA 5EQEA 3QRKA 4ORKA 4LGGA 2OU7A 1CM8A 2ZDUA 1KZ7A 4TYHB 1M2QA 3GENA 4KRDA 2VAGA 4RIOA 4U44A 3QU0A 5K4JA 1RW8A 1G3NA 4TWNA 3ROCA 4FIHA 3HZTA 1H28A 3ENMA 3SQQA 1V1KA 4LRKA 2HY0A 4G3CA 4EORA 4Y73A 3LJ0A 4JG8A 2XNOA 1PKGA 2WTDA 4Z7HA 5JN2A 3EQIA 5L6OA 1VYWA 4NKAA 1JKSA 4F64A 5CEMA 4A4OA 2ITTA 1ZWSA 3EQPA 4R3RA 1DAYA 3FYKX 3HX4A 5A4TA 5LMKA 2QO7A 4M15A 2Y4IC 2G2FA 1JVPP 4B8MA 2PMOX 5CYIA 5HOAA 3MJ1A 4AF3A 3QTSA 4L42A 4I24A 1RJBA 4WNPA 3ZDTA 2WELA 5CZIA 4ZSEA 5EHYA 3GVUA 4GU6A 3QQLA 4DC2A 4HGLA 1MK7B 3QTXA 1Y57A 3ORPA 4K77A 1WGQA 3ZLYA 2OICA 1H4RA 4OTGA 3R1SA 4LGHA 1EVHA 3BBWA 5LMBA 1KSWA 5CF6A 2NPQA 3RGFA 1PY5A 2Z60A 1MKEA 4PX6A 2C6KA 1ZOEA 4C4GA 4O83A 1ZYCA 3R9HA 4BVUA 5KHWA 1H26A 5HORA 2ITYA 4CRLA 2RSVA 3P7BA 3OUNB 5LWNA 3QZFA 4M0YA 4RC3A 4D5HA 4QPSA 4HYIA 5EOBA 4HZRA 3E5AA 4L43A 5JP4A 3TZMA 4QMTA 3LFNA 2WMQA 3R9NA 3W2OA 2X2LA 5KMMA 4EK3A 4I3ZA 5KBQA 5CTPA 2C3LA 3F3VA 4RFYA 3PY3A 4RG0A 4YTIA 4AGDA 3UGCA 4NZWB 3RPYA 3R8UA 1YOMA 5D3YA 3E3BX 4MWIA 3ZC5A 5JFWA 2HIWA 5JRSA 4ZTHA 2OJJA 3VOQA 3C9WA 2X0GA 4JQEA 4AW2A 4ARKA 2WMXA 3PXKA 4J96A 1G8SA 4DAWA 2PZIA 4M84A 3O8UA 4BBKA 4AOIA 5IQHA 1R3CA 3B8RA 4RFMA 1AGWA 2JDRA 3GC8A 3MY0A 4ZMFA 2PE1A 2XBJA 4AWIA 4CQGA 2O63A 4II5A 4ZXTA 1Y6BA 5AR7A 2YT1A 5G1XA 2R3OA 1E9HA 2GS2A 4NU1A 4X2KA 3GYOA 2B0QA 3NX8A 1DI9A 3IOPA 3V51A 3CD8A 4OAVB 4AG8A 3RAHA 3G9NA 4DG3E 5HX6A 3AGLA 3PJ1A 3O2MA 4LRMA 3M2WA 3IW6A 3QCXA 4RWLA 4BZOA 2P8VA 4CG9A 3ZUVA 5IA2A 5JFVA 4F1TA 2F2UA 2AC5A 3Q9ZA 3QBNA 4L6QA 2HW6A 5CXZA 2D10A 2BZHB 4HATB 5J3QA 1B39A 1FVTA 4I6HA 3H3CA 3LCTA 3TN8A 1ZRZA 4TYHA 4DE4A 3G15A 3DXEA 4I41A 1WBSA 2EVAA 2Y9QA 3H9OA 4G31A 5C03A 4BDBA 3SO6A 5GIPE 2COFA 4WO5A 2X4FA 1Z87A 2A4LA 1UKIA 4I22A 1W82A 2Y7BA 1MUOA 4CSVA 3VRZA 4UYAA 2M14A 4KHOA 2UZLA 3BGPA 2ETKA 3I81A 4BTJA 4D1ZA 3V6RA 1SZMA 1XO2B 2VX1A 2ZVAA 4IXPA 4F7LA 2G1TA 5J5TA 1MAIA 1UNRA 1ZMVA 3R6XA 3PXZA 1UWHA 3VUMA 4F09A 1MP8A 1Q61A 4WSQA 3CQWA 3F3WA 4BIBA 4FKJA 3EIDA 1ZSQA 3FY0A 3OWPA 2F49A 4JBVA 4D58A 4HAUB 2JDOA 4TRLA 3UVQA 3DK3A 4FX3A 4OTWA 1K2PA 3LFBA 4NT4A 5LVMA 4GVAA 4W4YA 4BCNA 2VWBA 3UZTA 3ZVRA 1NW1A 1PRYA 2C3IB 4D2SA 4QT1A 4F7SA 5B2MA 3VWAA 2W5AA 3ZSIA 4XEYA 1PXPA 4ACCA 5AFVA 3LJ1A 1M14A 2NRUA 4IDVA 2QVSE 4UWBA 1GZKA 3HLLA 4YC6A 4B4LA 4GCJA 3ZO3A 3DBFA 3KMMA 1ATPE 4DITA 1WAKA 2J59M 2NNWB 4EBWA 4ZZOA 3BWJA 4GMYA 4FKSA 4XG9A 1E1XA 3BLHA 3QUPA 4J71A 3BWFA 3VUKA 3PZDA 4H05A 1PMVA 1Y91A 4CFWA 4F99A 3N7CA 4PMTA 2H9VA 4KRCA 5AR4A 4P2KA 5LMAA 4JI9A 5IMEA 2B53A 5L2IA 3LXLA 1PFJA 3F3TA 2XK7A 3DAJA 2QOFA 3I60A 3QTWA 2R3RA 4FG9A 1ERKA 2X1NA 4E20A 4GL9A 2Z7SA 3UYSA 1XR0B 2JEDA 2RFSA 1OBGA 4K33A 4IADA 3W2SA 2UZEA 1A06A 4O0RA 1YDTE 4RSSA 4YJOA 3SOCA 3VUDA 5EM5A 3ZO4A 4E4LA 3OP5A 2XJ1A 3MTLA 3RK5A 2F2CB 4ZTRA 4IAZA 3RBWA 4FT7A 2OIDA 3BEGA 4Y46A 2OO8X 3HUBA 4NSTA 3QD3A 3PTGA 2P0DA 3VULA 5DPVA 4A9YA 4NEUA 4GT5A 1FPUA 4I0RA 5HNBA 5TR6A 3TUBA 3Q32A 2PZRA 5E1SA 3C1XA 3EQCA 3FY2A 5IQAA 2UUEA 3MH0A 3RMFA 3W1FA 4BR3A 2BRMA 3FZSA 5DYJA 3RK7A 4FIEA 4IAKA 4RIXA 4BIDA 4LV8A 1PMUA 2WEIA 5EH0A 3O0GA 5DGZA 4JG6A 4CT1A 3TM0A 3KB7A 3DZOA 3CSVA 3QLFA 3MH3A 1XBAA 3ITZA 1FINA 1PXLA 2ACXA 4V0GB 3QGYA 3R7GA 4JXFA 4RT7A 3L8VA 2YZLA 2CPKE 1QC6A 4O6LA 3FM8C 1VEBA 4YJNA 1Q67A 1Q4LA 3HV3A 2ERKA 4FV2A 3P9JA 2HELA 5M44A 4FVPA 3PIXA 4UBAA 1O6KA 5CSPA 1W98A 4P7EA 3RHXA 3ZS5A 2UW4A 3LOKA 3QD2B 4BWXA 2ETMA 1XR1A 2QOIA 3GCQA 3EQDA 3ZBXA 4C3RA 3ID6C 2FO0A 4GK2A 5AIRA 3VHKA 4WKQA 3MB7A 3OUKA 2L2IA 3JXWA 5GNKA 3FMEA 3THBA 4BB4A 5J7HA 2YAKA 4BCHA 2QKLA 2WQBA 5D7VA 2HZ0A 4DFYA 4ZAUA 2XIYA 4YU2A 5J9LA 3D7TA 2OW3A 3CJFA 1CKIA 1OIYA 2ITOA 4DFLA 4OR5A 3HV7A 1U29A 4KNBA 3S95A 4DA5A 2JDSA 3GC0A 2XM8A 3GBZA 3TNIA 1Y6AA 2WOUA 3MN3A 2VTJA 4L01A 4QMNA 1VJYA 4QRCA 5CI7A 5AIKA 3R8MA 3S4QA 3FI8A 3QQGA 3E92A 4FL3A 4ID7A 1BX6A 1OPLA 1V5UA 3PXQA 4DT9A 3QWMA 1YQJA 5HG9A 4IVDA 2WMVA 4WIHA 4DN5A 2FUMA 3TCAA 3K5VA 3TCPA 1U5FA 4XNEA 3KF4A 2ZPYA 4QYHA 5LARA 2B9IA 3KRXA 3RWPA 4H58A 4FTUA 4F6UA 4V01A 4OTDA 2O0UA 1V61A 2XRUA 3DJ5A 4H1MA 4X7QA 3ZSHA 3N4VA 4PY1A 3PJ8A 5E4HA 1U2BA 3OW4A 3QXOA 1A9UA 3FEHA 4O0WA 1JAMA 3VJOA 2OH0E 1QPCA 5FEDA 3QC9A 1GC6A 1UPQA 3OXZA 3KRRA 3ODZX 3VIAA 3G9LX 4X3FB 4U7ZA 1ZC3B 2C3KA 2ZMDA 4AN3A 2CODA 2GS7A 2JIIA 4YJTA 3OZ6A 3UZRA 3POZA 3KKVA 2JKMA 4AXAA 3PLAE 3B2WA 5AP0A 5C4KA 4GIHA 3ORMA 3QYZA 4EUUA 2IYBA 3MVJA 2R9SA 2PUIA 3WARA 2G01A 4O96A 1XH7A 2C6TA 4ACMA 3DDPA 3KEXA 3L1SA 5CVGA 2OF2A 4ZS0A 2WMBA 3CEKA 4C2VA 5AUUA 1ZMWA 3NEWA 4DCAA 4U41A 1J7UA 2JFLA 4FTJA 4FG7A 1YXTA 3AMYA 4GRBA 4CFVA 4UMTA 4RIYA 4K11A 1MQBA 1YXVA 2Z7RA 4I93A 2XEYA 4RJ4A 4GXBA 4ASEA 5L4QA 3ATTA 4FIGA 2VTQA 3RNIA 1JKLA 4CD0A 1LEWA 3KFAA 3Q4ZA 4XP0A 5LCKA 3SUZA 1XD4A 4AFJA 3A62A 5FP5A 5HGIA 2LYDA 1Q8TA 2C5NA 3R9OA 4IC7A 3MVMA 4D2TA 3D0EA 5AP3A 4D0XA 3CXWA 1WVWA 4MBIA 4XOYA 3A7IA 4CFXA 3A8WA 3NNVA 2LOXA 2HXQA 1KWPA 3C0GA 1XJDA 4XG7A 5FXRA 5EQYA 2V7AA 2ZB1A 2J0IA 2P4IA 3W2PA 2K2JA 2DWBA 2EXEA 4M69B 4TZRA 4Y95A 4BHNA 1DI8A 3GYPA 3VBXA 2YERA 4BDCA 4EK4A 3TL8A 3BRBA 2ROZB 4BWPA 2H7EA 1V88A 3R8PA 4AA0A 2UW8A 3KY9A 5DH9B 2GDOA 3OHTA 4RJ6A 1LPUA 1XX0A 2H34A 4RBLA 3PIYA 5EYCA 2O2UA 5L8JA 3VS2A 3CKXA 1CDKA 1Q8WA 3A2CA 3D7ZA 4NCTC 3PY0A 5HIDA 3RCJA 3ZDIA 2ELAA 5KMIA 2W1FA 4A6KA 2HWPA 5CSXA 1WZYA 4EOLA 4IZ7A 2R2PA 2I1JA 3LJUX 3Q53A 4MF1A 5B7VA 3AD6A 4ZEGA 3JR1A 4TWPA 3DV3A 2C1AA 3HV4A 2OTXA 5E7RA 4GMXB 1Q97A 1L8TA 5JQ8A 5AR8A 5HLPA 1Q3WA 1W1DA 2H6DA 3BHUA 4ASZA 2VO7A 4YC3A 4RWKA 3E8DA 4L00A 3BGZA 3UE4A 4KS7A 1ZARA 2JKOA 3VRYA 2WKMA 4ZLOA 4O0XA 3CQUA 4BKJA 4JQ7A 3DU8A 3HA6A 5TE0A 5FI0A 5T3QA 4JRNA 2VO3A 3OEZA 3PPZA 3VJNA 1KE5A 2OH4A 2V7OA 5A6OA 1YI3A 4RX8A 1WVYA 3BYUA 5E8TA 5A4EA 2L1CA 4HDOA 4FNWA 2JBOA 5EW9A 2YA9A 3IONA 4CLJA 4IANA 4DT8A 3D15A 1WI1A 2B52A 2PVMA 3MJ2A 4M68A 5CANA 5L2SA 3CGFA 4IQ6A 1UU8A 1RDQE 2R3PA 5HBHA 4WSYA 1EH4A 5E90A 3UQGA 3DK6A 4FSWA 2V22A 4DINA 5B2KA 2CGWA 5J79A 4QMZA 3QKMA 3R8LA 3GFWA 2B55A 2BCJA 1K5GB 4YPSA 5DEWA 3EFJA 4BGGA 1LP4A 3KXXA 3IGOA 2PK9A 3LFFA 2BDWA 2ESMA 4IHPA 1OL7A 3W33A 3AT2A 4FK3A 4YHTA 3VVHA 4FZ7A 2J51A 3OCGA 1NA7A 3C4EA 2BTRA 4UB7A 1PKDA 3F82A 2C47A 5ANDA 4CV8A 3S1HA 3CLYA 1NTVA 1HCLA 5KMNA 3NCGA 1QPEA 2XNNA 1XWSA 3E62A 2HOGA 1J3HA 3HP5A 3QHRA 2HYYA 4IB0A 4LGDA 4MD8E 4R3CA 1OMWA 4FNXA 4TTHB 1W8CA 1XH6A 2BKZA 1XKKA 2W4JA 3NIEA 4ZZNA 3SNHA 2Y6OA 1OL1A 5AADA 1OKVA 2WFYA 3I5ZA 4FKIA 2YCQA 4NY0A 4D55A 5C5BB 2BHHA 3AD5A 2QU6A 3UDBA 3NVMB 1U54A 2VWZA 3QQKA 5DR6A 3ZXZA 4BWKA 4F4PA 3A7HA 5L8KA 2R0DA 3MPTA 3ZSGA 3G2FA 4X3FC 4JIKA 5CEPA 2VN9A 1ZYSA 2CGXA 4L8MA 4S30A 3F2AA 4A4LA 3DZQA 5J9ZA 3DXPA 4ZK5A 3PA5A 3BU6A 4ZY4A 3EFLA 4Z55A 1WJ1A 3ET7A 3P78A 4QP8A 2XIRA 3FKLA 4I20A 1H10A 4USEA 1XCGA 4AN9A 2RKUA 4H3BA 2HW7A 3KREA 2RGPA 4TN6A 4ZSAA 5HI2A 4UMPA 4NM5A 4QTEA 5C5BA 1IA9A 3QQJA 3WF5A 1KV2A 2JITA 3TJCA 1U54B 1WFCA 2XNPA 2C6MA 4O91A 3ZO2A 3LJ2A 3NIZA 2J0KA 3PA3A 4QP4A 4H1JA 4C33A 4U97A 5CEQA 5M07A 2EUFB 5CAOA 4TWOA 3ZLSA 3ODOA 4NK9A 2R5TA 3LCDA 4YTHA 4HDQA 4BDIA 4FKWA 1KI1B 1YVJA 4UYNA 3FZOA 4IAPA 2ZV7A 4I94A 1V0PA 4IC8A 5JSMA 4RZVA 3ORNA 3CTJA 3L9NA 1X1FA 4BCMA 4HW7A 1CSNA 3DFCB 4IWDA 4RMZA 5ACBC 4V05A 3O23A 5CU3A 5H8GA 4CFNA 4EWHA 3UIUA 4KABA 3OT3A 2FH9A 3HRBA 3ULIA 3VW6A 4TPTA 4EZ7A 2XQNM 4W4VA 4IE9A 4F0FA 4O0SA 2W1HA 2EMSA 1F0QA 3ODWA 3DKGA 4ALWA 4FZDB 4R7IA 4I5HA 1SMHA 4D4VA 4AGUA 2HZIA 2VWYA 4KIPA 5GHVA 1U5QA 4EWQA 2BRBA 4UMRA 1GZ8A 3CY3A 4OTIA 4PDSA 5AP4A 2W2XD 3WOWA 2CY5A 4FL2A 3U54A 2VRXA 3X23A 4KB8A 3FL4A 4F7UP 5CQWA 4HVIA 5FBNC 2I0HA 3DB6A 3UMWA 4D1SA 2FSMX 1H4LA 3FBVA 3Q60A 4XG6A 4APPA 4YGAA 5ETIA 3F2NA 5DEYA 4LG4A 4FEWA 2DLWA 3G33A 3KCFA 3V5QA 5A6NA 2QC6A 5E8VA 3PJCA 3FPQA 2J0MA 1J91A 4L3LA 4EOMA 3FQSA 1WBPA 5CWZA 5BYLA 4USDA 3S3IA 2WMWA 4AOTA 1WVHA 3BHHA 3FE3A 3VN9A 2XKDA 4ZRJA 3W18A 3DFAA 2H8HA 4EC8A 2CNVA 5DHAB 3OBJA 2IFSA 1SNUA 4IZ5A 2W99B 2JBPA 2HCKA 5HG8A 4CCBA 4O1PA 2QI8A 4MXOA 5FWKK 4FTQA 4QP3A 5I3OA 3R7VA 3QXPA 3LLTA 1P14A 4ZTSA 4G9RA 4DCEA 2GNHA 3PDTA 2PZYA 1FHWA 1Z5MA 3HL7A 4KKGA 1GG3A 4HB0B 3ZH8A 5F20A 3DXDA 3O96A 2HTHB 3A8XA 4BTKA 2CKOA 1Q5KA 4K2RA 3PRIA 4OGRA 4X2JA 3VC4A 4XRJA 3ML4A 1U59A 1WBTA 3CR0A 4F65A 2EJ8A 2F7ZE 3RM6A 5FTGA 2UW9A 4FF8A 1H25A 3ORTA 3R7OA 3PLSA 4C38A 3HMIA 5EI8A 5I5ZA 3U9NA 3WIGA 1A48A 2VWUA 4QMXA 1P5EA 3FLWA 4O7TA 4BRXA 1KE6A 3O17A 3TVVA 3TNQB 5CLQB 2R09A 4I21A 4HGTA 4S31A 2PMLX 4GKHA 4QMVA 3HNGA 2I0YA 3QD0A 2GNIA 3WZEA 5IPJA 1WBOA 3IO7A 3HDMA 3POOA 5KCVA 3R7YA 5C8NA 3V5JA 3KL8A 3GC7A 1RQQA 4FTLA 4IX4A 4WT6A 5D41A 2D2QA 3BYSA 1LB1A 4RIYB 2B1PA 4IJ9A 2XK6A 3W8QA 5A4LA 1YWVA 1M17A 5KNJA 2R3MA 3R00A 3ODXA 4PV0A 4UWCA 3SD0A 5KZIA 4WSFA 4OBQA 3FXZA 3D9VA 3R9DA 1OI9A 4BYIA 2C6DA 3GCVA 4F0GA 1JSVA 2C6IA 3EOCA 1FB8A 2MKRA 2BMCA 2OZAA 3PG7A 4HVSA 1S9IA 4AZEA 3CTHA 3WZUA 3CPBA 3F5XA 2UZRA 3KN6A 1Y19B 4G5JA 2YIRA 3NYNA 4HPTE 4D9TA 5BVFA 2COCA 4A6FA 2GFSA 5TOZA 4C3FA 4DBNA 4AZTA 4I5CA 3L9LA 4QP7A 4YZNA 1KV1A 3IW4A 2ITUA 1M7QA 3CP9A 1NTYA 1ZZ2A 1FVRA 2VWXA 4C8BA 4F7GA 3VS0A 3K3JA 3SG9A 4L45A 4F9BA 2IZTA 3KC3A 4NFNA 3BQRA 2XVDA 5AAGA 1XQZA 5DHFB 3KZ1A 1YKRA 3MDBC 3L9PA 4EK5A 3GU4A 3KMWA 2OJIA 4QP9A 5DNRA 4G6NA 4KAOA 4EKUA 3P7CA 2X6DA 1DDVA 3NW7A 2UZWE 4FT0A 5FP6A 5CF5A 4ZSJA 4AFEA 3R9RA 3QTRA 3LFCA 2VNWA 2W17A 3BHVA 4OT5A 4Q9SA 3MDYA 4C37A 4K18A 1FVVA 4FTKA 4MHAA 3ALNA 3QALE 3SRVA 4BDAA 5DE2A 4X2GA 4OAUC 3C51A 1G5SA 3C4WA 4RVTA 3PPJA 1PW2A 4CQEA 4M66A 2FGIA 3UQCA 4OBPA 4XV1A 3NMUF 3PWYA 4JAJA 2QCSA 4NTTA 3VUGA 4UXLA 3RKBA 3OMVA 3VIDA 1T45A 5IA3A 3VF9A 1UU3A 4X2NA 3LMIA 4M7IA 1Y8GA 4EQCA 2X2MA 5E8XA 3NR9A 4FVRA 3R1NA 3E64A 4CHJA 2C6EA 4LUEA 3UP7A 2EC1A 1XKEA 3ZZEA 5H8BA 4FSMA 4D9UA 1J7IA 4TKNA 2AUHA 3AC3A 1I7AA 3UODA 2JFMA 4AA5A 3V5LA 4WVFB 3FXWA 5HU3A 3ORLA 3COIA 4ZRKA 5DT4A 2YM3A 3HGKA 3O8TA 2XNBA 4W9WA 5FM3A 4F9CA 5IDPA 4MF0A 1F5QA 2ETRA 4I6QA 1T46A 4ASDA 3R1YA 2UZBA 2X8EA 3T3UA 5AV3A 4EH7A 2GJYA 5HBJA 4JDHA 3QHWA 2XF0A 3ACJA 2GQGA 4GW8A 4QP6A 4Y85A 4E1ZA 4XHKB 2NZ8B 3BLQA 4B6HA 2WTJA 2R7IA 1JSUA 2YDJA 3GFEA 3RVGA 3B8QA 3DNDA 3DXCA 4GJ2A 2KGXB 3EH9A 1ZXEA 3DNEA 4XG4A 4F0IA 4ENXA 1SGHA 4YJRA 3U8WA 4J8NA 3UNKA 2XCKA 4OT6A 3UMXA 3BHTA 1EGXA 4FTNA 3KCKA 4BGHA 4HVHA 5GINE 2A0CX 4I6BA 3QTQA 2OGVA 3KRJA 4F70A 3RPRA 2ZM3A 4LOQA 2YJSA 1OB3A 5F9EA 4IVBA 4RIXB 4YNEA 5IEVA 2RNRB 2Y0AA 1SVEA 2PZPA 1PXIA 4FR4A 1PMSA 4K2PA 3DQWA 4O82A 2LGCA 4X6RA 2QR8A 4HYSA 5EG3A 2J9MA 5CU4A 5J87A 4BDFA 4GU9A 4I5PA 4V0GA 4AA4A 4FMQA 4AUAA 2YRYA 3HKOA 2DN6A 3OTUA 3O71A 1DS5A 5D9HA 3EN5A 4CLIA 2G35A 2X18A 2Z0QA 5IMXA 4RJ5A 4D0NB 4PQ0A 1U4DA 5DBXA 5GJDA 5JGBA 2CDZA 3R8ZA 4E5AX 3VHEA 4EYMA 4HCVA 3FYJX 5IUHA 5L8LA 1L3RE 2BFYA 2HZ4A 5JZJA 1P3RA 5KQ1A 1KUTA 3MY1A 3OWLA 3MBLA 1P4FA 3GB2A 2ZMCA 5DR9A 3SDJA 4BDJA 5AA9A 4F7JA 3MPXA 5D10A 3E7VA 4Y94A 2QHNA 3F3ZA 3VNTA 4WG5A 5IH4A 1I2HA 2PMIA 3FV8A 5A14A 4K17A 2PL0A 4I4EA 4Y8DA 5FXSA 4ANLA 1DBHA 4H8SA 2XK8A 5BPYA 4PL3A 4DXAB 1S9JA 2OQBA 4J99A 4QMLA 4CKIA 1ZYDA 5CT7A 4G3EA 5E1EA 5ANGA 5H9BA 4Y5QA 4D1XA 5BUEA 5M53A 2Z0OA 4DBBA 3FKOA 2A19B 2YM5A 3W10A 2GTNA 3VS5A 3BGQA 3EQBA 3PJ3A 2O65A 1MIZB 2P3GX 4JX3A 4PWNA 3WILA 2AL6A 3PP0A 5ANKA 4OTHA 4M67A 3NVKI 1Q41A 4BY9E 3I6WA 4O38A 4PPAA 5A3XA 5C4LA 1AD5A 3NAYA 5HG7A 2VKIA 3QZIA 3MA3A 4D4SA 2P55A 2VO0A 4EH9A 5EFXA 1UNPA 2RFNA 3GGFA 3UG1A 4NW5A 4K1BA 5HQ0A 4LFIA 2C5YA 4L67A 1MRYA 2IPXA 2OK1A 3PSBA 4FZFB 2WIHA 4HNFA 3K5UA 3ZUUA 2JDVA 4MK0A 1O6YA 5DLSA 5AUVA 4N70A 3FKNA 3LE6A 5EYDA 1JLUE 5CEOA 3SA0A 1QQGA 2DYLA 4MH7A 3EFKA 1XODA 3BJIA 3R21A 1CTPE 5CT0A 5DH3A 3QQUA 2WMSA 4L68A 4LRJA 4M8TA 3C7QA 2IZUA 4AW0A 4FV4A 1AWEA 2BAJA 4C02A 4PTGA 2XH5A 2WQOA 2ITZA 1JKTA 2W9ZB 4BGQA 4DEHA 3S00A 2ONLC 2DYNA 4LL5A 3WYYA 4DGGA 2BRNA 3KU2A 4ZP5A 1H1PA 4XP3A 1KE9A 4PDYA 2ITNA 4TKSA 3QQFA 4Z16A 2YIWA 4JL9A 3BYOA 5HICA 1NI2A 2BILB 1LW3A 3IDCA 3FHIA 3RAIA 4Y72A 2RVBB 4B0GA 4GK3A 5LCJA 3VW8A 3JVRA 2IN6A 2QOHA 3MWUA 4L6EA 2PUNA 3LQ8A 4HGEA 2GHGA 4C4JA 1GZOA 3RCPA 4JOAA 2ZB0A 4XP2A 2W7XA 5GZ8A 3NUNA 4OUCA 1PF8A 3EN7A 2IW9A 5AAEA 5E9EA 2IWIA 2Y7JA 3FJQE 4FTOA 5ANOA 3AT4A 4F9YA 3FLQA 2C6OA 2X7GA 3V8WA 4IEBA 2YIYA 3AU4A 2PUPA 3P7AA 3NUYA 3DKCA 3UZPA 5BVKA 3R7UA 4E4XA 4FGBA 5IEXA 5TO8A 2XJ0A 5E8YA 4HGSA 1UU7A 2VX3A 1IR3A 4JBOA 4CKJA 5JKGA 2GNLA 2GSFA 3PUPA 1UEFA 3SV0A 2F7XE 2YM8A 2JP2A 5HCYA 3COHA 4C4EA 2UV2A 2CY4A 3DJ7A 3ZZWA 4C3PA 4GIIA 2H7DA 2F4JA 2GNJA 2YCFA 2GHLA 5F1ZA 1M2RA 3FL5A 1AQ1A 1Q8YA 3WZKA 4DGLC 4AGWA 4Z2NA 2DFKA 2LG1A 2Q13A 3TV7A 4UY9A 3MSSA 1Q8UA 3O7LD 5GZ9A 4F6WA 1LEZA 4CZYB 1U27A 2I40A 1F3MC 4LV5A 3I1AA 2OI4X 2RF9A 3E8EA 5AUYA 4M0ZA 2I1KA 3D8EA 5AV1A 5C79A 4RX5A 5HE0A 1R0PA 5JMSA 5EM8A 4DYMA 2REIA 5AP7A 4YP8A 3I6UA 3T9IA 2GTMA 3CIKA 5C16A 3U51A 4AZWA 3MH1A 4E5WA 4O86A 4BCOA 5L2TA 4JAIA 4JIAA 1WBNA 4RGJA 2J0MB 5JZNA 3UYTA 2C4GA 2VWIA 3ZO1A 4GN1A 5LOPB 4BCQA 2VTPA 4OBOA 3Q4TA 4RA4A 3UVRA 3PXYA 4EOQA 1ZZLA 4EK8A 3D4QA 4YBKA 5EKNA 3TXOA 2UZOA 3OWJA 2A2AA 4BF2A 3T8OA 5K5XA 4PMMA 4U45A 3IOKA 4UMQA 2IW8A 3TZ9A 3UO5A 4DEBA 5ITAA 4N57A 5M56A 5IF1A 1JNKA 5AP1A 3ULBA 4YBJA 4NCTA 5EI6A 2XYUA 2BRHA 4CCUA 3FMLA 3KXNA 2P2IA 1XHAA 1ZVRA 2QKWB 4YR8A 3TTJA 3COMA 5DWRA 2ERZE 5HHWA 1OIQA 4R5SA 4QTCA 2BKKA 5EM7A 1RRPB 3VUHA 1WG7A 2OZAB 2UZNA 2VWWA 5AV0A 2X9EA 2QR7A 2VTSA 3DAKA 4GJ3A 4GUEA 4JRVA 5CSWA 3VUIA 4AT5A 1TQIA 2J50A 5CENA 3UNJA 2N23A 4TL0A 5M57A 4HB4B 3QCSA 3CKWA 2OFVA 5BVDA 1XBBA 3RAKA 1SVHA 3MY5A 1BTNA 4I4FA 2IZRA 4GYGA 5JEBA 2RG5A 3FPMA 4NW6A 4G2FA 4J53A 3LCOA 3D94A 4ZLZA 3L8SA 3TNHA 2KCJA 4WUAA 3L8PA 2ITPA 5ETFA 3FLYA 5DI1A 3KF7A 5J5SA 5LJJA 5DIFB 4IZYA 3RAWA 4F1OA 3R02A 5JT2A 4FV9A 3TNPC 3WF7A 3JYAA 4UWYA 4YPDA 4XCUA 4DX90 4KVGB 1TQPA 2BZIB 4KBAA 3FMMA 2DA0A 2JLDA 3D2IA 3ODYX 4L3PA 2X8DA 4DG2E 2W4OA 4EC9A 3D5XA 3GT8A 3HMOA 4YO4A 4EBVA 1MRUA 1O6LA 5AP2A 2E9VA 2IJMA 2R3LA 2CNQA 4GV1A 3Q2JA 5DT3A 4HB2B 5IQFA 4O7SA 5F95A 4J7BA 4C61A 2W96B 5BMMA 3RHKA 4FZ6A 4ZJJA 4Y5HA 1XH8A 3A4PA 3C5IA 4BDDA 2Q0BA 2QNJA 3LM5A 3V8SA 3VQHA 2W06A 3E88A 1OY2A 4P4CA 3LVPA 3TI1A 5L6WL 4MXYA 5GIOE 3WYFB 4FI1A 3C0IA 3V04A 2C68A 3FZTA 3A60A 4I92A 3IVFA 2YIXA 4GUBA 4UZHA 5AX9A 2QU5A 4QTAA 4J95A 2J6MA 4ANSA 2XCHA 4U9AA 5IA4A 4KUJA 2VTOA 4BBEA 4O7LA 2NP8A 2XB7A 3F5PA 1W1GA 3HVCA 5CNNA 3SC1A 1JBPE 1KOAA 3HK0A 4FEVA 2YZAA 4O6EA 1W0XC 3JY9A 4C0AA 4A07A 3BV3A 4FNZA 4RC2A 4XV3A 3W32A 2NRYA 4MXXA 4X21A 3IW7A 2ZV2A 3QD4A 3V5TA 2PU8A 3EJ1A 4FG8A 1WGUA 1OL5A 4L9IA 3V6SA 2ZV8A 4EMOA 2PHKA 4DEDA 4CYIA 4YMJA 5DIAA 1U5EA 2Z02A 5HEZA 2NO3A 3OVVA 4X3JA 2WTIA 2J7TA 2BAKA 2Z8CA 3LXKA 4UEUA 2DKQA 5F94A 3EQFA 4XJ0A 4CXAA 4P7IA 1FAOA 2DX1A 3FC2A 3KRLA 5B0XA 2HY81 5IG1A 4F9AA 4KA3A 3QAME 4LI5A 3ORZA 2UW6A 1OQNA 3HAVA 1OIRA 2BPMA 3BYMA 3UG2A 2K00A 5FG8A 3KXHA 2ROVA 4C7TA 4FEUA 5H3QA 4IMYA 2HXLA 5CALA 1H00A 2QLQA 2V55A 3UIBA 3PP1A 4DH3A 2K2UA 3RPOA 4F6SA 4KKHA 2J0LA 5HG5A 3TZ8A 4UX9A 3KGAA 4TYZA 5EHLA 4MQ2A 3C0HA 1CMKE 2RLOA 1ZY4A 1UNHA 5IUIA 2AEHA 2B9FA 2FVDA 4RX7A 3RZFA 4QD6A 1FGYA 2DQ7X 3IGGA 2ZJWA 2HZNA 3BX5A 5CSHA 3OF0A 4ALVA 4AU8A 4B9DA 4BDKA 4YHFA 1BI7A 3M42A 1MPHA 1P4OA 4GFOA 2ZOQA 4HCTA 3L9MA 5DR2A 1QPJA 4FKVA 2D9XA 3I4BA 3H4JA 4IACA 1ZY5A 3FDNA 1NVSA 2QOOA 1BLXA 3BBTB 3AG9A 4ZJIA 1XH4A 4EQUA 5E8WA 3TZ7A 2J5EA 2XA4A 4IH8A 3D2KA 4O22A 3FLSA 5D3WA 1ZOHA 2GNFA 4MYGA 5CVHA 4K8AA 1YXXA 4GSBA 1SYKA 1UNGA 3SKCA 3W55A 5EDRA 3SV1A 4HAYB 3TWJA 4F7HA 4XLVA 4XBUA 3E8CA 2ZAZA 3KMUA 3UC3A 5FLFA 4YZMA 3AMBA 4KIKA 1VYZA 4WNKA 4R77A 1OKZA 4ERKA 1STCE 3IG7A 4KIQA 1ND4A 2O3PA 2OJGA 2OBJA 3ANRA 4J97A 4BYJA 4FV7A 1SNXA 2C30A 4FKLA 4G3FA 3ROYA 3SYXA 3ALOA 2WTKB 3TT0A 3OD6X 2VTNA 5JLJB 5EYMA 5M08A 3VBWA 4PL4A 4YUQA 4ZZMA 5EM6A 3A98B 4O81A 4MTAA 5CLPA 4PDOA 2QLUA 4FSZA 4HB3B 4DBXA 4WUNA 5BVWA 5I9WA 3DLZA 4AS0A 2HENA 2WZJA 5ANEA 4E8AA 2W05A 1KZGA 2I0VA 3QCQA 2WGJA 4AE6A 3R28A 4C4FA 5C8KA 2MDXA 2QOBA 4IX5A 5AA8A 4ASXA 2VSZA 2A27A 3H9FA 5K9IA 4OLIA 4JBPA 2CGVA 3B2TA 2UZVA 3GUBA 3I0OA 2KUPA 4RIWB 1PXJA 3RINA 2XKEA 3FMKA 3TIYA 4F7NA 4O7NA 2XK3A 5J95A 3OWKA 4NWMA 1J1CA 4XG8A 2YVCA 2YFXA 3LHJA 1J0WA 4L7SA 4CYEA 4HNIA 1ZLTA 3FQEA 3E8NA 4QQCA 3UPXA 4B8LA 5IA0A 2ITVA 4D28A 2MFQA 4PMSA 3ELJA 3A8PA 1X86A 4KIKB 5JFXA 4ITHA 4LM5A 3IPHA 3NS9A 4HHVA 3HV5A 3MIAA 3UJGA 1X05A 2VTIA 3PZEA 3F7ZA 3EHAA 3NCZA 4JLCA 3ZEPA 3PP2A 4C35A 1X1GA 3BLRA 2E9UA 5HLWA 1E5WA 4LMNA 5HVJA 4EYJA 2GNGA 2QHMA 3RWQA 2VGPA 4YLLA 4HCUA 4GKIA 4YHJA 4GT4A 3MV5A 3FMDA 4Z7GA 3U4WA 3QL8A 4BI2A 1PMNA 2WTKC 4IAIA 4QP1A 4PF4A 3NSZA 4A5KA 4QPMA 4BC6A 3PA4A 5EI2A 5CAVA 3E93A 2YCSA 3PE1A 5L3AA 3G0EA 3TUDA 2GS0A 3GOPA 2QG7A 2BIYA 4DTKA 1JPAA 3I79A 4FV6A 3WF8A 5J3TA 3PEGA 2PVJA 5CY3A 4W8DA 1W83A 2QOQA 1VR2A 3DCVA 1W1HA 2C3JA 5BUIA 3N4UA 2YAAA 2UVYA 3E87A 3LAUA 3NYXA 4RWIA 3PPKA 1I44A 5CQUA 2HWOA 4JT3A 2DTCA 3BE2A 2LKOA 3LMGA 2X39A 4M14A 5CAQA 3H0YA 4IB3A 5CS6A 5K5NA 4EOJA 3DTCA 4EUTA 2V76A 3EZRA 3R22A 4IM2A 5FXQA 3A7JA 5FBOA 3OXIA 1OKWA 4HAVB 1YHSA 2JAMA 2PUUA 2B7AA 3ZMMA 2QO2A 1UNQA 2ZV9A 4RVMA 4D2VA 4CGAA 3NDMA 2XIKA 2D9YA 2R3HA 2R7BA 3EQHA 4BCFA 3A8QA 5EDPA 3C50A 3E63A 4QTBA 4XWXA 2W1DA 3CY2A 3NNXA 3LQ5A 3PVBA 5JHHA 3HDNA 4K6ZA 2Q83A 3VBYA 1IASA 3Q5ZA 3SLSA 4YC8A 3HUCA 5M09A 3D8DA 5IH6A 3FMHA 4PUZA 3JVSA 4C57A 3Q96A 4IJPA 5IISA 3KA0A 3OXTA 2W1CA 4NH1A 3NUAA 4AACA 4PP7A 4EH5A 5H8EA 4RRVA 4CT2A 5AUXA 3E7OA 3PE2A 3ZYAA 4GVJA 4E6AA 5HTBA 5IEYA 5CZHA 4E3CA 4FICA 5EK7A 3RCDA 4EONA 5EQPA 4O2PA 5M06A 3P0MA 3DBDA 5KMJA 1H07A 3OOGA 1ZOGA 5HNGA 2O64A 4BIEA 3AC4A 1YDRE 3MVHA 3QFVA 4YZBA 3IQ7A 4EL9A 2PYWA 2Y8OA 4BI0A 2UZTA 2JC6A 3EFWA 4IFCA 3TNWA 3TW1A 3PG3A 3GCPA 4ANOA 4BHZA 4ZTNA 4MX9A 3TKIA 2PVHA 3QQHA 1SHCA 4UXQA 2CN5A 3MFUA 4PDPA 4PTEA 4IW0A 1IRSA 2J2IB 5HBEA 1DROA 2GCDA 2VO6A 1KOBA 4Y83A 3UOJA 2YS5A 2PPQA 1MRVA 3NW5A 4DHFA 5HCZA 2YLFA 4ALUA 5AMNA 2CN8A 4L44A 5E8ZA 4BBFA 3PVLA 4NTSA 4QOXA 3OANA 4RQVA 2CCHA 4GMVA 5IA1A 1ZM0A 5EHOA 4QMOA 2CHLA 4ZRIA 4DH7A 4MWHA 5K4IA 2FSOX 2JAVA 4AAAA 3BHYA 3SGCA 4FV0A 4EOOA 2UW0A 3BCEA 3OY1A 4HPUE 3G9WA 1K3AA 1HCKA 2OXXA 3AC1A 4DFZE 5J1VA 4IM3A 3AOXA 4K9YA 3SG8A 1QL6A 2BDFA 2YLEA 4WBBB 3MW1A 5LWMA 2EU9A 3LM0A 1FMKA 2OIQA 2W1ZA 4L46A 5DA3A 2QD9A 2W2WA 3FUPA 3GU8A 4MD9E 2GQRA 3HRCA 3N4TA 2ITQA 4USFA 4G34A 3KULB 3C4ZA 1NXKA 1XBCA 2KTYA 5KMKA 3LZBA 4IOYX 4ITJA 3F6XA 3QCYA 4OTQA 3FHRA 2UW5A 4FTIA 4UV0A 3GU5A 2OZOA 4NJDA 2XIXA 3ZC6A 3S0OA 4R6VA 5KZ0A 3KK8A 5HTCA 1GZNA 5LMKC 2VTRA 4FKRA 1EF1A 1TXDA 3PVUA 4AT3A 4G6OA 3MGYA 4YNOA 4F63A 5JGDA 2JIUA 4AE9A 3PSDA 1YOJA 5HZNA 3F5UA 4HVGA 2FYSA 4ZY5A 1PXKA 4IWOA 3NWWA 3NYOA 2X2KA 3A7FA 4WOVA 5H2UA 4EH3A 1OIUA 3BYVA 3HMPA 3VUTA 1OGUA 4BCGA 2PTKA 4DLIA 3LFQA 1OL2A 2G9XA 2Y6MA 4O2ZA 3H10A 2VTTA 3BELA 5DVRA 3HAMA 1BTKA 5KO1A 1U5RA 5GJGA 3AXWA 4BZNA 3MFSA 3BU3A 4C2WA 4CMUA 5AEPA 3SW7A 3TO1A 3M1SA 4DGMA 5GOWB 3P79A 3EL8A 3BEAA 3SXSA 1YI6A 3MIYA 4O7ZA 4DF3A 1PLSA 3AC2A 2F9GA 3ZONA 5A9UA 2WHBA 1U5GA 4C4IA 4TNDA 3LXPA 5BNJA 4DEIA 4R78A 3FAAA 4DTAA 2OJ9A 1WBVA 4IM0A 4U80A 5AAFA 4KHAA 3H30A 1YW2A 4DGNA 3RM7A 4EKLA 3HA8A 2YHVA 4ANMA 2DS1A 2C5XA 4O84A 4O21A 4PNKA 3GNIB 2OJFE 3KRWA 4EOKA 4KKEA 5ETAA 2YN8A 3ATSA 3ZLXA 4IAAA 2W5BA 1FBNA 3DS6A 4EOIA 3O51A 1OL6A 1OM1A 4S32A 3UIMA 5AUTA 3SRVB 5B2LA 1PYXA 2O5KA 3Q9WA 2DHIA 4ANNA 3FLNC 4M69A 3OCBA 4NFMA 5EW8A 4QYEA 3U55A 1M52A 3WE8A 2QKRA 4YTCA 3D5WA 1VZOA 2HK5A 3TV6A 4MD7E 5DI9B 2XMYA 3TTIA 2B54A 2EXCX 3P08A 3QF9A 4FT3A 1IEPA 4PTCA 4U42A 4W4XA 5E8UA 4ANBA 4KAXB 1RJ2A 1TQMA 2R4BA 3EN4A 4RA5A 3SVVA 3IDPA 3WZDA 4Q9ZA 5HESA 3CE3A 2VRWB 5ICPA 2R3JA 4O7RA 1CKPA 5C8MA 2BZJA 3ORKA 5BUJA 3P86A 3MB6A 4XV2A 2F7EE 4N0SA 4N4SA 4W9XA 5AX3A 4PRJA 5JRQA 4NL0A 1GIHA 4P90A 3K2LA 4IWQA 1YOLA 4EEVA 5C26A 3KSYA 5BYYA 4RQKA 2OWBA 3LCSA 3NAXA 4G9CA 5IQBA 4EKKA 3R01A 1MQ4A 2XS0A 3S2PA 3QRTA 4HOKA 2WEVA 4Z3VA 2CLQA 4ZJVA 5KQ4A 2OSCA 4F9WA 1Z9XA 1GOLA 4OW8A 3EN6A 4PQNA 4DG0E 4BFMA 3R83A 2CSNA 3WBLA 5FI1A 3A61A 3RZBA 5TKDA 4TNBA 3AMAA 3OROA 4XLIA 3UO4A 4JS8A 4DFNA 3ZXTA 2W1EA 4FV5A 3PY1A 4CTBA 4E6CA 4O7WA 3PXRA 3WI6A 2IVVA 2X7OA 4ZMEA 4X2FA 3CQEA 3MPMA 4FKOA 4EJNA 4UMUA 3F66A 4YTFA 3R7IA 2DHJA 1UWJA 3FI4A 5I9YA 1BWNA 5DOSA 4BN1A 3MVLA 4Z9LA 2OFUA 1H08A 2H96A 2J4ZA 3D5UA 4MNEA 4E93A 3LKMA 2WO6A 4PNIA 4FK6A 4RX9A 1URCA 2VGOA 4QMQA 2XK4A 3QRIA 4TYGA 5AM7A 4C62A 2BUJA 2R3NA 3CGOA 2X81A 4J1RA 2JDTA 1IAHA 4ZSGA 1YHWA 3GCUA 4FSRA 2UZSA 3QIJA 3CTQA 3RPVA 3QTIA 4PP9A 3MESA 4FIJA 3CBLA 3AT3A 2QKMA 3ZLWA 4G16A 2I5CA 3G5DA 2UW7A 4FUXA 3DKOA 4QMUA 4IAYA 3KXMA 2DKPA 3NUUA 2YM7A 3QTUA 4GS6A 4X0MA 2GCLA 4CFFA 4KHBB 2EXMA 5D27A 5LVNA 3ZM9A 2ZDTA 3TKHA 1IG1A 2FSLX 3IW5A 3PVWA 4XRLA 3KQ7A 1OPKA 3I0QA 1W7HA 3NPCA 3V5PA 4R7HA 3R7EA 2ZM1A 3DAEA 4Q5EA 1OZ1A 2LULA 4D0WA 1PYEA 1KE8A 5JK3A 3JUHA 4JX7A 5C27A 2VZ6A 3Q04A 4O0UA 4U79A 3GP0A 3U9CA 3F88A 3ANQA 4ZIMA 4G3DA 2QOLA 4CZTA 2Z0PA 1JSTA 5FTQA 1DDWA 3AC8A 2XK9A 2YACA 2YISA 1JOWB 5KMLA 5KX8A 3VS3A 2VX0A 4FTMA 4MVFA 3W16A 2DX5A 3DB8A 4FV1A 1NU2A 3PZHA 4KINA 4WD5A 4ITIA 3GQIA 4JDIA 5I9UA 3NLBA 4M97A 3I5NA 5CEIA 3QBVB 3QUEA 1H27A 4D2RA 4IFSA 2QODA 3F3UA 2GS6A 3HV6A 5DRDA 4HAZB 5CF8A 4J98A 4EK6A 1BYGA 4FTAA 1NVQA 2XJ2A 2XM9A 5DHJA 4QNAA 2DUVA 2YEXA 5ANJA 1MK9B 3EMGA 2W1IA 3OY3A 1ZAOA 3W8LA 4QMMA 2R64A 1I09A 3FSKA 4JQ8A 3OOMA 2W2XC 3BPRA 2R0IA 4U0IA 1FGZA 3A99A 3G6HA 5A54A 1BUHA 2CJMA 3KXZA 2YWPA 4LMUA 3TFMA 2EMTA 3P4KA 2OXYA 2WIPA 3M1IB 2HAKA 4IBMA 2WMAA 3QC4A 4QYGA 4A9UA 4DGOA 4H3QA 4ZS4A 3R30A 4MXZA 3G0FA 5J1WA 4LOPA 4AX8A 2I5FA 3AQVA 3NZ0A 4R1YA 3F2RA 4ERWA 2FA2A 3PRFA 3UO6A 4HJOA 2UZUE 4G1WA 4NSWA 4N6ZA 2W9FB 4BTMA 3MI9A 4MCVA 1APME 4DFUA 3OCSA 2BR1A 2XNEA 5CX9A 3NNWA 2BIKB 3NNUA 4FKTA 4GEOA 3DBCA 4XUFA 4EHZA 2C6LA 2QONA 4C0TA 4EH4A 5HU9A 1GY3A 3NGAA 5J7BA 4JR7A 2GHMA 4PPBA 3VS1A 5C9CA 5M51A 3ORXA 4MXAA 2P0FA 3IK3A 2BVAA 2X6EA 4J52A 3UVPA 2PVYA 3ENHA 2FJLA 4L52A 2B9HA 5HIBA 5EW3A 2E2XA 2VUWA 3BV2A 4MAOA 5ACKA 2P0HA 2CKQA 4ZTMA 2WNTA 2PZ1A 4YJQA 3CXBB 3EB0A 4ONAA 3SAYA 3Q9XA 2ADZA 2KULA 3DBQA 4YO6A 3F7WA 1R1WA 3MPAA 1H1WA 4FSQA 5AR2A 2CAYA 4MY6A 2A1AB 2UZDA 4E26A 3DXQA 4EH6A 4FVQA 4WBOA 3TG1A 5K3YA 4RWJA 2PZ5A 1W84A 5IQCA 4U43A 4FV3A 5CU6A 1NT2A 5HO6A 2PVNA 4UZDA 4DEAA 4BCPA 4YLKA 4H39A 3DDQA 2YITA 4A7CA 4G6LA 3DLSA 2X9FA 4NYEA 4MEDA 3OCTA 5G6VA 3EKNA 1DM2A 3EYGA 3WE4A 4R5YA 5LOHA 1P2AA 3U6HA 3KN5A 3HQCA 5HTIA 2CCIA 2IO6A 2YABA 4KSPA 4Q5HA 2WQEA 4C36A 1BAKA 1H0VA 3BU5A 3CPCA 4RJ8A 2WU6A 5CXHA 4DLJA 4EOSA 3LQ3A 4I23A 2MWNB 2V0DA 4O7YA 4EH8A 4CYJA 3QGWA 3EWHA 4HZSA 4B99A 4M3QA 2Z2WA 2BROA 3QZHA 5FM2A 2OLCA 3C4CA 5E91A 2OG8A 3ZRKA 4NKSA 4CTCA 4CMTA 1V5MA 4E6DA 3KVWA 3Q4CA 3EZVA 2XUUA 1R0EA 3LFDA 5DN3A 3CJGA 3TIZA 4U81A 4D4RA 2PMNX 3NRMA 3PVGA 4LQMA 4L3JA 1URWA 4CFMA 3UP2A 2YIQA 3UOLA 5IQEA 3TUCA 3R73A 4A6FB 2RFEA 4FNYA 2BALA 2W5HA 3PYYA 4FZAB 5DFPA 1FQ1B 3F5GA 3HECA 1BL6A 5BQ0A 5C1QB 5KKRB 4BZDA 3TDWA 2OF4A 4RC4A 5FTOA 4WHZA 1Q8ZA 3ZM4A 4HAWB 3QWKA 2J90A 1REJA 2QOCA 3ACKA 4TW9A 2R3KA 3ZU7A 4GG7A 4E73A 4L53A 1QPDA 1YI4A 3RP9A 1ZC4B 4RPVA 4CG8A 1ZMUA 2R0UA 4NIFA 3D83A 3HRFA 4EHVA 5IKWA 5EYKA 3TDVA 1Q24A 5HE2A 3WZJA 5AUZA 1IRKA 2J0JA 4U3ZA 5EDQA 3HW2B 4WA9A 2WMRA 1U5DA 4BKZA 2ELBA 1Z57A 2O8YA 3CC6A 3SHEA 4L7FA 1LUFA 4MKCA 3SXFA 2YS3A 2CNUA 2PULA 2EB2A 2QOKA 4FSTA 5BYZA 3F61A 5M4FA 1TJ6A 3HYHA 3L8XA 3Q5IA 4FYOA 5IQDA 5IDNA 3LW0A 4G17A 3UC4A 2SRCA 1WCCA 2P33A 4FT5A 3RI1A 1UVRA 5J9YA 2N0YA 3R2YA 5IUGA 3VBQA 2XZSA 3W2QA 3RPSA 3E3PA 3Q6WA 2Z7LA 3P7ZA 4AOJA 3U4UA 3DY7A 3QRUA 5KHXA 3H0ZA 2Y4IB 2R3GA 3LIJA 4FOBA 3D7TB 4ZLYA 5CNOA 4CV9A 2EB3A 5CEKA 4FE2A 2XNMA 2ZM4A 3MYGA 3EQGA 5DG5A 4FIIA 5AR5A 4E4NA 4JJRA 3OG7A 5JH6A 3QX4A 4XYFA 4CZUA 2BZKB 5AUWA 4YL8A 4NM7A 2X7FA 3DXNA 1X8BA 3AC5A 3MH2A 4RZWA 1P6SA 4AW1A 3KK9A 2R3FA 3ULCA 3ETAA 1H01A 3DJ6A 4DTBA 5KBRA 5CAUA 3NSUA 1GJOA 4NM3A 2VV9A 1TVOA 1UNLA 4A4XA 3P6AA 5D3XA 3HEGA 3KVXA 3FSSA 3R1QA 4Z2MB 2P0CA 3EYHA 2HE7A 4YSMA 4JBQA 3PJ2A 1H1RA 4DH5A 4RVLA 5KUPA 4FTCA 3O8PA 4XH6A 4QQTA 2VTLA 4MT7A 4BCIA 3GU6A 4QMYA 4RJ3A 4CNHA 1FOEA 2CRFA 4K81A 3U8ZA 3P1AA 3C4XA 2C0IA 4FV8A 1WBWA 2WPAA 1FOTA 3FLZA 2PWLA 2XEZA 3Q52A 2Q0NA 4FSNA 5FEEA 3GOKA 3RJCA 3ZFXA 2ITWA 4DEGA 5J3YA 4ZTLA 4EHEA 2BAQA 1OECA 5AV4A 5D7AA 5KE0A 4BCJA 3SW4A 4D4YA 3ZRLA 4CHMA 1XH5A 2CGUA 4WJ7A 4GFMA 4BKYA 4XBRA 3ZCLA 3R71A 4DH8A 4GZUA 4DFBA 5CVFA 4U3YA 4LYNA 4FKQA 3ZFYA 3FEGA 4HYHA 5I9ZA 5L2WA 3LLAA 5LVLA 5I9VA 2X4ZA 3PG1A 3ZRMA 1KE7A 3PIZA 4BL1A 3DT1A 1TKIA 1B55A 5I4NA 3I7BA 1UU9A 2RG6A 2WAJA 5AP5A 4EZ5A 4PMPA 4Q2AA 4S33A 4TYJA 5EOLA 4AZSA 5BVEA 4C34A 2OKRA 4U8ZA 5FRIA 4FEQA 1H8FA 1GNGA 2I1MA 4QP2A 1PXNA 2ZYBA 4WG3A 4O0YA 4NIFB 4YSJA 4QNYA 3KY2A 4YJPA 2IZSA 2OIBA 4BI1A 5M55A 2WXVA 1WMKA 4QYYA 3FWQA 3Q3BA
chains in the Genus database with same CATH superfamily
3KULA 3UPZA 3SOAA 3QLGA 3WF9A 1TQZA 2XKCA 3G6GA 4NJ3A 4O27B 5L6PA 2EWAA 4EH2A 4I0TA 2V5QA 4LUDA 1H0WA 4EI4A 3GI3A 5HO7A 3DQXA 2UVMA 4HAXB 4XX9A 3MA6A 1YWRA 4FSYA 4FTTA 4KSQA 3WIKA 5HNIX 1AQCA 5AP6A 4JR3A 1QMZA 3BI6A 4WG4A 3GXLA 1FGIA 4RLLA 4G3GA 1FHXA 4CRSA 1P5TA 4WNMA 1Q99A 5CF4A 4IB5A 2VTHA 4QQ5A 3T06A 2QQ7A 1BMKA 3DKFA 3DGKA 4AW5A 3UTOA 2PSQA 3ORIA 1PXOA 3NUPA 4TT7A 1WJMA 4D5KA 2NMBA 2UVZA 4V04A 4FBXA 4TY1A 4XG2A 4C4HA 3LMHA 3SXRA 4KIOA 2UW3A 5A46A 2XYNA 4BICA 4E5BA 1V5PA 5C6RA 5D3VA 4GK4A 2W0JA 4FC0A 4FL1A 4LOOA 4DEEA 1E1VA 4YZDA 2C0OA 2KIEA 3ZFMA 4W4WA 3LFSA 4GFGA 4R8QA 3FI2A 4NM0A 5FDXA 1DYNA 2PE0A 3II5A 4ZOGA 3GC9A 3QKLA 2D4QA 4AXCA 4CFUA 3MFTA 5D11A 3V3VA 3VBTA 4UN0C 1YRPA 4KWPA 4GG5A 5HD4A 4QMWA 2YWVA 3LXNA 4FSUA 2XRWA 3V01A 3C13A 5GJFA 5HIEA 2LOZA 2WQNA 2C1BA 4MNEB 5JQ5A 1OUYA 4AZFA 1ZYLA 2CMWA 1M2PA 4QDVA 4ACHA 2D9VA 2Z59A 2OXDA 2IEWA 3D5VA 2VD5A 5L81A 4BDGA 1GIJA 4OTRA 3NUSA 5DRBA 5KMOA 2RUKB 1IAJA 3HMMA 4GH2A 2R3QA 5HX8A 3DTWA 5BX0A 4E6QA 4IVAA 1YDSE 4AXDA 1JWHA 2Z7QA 1JKKA 2ITXA 1SVGA 3RALA 4QXAB 1M7NA 3N51A 3T9TA 1OUKA 2GU8A 3PWDA 3O7LB 2E2BA 2IG7A 4FEXA 3R2BA 2YS1A 3FSFA 3QA8A 3GQLA 4QYFA 4JG7A 4W8EA 1REKA 3NW6A 3ZUTA 4A9SA 4EOPA 3TACA 1GAGA 2R3IA 3WA0A 1HOWA 4QPAA 4IIRA 3IKAA 4LL0A 3V5WA 2YCRA 3CCNA 4BTFA 5BMSA 3FMJA 2XIZA 4A9RA 2C5VA 2JD5A 1OKYA 2G2HA 2XP2A 4P5ZA 2PVRA 4ANQA 2IVSA 1PMEA 2DYQA 5ANIA 2AYPA 3HP2A 2X8IA 4MBLA 2I7QA 2WU7A 2FJUB 3HMNA 5AM6A 3OFMA 3OEFX 4YZ9A 5T68A 5IQIA 2E9OA 3FMNA 2YF0A 2IVTA 5BVOA 2G15A 5D12A 4RFZA 3Q4UA 4GPTB 2UVXA 3K54A 4OTPA 2WTCA 5IA5A 3U87A 4QO9A 4QQJA 3VS7A 1X11A 4D2WA 4YJVA 3IS5A 2PVLA 4WRGA 1M7RA 2WQMA 4S2ZA 3V8TA 4EJ7A 4UALA 4ACGA 1G8AA 3P23A 4ACDA 1OITA 1YXUA 4FT9A 3FC1X 2VWVA 3U7DA 3LFAA 4TWCA 1MIXA 4IFGA 3QYWA 4KBKA 2IW6A 5HE3A 5K0KA 3AGMA 3BINA 5C01A 1PHKA 3ZOSA 5DT0A 3R0TA 1CKJA 4S34A 2D9ZA 5TT7A 5J8IA 3I7CA 1PXMA 4M12A 5IZFA 4N6YA 2LAVA 3LFEA 4BDEA 4GT3A 3VS6A 4CMOA 1R78A 4HYUA 3IW8A 3U12A 5LVOA 3ULZA 2BHEA 4R1VA 4K2OA 3WYXA 5KKRC 4X3FA 2Y8FA 3Q6UA 4CKRA 3F69A 5FGKA 1N3HA 1DAWA 2YJRA 4FTRA 4ZTQA 2I0EA 4M13A 4RLKA 4YJUA 5HVYA 3FI3A 4IX3A 4K0YA 5CSVA 5CASA 5HLNA 5JHGA 3GU7A 3O50A 5I3RA 2FB8A 2QO9A 1PJKA 2XBAA 2PVKA 2WTWA 3OC1A 3PFQA 1JQHA 3GCSA 3F0WA 1DDMA 5F4NA 4AN2A 3QZGA 4FIFA 3U6JA 4DFXE 3QRJA 4GYIA 5FDPA 5FUTA 5CAPA 4IX6A 5FEQA 2VU3A 3N9XA 2C0TA 3BZ3A 4P5QA 4IWPA 5M4IA 4AZVA 2VTMA 5E92A 2KR0A 1B38A 2GMXA 4TXCA 1BL7A 5HO8A 3TV4A 4BDHA 2PE2A 4J8MA 2C5OA 3ERKA 3AU5A 4H3PA 5FQDC 5K0XA 3OBGA 1NY3A 2WB8A 4EHGA 3FQHA 1OVEA 1UV5A 2YM4A 4YJSA 1XH9A 2XKFA 1UA2A 3A7GA 4CEGA 3R04A 1Y5OA 4IAFA 1SM2A 4I6FA 3PXFA 5EFQA 4AQCA 2Z13A 2I6LA 5E8SA 3IDBA 2XALA 4I0SA 4O0TA 3UNZA 5GZAA 3R63A 2G2IA 3QTZA 4XV9A 4O7VA 3Q9YA 4EQMA 2F57A 2RL5A 3NFGB 4DX8A 5AJQA 1UKHA 3VBVA 3W2RA 3CS9A 5HCXA 1FHOA 1U46A 5L2QA 4QMSA 2GQSA 3CD3A 3JPVA 1BKXA 2V62A 2WD1A 3EQRA 3VAPA 4AT4A 5ETCA 3ZEWA 5LXMA 5M4UA 2C69A 2FSTX 2QG5A 4OTFA 1RE8A 1YHVA 2GFCA 2WOTA 1IA8A 2AQXA 2BDJA 3C5UA 1YWNA 5CU2A 5HD7A 3ZTXA 4FA2A 4YURA 2COAA 3F5RA 2J5FA 4XG3A 4XMOA 1R39A 3BKBA 4YLJA 3EN9A 3NYVA 3UIXA 5HKMA 2CLXA 2WMUA 1B6CB 2YM6A 3C4FA 4I1ZA 2W1GA 5T6KA 4AGCA 1OBDA 4BBMA 4KBCA 4O1OA 2RSGA 4QTDA 3FZPA 5CI6A 2IVUA 4CVAA 4I6LA 3T3VA 2CKPA 3UBDA 3RTPA 4FYNA 3FZ1A 3PSCA 5M4CA 3EL7A 1O9UA 3GEQA 3JS2A 1J19A 3DK7A 4RJ7A 1EAZA 2PVFA 5LONB 4XOZA 4IDTA 4IB1A 5AV2A 3W2CA 3MS9A 5BVNA 3DBEA 2BFXA 2RFDA 4QMPA 3SX9A 5FD2A 3OW3A 3TEIA 4JDJA 1Q3DA 4B6LA 2RGNB 2BTSA 3AD4A 4AP7A 5CU0A 4D2PA 4FUYA 2VNYA 2AC3A 3UQFA 4FODA 4E4MA 3LCKA 5AWMA 2PY3A 2JIVA 4XS2A 3R8VA 1Q62A 3U6IA 3AJ4A 2VTAA 1FGKA 5JGAA 3FXXA 2CKEA 3DPKA 4MXCA 1NVRA 4OSNA 4C59A 2D9WA 3QWJA 3TJDA 2YDKA 4PL5A 3MFRA 1FMOE 5A4QA 1BI8A 5LVPA 4BCKA 2WTVA 2Y4PA 5LQFA 4FOCA 5IQGA 3Q2MA 4MBJA 2RIOA 3W0PA 2QURA 4U5JA 5HE1A 4JDKA 3TKUA 3VQUA 4TYIA 4RVKA 2BRGA 3MTFA 2B9JA 4F1MA 3H9RA 4IZAA 4JVGA 5D1JA 3D14A 4C58A 1UPRA 4LV7A 4YONA 4YZCA 3NWDA 1ZYJA 3OTVA 4APCA 2D11A 4A9TA 1V89A 3ZBFA 1K5DB 2JKQA 4WNOA 4E7WA 4I5MA 2JKKA 4U40A 2YSZA 3IECA 3UOHA 5EKOA 1ISNA 2DHKA 3AKJA 2YDIA 1QCFA 3RNYA 3QX2A 3OT8A 1J7LA 4MNFA 1H24A 2E9PA 2GPHA 5TF9A 1WVXA 4PPCA 5HVKA 5I0BA 1OPJA 3G90X 2WMTA 3DOGA 4IVCA 1H1QA 3P5KA 4X6QC 4KS8A 3FZRA 3K3IA 3NUXA 4MQ1A 3VF8A 3VS4A 1K9AA 2Y8GA 3D8FA 1LR4A 4TYEA 3RK9A 4RIWA 4JNWA 3REPA 3DA6A 3G51A 3VO3A 4O0VA 5DMZA 2W4KA 3QA0A 1YXSA 3OS3A 3BIZA 4F08A 3A4OX 3ZHPC 4FGRA 3BQCA 1H1SA 5IH5A 2B4SB 1GC7A 1V0OA 2ONLA 4A06A 3LPBA 3F9NA 3KXGA 5CLLB 4ZY6A 3COKA 3EKKA 2GCJA 4NUSA 2P2HA 4A6HA 4WRSA 2E9NA 3A58A 4R3PA 4B7TA 4FKGA 5AR3A 4HVDA 4EZ3A 2JGZA 3WF6A 4FKUA 3JY0A 3ZDUA 1J1BA 1M7EA 5IU2A 3QUDA 4U6RA 4DH1A 3BE9A 2YT0A 4R7BA 5JFSA 1V0BA 4FKPA 4H36A 2XNGA 5A4CA 2M38A 4ENYA 1GIIA 4KD1A 3M11A 4ZSLA 5I9XA 3QKKA 3UOKA 1Y8YA 4G5PA 5EQEA 3QRKA 4ORKA 4LGGA 2OU7A 1CM8A 2ZDUA 1KZ7A 4TYHB 1M2QA 3GENA 4KRDA 2VAGA 4RIOA 4U44A 3QU0A 5K4JA 1RW8A 1G3NA 4TWNA 3ROCA 4FIHA 3HZTA 1H28A 3ENMA 3SQQA 1V1KA 4LRKA 2HY0A 4G3CA 4EORA 4Y73A 3LJ0A 4JG8A 2XNOA 2XANA 1PKGA 2WTDA 4Z7HA 5JN2A 3EQIA 5L6OA 1VYWA 4NKAA 1JKSA 4F64A 5CEMA 4A4OA 2ITTA 1ZWSA 3EQPA 4R3RA 1DAYA 3FYKX 3HX4A 5A4TA 5LMKA 2QO7A 4M15A 2Y4IC 2G2FA 1JVPP 4B8MA 2PMOX 5CYIA 5HOAA 3MJ1A 3AKKA 4AF3A 3BLAA 3QTSA 4L42A 4BJJB 4I24A 1RJBA 4WNPA 3ZDTA 2WELA 5CZIA 4ZSEA 5EHYA 3GVUA 4GU6A 3QQLA 4DC2A 4HGLA 1MK7B 3QTXA 1Y57A 3ORPA 4K77A 1WGQA 3ZLYA 2OICA 1H4RA 4OTGA 3R1SA 4LGHA 1EVHA 3BBWA 5LMBA 1KSWA 5CF6A 2NPQA 1XMMA 3RGFA 1PY5A 2Z60A 1MKEA 4PX6A 2C6KA 1ZOEA 4C4GA 4O83A 1ZYCA 3R9HA 4BVUA 5KHWA 1H26A 5HORA 2ITYA 4CRLA 2RSVA 3P7BA 3OUNB 5LWNA 3QZFA 4M0YA 4RC3A 4D5HA 4QPSA 4HYIA 5EOBA 4HZRA 3E5AA 4L43A 4O4CA 3TZMA 5JP4A 4QMTA 3LFNA 2WMQA 3R9NA 3W2OA 2X2LA 5KMMA 4EK3A 4I3ZA 5KBQA 5CTPA 2C3LA 3F3VA 4RFYA 3PY3A 4RG0A 4YTIA 4AGDA 3UGCA 4NZWB 3RPYA 3R8UA 1YOMA 5D3YA 3E3BX 4MWIA 3ZC5A 5JFWA 4OT1A 2HIWA 5JRSA 4ZTHA 2OJJA 3VOQA 3C9WA 2X0GA 4JQEA 4AW2A 4ARKA 2WMXA 3PXKA 4J96A 1G8SA 3UDZA 4DAWA 2PZIA 4M84A 2IF8A 3O8UA 4BBKA 4AOIA 5IQHA 1R3CA 3B8RA 4RFMA 1AGWA 2JDRA 3GC8A 3MY0A 4ZMFA 2PE1A 2XBJA 4AWIA 4CQGA 2O63A 4II5A 4ZXTA 1Y6BA 5AR7A 2YT1A 5G1XA 2R3OA 1E9HA 2GS2A 4NU1A 4X2KA 3GYOA 2B0QA 4AXEA 3NX8A 1DI9A 3IOPA 3V51A 3CD8A 4OAVB 4AG8A 3ML1A 4O4EA 3RAHA 3G9NA 4DG3E 5HX6A 3AGLA 3PJ1A 3O2MA 4LRMA 3M2WA 3IW6A 3QCXA 4RWLA 4BZOA 2P8VA 4CG9A 3ZUVA 5IA2A 5JFVA 4F1TA 2F2UA 2AC5A 3Q9ZA 3QBNA 4L6QA 2HW6A 5CXZA 2D10A 2BZHB 4HATB 5J3QA 1B39A 1FVTA 4I6HA 3P5JC 3H3CA 3LCTA 3TN8A 1ZRZA 4TYHA 4DE4A 3G15A 3DXEA 4I41A 1WBSA 2EVAA 2Y9QA 3H9OA 4G31A 5C03A 4BDBA 3SO6A 5GIPE 2COFA 4WO5A 2X4FA 1Z87A 2A4LA 1UKIA 1TFFA 4I22A 1W82A 2Y7BA 1MUOA 4CSVA 3VRZA 4UYAA 2M14A 4KHOA 2UZLA 3BGPA 2ETKA 3I81A 4BTJA 4D1ZA 3V6RA 1SZMA 1XO2B 2VX1A 2ZVAA 4IXPA 4F7LA 2G1TA 5J5TA 1MAIA 1UNRA 1ZMVA 3R6XA 3PXZA 1UWHA 3VUMA 4F09A 1MP8A 1Q61A 4WSQA 3CQWA 3F3WA 4BIBA 4FKJA 3EIDA 1ZSQA 3FY0A 3OWPA 2F49A 4JBVA 4D58A 4HAUB 2JDOA 4TRLA 3UVQA 3DK3A 5M4YB 4FX3A 4OTWA 1K2PA 3LFBA 4NT4A 5LVMA 4GVAA 4W4YA 4BCNA 2VWBA 3UZTA 3ZVRA 1NW1A 1PRYA 2C3IB 4D2SA 4QT1A 4F7SA 5B2MA 3VWAA 2W5AA 3ZSIA 4XEYA 1PXPA 4ACCA 5AFVA 3LJ1A 1M14A 2NRUA 4IDVA 2QVSE 4UWBA 1GZKA 3HLLA 4YC6A 4B4LA 4GCJA 3ZO3A 3DBFA 3KMMA 1ATPE 4DITA 1WAKA 2J59M 2NNWB 4EBWA 4ZZOA 3BWJA 4GMYA 4FKSA 4XG9A 1E1XA 3BLHA 3QUPA 4J71A 3BWFA 3VUKA 3PZDA 4H05A 1PMVA 1Y91A 4CFWA 4F99A 3N7CA 4PMTA 2H9VA 4KRCA 5AR4A 4P2KA 5LMAA 4JI9A 5IMEA 2B53A 5L2IA 3LXLA 1PFJA 3F3TA 2XK7A 3DAJA 2QOFA 3I60A 3QTWA 2R3RA 4FG9A 1ERKA 2X1NA 4E20A 4GL9A 2Z7SA 3UYSA 1XR0B 2JEDA 2RFSA 1OBGA 4K33A 4IADA 3W2SA 2UZEA 1A06A 4O0RA 1YDTE 4RSSA 4YJOA 3SOCA 3VUDA 5EM5A 3ZO4A 4E4LA 3OP5A 2XJ1A 3MTLA 3RK5A 2F2CB 4ZTRA 1W2DA 4IAZA 3RBWA 4FT7A 2OIDA 3BEGA 4Y46A 2OO8X 3HUBA 4NSTA 3QD3A 3PTGA 2P0DA 3VULA 5DPVA 4A9YA 4NEUA 4GT5A 1FPUA 4I0RA 5HNBA 5TR6A 3TUBA 3Q32A 2PZRA 5E1SA 3C1XA 3EQCA 3FY2A 5IQAA 2UUEA 3MH0A 3RMFA 3W1FA 4BR3A 2BRMA 3FZSA 5DYJA 3RK7A 4FIEA 4IAKA 4RIXA 4BIDA 4LV8A 1PMUA 2WEIA 5EH0A 3O0GA 5DGZA 3VONA 4JG6A 4CT1A 3TM0A 3KB7A 3DZOA 3CSVA 3QLFA 3MH3A 1XBAA 3ITZA 1FINA 1PXLA 2ACXA 4V0GB 3QGYA 3R7GA 4JXFA 4RT7A 3L8VA 2YZLA 2CPKE 1QC6A 4O6LA 3FM8C 1VEBA 4YJNA 1Q67A 1Q4LA 3HV3A 2ERKA 4FV2A 3P9JA 2HELA 5M44A 4FVPA 3PIXA 4UBAA 1O6KA 5CSPA 1W98A 4P7EA 3RHXA 3ZS5A 3W0SA 2UW4A 3LOKA 3QD2B 4BWXA 3NWFA 2ETMA 1XR1A 2QOIA 3GCQA 3EQDA 3ZBXA 4C3RA 3ID6C 2FO0A 4GK2A 5AIRA 3VHKA 4MUQA 4WKQA 3MB7A 3OUKA 2L2IA 3JXWA 5GNKA 3FMEA 3THBA 4BB4A 5J7HA 2YAKA 4BCHA 2QKLA 2WQBA 5D7VA 2HZ0A 4DFYA 4ZAUA 2XIYA 4YU2A 5J9LA 3D7TA 2OW3A 3CJFA 1CKIA 1OIYA 2ITOA 4DFLA 4OR5A 3HV7A 1U29A 4KNBA 3S95A 4DA5A 2JDSA 3GC0A 2XM8A 3GBZA 3TNIA 1Y6AA 2WOUA 3MN3A 2VTJA 4L01A 4QMNA 1VJYA 4QRCA 5CI7A 5AIKA 2X0QA 3R8MA 4QDEA 3S4QA 3FI8A 3QQGA 3E92A 4FL3A 4ID7A 1BX6A 1OPLA 1V5UA 3PXQA 4DT9A 3QWMA 1YQJA 5HG9A 4IVDA 2WMVA 4WIHA 4DN5A 2FUMA 3TCAA 3K5VA 3TCPA 1U5FA 4XNEA 3KF4A 2ZPYA 4QYHA 5LARA 2B9IA 3KRXA 3RWPA 4H58A 4FTUA 4F6UA 4V01A 4OTDA 2O0UA 1V61A 2XRUA 3DJ5A 4H1MA 4X7QA 3ZSHA 3N4VA 4PY1A 3PJ8A 5E4HA 1U2BA 3OW4A 3QXOA 1A9UA 3FEHA 5BV3A 4O0WA 1JAMA 3VJOA 2OH0E 1QPCA 5FEDA 3QC9A 1GC6A 1UPQA 3OXZA 3KRRA 3ODZX 3VIAA 3G9LX 4X3FB 4U7ZA 1ZC3B 2C3KA 2ZMDA 4AN3A 2CODA 2GS7A 4AXFA 2JIIA 5LG4B 4YJTA 3OZ6A 3UZRA 3POZA 3KKVA 2JKMA 4AXAA 3PLAE 3B2WA 5AP0A 5C4KA 4GIHA 3ORMA 3QYZA 4EUUA 2IYBA 3MVJA 2R9SA 2PUIA 3WARA 2G01A 4O96A 1XH7A 2C6TA 4ACMA 4DHJA 3DDPA 3KEXA 3L1SA 5CVGA 2OF2A 4ZS0A 2WMBA 3CEKA 4C2VA 5AUUA 1ZMWA 3NEWA 3FVCA 4U41A 4DIXA 1J7UA 2JFLA 4FTJA 4FG7A 1YXTA 3AMYA 4GRBA 4CFVA 4UMTA 4RIYA 4K11A 1MQBA 1YXVA 2Z7RA 4I93A 2XEYA 4RJ4A 4GXBA 4ASEA 5L4QA 3ATTA 4FIGA 2VTQA 3RNIA 1JKLA 4O4BB 4CD0A 1LEWA 3KFAA 3Q4ZA 4XP0A 5LCKA 3SUZA 1XD4A 4AFJA 3A62A 5FP5A 5HGIA 2LYDA 1Q8TA 2C5NA 3R9OA 4IC7A 3MVMA 4D2TA 3D0EA 5AP3A 4D0XA 3CXWA 1WVWA 4MBIA 4XOYA 3A7IA 4CFXA 3A8WA 3NNVA 2LOXA 2HXQA 1KWPA 3C0GA 1XJDA 4XG7A 5FXRA 5EQYA 2V7AA 2ZB1A 2J0IA 2P4IA 3W2PA 2K2JA 2DWBA 2EXEA 4M69B 4TZRA 4Y95A 4BHNA 1DI8A 3GYPA 3VBXA 2YERA 4BDCA 4EK4A 3NFFB 3TL8A 3BRBA 2ROZB 4BWPA 2H7EA 1V88A 3R8PA 4AA0A 2UW8A 3KY9A 5DH9B 2GDOA 3OHTA 4RJ6A 1LPUA 1XX0A 2H34A 4RBLA 3PIYA 5EYCA 2O2UA 5L8JA 3VS2A 3CKXA 1CDKA 1Q8WA 3A2CA 3D7ZA 4NCTC 3PY0A 5HIDA 3RCJA 3ZDIA 2ELAA 5KMIA 2W1FA 4A6KA 2HWPA 5CSXA 1WZYA 4EOLA 4IZ7A 2R2PA 2I1JA 3LJUX 3Q53A 4MF1A 5B7VA 3AD6A 4ZEGA 3JR1A 4TWPA 3DV3A 2C1AA 3HV4A 2OTXA 5E7RA 4GMXB 1Q97A 1L8TA 5JQ8A 5AR8A 5HLPA 1Q3WA 1W1DA 2H6DA 3BHUA 4ASZA 2VO7A 4YC3A 4RWKA 3E8DA 4L00A 3BGZA 3UE4A 4KS7A 1ZARA 2JKOA 3VRYA 2WKMA 4ZLOA 4O0XA 3CQUA 4BKJA 4JQ7A 3DU8A 3HA6A 5TE0A 5FI0A 5T3QA 4JRNA 2VO3A 3OEZA 3PPZA 3VJNA 1KE5A 2OH4A 2V7OA 5A6OA 1YI3A 4RX8A 1WVYA 3BYUA 5E8TA 5A4EA 2L1CA 4HDOA 4FNWA 2JBOA 5EW9A 2YA9A 3IONA 4CLJA 4IANA 4DT8A 3D15A 1WI1A 2B52A 2PVMA 3MJ2A 4M68A 5CANA 5L2SA 3CGFA 4IQ6A 1UU8A 1RDQE 2R3PA 5HBHA 4WSYA 1EH4A 5E90A 3UQGA 3DK6A 4FSWA 2V22A 4DINA 5B2KA 2CGWA 5J79A 4QMZA