5KCVA

Crystal structure of allosteric inhibitor, arq 092, in complex with autoinhibited form of akt1
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
433
structure length
353
Chain Sequence
IVKEGWLHKRGEYITWRPRYFLLKNDGTFIGYKERPAPLNNFSVAQCQLMKTERPRPNTFIIRCLQWTTVIERTFHVETPEEREEWTTAIQRVTMNEFEYLKLLGKGTFGKVILVKEKATGRYYAMKILKKVLQNSRHPFLTALKYSFQTHDRLCFVMEYANGGELFFHLSRERVFSEDRARFYGAEIVSALDYLHSEKNVVYRDLKLENLMLDKDGHIKITDFGLCPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHEKLFELILMEEIRFPRTLGPEAKSLLSGLLKKDPKQRLGGGSEDAKEIMQHRFFAGIVWQHVYEKKLSPPFKPQVTSETDTRYF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RAC-alpha serine/threonine-protein kinase
publication title Discovery of 3-(3-(4-(1-Aminocyclobutyl)phenyl)-5-phenyl-3H-imidazo[4,5-b]pyridin-2-yl)pyridin-2-amine (ARQ 092): An Orally Bioavailable, Selective, and Potent Allosteric AKT Inhibitor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/inhibitor
total genus 90
structure length 353
sequence length 433
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2016-06-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
A PF00169 PH PH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 5kcvA03
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 5kcvA01
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 5kcvA02
4NTSA 1FGIA 3JYAA 2W5BA 4PPAA 1LP4A 3R7EA 3ZBFA 5GZAA 4BCKA 5GIPE 4JR3A 1V0OA 3KY2A 2R4BA 4U7ZA 4AF3A 5AAEA 2EU9A 5HCZA 4NY0A 2YACA 3A8WA 2COAA 1E1VA 3IGOA 3S3IA 1IR3A 1EGXA 4F65A 2DFKA 5D10A 5HHWA 4BCPA 5IMEA 1UNQA 3ZO1A 2CNUA 2PYWA 5DLSA 4FMQA 5EHOA 2P4IA 3ZFXA 4BL1A 4LGGA 4D58A 4MNFA 2G9XA 2HOGA 3FSSA 2YWVA 4CVAA 4QP9A 4ZSAA 1ISNA 1V5MA 5IQEA 2F7ZE 2VWIA 3GCQA 3NWWA 2FVDA 4DXAB 2GQRA 4AZFA 2YLFA 3RPVA 3ZO4A 3GCVA 3CIKA 3CR0A 5E90A 3W8LA 4O84A 4OW8A 1AQ1A 4OR5A 4X3FC 4Y5HA 2ROVA 5KUPA 4AGCA 2W1GA 4EH5A 4ANQA 5E91A 2NNWB 2JDSA 4DT8A 5TE0A 4PDOA 1JSVA 1GZKA 4IIRA 3WF5A 1MIZB 3ZEPA 3FMKA 4AFJA 3FE3A 4EK3A 1JQHA 2WQEA 2ZM1A 3QRIA 4AS0A 4V0GB 2BUJA 2FSTX 2WQBA 3U7DA 2ZJWA 4YHFA 2XMYA 4GFOA 4RVMA 5CS6A 3R7OA 2PVLA 3PA4A 2P8VA 3MA6A 5FD2A 2E9PA 2WOTA 3MPTA 4ITIA 5GJGA 5BUJA 3IG7A 5K4IA 3R2YA 4CFXA 3FHRA 3ORPA 3W32A 1NVQA 4QYFA 1M14A 5A4EA 3Q9YA 2DA0A 3GUBA 2RG6A 2A1AB 4MNEA 3ZO3A 4EKLA 3TCAA 3IW4A 3QTUA 3GC0A 3EL8A 3NRMA 1YHVA 1DM2A 3F2NA 3FZPA 2DX1A 2CGWA 1ZOEA 4CMOA 4GFGA 3ZTXA 2G2IA 4ZLYA 5L2TA 1XKEA 2CGXA 4CV8A 3SDJA 4CCUA 3DLSA 3A98B 4TYZA 4WNKA 2JKKA 1BL7A 5HVJA 2YS5A 3Q6UA 1GY3A 3FWQA 5A6NA 4BC6A 1URWA 3FC2A 5KMKA 2DS1A 5LVNA 5BVWA 2Y6MA 3RAWA 3OD6X 5M4UA 4C4FA 1PW2A 5AR4A 4D1ZA 1TVOA 3A4OX 4HDQA 3WA0A 3FQEA 1QL6A 3U54A 4L53A 5IU2A 3E8CA 4IAYA 1FQ1B 5I5ZA 2OJGA 3R1YA 4Z7GA 3PEGA 2R7BA 4YR8A 1VR2A 4ZY5A 2E9VA 1OPLA 3FHIA 4QQCA 3MH2A 3JY9A 3OMVA 3PJ3A 5DR9A 5AV2A 2JBOA 4OAUC 3B2TA 4MBJA 5ETIA 5AA8A 4NH1A 2VO0A 4K77A 3HW2B 3IKAA 1NI2A 3TIYA 4CCBA 1CKJA 3LJ0A 5C5BB 1V5PA 1X1FA 3D2KA 4IH8A 5AEPA 3FXZA 4JL9A 2BROA 2Z7QA 4WRGA 4YMJA 3TUDA 4ZMEA 3HL7A 2GS6A 2X6DA 4O0TA 3KF4A 4KB8A 1JSUA 2BZHB 2I40A 4YP8A 4XV3A 4Q9ZA 2Y4PA 4YC3A 1VEBA 1J7LA 1MQ4A 1SZMA 5KBQA 2WEVA 1M52A 3PIYA 3GP0A 3EN5A 5I9WA 5DHJA 4G17A 3DFCB 4FNYA 4MXXA 4ZLOA 5B2KA 5GNKA 4PTCA 3P79A 3ZYAA 4IAIA 4YJSA 2QURA 5LMKA 1Z9XA 3LFQA 5M07A 4EORA 2XRUA 2ZDTA 5ANJA 3PG1A 3D4QA 4FNZA 4GJ3A 3PZHA 1KSWA 5BVFA 3ZONA 5L8LA 4C57A 2Z02A 3BQRA 3LFNA 3OZ6A 4IWOA 2QODA 4KABA 4EJNA 4CKRA 5CF4A 3GCUA 1PF8A 1ZOGA 3UNZA 4BCQA 2OBJA 5ANDA 3A8QA 1VJYA 3C4FA 3HV6A 5KE0A 3GENA 4V05A 5E92A 3E8EA 4OTDA 3OW4A 4Y85A 4N6YA 3BV3A 3T8OA 3CQEA 1U59A 1QPDA 2P3GX 2PHKA 2WIHA 4X2GA 4ZAUA 3MESA 3LM5A 1HOWA 4GW8A 4TKSA 3D8DA 4PQNA 4NIFB 2QI8A 4K0YA 4EKKA 3LQ3A 4DTKA 3NUSA 3GU6A 3DZQA 4AA5A 1ZMWA 3FSKA 2XCKA 4D9UA 4S34A 3I5NA 2F2UA 4CQEA 4IM2A 1O6LA 3KMUA 1W8CA 2YJSA 3P7ZA 5LMAA 5CX9A 2QOCA 3QD3A 4O0XA 3ZM9A 4RG0A 3RBWA 4DEGA 5CXZA 2COFA 2BIYA 4F6SA 1TQPA 3VUKA 3BI6A 4BZNA 3I0OA 3AMYA 3D0EA 3HMNA 4BI2A 2NZ8B 4B4LA 5C4LA 4XG3A 2QOKA 5IPJA 4AQCA 3GFWA 4KIPA 4OTGA 4FSTA 4GIIA 4AZWA 5IH6A 2IPXA 3I6UA 3EB0A 3MWUA 2QHMA 3EWHA 3LFBA 4FA2A 1OPKA 5HGIA 3AOXA 2SRCA 3OCGA 2GCDA 4MQ2A 4UZDA 1Q3WA 3TKUA 4CSVA 4V0GA 4X2NA 1CKPA 4M69B 2ETRA 4TWPA 1U27A 1H10A 5AUWA 2EXMA 4DCEA 4I4FA 4BI1A 4QTEA 1GJOA 3UMWA 5AIRA 2PUNA 4U9AA 1CTPE 2ITXA 4K6ZA 3SG8A 5CNNA 5EQYA 5IQDA 2YT1A 5EKNA 3W2QA 2NP8A 4UB7A 1BYGA 2P0FA 3QD0A 5CALA 4BCGA 5TR6A 2YAAA 3QX2A 4FK6A 4RX9A 1A9UA 2GHMA 5FEEA 3HGKA 1ZXEA 5GHVA 3AC4A 1ZAOA 4NKAA 3F2RA 3PE1A 5DR2A 4ALVA 5AA9A 5K3YA 4D28A 3DKCA 4ANLA 2RF9A 5I9ZA 1TQMA 1BAKA 5FP5A 3CEKA 2XNEA 4YU2A 2XIKA 4HW7A 4JBVA 4MBIA 3BLRA 5FTOA 1Q67A 3R8LA 4FSYA 3SAYA 3ULZA 4CFVA 2YS1A 3L9MA 5KCVA 4M0ZA 3R8MA 4GUBA 2I5CA 4EZ5A 2X8DA 2W2XC 3VW8A 3AD4A 5FTGA 5HCXA 4CV9A 3V5PA 3SLSA 4E5BA 1NVRA 4RIYB 4O96A 4YZMA 4JRVA 4FSNA 5AM6A 2QLQA 2WB8A 3TO1A 3DOGA 4O7YA 3R6XA 3GT8A 4O7LA 4GU9A 5A54A 3DBCA 1O6YA 4NZWB 3OY3A 4K9YA 4NCTA 3E3BX 3LFSA 3ZDTA 3QLFA 4IFCA 5A3XA 5IQHA 3OCTA 4L46A 4WIHA 3I4BA 3ZU7A 3HA6A 1PFJA 3DXEA 2XK8A 4O0WA 4ASEA 5AUTA 4MX9A 4TWNA 3AC5A 4IZAA 1RE8A 3KCFA 2B0QA 3UIBA 4DHFA 1EH4A 1XH4A 3QXPA 4XX9A 3TTJA 2V55A 2RSVA 4C2VA 1P6SA 3SRVB 2DN6A 5C5BA 4JI9A 1KOBA 5CSHA 3GYPA 4KWPA 1OBGA 4BIEA 3BPRA 2R3MA 3ULCA 4U3YA 4YLLA 5EM8A 4BYJA 1IRKA 4C38A 1U5QA 1PKGA 3FI3A 4EKUA 4TL0A 1QPJA 2C6DA 2G15A 3ALOA 1PHKA 2Y4IC 4HGEA 4TYJA 4X6QC 4UMUA 3MTLA 3V5LA 4HNIA 3BEAA 3ACKA 1UWJA 4G9RA 4YZBA 1Q5KA 1WBOA 2RFSA 5LCKA 3TACA 2J4ZA 3ZS5A 1UNLA 4EQMA 2JIIA 2VWVA 2DYLA 5CU6A 4HHVA 5DHFB 5HTIA 3DXNA 3ANRA 5HE1A 1FHOA 3NDMA 5KKRB 4X3FA 4GMXB 2GNIA 5A9UA 2C6EA 4J53A 1OECA 4K11A 4LUEA 1GC6A 4RX5A 4YHJA 2YZAA 4E4MA 3HRBA 4RPVA 4W4YA 3I0QA 1F0QA 3U6JA 2PL0A 1NT2A 4L68A 5E8ZA 2VRXA 4ZTQA 2REIA 4AT4A 4RQVA 3ZUTA 1I7AA 5ANEA 5CVGA 4ZTLA 2O3PA 5EHLA 2UV2A 3LXNA 1W84A 2HE7A 3X23A 5HO7A 4JG7A 5C27A 3LLTA 4ANNA 4RA4A 5HX6A 3GU5A 2DYNA 2L2IA 2J0IA 1YDSE 3W8QA 4E93A 3QWKA 2Y6OA 4PWNA 4XG2A 4RMZA 3SOCA 3D5WA 3O0GA 4YLKA 3Q4CA 4M7IA 4XG7A 5K0KA 3QYWA 4IC7A 4LGHA 2ZMDA 3JXWA 3NYXA 4KKGA 4O0RA 4ZSLA 3ZFMA 5DMZA 4Q5HA 2ONLC 5DIAA 4KRDA 3TV6A 3KB7A 3Q2MA 4EH9A 3EN9A 2RL5A 2UZVA 3PYYA 1YVJA 2ERKA 4PDSA 2J50A 1G3NA 2I1JA 1O9UA 3OG7A 2PZRA 4F9AA 4G3CA 4G3FA 4LI5A 2WTKB 4UBAA 4HVDA 3FV8A 1YQJA 3AT2A 2X2KA 1V89A 1IG1A 2CHLA 2EB3A 3E63A 4R1YA 1ZYLA 4E4LA 5CT0A 4C34A 5LVOA 4HB2B 5IMXA 2VV9A 4GG7A 3LLAA 4Y95A 4M69A 4YC8A 2YS3A 3KRRA 3OW3A 4NUSA 4BTKA 4B6HA 3L1SA 3QA0A 3HP5A 2V5QA 3M2WA 4RFYA 2RUKB 4D2WA 2IVTA 4ZJIA 2Z0OA 5ACBC 1XH6A 2HXQA 2WU6A 3W2SA 5AX3A 3TEIA 4KSPA 4CXAA 3C51A 3MSSA 1Q8ZA 4JIAA 4U3ZA 3G6GA 3FPQA 3WZEA 4UMPA 4FZFB 4XBRA 5CZIA 5FWKK 4GCJA 2YM8A 4XLVA 1SNXA 1WVYA 1HCKA 4RZVA 5C16A 1H1SA 4U41A 4MF1A 2IZRA 3OROA 4I5MA 4IX6A 4UWCA 2X6EA 3UG1A 4IB0A 4J1RA 4YJVA 5IF1A 2Y4IB 1OIRA 2ITTA 4GK4A 5CSWA 3KMMA 3NSZA 2W5HA 1Q41A 3PJ2A 4I3ZA 1UV5A 2J9MA 4MYGA 3UVQA 3ZM4A 4EYMA 4EOLA 3AXWA 1UNPA 2R09A 4WD5A 1YDRE 1Q4LA 3AT4A 3I81A 5B2MA 3JR1A 3QF9A 3HKOA 5EM7A 1H25A 2NMBA 1WMKA 3LHJA 4YZNA 5E8XA 1WCCA 3IONA 5HNGA 5KHXA 1JOWB 2CGUA 2OICA 4DCAA 1Q8TA 3NW6A 3GCSA 4GVJA 2W17A 1SVHA 2GNGA 4FV4A 4H58A 3A7GA 1UVRA 3MH3A 3COKA 3F5GA 3QQUA 4N6ZA 5LQFA 3D8FA 3GU8A 3RAIA 2A19B 5E9EA 4EMOA 3C7QA 1H1PA 3VIAA 3W2RA 1XBCA 3NS9A 2WTCA 4FIEA 4FKTA 4QMOA 4EOKA 5G1XA 3D7ZA 4AACA 3FZTA 4FKJA 4BDDA 3ZOSA 1V1KA 2ESMA 2FB8A 1W82A 4HVIA 5HU3A 1MP8A 1PMNA 3TNQB 4QP7A 1BKXA 4E5AX 5EQPA 2YWPA 3NR9A 5EFXA 5FUTA 3FI8A 1PMSA 2UZUE 3LXKA 3WARA 3FYKX 3BYMA 5A14A 5CEPA 4P90A 4RZWA 3KSYA 4BBKA 2VTAA 5FP6A 4A6KA 2FYSA 2CKPA 4BBFA 1ND4A 2BRGA 2C69A 2ZV8A 2R3OA 2DKQA 1KV2A 3CCNA 1WVHA 2G35A 5AP1A 3NNWA 3LZBA 2OIQA 3KY9A 4YONA 5FRIA 4C4JA 3P86A 4CFNA 4UMTA 5CSPA 2V7OA 5IEVA 3TV4A 4QQTA 5JFSA 2BAJA 3Q5IA 3TV7A 1ZVRA 2CKOA 3NIZA 2UW5A 4RRVA 5D3VA 5ANKA 4L3LA 4FV3A 3TTIA 4S2ZA 4FIGA 4H36A 3UO6A 3PPKA 3OVVA 2RKUA 4IC8A 5JGBA 1ATPE 5LARA 3C4XA 3QUPA 5BPYA 4BCJA 2QOIA 4D55A 4J71A 4ANSA 3WZKA 2X9EA 3C5IA 3B8QA 4KHAA 3MVLA 1NTVA 2ITZA 2ITYA 5E1SA 3Q4TA 4MY6A 3BU5A 3RK7A 5M57A 4QMYA 3MH0A 4TYEA 2YIYA 1YWVA 3ZZEA 3ROYA 3H9RA 2YLEA 2UZNA 3T9IA 1ZY5A 2F49A 1NXKA 4I0SA 3KRJA 4AW5A 2D9WA 5KMLA 2C3LA 2UW7A 4S30A 4BBEA 3U6HA 4O21A 4RGJA 5IA3A 3RAHA 2X81A 4IANA 4ACHA 3FLQA 3UO5A 2HW6A 2XF0A 3FSFA 1JKTA 2CJMA 3C4CA 3EZRA 4YJPA 5CSVA 5E8WA 5EHYA 4ZSEA 5FBNC 4P7EA 4EOOA 3SVVA 2C0TA 4ZP5A 2UZRA 3WOWA 2R0IA 2V22A 3V5WA 4RIOA 3TDVA 4HAXB 3LCOA 3RAKA 4X21A 1YI3A 3DK6A 2VKIA 1E1XA 4EZ3A 3RJCA 2VWWA 5HBHA 4M68A 5HIBA 4DFLA 4FKIA 2J7TA 1Y8GA 5HTBA 2H7EA 2WMBA 5JP4A 4WNPA 1GNGA 3QZGA 4UYAA 4ZTHA 4EHGA 4NJDA 3MV5A 4FKVA 4O2PA 4PL3A 2OK1A 4EBWA 4BY9E 3G9LX 4FGRA 3CXWA 1ZZ2A 4L43A 3R9HA 5JFXA 3IDCA 1MUOA 2JLDA 1Q3DA 1VZOA 3E8DA 4FF8A 3BKBA 4DFBA 4IJPA 2W4OA 4W4WA 4C37A 2W9ZB 3CLYA 3R7YA 4II5A 1E5WA 4QYGA 1JPAA 1S9JA 4MVFA 2WNTA 4ZJJA 4QQJA 4YC6A 2UW4A 5BNJA 3NYVA 4K2RA 1H1RA 1H8FA 3LFDA 4DA5A 4AZTA 2DLWA 4K2OA 3PWYA 4WSFA 2W1HA 3LQ5A 2I5FA 2X9FA 1ZC3B 4FV5A 4I6QA 5FI0A 3BELA 2B54A 2HY81 2YITA 3OWJA 4E73A 4AW2A 2C3IB 3O8TA 4GV1A 1CMKE 2WFYA 4AGDA 4J8MA 5K0XA 2WTWA 3CJFA 4YJQA 2QG7A 3QCYA 2OW3A 4L00A 4S32A 3OCBA 4G31A 5J9LA 3D5UA 1XODA 2Y7JA 2GS0A 3RPYA 5DIFB 4MXOA 2GHGA 4GUEA 4HYSA 4PPBA 3NYNA 2XBJA 4MQ1A 5F1ZA 3WZDA 3NNUA 3VS0A 3DXQA 4IVBA 4DG2E 3K3IA 3WILA 2YHVA 2JKMA 2PE0A 4D4RA 4OAVB 2YDKA 3FZOA 4YJTA 2N0YA 5DYJA 4U42A 4AOJA 3TM0A 2C6LA 3ORLA 3U8ZA 3MDYA 2F2CB 3G5DA 3MVJA 2JKQA 4ID7A 3QC4A 1L8TA 1YXXA 3UQFA 5IA5A 3VC4A 4OTIA 2GSFA 3VQHA 2DQ7X 2W96B 4XG9A 5L6WL 2BDWA 3HRFA 4BICA 1O6KA 4WRSA 4I41A 4YLJA 5IEYA 1X1GA 4CFWA 5EH0A 2JKOA 5AP4A 3D7TB 4KNBA 3R9DA 3ODOA 3KFAA 3QQGA 4DAWA 4UYNA 4P5ZA 4U79A 2KULA 2WQMA 2CY5A 1ZYCA 3GC7A 3DA6A 3E7OA 5JGAA 5I3OA 2ONLA 3U4WA 3KK8A 4JRNA 4EZ7A 4I6FA 3GOKA 4AE9A 2JC6A 3LOKA 2R9SA 3MIYA 4CLJA 2B9FA 2IVSA 3UJGA 3MY5A 2QO9A 5GZ8A 5KO1A 4USDA 4FVRA 3V01A 5BVEA 4C58A 3QU0A 4FTOA 3ACJA 5JEBA 4JG8A 4ARKA 4A7CA 2YIWA 4EOIA 5BX0A 4ORKA 5J79A 3F3WA 4I23A 4I21A 4IM3A 5CT7A 2VSZA 4IVAA 4F4PA 5LOHA 1ZRZA 5KMIA 3PXFA 5KZ0A 4OTPA 4CFUA 2J6MA 2YVCA 2OZAB 1APME 2FSOX 2QU6A 1V0PA 3ANQA 4OTFA 3FY0A 1WZYA 1KWPA 4PTGA 3ZLWA 1IEPA 2D9VA 3FAAA 2WTVA 2IW9A 5D1JA 3UVPA 4B8LA 5HG7A 2PVNA 3C4EA 4QYYA 4ANBA 4O0YA 1ZWSA 3BIZA 3L8XA 4RIWB 5L2WA 4GPTB 4YPDA 4BCMA 3MTFA 3SOAA 1U5GA 4U40A 2W9FB 5IH5A 3HK0A 2HELA 2VWUA 2PY3A 2Z7SA 3CTJA 2R5TA 3OHTA 5JLJB 3O51A 5CWZA 2DX5A 3BHTA 2BKKA 2QONA 5GOWB 3MJ1A 1W83A 3FMMA 1UNGA 5AFVA 2W1CA 1XO2B 3FMDA 3HX4A 3MFTA 4FV0A 1M7EA 5AV1A 3M11A 1QPEA 2Q0BA 3OOGA 2IO6A 3OTVA 4GFMA 4P5QA 4V04A 3TIZA 2WU7A 4QTDA 3RNYA 4FKUA 4H1MA 4EONA 4WSYA 4XLIA 1J19A 1Q97A 3G51A 4D0XA 1M2RA 3LFEA 3ROCA 3DXCA 1MAIA 1W98A 4FV8A 3VUDA 2VTOA 3FUPA 4A6HA 3NGAA 4Y94A 4RJ5A 2ITNA 5HU9A 5M44A 2OLCA 4FKWA 4OTHA 3VIDA 3ORMA 5HCYA 3ELJA 2OGVA 3BBTB 4R3RA 3JVSA 4C3FA 3TNIA 3N4TA 1W0XC 3WF9A 4O22A 4RWIA 5AUZA 2GCLA 3POZA 1FVRA 4YL8A 3GU4A 3SHEA 5CLPA 3IW7A 4R7BA 4F7NA 2R0UA 3QTQA 3RZBA 2H7DA 3MPMA 2X4FA 3QZIA 4L8MA 5AADA 5BUIA 2GHLA 5IQBA 3ITZA 4QMVA 4DITA 1YI4A 5BYLA 2L1CA 3VUIA 1ZSQA 4MD7E 4FIJA 3EN6A 2PVMA 4LQMA 3RPOA 2R7IA 1Y6BA 5JMSA 2EMSA 4RA5A 2YEXA 3KZ1A 3H9FA 4QP6A 3IECA 1B55A 2GTNA 4RWKA 4IE9A 5EW9A 3ZLXA 4O7VA 3QL8A 4NU1A 4QTBA 5B0XA 3VBTA 3IW5A 1Y57A 3CSVA 3GQIA 2CN5A 2M38A 2WTJA 4BHZA 4GG5A 2C1AA 3V04A 4X2KA 3E93A 5EYCA 3VULA 3WIKA 4B99A 2XEZA 4CG8A 3K5UA 3PJCA 4MF0A 5AP7A 5I9VA 2VX3A 3LJ1A 3F66A 3UNJA 4IOYX 4X7QA 3KXXA 3F3VA 4FV1A 2YDIA 2VNYA 4TWOA 4IAZA 4EH6A 3ULIA 4FKQA 5CI6A 3PUPA 3II5A 2GU8A 4FL1A 4IVCA 1J91A 4F99A 3ZO2A 2JDVA 2UW3A 2ETKA 2AC3A 3RPRA 3QTSA 1OIYA 3CPCA 5JFVA 2C0IA 3G0FA 4FODA 4RC4A 5FXRA 2ZB1A 2PU8A 4A4LA 2VTRA 4FK3A 4EL9A 1PLSA 3IDBA 3OF0A 5E8SA 2J0MB 3FI2A 1T45A 4KBKA 4D2VA 4FYOA 1SMHA 4JVGA 3BGQA 2ZM4A 2PTKA 3M1SA 4WG4A 2PMOX 3D7TA 4UN0C 1JWHA 4JLCA 2FJLA 3FMNA 3ZBXA 1GZ8A 5LJJA 2ITPA 2WQNA 5FBOA 3RWQA 1R1WA 3Q2JA 3KULA 4ZZOA 1OGUA 1U5RA 4FTAA 5ICPA 2DHJA 4CYJA 2W7XA 3BRBA 4JR7A 3OEFX 3Q5ZA 3PXZA 4K18A 4L44A 2ZAZA 4LV5A 2FA2A 1S9IA 3PLSA 4X0MA 3UO4A 5M4IA 5CLLB 1G8SA 4XCUA 3MFRA 3QKLA 3WI6A 2MFQA 5IA4A 3QD4A 4F7LA 3KGAA 3TXOA 3UYTA 4EI4A 4P7IA 2E2XA 2ZB0A 3DQWA 2WMVA 3EQIA 3UZPA 4PP7A 3SC1A 4PTEA 3U4UA 4PDYA 2H6DA 3LM0A 2AEHA 4QYHA 3T9TA 3R63A 4QMSA 3TZ9A 4I6HA 5AP5A 4E4NA 2C5YA 4IZ7A 2XNBA 4J96A 4IDTA 4GS6A 3UC4A 2IFSA 4DX90 3MPAA 2PMNX 5LCJA 3F88A 5HD7A 1W1DA 2VTNA 3HV4A 3E8NA 4FIHA 5B7VA 5ETCA 4GMVA 2WMUA 3KXZA 1I09A 3CPBA 4RC3A 4TW9A 2GNJA 1KE8A 1WBTA 4OUCA 3SD0A 3I7CA 4L6EA 3NPCA 2W4JA 4RIWA 2J2IB 3Q96A 5LWMA 1WBSA 5BVKA 3PG3A 2IYBA 4E20A 4ZY4A 3TNHA 1KZ7A 3F5XA 2GFSA 4FEXA 4P2KA 5IDNA 4WBBB 3UODA 1YXUA 2OXYA 3KK9A 4B6LA 1PXLA 1W7HA 4FZDB 3VF9A 2A0CX 3DCVA 3HNGA 3E5AA 5A4TA 5LOPB 1ZYJA 1G8AA 2PUPA 3Q53A 3UYSA 3DV3A 4ACMA 4F70A 5CU0A 3VS3A 1Z87A 3IW8A 2VN9A 4I5HA 4G6NA 4TYHA 3KN6A 4J7BA 3LXLA 4WNMA 3DKOA 4PMMA 3W10A 1W1GA 3HMOA 3RWPA 4O2ZA 3ORKA 3C1XA 3FLYA 3EYGA 5FEDA 5I0BA 2PWLA 5AR2A 3C4ZA 5IKWA 4JXFA 2XKFA 1J7IA 1URCA 3FI4A 1P2AA 1YOLA 4NT4A 3E62A 2CSNA 3C0IA 3HQCA 3I7BA 4O0SA 4BIDA 1XH7A 3PXYA 1IA8A 3OTUA 4FTLA 1LR4A 5EOBA 1XWSA 3VBXA 4EK6A 2UVZA 4U44A 3VRYA 4BDBA 1K5GB 1IAHA 2WZJA 4I4EA 3D2IA 3R28A 4QMLA 3EQBA 1NW1A 4UWBA 1OB3A 4ZZMA 3Q52A 2F57A 1KE9A 2WELA 3SW4A 2GS2A 4N4SA 3R01A 1OY2A 5EW3A 1X11A 1JNKA 4G6LA 4CRLA 1OKVA 4FSQA 1UU3A 3WYYA 2V0DA 4R7HA 4O0UA 2HW7A 2V62A 4WBOA 4Y73A 1H0VA 4BDIA 5AR8A 2PVHA 3HP2A 3LCTA 4WUNA 2DWBA 2IVUA 4RIXA 4I5PA 2C1BA 4TYIA 1XH5A 4IM0A 2XK9A 3FL5A 4FTNA 3AGMA 1DDVA 4PY1A 2C4GA 4FTRA 4XBUA 5IUGA 2LOZA 2VWZA 1Q62A 3NAXA 3PY0A 2W05A 4YBJA 3EN7A 3P9JA 2CCHA 4YZCA 5J8IA 3RZFA 4MD9E 3BYSA 5LWNA 3HMMA 1KE6A 3RCJA 2QOBA 4JQ7A 3OWPA 2W1ZA 2P0DA 4HAYB 4B9DA 3MI9A 5KMOA 5HLPA 2OFUA 4JAJA 2XKDA 2XNOA 2YERA 4M13A 3QALE 4M12A 4TN6A 3RHXA 4NTTA 4C35A 4PRJA 1UPRA 3VUMA 5HEZA 2PSQA 2PE2A 1UA2A 4DH5A 3NUUA 2PVYA 5IA1A 3MPXA 3ODZX 5AAFA 3PVGA 4EH8A 2UZBA 2VGOA 1P5TA 4F1MA 3DBQA 4IHPA 4D0WA 2CAYA 4EH3A 5IQIA 2OO8X 1F3MC 3TDWA 4KVGB 4RQKA 4EH4A 4DH7A 4G3DA 4ZY6A 5KKRC 2J0MA 3AGLA 4E3CA 4KIKB 5M51A 3MW1A 5HG9A 1MPHA 3FMEA 1NU2A 3Q6WA 1LEWA 1MRVA 2XK7A 4LV8A 5LVMA 2FSLX 1UNRA 2XM8A 2QO7A 4K33A 3QBVB 4OT6A 4NM5A 1P5EA 2UZOA 2QOOA 3KVXA 3DBDA 3AU5A 4IX3A 3BHYA 3QXOA 4TY1A 5J7BA 4WOVA 1OZ1A 4FSZA 3BJIA 2H8HA 3F0WA 3COMA 4RSSA 5CI7A 4RFMA 3OEZA 3R8PA 4QOXA 2LKOA 2P0CA 4KD1A 2W1DA 1UU8A 3GEQA 3PP2A 3F3ZA 4BDFA 4DEAA 4G9CA 3DTWA 4LG4A 2C5OA 2YIXA 4S33A 4AU8A 5BUEA 5J9ZA 2GCJA 1H26A 3R83A 2C6IA 4NSTA 2XCHA 4FSWA 4RWJA 4USFA 4NFNA 2G2HA 4NYEA 2YIQA 3F5PA 3K3JA 1UWHA 2BR1A 4QPMA 2VO7A 3A61A 4XOYA 4A4OA 5DA3A 2QG5A 3CC6A 4YZDA 3SA0A 5DGZA 2VU3A 5J87A 4C8BA 3V5TA 5HQ0A 2BCJA 2WO6A 2XNMA 2WMWA 4H3BA 2YM3A 3Q60A 3P4KA 3FZ1A 1SYKA 4DT9A 1SNUA 5DWRA 4AG8A 1JLUE 3A2CA 3FLWA 3RALA 1DDMA 3BU3A 3L9PA 4EUUA 4FEWA 2WTKC 2Y0AA 3DJ5A 2XNGA 2GFCA 3PIXA 2ZDUA 3O96A 1A06A 4YURA 5K5NA 4BIBA 5HLNA 1Q8WA 4FL2A 1M2QA 1PXNA 1OUKA 4F0FA 2VTMA 1YXVA 2OH4A 4WO5A 2FUMA 4HCVA 4APPA 4HVSA 3R04A 5K9IA 3ETAA 2CRFA 3TFMA 2RFEA 4DEHA 2PULA 3EKKA 3VRZA 2WMSA 5HNIX 4F7SA 3RTPA 4JQEA 4QP8A 1GOLA 4HGLA 4RC2A 1OM1A 4BTFA 4Z3VA 3L8SA 4I20A 4JDKA 2HZ4A 3QCXA 2HCKA 3MB6A 4C36A 3PDTA 2O65A 3TJDA 3R73A 1ZLTA 1VYZA 3EL7A 3OOMA 4YSMA 2RSGA 3C50A 4EK8A 2J90A 2PVKA 4W9XA 2BFXA 5C8MA 2QNJA 4H39A 4Z16A 4O1OA 4K81A 3QD2B 3PVWA 2PK9A 4FSRA 4G3GA 3KREA 4WNOA 5J3YA 5J3QA 1IRSA 2OXDA 4GK2A 4PF4A 3QHWA 1R0PA 2GNFA 2R3QA 2CCIA 3MJ2A 2NRYA 3VW6A 4A9YA 2X2LA 3T06A 2CNQA 4MK0A 2UZLA 1FOTA 3W33A 1GIJA 3BGPA 4XRJA 4AA0A 1LUFA 3FYJX 4QNAA 3CD8A 4Y8DA 3DPKA 3THBA 4AOTA 3R8VA 4BDHA 5JRQA 3NUAA 4IWDA 4ZTSA 4W4XA 5CAUA 2XKCA 4S31A 4PL4A 3WIGA 4QO9A 3RGFA 1PXPA 3QUEA 4P4CA 1QMZA 5FLFA 4AOIA 4C4GA 3BV2A 4CT1A 4DGLC 3KF7A 1FHWA 2YM6A 4A06A 5IZFA 1H1WA 3TVVA 5TF9A 4F08A 3V6SA 4E8AA 2BMCA 4YJUA 5AR7A 3DNEA 2RFNA 4R1VA 4RJ6A 2N23A 4HAVB 3D8EA 3CY3A 1GIIA 4Z55A 2M14A 2B7AA 2ZOQA 4NIFA 3HDNA 2B52A 5M4FA 3MS9A 5ETAA 4LRJA 4IQ6A 1WVXA 4QMXA 2XBAA 3EFWA 4G2FA 4F7HA 3F61A 3TT0A 1B6CB 4C4HA 2OH0E 2D11A 2EXEA 2ITUA 4NWMA 3FKLA 4DFNA 3HRCA 4O6EA 3OUNB 3EQDA 4XYFA 2XJ2A 1ZC4B 3D14A 5CU3A 1P4OA 4IAAA 1AD5A 4IAPA 3H3CA 3EJ1A 4R5YA 4RBLA 4CRSA 4UMRA 4DEIA 1BWNA 4HB3B 5AP2A 4EC8A 2IG7A 2IZTA 2C6OA 4XWXA 3TUCA 1AWEA 4NEUA 4XG6A 4UEUA 2QR8A 1U2BA 3ORNA 4O83A 1H24A 4L9IA 3QFVA 4KIKA 4QMNA 2OJFE 2YRYA 1B39A 4DGMA 3GB2A 4MAOA 3TL8A 4YTCA 3UOKA 1EF1A 4FNXA 3I6WA 4ACCA 3PG7A 1YOMA 2I0YA 1ZYDA 2HK5A 3O23A 4FTQA 5AM7A 4BGHA 4XP2A 5CZHA 5EI2A 1RJBA 4IX5A 4CHJA 2BZIB 4F0IA 4R8QA 1WBPA 3O71A 3V8TA 5IQAA 5EI8A 3HUBA 3WYFB 2BRMA 4WUAA 2B4SB 3DJ7A 3AMBA 5DPVA 3C13A 3V8WA 5C26A 1P3RA 4FEUA 3LW0A 2P2HA 3KVWA 2H34A 3LMGA 2C5XA 3N9XA 5F95A 4EHEA 4EJ7A 4GH2A 4I0TA 4I24A 2DUVA 4C3PA 2WMXA 3OCSA 2AC5A 2X8EA 5CU2A 4XMOA 4EHVA 3KMWA 4J99A 4IWPA 4CYEA 3R7UA 2I0EA 1JKLA 3CGFA 2Y7BA 4AN3A 2BRBA 2RFDA 4D2RA 2ROZB 4RJ8A 2VZ6A 2WQOA 4RVLA 3MFUA 5H8EA 3VO3A 5DVRA 1NVSA 3DQXA 5A4QA 3MVHA 3PSCA 2WTDA 4RIYA 3SNHA 4WKQA 4GSBA 4U80A 5HBEA 5M08A 2K00A 2NRUA 4AN9A 2VRWB 2UW0A 4RJ3A 4TNBA 1OL7A 1FMKA 2IWIA 5LVPA 1OIUA 2XIZA 5HNBA 3ZDUA 5JFWA 5CXHA 4IEBA 4I6BA 4L6QA 4U6RA 1KE5A 2HWPA 3GGFA 3MH1A 2J0JA 1XKKA 3LFCA 2VTIA 4ANMA 3R22A 2X18A 2HENA 5CEOA 4Q2AA 3QTZA 3CBLA 3BYOA 3DKGA 2BDFA 5C1QB 3SRVA 1PYXA 4BFMA 5D27A 4D9TA 2VX0A 5HX8A 3FLSA 4RJ4A 4UXQA 4D1XA 2YAKA 1BTKA 4DG3E 1WJMA 2GQGA 2ZV9A 1JBPE 2GTMA 4JX7A 4M8TA 4QP4A 3LMHA 3CKXA 5CYIA 2V7AA 4A9RA 3QCSA 4IAFA 3AU4A 4ZTRA 3SXFA 3K54A 2A2AA 4BKZA 1XBBA 1ZM0A 3RMFA 3A8PA 3ZH8A 3G90X 4GRBA 2OWBA 3QTIA 3PY3A 3DNDA 4MWIA 4YJRA 4CTBA 2WMTA 2YCSA 2OU7A 3SQQA 3VQUA 4G3EA 5HG8A 2XEYA 3OC1A 4GKHA 2BAQA 2JFLA 2Z7RA 4LOQA 4WT6A 2ITOA 3IDPA 3RPSA 4QPAA 4EOPA 4MT7A 5EQEA 3ZUVA 1FINA 1Q24A 3FMLA 4YJOA 4W8DA 5AV3A 4NKSA 5EW8A 2C6KA 3QRTA 4AT5A 4M14A 5GIOE 2X2MA 5DHAB 4IADA 1PY5A 3HA8A 3C5UA 5T68A 4EH7A 3F3UA 4JG6A 4EK5A 3HDMA 2WEIA 2XP2A 4C59A 3R9NA 1M7NA 3DDQA 5ANIA 1M7QA 3RKBA 4TWCA 1FOEA 4W9WA 2P0HA 4HNFA 4KIQA 3UZRA 3KXMA 5CVFA 3ZRMA 3UPZA 1OKWA 2J51A 4YNEA 3PPJA 5DEYA 4A6FB 3RCPA 5I3RA 3KRWA 4U5JA 4U43A 4CZUA 1KI1B 4H3PA 2I6LA 3DT1A 2YCRA 1ZMUA 3E7VA 3H4JA 5HVYA 3ZLSA 5AP3A 5LONB 3AMAA 4UV0A 5IDPA 4Y46A 3COIA 3RI1A 4DYMA 2Z7LA 1ZYSA 1Q8UA 3TWJA 2PVFA 1U54B 5I9UA 1H27A 3ORIA 3SKCA 4L45A 1OBDA 3RM7A 2VTSA 3LCDA 1DBHA 3LQ8A 3JY0A 3OY1A 1CSNA 5DI1A 1BI7A 3ZUUA 3CP9A 4L7FA 4C0TA 2FGIA 3C0HA 1U46A 3CQUA 5DR6A 3OXTA 3ZZWA 2UW6A 2GDOA 4IFSA 2UVXA 2Q83A 4EQUA 3EMGA 5HKMA 4CTCA 4JJRA 1JKSA 2J5FA 4MHAA 2GQSA 4KBCA 3N4VA 4L7SA 3L9NA 4ASZA 4FUXA 3GXLA 2W99B 2PE1A 1Q61A 2QOFA 1QCFA 1PMEA 3DXPA 2OZOA 3TJCA 2CMWA 3F6XA 5HBJA 1GZOA 3AD6A 3KQ7A 4LRMA 5HO8A 3RVGA 1RQQA 3E3PA 4B7TA 4JBQA 3C9WA 2G2FA 3FBVA 2DKPA 4RLLA 5K5XA 4M66A 1AQCA 3QQKA 3UP7A 4D0NB 5TT7A 2Q13A 3VS4A 3SUZA 3VS5A 3FDNA 5ETFA 5HG5A 3RP9A 1KV1A 5CF5A 3KKVA 2XA4A 5L6OA 4TKNA 2I1KA 4PNKA 3MY0A 4KA3A 1SHCA 3QLGA 2IJMA 4ZK5A 3TN8A 4PMTA 1XR0B 2WPAA 4ZZNA 3F5UA 3R30A 4HATB 3QQFA 2WMAA 3FMHA 2B55A 3ZSHA 3IVFA 3MDBC 3BLQA 2W4KA 2CNVA 2YM5A 4LYNA 1PMUA 1J0WA 2QKRA 3UE4A 2F9GA 4GMYA 1FBNA 1YI6A 5F94A 3R7GA 4X2FA 2AYPA 3PJ1A 3QWJA 4C4EA 5HZNA 3TI1A 2R3RA 4ZIMA 5IH4A 3BHVA 3NX8A 4FGBA 1IAJA 4JDHA 5H9BA 1OITA 2R3JA 5HO6A 4MBLA 3R71A 5EM5A 2E9OA 2JIUA 4ZTNA 3ZCLA 2HY0A 2V76A 3K5VA 4KS7A 1KUTA 4F1OA 3GOPA 4FTKA 3OT3A 4IXPA 1V88A 4IB1A 4UZHA 5HTCA 4E5WA 2YA9A 1XD4A 3MYGA 3O2MA 3LFFA 2VTPA 5BYYA 2Y9QA 3QQHA 5CF6A 4Q9SA 4KUJA 3FQSA 4O86A 4XHKB 4NSWA 3EN4A 4RVKA 2B9HA 3PXQA 3JS2A 3OWKA 4E4XA 4L3PA 3V5QA 2D9ZA 4GXBA 2YCQA 2OI4X 3OANA 2RGNB 4PNIA 2E9NA 2W0JA 4GU6A 1RRPB 5LMKC 3PZEA 4DG0E 3PZDA 3CTHA 4GVAA 2PVRA 1DAYA 3QUDA 4U0IA 5DE2A 4EBVA 4IZYA 1OL6A 1Y91A 2F7EE 3IO7A 5AUVA 5IUIA 3VJNA 3WZUA 4D2TA 3SW7A 1GC7A 1K2PA 5J9YA 2PZ1A 3O8PA 4QD6A 5T3QA 5GJDA 2QU5A 1FB8A 3VUTA 3PVLA 2D9XA 1R0EA 2VTLA 2NPQA 4QPSA 3ET7A 3HAMA 4EK4A 4FIFA 4MCVA 2CLQA 4C7TA 5D3XA 1WFCA 3BE2A 1LPUA 2XJ1A 4A6FA 4LMUA 4I0RA 3JUHA 2R3GA 4W8EA 2VWYA 2XM9A 4BZDA 3BYVA 2EXCX 2R3PA 4FSMA 4MNEB 4U97A 1XR1A 1LEZA 4O7ZA 4BWXA 5M53A 2O0UA 5E8YA 4BI0A 3NSUA 3U6IA 5DI9B 3CS9A 2XYUA 1GZNA 1U54A 2OJJA 2WD1A 2X1NA 3JVRA 5KZIA 4BDKA 1N3HA 1X86A 1OQNA 2JDTA 4FV9A 3QAME 3ODYX 4NM0A 3UG2A 5KMNA 1FGYA 4G1WA 2IZSA 2PMIA 1NTYA 3QHRA 3HYHA 4FKGA 4H1JA 1QPCA 1M7RA 2K2UA 1QC6A 4BCNA 2YN8A 1DI8A 3NCZA 4BZOA 1V0BA 2BALA 4YJNA 3QYZA 4IFGA 2OJIA 4J52A 4G6OA 4HVHA 4TRLA 3MGYA 3W55A 2H9VA 3NAYA 2W1IA 5DFPA 5AV4A 3H10A 1FMOE 3EQGA 3N4UA 5KMJA 4YZ9A 1YDTE 2CLXA 3SV0A 3UOHA 5HE2A 4CQGA 1BLXA 5KNJA 2LULA 4U8ZA 5DRBA 2C3KA 2DTCA 1IA9A 4MTAA 4UMQA 3TZMA 5HI2A 4XOZA 5JK3A 4L52A 3P08A 1UPQA 3FEGA 3PVUA 4F09A 4HAWB 2R3HA 4J97A 3H30A 4D4SA 5L2IA 4RFZA 5H8BA 3WZJA 3RNIA 5DEWA 5EFQA 4H05A 1Y19B 3RHKA 1TQIA 2W06A 2C3JA 1G5SA 1WBNA 4AZVA 3UOLA 4AW1A 3OXZA 3A99A 3FKNA 4ZEGA 4OGRA 4GIHA 3KXHA 4OBOA 4XEYA 2VWBA 2WHBA 3BZ3A 2UZSA 3IS5A 5TOZA 3OUKA 4ZJVA 3E88A 5CQUA 5J1VA 3GI3A 3NW5A 4WHZA 3A7FA 4DFUA 3EHAA 3IOKA 3QA8A 4RWLA 3EIDA 4FKOA 4AWIA 2I1MA 5EYDA 2R3LA 4XJ0A 4FG8A 4LOOA 5AV0A 1DI9A 2C47A 4XS2A 5I9YA 2BZJA 4HB4B 3ORXA 2HTHB 4EC9A 1PMVA 4WSQA 1JVPP 2GJYA 3ZXZA 2IZUA 5EDQA 3EQCA 3OT8A 3FQHA 5GJFA 3IQ7A 1WI1A 3BEGA 5D3YA 5IEXA 1MIXA 2P2IA 2QO2A 1CKIA 2LYDA 3KRLA 4QNYA 4AT3A 4C3RA 2ITVA 5FM2A 3TZ7A 4HYHA 3EQPA 3AQVA 3GNIB 4FUYA 1K3AA 4F6UA 3FMJA 3MBLA 3D5XA 4BGQA 4APCA 4O81A 1RW8A 4AAAA 3UGCA 5JQ8A 3PY1A 2LG1A 4M15A 3ZC6A 3NIEA 4M84A 3SO6A 3UQCA 3DB8A 3DU8A 3QTWA 3I5ZA 4EH2A 4R5SA 2JDRA 3AC2A 2QKMA 4G5JA 2ELBA 2VO6A 3GU7A 3QQJA 3WE4A 4FICA 4YSJA 3HECA 5JH6A 3QWMA 2RGPA 3R7IA 5EI6A 3NW7A 4BGGA 3VNTA 5EKOA 1UKHA 1MQBA 4I5CA 3ODWA 3IGGA 2IN6A 5L4QA 5CEQA 2EMTA 5FG8A 3ENMA 4BKYA 2J59M 1FVVA 1TJ6A 2EC1A 4HAUB 4GKIA 3D94A 3U55A 3G33A 4I22A 4O0VA 5GZ9A 5M06A 4EOJA 1TKIA 3GBZA 2OZAA 2BVAA 2RNRB 3UC3A 4KHOA 5E8UA 3VN9A 3F82A 1ERKA 2VNWA 2BHHA 4BDCA 1EAZA 3U51A 1MRYA 5L8JA 3MB7A 3ATTA 1PXMA 1XJDA 2VWXA 4F1TA 4LL5A 4CFFA 4LRKA 3R8UA 2QOLA 4BVUA 1MKEA 2BILB 2ERZE 4FT5A 4ZMFA 4AE6A 3PA5A 3QZHA 3PLAE 4FZAB 2YF0A 2QQ7A 4HCTA 4AN2A 5C8NA 4NJ3A 4O7SA 2HZ0A 2KUPA 3LFAA 2BFYA 3OXIA 3ZLYA 2JAVA 4FEVA 2WAJA 2Z60A 3ATSA 1STCE 3U8WA 2AL6A 2JAMA 1EVHA 3UIXA 4AGUA 4FSUA 4HOKA 5CVHA 1Z5MA 2YT0A 1REKA 4QMUA 4O91A 2OTXA 4JQ8A 4D4VA 2VTQA 5L3AA 3E64A 2VUWA 4YTHA 3KXGA 5FEQA 3VAPA 4O7WA 4LMNA 4QRCA 1BTNA 2R64A 3R1SA 5AWMA 3HMPA 3KU2A 3ORZA 4KINA 5JHGA 4FTCA 3T3VA 4TYGA 5L6PA 4PUZA 2EUFB 4K1BA 5I4NA 1HCLA 4PX6A 4A4XA 4FVQA 2XZSA 5JRSA 3CQWA 4ACGA 4B0GA 4BDAA 3DAEA 5C4KA 4RLKA 1R3CA 5JZJA 1FGZA 3L9LA 4X3JA 1L3RE 4FKRA 4FTMA 4X2JA 4AGWA 5KMMA 4DTAA 3SV1A 3A4PA 2R3NA 5CU4A 5CY3A 2BHEA 2UZDA 3VBVA 4DBXA 4GT4A 3HAVA 1H08A 3DTCA 3ZRLA 3VS1A 2OXXA 1BL6A 1PRYA 4UX9A 5ANOA 5BMSA 1V5UA 3LAUA 2RLOA 1A48A 3DY7A 3HVCA 3TUBA 1UKIA 2O5KA 4TXCA 4Z2NA 3R7VA 1W1HA 4JBOA 1J1BA 1YOJA 5JSMA 3P23A 2ITQA 1YWNA 2JP2A 2D4QA 3DBFA 4E6CA 3Q4UA 2YM7A 1PYEA 4DEBA 2HIWA 1P4FA 1XQZA 4KAOA 3P7CA 2PZPA 3R1NA 4R3PA 5AP6A 4J8NA 4IBMA 5JHHA 4ZS4A 4FV6A 3UIUA 5F9EA 3VF8A 4IAKA 4AA4A 1CM8A 3HV3A 3FEHA 2ADZA 4CKIA 4Y83A 3DK7A 3QCQA 4EUTA 5CTPA 5E8VA 4CEGA 4O6LA 4CGAA 4ZRJA 4X3FB 5JZNA 2A4LA 1BI8A 1U29A 2XYNA 4LGDA 4YO6A 2DHIA 2UW8A 3REPA 3S4QA 1Q8YA 2WXVA 4HZRA 2QLUA 4TPTA 3EYHA 3FKOA 1H1QA 4GYGA 4JDJA 2WKMA 5DOSA 5IISA 4FNWA 2BRHA 2QR7A 4WJ7A 5KX8A 3MVMA 4GEOA 3DJ6A 2R2PA 3R21A 4FI1A 5H2UA 4QMPA 4R3CA 3G2FA 3EH9A 5DN3A 3P7BA 3UIMA 2XIXA 5A4LA 3G9WA 3QTRA 3UP2A 1ZOHA 3T3UA 5E4HA 4FG7A 1J7UA 4C4IA 3MN3A 3R2BA 4JOAA 5DG5A 4LL0A 4YHTA 3CKWA 2ZVAA 1XHAA 4AW0A 4E6AA 4NL0A 1OUYA 1H4RA 3Q9ZA 5EG3A 4EOMA 2COCA 1SVEA 2XH5A 1XH9A 2F4JA 1GIHA 3C0GA 5B2LA 1WG7A 4BCOA 4E7WA 5FI1A 4CHMA 5D7AA 5DH3A 5TKDA 4RX8A 3PRIA 2OQBA 2ZV7A 5GINE 2YISA 3TNPC 3BE9A 3NUPA 4KSQA 3LXPA 4O1PA 2IW8A 4DGOA 1MK7B 4MXZA 4CMUA 3DAJA 4ENYA 1QQGA 2VTTA 4M0YA 3QKMA 2Z2WA 2X7FA 5D12A 3OS3A 3ZDIA 3CD3A 2XVDA 4DEEA 5IUHA 3F9NA 3VBYA 4MH7A 3QBNA 2W2WA 5C8KA 3UOJA 5A46A 3HZTA 4PV0A 4K8AA 2GS7A 5L8KA 2D10A 1FGKA 1YWRA 2O63A 2XK6A 2FH9A 3F3TA 3UVRA 4FTJA 3ID6C 2JIVA 2QC6A 3PWDA 4TNDA 2BAKA 5HICA 3R9RA 2UZEA 3E87A 2O64A 4KIOA 1XBAA 3PXRA 3WE8A 5A6OA 4R77A 4HAZB 4FBXA 4KBAA 2K2JA 4NM7A 3BCEA 3PXKA 5IA2A 3C4WA 5FXSA 4YNOA 5C03A 1H00A 1XCGA 4HYUA 2OF2A 4TZRA 4OBQA 3ML4A 1YKRA 2JBPA 3BLHA 2JFMA 5D41A 4BDEA 1WBWA 5H3QA 2OSCA 2CY4A 5BVNA 4F7UP 4C61A 5EDRA 1WGUA 3QRKA 1VYWA 4UALA 5KHWA 4V01A 1WGQA 2BZKB 2XB7A 3B2WA 3DAKA 4AXAA 3S1HA 3R9OA 1T46A 4FC0A 2YSZA 2C6MA 4DE4A 3R8ZA 4GL9A 4ENXA 5JN2A 5BQ0A 5D3WA 2A27A 2J0LA 4GYIA 4UXLA 4OTWA 5A4CA 2X39A 2GPHA 1NA7A 3ODXA 2OJ9A 4ZRIA 5HIDA 3GC9A 3A7JA 3Q4ZA 2B53A 3ZC5A 4M3QA 3FXWA 3WF7A 3BWFA 4L01A 2HXLA 4O38A 2QD9A 3QTXA 4FV7A 3V3VA 2BKZA 3ZSIA 2XIYA 5DRDA 2HYYA 3O7LB 5CAQA 1FPUA 4ITHA 5AR3A 5L81A 1U5FA 3ZVRA 4O82A 1YXSA 4QTCA 4DFZE 4CFMA 2OF4A 5EDPA 4OTRA 4DINA 4DC2A 3KC3A 1R78A 1ZZLA 3MY1A 2C5NA 3SG9A 4JBPA 4BB4A 3H0ZA 2OKRA 4XV2A 3U87A 1OVEA 2VGPA 2F7XE 2JITA 3I60A 3PP1A 4DBBA 1NY3A 4NW5A 2QOHA 4OBPA 5DT0A 3BQCA 5LMBA 3D9VA 2ZM3A 3KL8A 4IWQA 4IB3A 4E6DA 3ZXTA 2XS0A 4OTQA 3A7HA 4XV9A 4HDOA 1H4LA 1J3HA 2XKEA 2XIRA 5M4CA 3KEXA 4F7JA 3FC1X 4FOBA 2BIKB 2YCFA 3PJ8A 5CEMA 3CTQA 3BWJA 2O8YA 2UW9A 3AD5A 3NLBA 4TTHB 4A9SA 3LIJA 4D2SA 2X4ZA 4F9BA 3SGCA 4QTAA 2YFXA 3M42A 3O50A 3QQLA 1X05A 5E7RA 3IOPA 2RG5A 1OL2A 4R6VA 4N0SA 3Q9XA 2Z8CA 4N57A 1Z57A 2ITWA 2C0OA 2QCSA 5AMNA 4RT7A 1MRUA 3VS7A 3OWLA 5BMMA 1DS5A 3NUNA 1H01A 4AZSA 1U5DA 2IW6A 2BRNA 4PP9A 3W2OA 3QRJA 3VS6A 1ZY4A 4RVTA 4BWPA 4MKCA 2YZLA 3UQGA 4JT3A 1F5QA 1M2PA 3R02A 2WMQA 2X8IA 4HZSA 3VHKA 3RINA 3UDBA 3V8SA 2YDJA 2PPQA 3Q9WA 3R0TA 1DROA 5I9XA 1UU9A 4DH8A 2C30A 3LKMA 4PMSA 4DLJA 2XNPA 2VTJA 2WGJA 4MD8E 4CZYB 3UNKA 3I79A 4GJ2A 3IK3A 1B38A 5J7HA 5CSXA 4ALUA 3OBGA 4FT0A 5C9CA 4DX8A 3VUHA 5BYZA 4A9UA 5CF8A 2P33A 4M97A 3ALNA 4RJ7A 4FV2A 5FXQA 4QP1A 3VBQA 1JSTA 4F7GA 4C2WA 3QZFA 4EYJA 4N70A 4F6WA 4O7RA 1ZMVA 4D5KA 5FGKA 2MDXA 3A8XA 4Q5EA 5IQCA 4L67A 4ONAA 2R3IA 2Y8FA 4KRCA 2ACXA 3WF8A 4IMYA 5IQGA 5IG1A 4ZTMA 4FEQA 4X6RA 4QMZA 2GNHA 4LFIA 4CT2A 1PXKA 4FT7A 4G5PA 5CAOA 5KQ4A 4ACDA 2C6TA 4OLIA 4YTFA 3L8VA 3EZVA 3KCKA 5HVKA 5H8GA 3QGYA 1UU7A 4CNHA 3BBWA 3FY2A 4DLIA 3S0OA 3FLNC 3EQFA 1TQZA 3F2AA 4YBKA 3PSBA 3SX9A 2ETMA 2NO3A 1REJA 2JEDA 4HYIA 4JS8A 1U5EA 5C6RA 4XG8A 5D11A 3CXBB 5HE0A 2QHNA 4ASDA 3G9NA 3DZOA 5CAVA 4L42A 1UEFA 2VD5A 3GC8A 3N7CA 4CG9A 1LW3A 4NFMA 5HE3A 2B9JA 3NYOA 3GYOA 1J1CA 4D5HA 3NCGA 5AR5A 4WG5A 5TO8A 4AX8A 2CPKE 1I44A 1LB1A 3D83A 1IASA 4FX3A 4C62A 2JDOA 1BMKA 4IX4A 3WBLA 3LCKA 1YHSA 2R3FA 5JGDA 5HESA 1H28A 4XP3A 3QRUA 1FVTA 3BHUA 3CGOA 2BTRA 5EK7A 5FTQA 3DBEA 3FZSA 4KAXB 3PE2A 1K9AA 5T6KA 4IACA 1PKDA 1OI9A 3ENHA 4BWKA 3QIJA 3NVKI 3A60A 2I0HA 5CEIA 2BTSA 4FZ7A 4HGSA 2X0GA 5J95A 2YJRA 3W18A 5EOLA 4BN1A 3KA0A 3DDPA 3QKKA 4FL3A 1TXDA 3AC8A 4TT7A 1WJ1A 3IPHA 3ERKA 4FTTA 4DN5A 2VTHA 2WOUA 4QMMA 4BRXA 4FG9A 4F9YA 1Y6AA 4CMTA 5CEKA 4FT9A 4BF2A 1XX0A 2PZ5A 3MFSA 2QKWB 3TKIA 5AIKA 4R7IA 4QYEA 3KXNA 3SXSA 2P55A 4DF3A 3I1AA 3LJUX 1I2HA 3FLZA 3ZSGA 4Z9LA 3PA3A 4ZOGA 4BR3A 5AAGA 4O27B 4XNEA 1R39A 4JNWA 3DLZA 4QP2A 3GCPA 4DGNA 3OBJA 5J3TA 1YRPA 4OT5A 4ZSGA 4IW0A 4K2PA 4AP7A 4XRLA 5FDXA 3AC1A 3H9OA 3WF6A 1JAMA 4RX7A 3W2PA 5CLQB 4USEA 4ERKA 4DH3A 2XQNM 3N51A 5KQ1A 4GN1A 4I92A 3VS2A 3W16A 4YTIA 5DNRA 4GZUA 5AP0A 4F9WA 1KZGA 2IVVA 1WBVA 4KKHA 4DH1A 4D2PA 4EWQA 4HGTA 2Z0PA 4I94A 3M1IB 5LVLA 2CKQA 3UTOA 4BDGA 1WVWA 1JKKA 1RDQE 5DBXA 1DDWA 4C02A 4GK3A 3Q04A 3F5RA 3ZHPC 4KKEA 4LM5A 4ZLZA 3TKHA 4F0GA 3ZMMA 3DB6A 4J98A 3V5JA 5LXMA 2MKRA 4WA9A 4Z2MB 2FO0A 3EQRA 3FM8C 1OMWA 4HCUA 3PRFA 4O7NA 2HZIA 1OL1A 5HORA 2W1FA 3GVUA 4HPUE 4YGAA 3SXRA 3ZRKA 5AUUA 4FE2A 3FJQE 5E1EA 5L2QA 4CKJA 4ALWA 5CANA 4DTBA 2WIPA 2XUUA 1H07A 4AUAA 3EFJA 3NMUF 1CDKA 1SM2A 2HWOA 3Q32A 3FL4A 2XJ0A 4EHZA 2OFVA 1PXOA 5ANGA 4EOSA 1FAOA 1YXTA 3UBDA 3F7ZA 3DXDA 2R0DA 3LPBA 2WTIA 1YW2A 3RK9A 3LJ2A 4NW6A 5F4NA 3A62A 3DK3A 2ZV2A 2LGCA 3EFKA 4UY9A 4W4VA 3R00A 3VBWA 4EWHA 5J5SA 3S2PA 4PMPA 3OP5A 3IW6A 5AJQA 4QMWA 3MIAA 4MXAA 5AUYA 1M17A 5DT3A 4MEDA 5AUXA 4BTJA 4YUQA 3QGWA 2D9YA 2XRWA 4XH6A 3EKNA 4FVPA 4JIKA 4AZEA 4D1SA 4HB0B 4BHNA 1DAWA 2Q0NA 4JDIA 4BYIA 1GAGA 5BVDA 3Q3BA 5FQDC 5M56A 4BBMA 4B8MA 1U4DA 2UUEA 1BX6A 4E1ZA 1P14A 2MWNB 4H8SA 4FKPA 2D2QA 2GMXA 5FDPA 3VOQA 3DS6A 4FR4A 2HAKA 4WG3A 4Y5QA 1FHXA 4LOPA 4IVDA 3NVMB 4CLIA 2UVMA 1DYNA 5CAPA 4F63A 3ZFYA 1PJKA 4EQCA 5G6VA 4JAIA 3W1FA 5D9HA 2YM4A 3O7LD 4IZ5A 2VAGA 2RIOA 3A7IA 2VO3A 4I93A 4KS8A 3PP0A 4IJ9A 4K17A 4YO4A 3PPZA 1ZARA 3L8PA 3NNVA 3S00A 2BPMA 2PZIA 3PVBA 2OIDA 4G34A 1PXIA 4ERWA 2YABA 2X7GA 3O8UA 4F9CA 2AUHA 3RCDA 4HVGA 1OIQA 3QX4A 3HLLA 2BDJA 4NM3A 3DFAA 5HOAA 3QC9A 1GG3A 3G15A 3DKFA 5ACKA 2Z0QA 4CZTA 4HPTE 4IB5A 1SVGA 3TW1A 5IA0A 1AGWA 4QMQA 1MK9B 4GT3A 5E8TA 2DHKA 2QKLA 3ORTA 2W5AA 1OL5A 2PUIA 2W1EA 2CKEA 3HV7A 2G01A 3P0MA 5HD4A 5J1WA 2KCJA 2JD5A 3FZRA 3EQHA 4E26A 3LE6A 1H0WA 2OG8A 4ZS0A 3TG1A 5HLWA 4JX3A 3HEGA 3KRXA 2XNNA 3TZ8A 4E6QA 2J5EA 2B9IA 4LUDA 2E9UA 4Z7HA 4FZ6A 4ZRKA 2CGVA 2X7OA 5K4JA 3UPXA 1OKYA 5ITAA 3KULB 3P5KA 4FTUA 3G6HA 3HV5A 1V61A 2PUUA 4ZSJA 3PTGA 5KBRA 2LOXA 5DT4A 4QP3A 4KHBB 2GNLA 3BGZA 1X8BA 1Y8YA 3P1AA 3FXXA 3AC3A 4J95A 3O17A 5L2SA 5IQFA 2I0VA 3FPMA 3GQLA 3PFQA 4BDJA 2O2UA 3BU6A 4XP0A 3SYXA 2C68A 2UZWE 4WVFB 4FT3A 3EFLA 3U9CA 4F64A 2XK4A 3VWAA 3VUGA 4CYIA 4G16A 5M55A 4R78A 2H96A 3F7WA 3R1QA 3W2CA 4Y72A 3G0EA 4H3QA 3KN5A 3NEWA 4FOCA 4XUFA 4L3JA 5CASA 1YHWA 3P6AA 4YPSA 3NUYA 3RM6A 1PXJA 3ZEWA 2OIBA 1OPJA 2JGZA 3F69A 4FTIA 3LMIA 3PIZA 2W2XD 2RVBB 5F20A 3RK5A 4MWHA 2WMRA 4GT5A 5D7VA 4D4YA 4O7TA 5CNOA 5EYKA 2EVAA 3NUXA 4C33A 4MXCA 2XK3A 2ZYBA 3GFEA 4EOQA 1Y5OA 2CODA 2CN8A 3AG9A 1OKZA 5CQWA 2LAVA 1SGHA 2KGXB 4UWYA 3VHEA 3BX5A 3LCSA 2ZPYA 1KE7A 2E2BA 3D5VA 3V51A 4DFXE 4EEVA 3BINA 4FYNA 5EM6A 5FM3A 4DEDA 4QT1A 2ELAA 2QOQA 2QVSE 3P78A 1UNHA 4XV1A 4TYHB 1E9HA 4AFEA 4PQ0A 3DGKA 4FKLA 3CJGA 5AX9A 3VJOA 4FIIA 1BUHA 4U81A 2PZYA 5EYMA 2EJ8A 2B1PA 3CE3A 2UZTA 2C5VA 2J0KA 2R3KA 3HUCA 3NZ0A 4ZXTA 5CENA 4C0AA 4ANOA 4BTMA 5BVOA 3AT3A 3D15A 4NK9A 5C01A 2KTYA 4FKSA 3JPVA 4I1ZA 2EB2A 3EOCA 4ITJA 3PSDA 4PDPA 3V6RA 4BKJA 4CD0A 2YIRA 5JQ5A 3ULBA 1WAKA 3CY2A 4A5KA 5DH9B 4ASXA 2Y8OA 1RJ2A 4BCHA 2EWAA 4MXYA 3K2LA 3VVHA 2G1TA 4BCFA 2I7QA 2FSMX 3P7AA 4QMTA 4IDVA 3H0YA 4U45A 3AJ4A 4PL5A 2VX1A 1KOAA 3MA3A 3B8RA 4DBNA 2Y8GA 3HMIA 2CDZA 4A07A 3E92A 3BHHA 4DFYA 3UMXA 2HZNA 3U9NA 5J5TA 3UZTA 5JKGA 3WYXA 3TCPA 5C79A 2ZMCA 5JT2A 2UVYA 3BYUA 1XH8A 2PMLX 4PPCA 1K5DB 4QQ5A 4A9TA 4NCTC 3S95A 4BCIA 4DGGA 2PVJA 4RIXB 3LVPA 4XG4A 3TNWA 1Q99A 4HJOA 3POOA 4M67A 5M09A 5HIEA 3OFMA 2DYQA 3COHA 3NNXA
chains in the Genus database with same CATH superfamily
4NTSA 1FGIA 3JYAA 2W5BA 4PPAA 1LP4A 3R7EA 3ZBFA 5GZAA 4BCKA 5GIPE 4JR3A 1V0OA 3KY2A 2R4BA 4U7ZA 4AF3A 5AAEA 2EU9A 5HCZA 4NY0A 2YACA 3A8WA 2COAA 1E1VA 3IGOA 3S3IA 1IR3A 1EGXA 4F65A 2DFKA 5D10A 5HHWA 4BCPA 5IMEA 1UNQA 3ZO1A 2CNUA 2PYWA 5DLSA 4FMQA 5EHOA 2P4IA 3ZFXA 4BL1A 4LGGA 4D58A 4MNFA 2G9XA 2HOGA 3FSSA 2YWVA 4CVAA 4QP9A 4ZSAA 1ISNA 1V5MA 5IQEA 2F7ZE 2VWIA 3GCQA 3NWWA 2FVDA 4DXAB 2GQRA 4AZFA 2YLFA 3RPVA 3ZO4A 3GCVA 3CIKA 3CR0A 5E90A 3W8LA 4O84A 4OW8A 1AQ1A 4OR5A 4X3FC 4Y5HA 2ROVA 5KUPA 4AGCA 2W1GA 4EH5A 4ANQA 5E91A 2NNWB 2JDSA 4DT8A 5TE0A 4PDOA 1JSVA 1GZKA 4IIRA 3WF5A 3W0SA 1MIZB 3ZEPA 3FMKA 4AFJA 3FE3A 4EK3A 1JQHA 2WQEA 2ZM1A 3QRIA 4AS0A 4V0GB 2BUJA 2FSTX 2WQBA 3U7DA 4KHBA 2ZJWA 4YHFA 2XMYA 4GFOA 4RVMA 5CS6A 3R7OA 2PVLA 3PA4A 2P8VA 3MA6A 5FD2A 2E9PA 2WOTA 3MPTA 4ITIA 5GJGA 1T77A 4AQKA 5BUJA 3IG7A 5K4IA 2A98A 3R2YA 3FHRA 3ORPA 3W32A 1NVQA 4QYFA 1M14A 4CFXA 3Q9YA 5A4EA 2DA0A 3GUBA 2RG6A 2A1AB 4MNEA 3ZO3A 4EKLA 3TCAA 3IW4A 3QTUA 3GC0A 3EL8A 3NRMA 1YHVA 1DM2A 3F2NA 3FZPA 2DX1A 2CGWA 1ZOEA 4CMOA 4GFGA 3ZTXA 2G2IA 4ZLYA 5L2TA 1XKEA 2CGXA 4CV8A 3SDJA 4CCUA 3DLSA 3A98B 4TYZA 4WNKA 2JKKA 1BL7A 5HVJA 2YS5A 3Q6UA 1GY3A 3FWQA 5A6NA 4BC6A 1URWA 3FC2A 5KMKA 2DS1A 5LVNA 5BVWA 2Y6MA 3RAWA 3OD6X 5M4UA 4C4FA 2AEGA 1PW2A 5AR4A 4D1ZA 1TVOA 3A4OX 4HDQA 3WA0A 3FQEA 1QL6A 3U54A 4L53A 5IU2A 3E8CA 4IAYA 1FQ1B 5I5ZA 2OJGA 3R1YA 4Z7GA 3PEGA 2R7BA 4YR8A 1VR2A 4ZY5A 2E9VA 1OPLA 3FHIA 4QQCA 3MH2A 3JY9A 3OMVA 3PJ3A 5DR9A 5AV2A 2JBOA 4OAUC 3B2TA 4MBJA 5ETIA 5AA8A 4NH1A 2VO0A 4K77A 3HW2B 3IKAA 1NI2A 3TIYA 4CCBA 1CKJA 3LJ0A 5C5BB 1V5PA 1X1FA 3D2KA 4IH8A 5AEPA 3FXZA 4JL9A 2BROA 2Z7QA 4WRGA 4AXCA 4F78A 4YMJA 3TUDA 4ZMEA 3HL7A 2GS6A 2X6DA 4O0TA 3KF4A 4KB8A 1JSUA 2BZHB 2I40A 4YP8A 4XV3A 4Q9ZA 2Y4PA 2XAOA 4YC3A 1VEBA 1J7LA 1MQ4A 1SZMA 5KBQA 2WEVA 1M52A 3PIYA 3GP0A 3EN5A 5I9WA 5DHJA 4G17A 3DFCB 3HSAA 4FNYA 4MXXA 4ZLOA 5B2KA 5GNKA 4PTCA 3P79A 3ZYAA 4IAIA 4YJSA 2QURA 5LMKA 1Z9XA 3LFQA 5M07A 4EORA 2XRUA 2ZDTA 5ANJA 3PG1A 3D4QA 4FNZA 4GJ3A 3PZHA 1KSWA 5BVFA 3ZONA 5L8LA 4C57A 2Z02A 3BQRA 3LFNA 3OZ6A 4IWOA 2QODA 4KABA 4EJNA 4CKRA 5CF4A 3GCUA 1PF8A 1ZOGA 3UNZA 4BCQA 2OBJA 5ANDA 3A8QA 1VJYA 3C4FA 3HV6A 2IF8A 5KE0A 3GENA 4V05A 5E92A 3E8EA 4OTDA 3OW4A 4Y85A 4N6YA 3BV3A 3T8OA 1U59A 3CQEA 1QPDA 2P3GX 2PHKA 2WIHA 4X2GA 4ZAUA 3MESA 3LM5A 1HOWA 4GW8A 4TKSA 3D8DA 4PQNA 4NIFB 2QI8A 4K0YA 4EKKA 3LQ3A 4DTKA 3NUSA 3GU6A 3DZQA 4AA5A 1ZMWA 3FSKA 2XCKA 4D9UA 4S34A 3I5NA 2F2UA 3PUFC 4CQEA 4IM2A 1O6LA 3KMUA 1W8CA 2YJSA 3P7ZA 5LMAA 5CX9A 2QOCA 3QD3A 4O0XA 3ZM9A 4RG0A 3RBWA 4DEGA 5CXZA 2COFA 2BIYA 4F6SA 1TQPA 3VUKA 4DHIB 3BI6A 4BZNA 3I0OA 3AMYA 3D0EA 3HMNA 4BI2A 2NZ8B 4B4LA 5C4LA 4XG3A 2QOKA 5IPJA 4AQCA 3GFWA 4KIPA 4OTGA 4FSTA 4GIIA 4AZWA 5IH6A 2IPXA 3I6UA 3EB0A 3MWUA 2QHMA 3EWHA 3LFBA 4FA2A 1OPKA 5HGIA 3AOXA 2SRCA 3OCGA 2GCDA 4MQ2A 4UZDA 1Q3WA 3TKUA 4CSVA 4V0GA 4X2NA 1CKPA 4M69B 2ETRA 4TWPA 1U27A 1H10A 5AUWA 2EXMA 4DCEA 4I4FA 4BI1A 4QTEA 1GJOA 3UMWA 5AIRA 2PUNA 4U9AA 1CTPE 2ITXA 4K6ZA 3SG8A 5CNNA 5EQYA 5IQDA 2YT1A 5EKNA 3W2QA 2NP8A 4UB7A 1BYGA 2P0FA 3QD0A 5CALA 4BCGA 5TR6A 2YAAA 3QX2A 4FK6A 4RX9A 5IRSA 1A9UA 2GHMA 5FEEA 3HGKA 1ZXEA 5GHVA 3AC4A 1ZAOA 4NKAA 3DCXA 3PE1A 5DR2A 4ALVA 5AA9A 5K3YA 4D28A 3DKCA 4ANLA 2RF9A 5I9ZA 1TQMA 1BAKA 5FP5A 3CEKA 2XNEA 4YU2A 2XIKA 4HW7A 4JBVA 4MBIA 3BLRA 5FTOA 1Q67A 3R8LA 4FSYA 3SAYA 3ULZA 4CFVA 2YS1A 3L9MA 5KCVA 4M0ZA 3R8MA 4GUBA 2I5CA 4EZ5A 2X8DA 2W2XC 3VW8A 3AD4A 5FTGA 5HCXA 4CV9A 3V5PA 2K49A 3SLSA 4E5BA 1NVRA 4RIYB 4O96A 4YZMA 4JRVA 4FSNA 5AM6A 2QLQA 2WB8A 3TO1A 3DOGA 4O7YA 3R6XA 3GT8A 4LDTA 4O7LA 4GU9A 5A54A 3DBCA 1O6YA 4NZWB 3OY3A 4K9YA 4NCTA 3E3BX 3LFSA 3ZDTA 3QLFA 4IFCA 5A3XA 5IQHA 3OCTA 4L46A 4WIHA 3I4BA 3ZU7A 3HA6A 1PFJA 3DXEA 2XK8A 4O0WA 4ASEA 5AUTA 4MX9A 4TWNA 3AC5A 4IZAA 1RE8A 3KCFA 2B0QA 3UIBA 4DHFA 1EH4A 1XH4A 3QXPA 4XX9A 3TTJA 2V55A 2RSVA 4C2VA 1P6SA 3SRVB 3P5JC 2DN6A 5C5BA 4JI9A 1KOBA 5CSHA 3GYPA 4KWPA 4QJ5B 1OBGA 4BIEA 3BPRA 2R3MA 3ULCA 4U3YA 4YLLA 5EM8A 4BYJA 1IRKA 4C38A 1U5QA 1PKGA 3FI3A 4EKUA 4TL0A 1QPJA 2C6DA 2G15A 3ALOA 1PHKA 2Y4IC 4HGEA 4TYJA 4X6QC 4UMUA 3MTLA 3V5LA 4HNIA 3BEAA 3ACKA 1UWJA 4G9RA 4YZBA 1Q5KA 1WBOA 2RFSA 5LCKA 3TACA 2J4ZA 3ZS5A 1UNLA 4EQMA 2JIIA 2VWVA 2DYLA 5CU6A 4HHVA 5DHFB 5HTIA 3DXNA 3ANRA 5HE1A 1FHOA 3NDMA 5KKRB 4X3FA 4GMXB 2GNIA 5A9UA 2C6EA 4J53A 1OECA 4K11A 4LUEA 1GC6A 4RX5A 4YHJA 2YZAA 4E4MA 3HRBA 4RPVA 4W4YA 3I0QA 1F0QA 3U6JA 2PL0A 1NT2A 4L68A 5E8ZA 2VRXA 4ZTQA 1ZYIA 2REIA 4AT4A 4RQVA 3ZUTA 1I7AA 5ANEA 5CVGA 4ZTLA 2O3PA 5EHLA 2UV2A 3LXNA 1W84A 2HE7A 3X23A 5HO7A 4JG7A 5C27A 3LLTA 4ANNA 4RA4A 5HX6A 3GU5A 2DYNA 2L2IA 2J0IA 1VLRA 1YDSE 3W8QA 4E93A 3QWKA 2Y6OA 4PWNA 4XG2A 4RMZA 3SOCA 3D5WA 3O0GA 4YLKA 3U12A 3Q4CA 4M7IA 4XG7A 5K0KA 3QYWA 4IC7A 4LGHA 2ZMDA 3JXWA 3NYXA 4KKGA 4O0RA 4ZSLA 3ZFMA 5DMZA 4Q5HA 2ONLC 5DIAA 4KRDA 3TV6A 3KB7A 3Q2MA 4EH9A 3EN9A 2RL5A 2UZVA 3PYYA 1YVJA 2ERKA 4PDSA 2J50A 1G3NA 2I1JA 1O9UA 3OG7A 2PZRA 4F9AA 4G3CA 4G3FA 4LI5A 2WTKB 4UBAA 4HVDA 3FV8A 1YQJA 3AT2A 2X2KA 1V89A 1IG1A 2CHLA 2EB3A 3E63A 4R1YA 1ZYLA 4E4LA 5CT0A 4C34A 5LVOA 4HB2B 5IMXA 2VV9A 4GG7A 3LLAA 4Y95A 4M69A 4YC8A 2YS3A 3KRRA 3OW3A 4NUSA 4BTKA 4B6HA 3L1SA 3QA0A 3HP5A 2V5QA 3M2WA 4RFYA 2RUKB 4D2WA 2IVTA 4ZJIA 2Z0OA 5ACBC 1XH6A 2HXQA 2WU6A 3W2SA 5AX3A 3TEIA 4KSPA 4CXAA 3C51A 3MSSA 1Q8ZA 4JIAA 4U3ZA 3G6GA 3FPQA 3WZEA 4UMPA 4FZFB 4XBRA 5CZIA 5FWKK 4GCJA 2YM8A 4XLVA 3AKLA 1SNXA 1WVYA 1HCKA 4RZVA 5C16A 1H1SA 4U41A 4MF1A 2IZRA 3OROA 4I5MA 4IX6A 4UWCA 2X6EA 3UG1A 4IB0A 4J1RA 4YJVA 5IF1A 2Y4IB 1OIRA 2ITTA 4GK4A 5CSWA 3KMMA 3PFYA 3NSZA 2NBVA 2W5HA 1Q41A 3PJ2A 4I3ZA 1UV5A 2J9MA 4MYGA 3UVQA 3ZM4A 4EYMA 4EOLA 3AXWA 1UNPA 2R09A 4WD5A 1YDRE 1Q4LA 3AT4A 3I81A 5B2MA 3JR1A 3QF9A 3F2RA 3HKOA 5EM7A 1H25A 2NMBA 1WMKA 3LHJA 4YZNA 5E8XA 1WCCA 3IONA 5HNGA 5KHXA 1JOWB 2CGUA 2OICA 4DCAA 1Q8TA 3NW6A 3GCSA 4GVJA 2W17A 1SVHA 2GNGA 4FV4A 4H58A 3A7GA 1UVRA 3MH3A 3COKA 3F5GA 3QQUA 4N6ZA 5LQFA 3D8FA 3GU8A 3RAIA 2A19B 5E9EA 4EMOA 3C7QA 1H1PA 3VIAA 3W2RA 1XBCA 3NS9A 2WTCA 4FIEA 4FKTA 4QMOA 2IEWA 4EOKA 5G1XA 3D7ZA 4AACA 3FZTA 4FKJA 4BDDA 3ZOSA 1V1KA 2ESMA 2FB8A 1W82A 4HVIA 5HU3A 1MP8A 1PMNA 3TNQB 4QP7A 1BKXA 4E5AX 5EQPA 2YWPA 3NR9A 5EFXA 5FUTA 3FI8A 1PMSA 2UZUE 3LXKA 3WARA 3FYKX 3BYMA 5A14A 5CEPA 4P90A 4RZWA 3KSYA 4BBKA 2VTAA 5FP6A 4A6KA 2FYSA 2CKPA 4BBFA 1ND4A 2BRGA 2C69A 2ZV8A 2R3OA 2DKQA 1KV2A 3CCNA 1WVHA 2G35A 5AP1A 3NNWA 3LZBA 2OIQA 3KY9A 4YONA 5FRIA 4C4JA 3P86A 4CFNA 4UMTA 5CSPA 2V7OA 5IEVA 3TV4A 4QQTA 5JFSA 2BAJA 3Q5IA 3TV7A 1ZVRA 2CKOA 3NIZA 2UW5A 4RRVA 5D3VA 5ANKA 4L3LA 4FV3A 3TTIA 4S2ZA 4FIGA 4H36A 3UO6A 3PPKA 3OVVA 2RKUA 4IC8A 5JGBA 1ATPE 5LARA 3C4XA 3QUPA 1G8KA 5BPYA 4BCJA 2QOIA 4D55A 4J71A 4ANSA 3WZKA 2X9EA 3C5IA 3B8QA 4KHAA 3MVLA 1NTVA 2ITZA 2ITYA 5E1SA 3Q4TA 4MY6A 3BU5A 3RK7A 5M57A 4QMYA 3MH0A 4TYEA 2YIYA 1YWVA 3ZZEA 3ROYA 3H9RA 2YLEA 2UZNA 3T9IA 1ZY5A 2F49A 1NXKA 4I0SA 3KRJA 4AW5A 2D9WA 5KMLA 2C3LA 2UW7A 4S30A 4BBEA 3U6HA 4O21A 4RGJA 5IA3A 3RAHA 2X81A 4IANA 4ACHA 3FLQA 3UO5A 2HW6A 2XF0A 3FSFA 1JKTA 2CJMA 3C4CA 3EZRA 4YJPA 5CSVA 5E8WA 5EHYA 4ZSEA 5FBNC 4P7EA 4EOOA 3SVVA 2C0TA 4ZP5A 2UZRA 3WOWA 2R0IA 2V22A 3V5WA 4RIOA 3TDVA 4HAXB 3LCOA 3RAKA 4X21A 1YI3A 3DK6A 2VKIA 1E1XA 4EZ3A 3RJCA 2VWWA 5HBHA 4M68A 5HIBA 4DFLA 4FKIA 2J7TA 1Y8GA 5HTBA 2H7EA 2WMBA 5JP4A 4WNPA 1GNGA 3QZGA 4UYAA 4ZTHA 4EHGA 4BJJB 4NJDA 3MV5A 4FKVA 4O2PA 4PL3A 2OK1A 4EBWA 4BY9E 3G9LX 4FGRA 3CXWA 1ZZ2A 4L43A 3R9HA 5JFXA 3IDCA 1MUOA 2JLDA 1Q3DA 1VZOA 3E8DA 4FF8A 3BKBA 4DFBA 4IJPA 2W4OA 4W4WA 4C37A 2W9ZB 3CLYA 3R7YA 4II5A 1E5WA 4QYGA 1JPAA 1S9JA 4MVFA 2WNTA 4ZJJA 4QQJA 4YC6A 2UW4A 5BNJA 3NYVA 4K2RA 1H1RA 1H8FA 3LFDA 4DA5A 4AZTA 2DLWA 4K2OA 3PWYA 4WSFA 2W1HA 3LQ5A 2I5FA 2X9FA 1ZC3B 4FV5A 4I6QA 5FI0A 3BELA 2B54A 2HY81 4AXEA 2YITA 3OWJA 4E73A 4AW2A 2C3IB 3O8TA 4GV1A 1CMKE 2WFYA 4AGDA 4J8MA 5K0XA 2WTWA 3CJFA 4YJQA 2QG7A 3QCYA 2OW3A 4L00A 4S32A 3OCBA 4G31A 5J9LA 3D5UA 1XODA 2Y7JA 2GS0A 3RPYA 5DIFB 4MXOA 2GHGA 4GUEA 4HYSA 4PPBA 3NYNA 2XBJA 4MQ1A 5F1ZA 3WZDA 3NNUA 3VS0A 3DXQA 4IVBA 4DG2E 3K3IA 3WILA 2YHVA 2JKMA 2PE0A 4D4RA 4OAVB 2YDKA 3FZOA 4YJTA 2N0YA 5DYJA 4U42A 4AOJA 1XMMA 3TM0A 2C6LA 3ORLA 3U8ZA 3MDYA 2F2CB 3G5DA 3MVJA 2JKQA 4ID7A 3QC4A 1L8TA 1YXXA 3UQFA 5IA5A 3VC4A 4OTIA 2GSFA 3VQHA 4GNKB 2DQ7X 2W96B 4XG9A 5L6WL 2BDWA 3HRFA 4BICA 1O6KA 4WRSA 4I41A 4YLJA 5IEYA 1X1GA 4HSIA 4CFWA 5EH0A 2JKOA 5AP4A 3D7TB 4KNBA 3R9DA 3ODOA 3KFAA 3QQGA 4DAWA 4UYNA 4P5ZA 4U79A 2KULA 2WQMA 2CY5A 1ZYCA 3GC7A 3DA6A 3E7OA 5JGAA 5I3OA 2ONLA 3U4WA 3KK8A 4JRNA 4EZ7A 4I6FA 3GOKA 4AE9A 2JC6A 3LOKA 2R9SA 3MIYA 4CLJA 2B9FA 2IVSA 3UJGA 3MY5A 2QO9A 5GZ8A 5KO1A 4USDA 4FVRA 3V01A 5BVEA 4C58A 3QU0A 4FTOA 3ACJA 5JEBA 4JG8A 4ARKA 4A7CA 2YIWA 4EOIA 5BX0A 3O5AA 4ORKA 5J79A 3F3WA 4I23A 4I21A 4IM3A 5CT7A 2VSZA 4IVAA 4F4PA 5LOHA 1ZRZA 5KMIA 3PXFA 5KZ0A 4OTPA 4FRFA 4CFUA 2J6MA 2YVCA 2OZAB 1APME 2FSOX 2QU6A 1V0PA 3ANQA 4OTFA 3FY0A 1WZYA 1KWPA 4PTGA 3ZLWA 1IEPA 2D9VA 3FAAA 2WTVA 2IW9A 5D1JA 3UVPA 4B8LA 5HG7A 2PVNA 3C4EA 4QYYA 4ANBA 4O0YA 1ZWSA 3BIZA 3L8XA 4RIWB 5L2WA 4GPTB 4YPDA 4BCMA 3MTFA 3SOAA 1U5GA 4U40A 2W9FB 5IH5A 3HK0A 2HELA 2VWUA 2PY3A 2Z7SA 3CTJA 2R5TA 3OHTA 5JLJB 3O51A 5CWZA 2DX5A 3BHTA 2BKKA 2QONA 5GOWB 3MJ1A 1W83A 3FMMA 1UNGA 5AFVA 2Z59A 2W1CA 1XO2B 3FMDA 3HX4A 3MFTA 4FV0A 1M7EA 5AV1A 4D6WA 3M11A 1QPEA 2Q0BA 3OOGA 2IO6A 3OTVA 4GFMA 4P5QA 4V04A 3TIZA 2WU7A 4QTDA 3RNYA 4FKUA 4H1MA 4EONA 4WSYA 4XLIA 1J19A 1Q97A 3G51A 4D0XA 1M2RA 3LFEA 3ROCA 3DXCA 1MAIA 3NW8A 1W98A 4FV8A 3VUDA 2VTOA 3FUPA 4A6HA 3NGAA 4Y94A 4RJ5A 2ITNA 5HU9A 5M44A 2OLCA 4FKWA 4OTHA 3VIDA 3ORMA 5HCYA 3ELJA 2OGVA 3BBTB 4R3RA 3JVSA 4C3FA 3TNIA 3N4TA 1W0XC 3WF9A 4O22A 4RWIA 5AUZA 2GCLA 2Z4DA 3POZA 1FVRA 4YL8A 3GU4A 3SHEA 5CLPA 3IW7A 4R7BA 4F7NA 2R0UA 3QTQA 3RZBA 2H7DA 3MPMA 2X4FA 3QZIA 4L8MA 5AADA 5BUIA 2GHLA 5IQBA 3ITZA 4QMVA 4DITA 1YI4A 5BYLA 2L1CA 3VUIA 1ZSQA 4MD7E 1MI1A 4FIJA 3EN6A 2PVMA 4LQMA 3RPOA 2R7IA 1Y6BA 5JMSA 2EMSA 4RA5A 2YEXA 3KZ1A 3H9FA 4QP6A 3IECA 1B55A 2GTNA 4DHZA 4RWKA 4IE9A 5EW9A 3ZLXA 4O7VA 3QL8A 4NU1A 4QTBA 5B0XA 3VBTA 3IW5A 1Y57A 3CSVA 3GQIA 2CN5A 2M38A 2WTJA 4BHZA 4GG5A 2C1AA 3V04A 4X2KA 3E93A 5EYCA 3VULA 3WIKA 4B99A 2XEZA 4CG8A 3K5UA 3PJCA 4MF0A 5AP7A 5I9VA 2VX3A 3LJ1A 3F66A 3UNJA 4QDVA 4IOYX 4X7QA 3KXXA 2K8EA 3F3VA 4FV1A 2YDIA 2VNYA 4TWOA 4IAZA 4EH6A 3ULIA 4FKQA 5CI6A 3PUPA 3II5A 2GU8A 4FL1A 4IVCA 1J91A 4F99A 3ZO2A 2JDVA 2UW3A 2ETKA 2AC3A 3RPRA 3QTSA 1OIYA 3CPCA 5JFVA 2C0IA 3G0FA 4FODA 4RC4A 5FXRA 2ZB1A 2PU8A 4A4LA 2VTRA 4FK3A 4EL9A 1PLSA 3IDBA 3OF0A 5E8SA 2J0MB 3FI2A 1T45A 4KBKA 4D2VA 4FYOA 1SMHA 4JVGA 3BGQA 2ZM4A 2PTKA 3M1SA 4WG4A 2PMOX 3D7TA 4UN0C 1JWHA 4JLCA 2FJLA 3FMNA 3ZBXA 1GZ8A 5LJJA 2ITPA 2WQNA 5FBOA 3RWQA 1R1WA 3Q2JA 3KULA 4ZZOA 1OGUA 1U5RA 4FTAA 5ICPA 2DHJA 4CYJA 2W7XA 3BRBA 4JR7A 3OEFX 3Q5ZA 3PXZA 4K18A 4L44A