5KCVA

Crystal structure of allosteric inhibitor, arq 092, in complex with autoinhibited form of akt1
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
433
structure length
353
Chain Sequence
IVKEGWLHKRGEYITWRPRYFLLKNDGTFIGYKERPAPLNNFSVAQCQLMKTERPRPNTFIIRCLQWTTVIERTFHVETPEEREEWTTAIQRVTMNEFEYLKLLGKGTFGKVILVKEKATGRYYAMKILKKVLQNSRHPFLTALKYSFQTHDRLCFVMEYANGGELFFHLSRERVFSEDRARFYGAEIVSALDYLHSEKNVVYRDLKLENLMLDKDGHIKITDFGLCPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHEKLFELILMEEIRFPRTLGPEAKSLLSGLLKKDPKQRLGGGSEDAKEIMQHRFFAGIVWQHVYEKKLSPPFKPQVTSETDTRYF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/inhibitor
molecule keywords RAC-alpha serine/threonine-protein kinase
publication title Discovery of 3-(3-(4-(1-Aminocyclobutyl)phenyl)-5-phenyl-3H-imidazo[4,5-b]pyridin-2-yl)pyridin-2-amine (ARQ 092): An Orally Bioavailable, Selective, and Potent Allosteric AKT Inhibitor.
pubmed doi rcsb
source organism Homo sapiens
total genus 90
structure length 353
sequence length 433
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2016-06-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
A PF00169 PH PH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 5kcvA03
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 5kcvA01
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 5kcvA02
2C30A 4ASEA 2MFQA 1J7IA 4FIFA 4QP1A 4BBFA 2Q0BA 5DWRA 3WE4A 5KHWA 2AEHA 4NJ3A 4E4XA 1K3AA 4AZSA 2CPKE 2OJ9A 5F1ZA 5BVDA 3F3WA 2UZUE 4GW8A 2E9UA 3H0YA 1JPAA 3HEGA 1YXXA 4IJPA 5IH6A 3MPTA 3HA8A 1XBBA 5JFXA 5K0XA 4ZRIA 2JDRA 2FSLX 3LCTA 1NVSA 4J7BA 3ODOA 2GSFA 5K5NA 4PY1A 3FMEA 5DI1A 3WARA 4EH6A 3A8PA 4R3CA 1GZOA 2J4ZA 2WMVA 2EXMA 5FQDC 1GC7A 5BYZA 2R3PA 3O8TA 1O6KA 4QYFA 5AAFA 4AACA 4GMXB 4HYUA 4D2SA 3ZVRA 1TJ6A 4KBKA 4X2JA 1G3NA 1YWRA 2C69A 2QG5A 2WMRA 3W55A 4EK5A 5HLWA 3UG2A 1I44A 3PTGA 3IECA 3HW2B 3QQJA 3IVFA 5HNGA 4XV9A 4Y85A 4YC8A 4EJ7A 4UYNA 4R5YA 5D3VA 5CI7A 5C4KA 2XYNA 3R7YA 2CY5A 4NL0A 4U44A 5FXQA 3T3UA 1OECA 4ZTSA 5H9BA 4BZDA 4YMJA 1JOWB 5KNJA 3UIXA 3COHA 2O65A 4G6LA 4RVTA 1J91A 1BTNA 4HAXB 5CVHA 2IW8A 4JBPA 3F7ZA 4EC9A 4ZS0A 4IXPA 2XIRA 5ETIA 2OJJA 5C6RA 3B8QA 4PPBA 2M14A 4GVAA 4F63A 2YCQA 3CTHA 4JQ7A 5EM6A 4AGCA 4BI0A 1BMKA 5KUPA 5KX8A 1M7EA 4WUAA 3R8MA 4EYJA 3SW7A 3FI4A 4ZRKA 4C2VA 2CN8A 3DJ5A 3HMNA 2JKKA 4PDOA 2I0HA 2XEYA 3HRCA 1J7LA 1UNGA 2VNWA 3PP0A 1WJ1A 4FTAA 4JX3A 2C5YA 4O81A 4D1ZA 3KN5A 4CCBA 2OXXA 2QHMA 4X2NA 3JVRA 2XNGA 1PXJA 3PA3A 4KIKB 4NFNA 4R7IA 3RBWA 3G9WA 5D27A 3FKOA 3PJ1A 3SGCA 1P4FA 4B4LA 2QO7A 5GZ9A 2XB7A 4EH3A 2DYQA 4MWIA 5KQ4A 4IM3A 4LRKA 4IHPA 4ALUA 3A98B 3KRXA 4IVBA 5TR6A 2YM6A 4YSJA 3N7CA 5AV0A 4TL0A 4O0VA 3W2OA 1P5EA 5D7AA 4ANNA 4WSYA 2W4JA 4FODA 4U80A 3SC1A 1YXVA 3QL8A 2PUIA 4EOKA 4QO9A 2XKEA 4PPAA 4DBBA 1Q8WA 2X8EA 3OCBA 2P0CA 3OBJA 3OUNB 4CFFA 1ZYLA 5AX3A 4ZTMA 4IZ7A 1Q8UA 3F0WA 5CNOA 4NKSA 5BVNA 4S33A 2VWWA 5IA1A 3H9RA 3U55A 1ZYJA 4XMOA 4C2WA 4DG0E 3H10A 3IQ7A 2BR1A 3BGQA 3OBGA 4MBJA 3UPXA 2GTNA 3HRBA 4IADA 3NAYA 5L8JA 4O27B 4O0SA 2A27A 5B2KA 1STCE 1SVHA 5DR9A 3PPKA 3VS0A 4EBVA 1K5DB 2XZSA 3OCTA 2D11A 1ZRZA 2XIZA 3KY2A 4U45A 3FQEA 4QP2A 3RM7A 4BDHA 4O96A 2RSGA 2RKUA 3R04A 1UKHA 1YOJA 3HMIA 4CKRA 3HUCA 4KKGA 3FLWA 5DMZA 3I6UA 1X11A 1OL5A 2RVBB 4I22A 3UBDA 5DEWA 3HA6A 3OT3A 4BBEA 1SM2A 3C4FA 4W9XA 3DGKA 3FXXA 4MT7A 1GNGA 3UNKA 4YJSA 3AD4A 3HDNA 3TACA 2YM5A 1Y8GA 4B6LA 3V5QA 1WBOA 2XKDA 3L9LA 4G3GA 4R78A 4GFOA 4NYEA 1A9UA 5J7HA 4WG5A 1QL6A 3Q4TA 5HTBA 3E8DA 3KMWA 4RFYA 1I2HA 4FV5A 3OWJA 3RK7A 5J9LA 4O7LA 5IEVA 5CU6A 1H1SA 3U6IA 3FMNA 2QNJA 2RGPA 4ZLZA 2UVZA 3ZSIA 3BCEA 1P3RA 3MDBC 1VZOA 4TYZA 2B55A 4KS8A 4KHAA 3QHRA 2WAJA 5EOBA 4CFVA 4EOIA 4NY0A 1H07A 2VGPA 4TWNA 4RX7A 4AFJA 2QLQA 3DFCB 1B38A 4F7NA 4XOZA 3KF4A 1U59A 4AW1A 4I94A 1OM1A 2J5FA 3EJ1A 1PKGA 5EDQA 2QC6A 3GEQA 2V22A 3I5NA 4ZP5A 5HG8A 3ZM4A 3SAYA 4AA5A 5EKNA 4O91A 4UEUA 4J71A 2YRYA 4DHFA 2OBJA 3D8FA 4USEA 4HAVB 4EH8A 3ATTA 4JIKA 4ORKA 3QC9A 4F65A 4IAZA 3MIYA 5DRDA 4KHBB 5IA4A 3ZTXA 4JNWA 3U8WA 4PPCA 3CY3A 5LVMA 5IG1A 4ZJIA 4CZTA 3MIAA 2HWPA 4W4YA 1O6LA 2YM3A 3NNXA 3OXZA 1AD5A 4NIFA 4R5SA 1VYZA 3PRIA 2WXVA 3TV7A 2COFA 1TVOA 5AR8A 3ZFXA 2PSQA 4OBQA 4BDJA 3LHJA 2YITA 1X1GA 1PRYA 3QYZA 3TNQB 1JBPE 1M2QA 3UG1A 2Y7JA 2YWVA 2JC6A 4TKNA 4NKAA 3TTIA 3GC9A 3KC3A 3TV6A 4HYIA 3RCPA 2IFSA 5J3TA 3QTWA 4AFEA 3EQIA 2E9VA 3DBDA 4BCOA 2LOXA 2UZTA 3LFCA 4X3FA 2B0QA 1OMWA 2FA2A 3KN6A 3RZFA 3AT2A 4GZUA 3NUPA 5C4LA 2EWAA 5I4NA 4HDQA 4ANSA 4QMPA 4HGTA 3FC1X 3NNWA 4NCTC 4KIOA 5FDPA 1G8SA 4AE6A 2C0TA 3DXEA 3T3VA 2XJ1A 5CNNA 5ANJA 2DTCA 3F3UA 1UU3A 4IWDA 4BZNA 3POOA 4O0UA 2E9OA 4QP3A 5AM6A 4C4GA 4M97A 1PY5A 2QO2A 3AMAA 2XNPA 3VQUA 2W96B 4FZAB 4L42A 3W32A 3BPRA 3ZLYA 1OQNA 4BL1A 3UVQA 2B9HA 1XCGA 2F2CB 1NVQA 4EH4A 5FRIA 3A7IA 4MTAA 4CZYB 2HXLA 4OTHA 4QP6A 4Z3VA 5J7BA 3GC0A 5D11A 3IGOA 5I3OA 5HTCA 5JMSA 2YS1A 4FF8A 4CKJA 5M06A 4W9WA 4YJPA 4PDYA 4WO5A 5A54A 2W7XA 4AF3A 5GINE 2XM8A 3PYYA 4MKCA 3TVVA 4IFGA 4TYGA 5CYIA 3VBWA 4MCVA 4HVHA 5CEPA 1GIIA 3MV5A 4O7ZA 2RSVA 2UZLA 2X2MA 2X6EA 4OUCA 2WKMA 1H28A 4P5ZA 3RVGA 4B7TA 4TWCA 2YAAA 4EOJA 1DBHA 2Z0OA 1YW2A 1JSTA 1KOAA 4NM0A 3JPVA 5IUGA 4K9YA 2X1NA 3QIJA 4A9SA 5IQHA 5AADA 4KIQA 4RWIA 4AGUA 1YI6A 3HVCA 3PG3A 5I9UA 2AUHA 4IVDA 3O7LB 5HG9A 4IX6A 4KWPA 4W4XA 4Y5HA 3TUCA 4I5HA 3TEIA 4CQEA 2LOZA 3HP2A 5CASA 3KREA 4DFBA 1Z9XA 3NSZA 5DG5A 2GHMA 4ZJVA 2G01A 2DQ7X 5DR6A 4FT7A 3C50A 1URCA 1XH8A 3A4OX 4NSWA 3PWDA 3HRFA 4J8NA 4CZUA 3I0OA 4AWIA 1YI3A 5CAPA 1MK7B 2C3JA 4YZDA 3QZGA 4PTEA 3R02A 3DJ6A 1FVRA 2CGVA 4JR3A 2B9FA 3GBZA 4MXYA 2PTKA 4D9UA 4DGMA 4JBQA 5E8SA 2PVKA 3ROYA 3FV8A 1KE7A 1XH4A 2V62A 2P2IA 5GJFA 5HE0A 4R6VA 3K5UA 3ZDIA 4YU2A 2YN8A 4BTKA 1FPUA 3R73A 3EN4A 4AOIA 1WBVA 3COKA 4UX9A 1UWHA 5HG7A 3K2LA 4NFMA 4G3FA 5CQWA 5TOZA 4JDJA 4XP2A 5BYYA 4V04A 3PVBA 3PXZA 2Z0PA 3QLFA 3CKWA 1FBNA 5IZFA 2PMNX 3E8EA 4UMRA 3UP2A 4J1RA 4X7QA 3D7ZA 4EHVA 2ZM1A 3ORIA 3TT0A 3AC8A 3H4JA 4PQNA 1EVHA 3PFQA 2ROZB 4MD9E 2QD9A 4MF0A 3FMHA 3V8SA 3EQHA 3T9IA 2YA9A 4HVIA 2EVAA 2D9VA 3VC4A 2H8HA 1LW3A 4NM5A 4BN1A 2C47A 1ZWSA 1Q97A 2PZIA 3OF0A 2ELBA 3CD8A 4V05A 2WTIA 1OKZA 1ZM0A 2Z7LA 1YWVA 4YHTA 1KOBA 4GT5A 2IZTA 2VWIA 4EH7A 5DGZA 1ISNA 5CT0A 3R63A 3HUBA 4DT8A 2CN5A 2QODA 4P2KA 1U27A 3QQKA 3IG7A 5DIAA 5HBJA 2DHJA 1GIHA 4FV6A 4DE4A 1TQMA 4FG9A 4CFMA 1ZVRA 3E7OA 3ELJA 4QMZA 3MY1A 5B0XA 2H96A 1V0BA 3LQ8A 4FKPA 4UZDA 1DDWA 4LV5A 2V7OA 3AJ4A 5EDPA 4BICA 3NS9A 4QQTA 4ZY4A 5JEBA 5KKRC 4EK8A 2G35A 5LMAA 3MWUA 3KK9A 4FTCA 5CVGA 4A4OA 4NSTA 2W2WA 5JRQA 5C79A 4LL5A 5FTGA 3UQGA 4GH2A 5BVFA 1XBCA 2RF9A 4DFYA 4GN1A 4GRBA 4OTPA 5A3XA 2DWBA 2XM9A 3SV0A 5BUEA 1R1WA 4G1WA 4AW2A 4KAOA 4HNFA 4F1TA 1MIZB 3QRUA 5KBRA 2Y4IC 3C51A 3AD5A 3Q4ZA 2CODA 3R1SA 2UZEA 5ICPA 3NUAA 2XK4A 3QTRA 4YLKA 4UYAA 4A4LA 1DS5A 3E92A 2Q0NA 4OW8A 4UXQA 4ACHA 3W2CA 2G2HA 3P1AA 2FSMX 2DKQA 4M3QA 3MS9A 5L2QA 3TI1A 3R1QA 2UZWE 3U9NA 4KIPA 5H8BA 2YS3A 3R9DA 4L46A 3SLSA 2DKPA 3G6HA 4CRSA 4O7VA 3PPZA 3OC1A 2L1CA 2O0UA 5AUYA 3CJGA 2ITUA 4XEYA 1DAYA 4J53A 4WKQA 4Q5HA 3L8SA 5CU4A 2ZJWA 2BCJA 3PY0A 5GZ8A 4RVKA 4A6FA 1GIJA 1CSNA 1V1KA 3BZ3A 4L9IA 5CTPA 2VTPA 3UOJA 5CLQB 2YAKA 4I24A 4C4IA 1JWHA 4FKWA 4NK9A 4U9AA 2D9XA 4I0SA 5LMBA 3D5WA 4DTAA 5AR3A 1I09A 4ZOGA 2C6IA 1V0PA 4O7RA 3QZIA 4GXBA 1PXLA 4BDCA 5DH9B 1KI1B 3PIYA 1EF1A 4DG2E 4ONAA 2ADZA 2R3NA 5I9WA 1ZYCA 1BUHA 5HCYA 5I9YA 4CD0A 4AA0A 3SUZA 2HY0A 4G31A 3V5PA 4A9YA 4H39A 2X7FA 3NLBA 3QHWA 3LCSA 2YLEA 3G9NA 2WD1A 1Y57A 2X7OA 3HV6A 1H1RA 3DB6A 3LIJA 3LJ0A 3NW6A 4FTIA 4GU9A 4AGWA 4F1MA 2WMXA 2W1EA 3L1SA 3N51A 3PIXA 2D9WA 4QRCA 3TIYA 3HV3A 4TYJA 4K17A 3FHIA 3V8TA 4DINA 5L8LA 3A99A 3Q4UA 3Q4CA 4RC2A 5AV3A 3ROCA 2ZYBA 3D8EA 4WVFB 3LXKA 3M1SA 4FK6A 5ACKA 1OI9A 3R30A 3U4UA 3WZKA 5CSVA 5GIPE 4LOPA 4DEIA 4MXAA 3BE2A 2YJSA 4BKJA 4D4VA 5A4LA 4L68A 4XG7A 4Y83A 3TJCA 4PMPA 3LQ3A 1WI1A 4FVRA 5E8ZA 3QAME 4XP3A 3VO3A 3ULZA 4EORA 2HZIA 3RTPA 2DYLA 2BIKB 2VTQA 2D9YA 1YKRA 4RJ7A 4QPAA 3B8RA 4YHFA 4F08A 3A7FA 3I79A 3F3TA 4B9DA 4LOQA 4C0AA 5JGDA 2GFCA 4DFLA 4BCQA 3NR9A 2R3IA 4BCNA 2C6OA 2W17A 4NT4A 2V5QA 3ZBFA 5LOPB 4DTBA 1Q3DA 2H6DA 3KK8A 2UZVA 4PRJA 2Y6MA 4IDVA 4J8MA 4DGOA 4O0YA 3P86A 3P4KA 2XIXA 5C5BB 4R3PA 3GCVA 2YZLA 4DXAB 2NZ8B 3KXMA 1XBAA 2BZKB 4FL2A 4HOKA 5JZJA 5L6OA 3ATSA 2A19B 5IQAA 2X9FA 3NPCA 3SX9A 5AEPA 4Y46A 3R0TA 4HCUA 4TKSA 1Z57A 4YHJA 4QMYA 3ODWA 2PWLA 3EKNA 4FK3A 1XHAA 4QYHA 4IQ6A 2UZBA 4FKQA 5B2MA 3C1XA 4OT5A 1H26A 1IEPA 3U8ZA 5FUTA 3DZOA 4IDTA 3EWHA 4TPTA 1PW2A 3F69A 3DBFA 3LAUA 3HMPA 3OEZA 3P7AA 4PL3A 4F7UP 3N4VA 2ZV8A 4I6QA 4L6QA 3F5UA 3AT3A 3CXWA 3G6GA 4FVQA 2PVJA 5LQFA 4ITHA 2LULA 5EQPA 3QA8A 2P0FA 4G6OA 4KKEA 2GFSA 4L45A 4LM5A 5EHOA 4HCVA 5FD2A 4BKZA 4HB2B 4IB5A 4FEXA 2A1AB 3II5A 1U54B 1OZ1A 4L7SA 5D12A 4I4FA 4R1YA 2AC3A 4E5WA 4L8MA 1M7NA 5EYDA 2UZRA 4XP0A 3IOPA 4CV8A 1LEZA 4UMTA 4A4XA 3WYFB 3D94A 3E87A 5HGIA 1UV5A 1PMEA 2BIYA 2R3HA 3R7GA 4RX9A 1MUOA 4WNKA 4PUZA 3R83A 2OXDA 3WF8A 4MXOA 4APCA 3RI1A 4BWKA 1W84A 5BQ0A 3ET7A 3SVVA 1L8TA 3MPXA 4O7SA 2QR8A 1CM8A 4D4YA 2DLWA 5AP1A 5EFQA 2VX1A 4IJ9A 4D1SA 2Z7RA 4DEEA 4EUUA 2W4OA 2AC5A 1SVEA 2XMYA 3DPKA 4FI1A 3OWKA 3SOAA 5CSWA 4K18A 3TZ7A 4GJ3A 3NRMA 3FZSA 4GIHA 1APME 4W8DA 3R9HA 4IZ5A 3EB0A 1JNKA 4EI4A 1NU2A 4YL8A 1BL7A 2OIQA 3PLSA 4ARKA 3X23A 3FI8A 3PXYA 2BDJA 4TT7A 3DCVA 3PDTA 5AUXA 4AU8A 3ZZWA 3R8ZA 1ND4A 3EL8A 4FV9A 3UO6A 4NZWB 4D1XA 3FEHA 4KSQA 1CKJA 2PU8A 3CP9A 1MPHA 4H05A 2VTJA 1LB1A 4NJDA 4EQCA 4XG8A 1FOTA 5E90A 5KMMA 3D7TB 4DN5A 4BI2A 3RCDA 5E8YA 1W1DA 1FMOE 4FYOA 5ANEA 4AP7A 5FXRA 3FSSA 2RG6A 3AMYA 3EZRA 4MWHA 4RJ6A 3OWLA 2YJRA 4J97A 1MRUA 2GNHA 2HAKA 3TNWA 5EM5A 4RT7A 2PUUA 3UVPA 5J9ZA 1P2AA 4ASZA 2OW3A 1WBTA 4D4SA 2CJMA 1U5FA 4IM0A 3EH9A 2WTVA 4N70A 3QUPA 1OPLA 4KS7A 3RPOA 1ZMVA 4BTJA 1RDQE 2RIOA 1ATPE 3LOKA 3QUEA 5HO6A 3DTWA 3UZPA 4RLKA 4XG4A 1AWEA 4L53A 4Z7GA 5KMNA 4Z2NA 4YJUA 1QQGA 3O2MA 2F7ZE 4PDPA 3CD3A 3ORTA 4QNYA 1SNUA 4DEGA 2P8VA 5L81A 3BQCA 4M69A 4EWHA 3ZCLA 1VJYA 4H58A 4D2PA 3WZUA 1V89A 3AGMA 3ZDTA 3MH1A 4I5CA 1T45A 2J9MA 4RWJA 3VS7A 1QC6A 4HAWB 5C8KA 1BAKA 5E9EA 5DA3A 5L6WL 1R3CA 4FSWA 4S34A 3UPZA 3K54A 2GQRA 3VOQA 4HB0B 1R0EA 4U40A 4WRGA 2X81A 5EM7A 4RX5A 5J5TA 3BLRA 1YHSA 3NW7A 4HNIA 2CHLA 2RFEA 5HNBA 3JR1A 3LJ2A 3Q6UA 4ANLA 5J1VA 3UJGA 3FWQA 4ZY6A 2XK9A 4EC8A 1B39A 2YWPA 3BWJA 1U46A 2PHKA 3HDMA 5ITAA 3UIBA 5L4QA 1AQCA 3CTJA 4F7HA 4ZEGA 4BHNA 4DH8A 4B99A 2VO3A 5AM7A 4FGBA 4LRMA 1OIRA 5AMNA 3UE4A 1ZOHA 4JG6A 3A8WA 2ERKA 5HCXA 2K00A 1NY3A 3RJCA 4ZMEA 3FSFA 2HZ4A 2OSCA 4FTNA 4FKRA 1WGQA 2VKIA 1OBDA 4FG7A 1JKLA 4E8AA 1UPRA 3A8XA 2HK5A 3SXFA 3ZS5A 2HW6A 3PZEA 4NEUA 2ITOA 3DDQA 3ZO4A 4E93A 1GC6A 1IAHA 2X4ZA 5LCKA 2ONLA 3R71A 3ANRA 4LGHA 1J1BA 4DEHA 4RIYA 4QYGA 4I0RA 1GG3A 1IRSA 2ERZE 2ZPYA 3LFQA 2QOHA 3W18A 5E8WA 4WJ7A 1REKA 2WFYA 5C9CA 3OCSA 3GU4A 1YHVA 3UDBA 2KUPA 4V0GB 3D83A 1J3HA 4U43A 4XG2A 3R7EA 2BZJA 4UZHA 1MQBA 3EQPA 4BF2A 4C3RA 5KO1A 3QC4A 4ACMA 3H0ZA 3QCYA 1FGZA 2ZDTA 1YVJA 3DK3A 3VUIA 4DFZE 2KCJA 3L9NA 4C4FA 4GMVA 3A4PA 1Q8TA 1Y19B 4FKSA 3OP5A 2GDOA 4LL0A 5E7RA 3SO6A 3VBYA 4RA5A 4Z2MB 1W98A 3KA0A 2C6DA 3PP1A 4CTCA 2EJ8A 5L2IA 2NO3A 3L8PA 1WVHA 2J0KA 5AUVA 1DM2A 4GVJA 2HCKA 1PMNA 2WTCA 3DY7A 4R7BA 4PX6A 2OGVA 3KCKA 3NDMA 1QPEA 1W1GA 1GOLA 3IO7A 4DCAA 3G90X 2B1PA 5C1QB 4BR3A 4I21A 3LJ1A 3QA0A 4G3CA 5E4HA 3SYXA 4RVLA 4XG3A 5HCZA 5CLPA 3Q53A 1XODA 4GL9A 3L9MA 4ZS4A 5F20A 3TJDA 3K5VA 2IVSA 4YJRA 5KMJA 2BDFA 1VR2A 3RM6A 3OANA 3PWYA 1Q8YA 4KBAA 3ZEWA 5IMEA 2X39A 3QCSA 5HD7A 2GQGA 4ITJA 1U5DA 2QLUA 3CLYA 2W9FB 3ORNA 4FT9A 1ZC4B 2EXCX 2O63A 3HMMA 4QMSA 3LLTA 4MY6A 2R3QA 3HYHA 4WG3A 5D3WA 4TWPA 4QMXA 4FEUA 3DK6A 4I92A 4BCKA 4F9YA 2RG5A 5KKRB 2XA4A 2C6MA 2PVYA 4R8QA 5AP5A 3V5JA 1WG7A 5IU2A 1UPQA 3DKFA 2P55A 1UU8A 1RQQA 3WIKA 4JXFA 3QQUA 4BGHA 2P0HA 1WZYA 2OU7A 5CSXA 2EC1A 1W7HA 4BDBA 5LOHA 2BPMA 2HY81 4V0GA 5IQIA 2O5KA 3Q60A 5CEIA 2Z2WA 4CV9A 3P7ZA 2QR7A 2CKEA 2LAVA 3QQGA 4ACGA 2Z7QA 2UVYA 3R9NA 5FI0A 5AUZA 5DE2A 3CSVA 3Q9WA 1BTKA 3I60A 4HVSA 2R09A 4FIIA 3ULBA 4ZJJA 3SXSA 4GPTB 4IFSA 3KU2A 3MA6A 4EOQA 4CFXA 2Z02A 2VWBA 3JUHA 4FL3A 4Y5QA 1OITA 4NH1A 2BRBA 4YJVA 3ZZEA 4CLIA 3E7VA 4A9UA 2C6LA 3C13A 3W33A 1BI7A 3BRBA 2VTTA 4BKYA 1Q4LA 5JGAA 2IW6A 3WBLA 2YIWA 2VTIA 3LM0A 3MYGA 4KHOA 5G6VA 5FM3A 3QCQA 3QTXA 5T6KA 4M68A 2KGXB 3MB7A 5IEYA 4D4RA 2OKRA 3LFNA 4FBXA 4ACDA 3QTQA 5EM8A 2J5EA 3NYNA 3R8UA 2OO8X 3KVWA 3VW6A 4GEOA 3JVSA 2UW6A 4IWQA 4KBCA 5KE0A 3QKKA 4FSMA 4RIOA 2J0IA 2REIA 3SRVB 3U87A 3DNEA 4Y95A 2OZAB 2X8DA 2XUUA 4BDFA 2Y8FA 4QTDA 4QP7A 1ZY5A 4FTJA 4FG8A 1Q5KA 1XQZA 1UU7A 2XRWA 4JVGA 2JITA 4FT5A 3R01A 4O86A 5M55A 2YDIA 4FT3A 4RVMA 4ENXA 1XKEA 2XNEA 4L52A 3EOCA 4AQCA 3BV2A 3HZTA 2GS2A 4X3JA 4K2PA 3PP2A 3GU6A 4LMUA 4E4MA 4AXAA 1OL2A 4AS0A 4QYYA 1JSUA 1KE9A 2O8YA 3QWMA 2Z60A 3I0QA 3C4EA 3CC6A 1H0WA 4BDAA 3PE2A 1OIUA 2X2LA 1OPKA 1ZXEA 3PG1A 3FDNA 5ACBC 4JIAA 2ZV2A 1HOWA 4S31A 5EYCA 3ZLXA 5A14A 3WF5A 2QOOA 5C26A 5CF6A 5JKGA 3U7DA 5K5XA 3CQWA 1FINA 5KZIA 5B2LA 4QQCA 2WQEA 4H8SA 1FOEA 3W10A 1MAIA 4BZOA 5D3YA 1MRYA 1RW8A 4MNEB 5EK7A 2CKOA 1ZY4A 3LFSA 5CZHA 2DHIA 3ENHA 4KIKA 3FEGA 1UNLA 4A6HA 2W1DA 5H8GA 2JBPA 3VN9A 4FSRA 3VBQA 1V5PA 4RJ3A 3FI3A 4P4CA 4NW6A 3ULIA 3RAHA 2OXYA 3QYWA 4HATB 3CTQA 5KBQA 4FYNA 3A60A 2J50A 1XKKA 2W1CA 2WEVA 1WGUA 2M38A 3DJ7A 4J52A 1NA7A 3FLNC 3L8XA 4U81A 3DXNA 3MJ2A 2PMLX 3DBQA 2XIKA 3KULB 5AAEA 2CNQA 2WOUA 2G2FA 3Q52A 4GK4A 4C4HA 4E6QA 4RRVA 5LWMA 3ORXA 2QU6A 4XJ0A 2I40A 4ZSEA 3RPYA 3VS2A 5JHHA 3BELA 1ZARA 3BLHA 3VHKA 1PMSA 1DAWA 5GJDA 4BIBA 4RJ8A 3U9CA 3BE9A 4X2GA 3KRJA 4QOXA 4YJOA 5AJQA 5A6NA 2XBJA 2ZM4A 3RZBA 4ANMA 5IF1A 3BINA 4O2ZA 4IBMA 4N6ZA 4C37A 1H0VA 3LMGA 4E4NA 1HCLA 3LFFA 4FV2A 3VJNA 3SW4A 2GCLA 4ZIMA 2O2UA 3Q2MA 1PMUA 4EQMA 3BEAA 4PTCA 3QRKA 3MY5A 4O82A 4WT6A 2Z8CA 4GSBA 4I41A 1L3RE 3UC3A 4YR8A 4O84A 2OF2A 3QUDA 4BI1A 5CEOA 3MFRA 4TXCA 4NUSA 3TUBA 2PK9A 4H1JA 1KZ7A 2YIYA 4HZSA 4JAJA 1Q67A 3PPJA 2WMBA 4XRJA 2EU9A 2VAGA 1K5GB 4F0FA 5BMMA 3TNIA 3UQFA 2R2PA 5IKWA 2ITQA 2XVDA 4IVCA 5BNJA 2OWBA 4P5QA 3D8DA 5BUIA 3C5IA 2W99B 4EZ3A 1Q3WA 2D4QA 1JKTA 1YI4A 2ITPA 3F5GA 4GCJA 4AT3A 4UY9A 4U3ZA 2FJLA 2UW5A 3UODA 3GU5A 4XV3A 2WTDA 2FB8A 5M56A 4HAUB 1UU9A 5IA5A 4QP9A 5A4TA 3QZFA 3WZEA 5FWKK 4B0GA 3CJFA 2W06A 4FNYA 4XS2A 3LCKA 3CQEA 4U7ZA 4KA3A 2KTYA 2NRUA 1JSVA 4YLLA 2R3RA 3VRYA 4U79A 5J9YA 3C9WA 3PSCA 1YRPA 3C5UA 3IPHA 3EN7A 5ANKA 4YZ9A 1OKYA 2CNUA 4GV1A 4F9AA 4F0IA 2ETRA 4GFGA 2X8IA 5ANGA 3B2WA 3RMFA 4E5AX 4E1ZA 4UMUA 4Y94A 2J90A 1YHWA 3TM0A 2BZIB 1YDTE 3I1AA 2PZRA 4D0WA 4Z16A 4YC3A 4E7WA 3HL7A 4MD7E 4D2WA 2ROVA 3A2CA 3MTFA 2ZDUA 3NIZA 1WCCA 3UMXA 4JX7A 2WQBA 4PL4A 1YOLA 5ANDA 5AR4A 4EOPA 3PXRA 4C34A 2VTSA 5FGKA 3TDWA 4IIRA 5L3AA 3QD4A 4M66A 3VUMA 2W2XC 2ZB1A 3ANQA 2F57A 4C35A 3VJOA 4YPSA 3ORLA 2VD5A 4YONA 2RNRB 2F2UA 4FEVA 1DDMA 2JDVA 3UNZA 4EHEA 1Z87A 4U8ZA 2PULA 5G1XA 3TL8A 3NEWA 4PNIA 3ZUTA 4ZXTA 3PXQA 5CENA 2B4SB 3DAJA 3QKLA 3WA0A 2B9JA 2D2QA 5AR7A 2PUNA 2R0DA 3ODYX 4EL9A 2W2XD 1QMZA 4S30A 2Y0AA 4FNWA 2XS0A 3E3BX 5EH0A 3WZDA 4AN3A 4K81A 4C3PA 4QD6A 2PY3A 3FYJX 3BV3A 4I93A 3W16A 4NU1A 4KUJA 1TQIA 1JLUE 2B53A 3EQRA 4IOYX 4QP8A 3DTCA 1CTPE 2BALA 2D10A 4MBLA 3K3IA 5EW8A 4QQ5A 4CRLA 1RRPB 1SVGA 4M84A 5CEQA 1DI9A 3UQCA 2QKRA 5CX9A 4FMQA 3V01A 4CKIA 5F94A 4XUFA 3QX4A 1UNHA 3E93A 4HPTE 3PLAE 5AP6A 3VBXA 4DCEA 3BEGA 4YUQA 1N3HA 3HMOA 4FV3A 1RJ2A 2PVRA 2ZM3A 4G6NA 2CAYA 1UEFA 2IZSA 1JVPP 2BRMA 2WIPA 2YCRA 4RPVA 3PVGA 5M4CA 5JN2A 1CKPA 2SRCA 4YBKA 3QQHA 2MDXA 3EN6A 2RFNA 3UYTA 5JGBA 2PUPA 2JKQA 2QOKA 3NNVA 5KMLA 3KRRA 2XBAA 5HU9A 2C3LA 5HNIX 2CKPA 5GHVA 3RWPA 3PVLA 4HW7A 2NP8A 4O38A 3DFAA 2MWNB 5JFVA 4C38A 2BROA 5C27A 1CDKA 2ESMA 1P4OA 3O23A 3RINA 4BTMA 1OIYA 3CPBA 2BILB 4TW9A 4ZTQA 4GT4A 4B8MA 3O96A 1ZYDA 3BU3A 3H3CA 1JKSA 1FVTA 1S9JA 2RFSA 4RA4A 1V5UA 1XWSA 4FOCA 1Z5MA 4ZAUA 3TZ8A 2GS0A 4BCJA 3GC8A 2V76A 2VTMA 2GHLA 5LJJA 2CLXA 4JBOA 3O0GA 3C7QA 5CAOA 3NNUA 3QBNA 4YZBA 3VIDA 1LP4A 3RPVA 4I4EA 3TXOA 2CDZA 2PZ5A 4IX3A 3U6JA 2XCKA 2W0JA 4QQJA 2H7DA 1KSWA 4IB3A 4RFMA 3FL4A 3FZ1A 5DT4A 4C4EA 1K2PA 2IVUA 4OTIA 2HOGA 4IFCA 4HYSA 4YGAA 4EOMA 4II5A 4PF4A 1B55A 5HIBA 2PMOX 1H10A 3TCAA 4TRLA 2BKKA 2QURA 4NTTA 1KV2A 2CSNA 5DT0A 1PXNA 4FX3A 5KQ1A 3PA4A 3QFVA 2BFYA 2YIQA 2UZDA 4IZYA 2BDWA 4G5PA 5CU3A 4EKUA 5IEXA 1G5SA 5I9ZA 3CGFA 1Y5OA 3BU6A 2QOBA 2C1BA 2OFVA 4F6WA 1W1HA 1XJDA 3G5DA 3QTIA 3T8OA 2Y4PA 4G3DA 3AQVA 3V5WA 1R39A 2I1JA 2Y9QA 3GU8A 3BBWA 4ERWA 1SYKA 3CY2A 4GG5A 4CFNA 3WIGA 5DIFB 1J1CA 4FZ6A 4J99A 3VF9A 3HAVA 4CYJA 2E2BA 2I7QA 3IS5A 3LW0A 5LMKA 4GYGA 5FDXA 3UMWA 2J0MB 3DT1A 3KY9A 4HDOA 3ZBXA 1MKEA 3DBEA 1JAMA 3POZA 4I20A 3MPAA 1TQPA 2OJIA 3AG9A 3PZHA 3JYAA 2UZOA 4DLJA 2C6EA 5JSMA 5A9UA 4EK6A 5IQDA 1XH6A 2JDOA 5HG5A 4JBVA 4LMNA 2H7EA 4HAZB 3COIA 2PPQA 5LVLA 2I0YA 1WVXA 5L8KA 2D9ZA 2FVDA 4M15A 1PXPA 4AZEA 2VTNA 3EMGA 5GZAA 2YF0A 3FMMA 3DZQA 4KINA 3GVUA 4A6KA 2X4FA 2XJ0A 4DT9A 3PEGA 1XO2B 4H3BA 4RBLA 5CSHA 4EONA 2QCSA 4GFMA 3FHRA 2DS1A 3QD3A 4JG7A 2VTRA 3RALA 4FSNA 5EI6A 2LG1A 5L2WA 4EOSA 2WB8A 1ERKA 2C5XA 2G15A 4I1ZA 4MAOA 3SQQA 3UC4A 4MXXA 5CALA 5HQ0A 2IW9A 3R9RA 3GI3A 4I23A 5DH3A 1PXIA 3PSDA 3GCUA 4YNOA 1OKWA 4BGGA 4YC6A 4DYMA 2V7AA 4I5MA 4DH1A 5B7VA 1FMKA 4FEWA 3FQSA 2G9XA 4DA5A 4EHZA 2UUEA 3CCNA 2BRNA 4H36A 1LEWA 3NAXA 1J19A 2JIIA 4X2FA 3DDPA 4X3FC 4G16A 1V0OA 3JY0A 5HVJA 4CFUA 4DGLC 4M0YA 1QCFA 4TN6A 4IB1A 3IW4A 3A8QA 4ALVA 1WBNA 4RC4A 4LG4A 4D2RA 3AMBA 2VWVA 2R64A 2OG8A 5CS6A 1WFCA 4MEDA 4EZ7A 1FHXA 3IKAA 4P7EA 3R2BA 3MA3A 1OGUA 4FIHA 3IK3A 2R0UA 4YZMA 3F2RA 1SGHA 4EEVA 1FHWA 4AW0A 3LXLA 4HCTA 3D0EA 2XIYA 2EMTA 1KUTA 4C59A 3NIEA 2ZB0A 4JOAA 4RX8A 3R8LA 4DLIA 3SV1A 3G15A 1Q62A 2QHNA 4CMUA 4FSZA 4YLJA 3VUGA 5F95A 5IA3A 4DH3A 5L6PA 4FKJA 5KHXA 3GT8A 4NTSA 2V0DA 4XRLA 2GTMA 5AR2A 3ZU7A 4JDIA 5LXMA 4JDKA 4IB0A 3I7CA 4EKKA 3MBLA 2F9GA 4C61A 5C8NA 3CE3A 4WNPA 3VUKA 4ZZOA 4FEQA 2CKQA 3OXTA 3KSYA 4R77A 1M17A 4Q9ZA 2YERA 4CVAA 5HO8A 4FZ7A 1YOMA 2F7XE 4EOOA 2R3KA 3MPMA 3A7HA 2GCJA 1UNRA 2HWOA 4P7IA 4FTUA 3EHAA 4L7FA 2NNWB 2PE0A 5ETCA 4EUTA 3MESA 4XG6A 1BKXA 3KXGA 3L8VA 5K9IA 2R7BA 2W5HA 5FBNC 3BJIA 4OBOA 5FBOA 2DFKA 5HZNA 1FGKA 2GS7A 4L6EA 5CAUA 2PZ1A 4OAVB 5J1WA 3EZVA 4GS6A 4EK4A 4U3YA 5JP4A 2J6MA 3GXLA 5HEZA 4CMOA 4JS8A 5GIOE 3KF7A 4ZLYA 4K1BA 5A6OA 5BPYA 3EL7A 4DGGA 2XJ2A 4RIWB 2WMTA 3EN5A 3MTLA 2VNYA 3FUPA 1PYXA 4QTBA 4Z55A 5M57A 2GNGA 5CANA 3PJ2A 2J2IB 2X9EA 4IAFA 4OTDA 4F0GA 2OZOA 3R7OA 4XH6A 4MYGA 4TYEA 2C5VA 4D28A 3DXQA 2QOLA 4U41A 4G9RA 3F6XA 3FBVA 1OPJA 3DA6A 3FMDA 3H30A 5DHJA 4FV0A 3ORMA 3AT4A 4Q9SA 3CS9A 5DHAB 4K8AA 5D1JA 2BUJA 3D4QA 5LWNA 3PVUA 4L3JA 5LARA 5HVKA 2WU7A 5JQ8A 4EWQA 5CF8A 3M1IB 1KE5A 5C5BA 3D5VA 2IVVA 4NM3A 3RAKA 4X6RA 4F9BA 5AP3A 3IW5A 3W2SA 2VZ6A 3KGAA 3ZRMA 3NYVA 2W4KA 2YEXA 2DUVA 3EFLA 1JQHA 2QVSE 4IM2A 4W4WA 4CYIA 4F6UA 1FAOA 2OJFE 3BLQA 3FKLA 3FSKA 4NWMA 4ANBA 4KB8A 3D14A 3FLSA 3BX5A 3KMUA 3TW1A 1Y8YA 2B52A 2IWIA 2O3PA 4O0TA 2DX5A 4AX8A 4E6AA 3ZC5A 4WUNA 1XH5A 2ITWA 4RSSA 4EMOA 3ZRLA 4A7CA 3P79A 1V61A 3IOKA 2WMAA 1NTVA 2YDKA 4ZZMA 1RE8A 3DK7A 2Z7SA 4O0XA 4D0XA 2ETKA 2WMQA 4YO4A 4W4VA 4NW5A 3MFTA 1IR3A 3AC2A 3PJCA 4FKUA 1U54A 4CLJA 4XBUA 1LPUA 4U6RA 4FIJA 2PYWA 1SHCA 3NCZA 3W8QA 2BMCA 1ZOGA 3LFBA 2W1ZA 2QKWB 3D5XA 3SG8A 2CY4A 3THBA 2JFMA 2VTHA 2FH9A 1WVWA 3TUDA 4A9RA 5EQYA 2WNTA 3VQHA 4ZLOA 2ZAZA 5HLPA 4O21A 2W1HA 2YACA 3W8LA 5AUTA 2VRWB 3VBTA 4N4SA 3QALE 4CG8A 4QMWA 3WYXA 3LFEA 3OY3A 5J95A 2J7TA 5ANIA 1Q24A 1KV1A 3FZRA 4OTQA 5IUIA 2JD5A 2JAMA 2BTSA 4J96A 5HVYA 3RCJA 3WF9A 2UW0A 4AN9A 2ITXA 5HIDA 2N0YA 1Q61A 4FSQA 1VYWA 2BAQA 4IE9A 2PVNA 5CF5A 4PWNA 4G17A 4Y73A 4B6HA 4YPDA 3OY1A 3A61A 2IYBA 4CYEA 2ACXA 4C57A 3QLGA 2IZUA 4QMVA 3ACKA 4DEBA 5D10A 5AX9A 1M2RA 3ZXTA 3KXZA 4L67A 4ZSGA 5ETFA 3FMLA 4CNHA 4F7GA 3E8NA 4I6FA 4I6BA 3UYSA 3G0FA 4UXLA 3OG7A 3W2PA 3NVMB 3DXPA 2I0VA 4FNXA 3DQWA 3D7TA 3RNYA 3NWWA 3BWFA 1HCKA 5AAGA 2ITTA 5AIKA 2J0LA 1WVYA 4QMTA 4Y72A 5JZNA 3VUHA 4E26A 3BGZA 4BVUA 4RLLA 5FXSA 3LXPA 4C02A 3FKNA 3CKXA 1YWNA 4YSMA 2B9IA 3PUPA 3HNGA 3GU7A 2RUKB 5IISA 1O9UA 1EGXA 4L01A 2F4JA 5AP4A 3RKBA 3C0GA 1IAJA 3UOHA 4OT6A 4PMMA 4GK3A 3QCXA 4XV2A 3DKOA 5CT7A 4LI5A 4DTKA 5AFVA 4ZSAA 3KL8A 4N0SA 4X2KA 4M67A 1M14A 3A62A 2Q13A 4LUDA 4OTGA 3LLAA 3WYYA 5DHFB 5I0BA 3CIKA 3KB7A 3MH0A 4MK0A 5EKOA 4MQ2A 4X6QC 5KMKA 4A9TA 4C7TA 1SNXA 5JH6A 1YQJA 1U4DA 3DKCA 4NCTA 1F5QA 5JRSA 3U6HA 1UWJA 1BX6A 1F3MC 2UVMA 4C4JA 2HELA 2QKMA 4HAYB 4FC0A 2JKMA 4RIXB 1R78A 4O83A 3HV7A 2YM8A 2CGUA 4FIEA 4C33A 5M4IA 2OFUA 2LYDA 2XNMA 1SMHA 2WO6A 5FM2A 3HV4A 2PVFA 3GUBA 3R2YA 3E8CA 1E1VA 4BDKA 5HESA 4DAWA 5J3QA 4HVGA 5IA0A 2ZV7A 3VAPA 4E73A 4FTMA 3WE8A 2ITYA 3D2IA 3F9NA 2IN6A 2VRXA 2P33A 3GFWA 1OL1A 1U5RA 2XKCA 4L43A 4X0MA 4YJTA 3M11A 3NW5A 3HK0A 4O1OA 3SOCA 5IQGA 2GPHA 2WQOA 2BTRA 2JGZA 4AW5A 4O0WA 3AXWA 4U42A 1PXOA 3NUXA 4WOVA 3P23A 4MD8E 3DOGA 4YP8A 5I3RA 4D55A 4BCIA 4EJNA 4H3QA 2UW3A 4O6LA 3FAAA 4D2VA 3MB6A 4K77A 1ZZLA 3UTOA 3ZM9A 4FTLA 4AZFA 4GYIA 3NCGA 5LONB 2W1IA 4R3RA 3TG1A 4QPSA 3S4QA 5FTQA 5EQEA 3U54A 2GNFA 1KWPA 4G3EA 4N6YA 5ANOA 3BYSA 3CEKA 4DGNA 4F9WA 2XP2A 5IDPA 2YHVA 2WEIA 2ZV9A 3VBVA 3C4ZA 5J3YA 3QQFA 4OBPA 4RJ4A 2CGXA 4BC6A 2QKLA 2PVLA 1G8AA 4X21A 3GOPA 3OMVA 4I6HA 3QTUA 2VO0A 2Y8OA 4O2PA 2YLFA 1KE6A 3G51A 4EZ5A 2ZVAA 1WJMA 2OQBA 4QMOA 2R3GA 3AC5A 3DB8A 2VWYA 2HZ0A 2ITZA 3NSUA 5DNRA 3PZDA 3PXKA 3TV4A 2VWXA 3R1YA 2Y4IB 3KXXA 1FQ1B 1W82A 4WBOA 5T68A 3GOKA 5CXZA 4EH5A 3F5XA 4E6CA 4E20A 5HORA 2YISA 4TNDA 3FE3A 2NMBA 3I81A 1OL7A 2YIRA 4RIXA 1ZLTA 4DFNA 4XBRA 3M42A 3TKUA 3VS1A 4P90A 2E9NA 5CVFA 3Q96A 3VIAA 3NVKI 3LE6A 2YVCA 2XK3A 4AA4A 4OTRA 2R3LA 3F5PA 2W1FA 4ZY5A 2VTAA 2HIWA 4RG0A 5CEMA 2QO9A 3KZ1A 4Q5EA 3LCDA 4RC3A 3VRZA 2ETMA 5H8EA 1NI2A 4YTHA 5JQ5A 2W9ZB 2JLDA 3OTUA 4APPA 5IMXA 3LKMA 4QMUA 1ZOEA 2F7EE 5AWMA 4FVPA 3PY1A 3FL5A 3DKGA 1H8FA 4FV4A 3F5RA 1VEBA 4CEGA 3GFEA 3UP7A 4UWCA 4O0RA 3F66A 3NMUF 3E63A 4FZDB 4HPUE 1KZGA 2A2AA 2Y8GA 4FKTA 4F9CA 3MGYA 3R8VA 2YDJA 4RWLA 2YIXA 1ZZ2A 2IZRA 3S95A 3QWJA 5A4QA 2EXEA 1PMVA 2X7GA 3MDYA 4FKLA 3DNDA 5CZIA 4UMPA 5CF4A 4RZVA 3Q9ZA 5CQUA 3U4WA 3RNIA 2WQNA 5FP6A 2BKZA 4IANA 3VUDA 3CPCA 4EK3A 1P14A 4IEBA 4WBBB 5A46A 5M09A 4QP4A 4NM7A 5EW3A 1IG1A 3QGWA 1H01A 2XK6A 3R28A 4RZWA 4TZRA 5KCVA 4AZVA 4D5KA 5LCJA 1NXKA 4NIFB 5FG8A 4DITA 4E6DA 2W1GA 4GUBA 4FE2A 5IA2A 3MSSA 2IJMA 3GQIA 4QTCA 4ZSJA 4CQGA 4GIIA 4KKHA 1IA8A 4BCFA 1U29A 3G2FA 3I6WA 4JG8A 3ZO2A 3RPRA 5IQFA 4ZZNA 3MFUA 4YTCA 2GNLA 3EN9A 4BBKA 5HBEA 3PG7A 3OUKA 4FIGA 3TNPC 4CFWA 3OXIA 5CEKA 4UALA 2N23A 3P08A 1UA2A 4JDHA 4CSVA 3OW4A 4X3FB 3QTZA 4FV1A 3IW8A 3ZMMA 3OOMA 3QWKA 3F88A 1M7QA 1PXKA 3P78A 1ZSQA 3IW6A 4RWKA 3NYOA 3KEXA 4U97A 2VSZA 3TN8A 2YM4A 2JFLA 4HGLA 5M4UA 2YS5A 4K11A 1SZMA 4A07A 4QMLA 5AP0A 2HENA 3OHTA 4YTIA 5HD4A 4XV1A 3ORPA 3ITZA 3EFJA 3TWJA 4YZCA 5EYKA 4YJNA 2UW9A 5FEQA 3VULA 2WHBA 4TYIA 1ZC3B 4G34A 5IQEA 2QOCA 3SHEA 4UMQA 2JBOA 3EQBA 3SA0A 3LFAA 4BDEA 1OKVA 3C4CA 4ACCA 3MVHA 3UIMA 4IWOA 4E3CA 1XH9A 2BVAA 4F7LA 2PMIA 5M53A 1TKIA 3F7WA 4OGRA 1FGYA 4BCMA 2JDTA 3C0HA 2COCA 3SRVA 1H1QA 4QTAA 5E92A 2OZAA 1GJOA 4Z7HA 5LVOA 3F82A 5LVPA 2WTKC 3IDBA 3JS2A 4IVAA 2PVMA 4M13A 4Z9LA 4GT3A 3HECA 4QNAA 3W2QA 2EB3A 3Q6WA 4LUEA 4PDSA 3CXBB 4D0NB 5CLLB 3G9LX 3PIZA 2VGOA 4BBMA 3HGKA 4MVFA 3V5LA 1WBPA 1PLSA 2E2XA 2YABA 3ENMA 2HXQA 4FUYA 4G9CA 4MHAA 3PY3A 3FPQA 1BWNA 3Q9XA 4N57A 3K3JA 5FEDA 2R3FA 3S1HA 1H4RA 4C3FA 3QRIA 4L00A 5CXHA 2C6TA 3ALNA 5HOAA 3TKIA 2NPQA 4AG8A 1XX0A 2C5OA 4ANQA 2I5FA 2Q83A 4ERKA 4XLVA 2PZYA 3E62A 1XR0B 1IA9A 4IH8A 5DBXA 2ONLC 4ITIA 3VUTA 4E5BA 5IUHA 2A0CX 3RK5A 3QXPA 3EIDA 5EHLA 4YTFA 2KULA 3CQUA 3NUNA 3PA5A 5M44A 3ORKA 3H9FA 4CT2A 3LM5A 2P0DA 3AOXA 4HB3B 5ETAA 4F09A 4FKIA 1BLXA 1M2PA 1XH7A 4MNEA 3R8PA 3ZFMA 4HZRA 5DPVA 5EI2A 3DXDA 3R7UA 5FLFA 3BI6A 4HGEA 2BAKA 3GP0A 4USDA 5HE1A 3UZTA 4RQVA 3GCQA 4WSQA 3SD0A 2BHHA 3BHHA 3V51A 4F6SA 3Q5ZA 4TNBA 3COMA 3DLZA 5E8TA 4K2OA 3WILA 4FICA 1X1FA 1MRVA 3CR0A 4AT5A 2R3JA 5HICA 3ZYAA 3IDPA 3GYOA 4PL5A 1WBWA 3GCPA 3KULA 5M4FA 2WQMA 3FMKA 4GG7A 3Q9YA 4LYNA 1V5MA 3ZLWA 1JKKA 2X6DA 4F7SA 2BHEA 4FV8A 3I4BA 4MBIA 5CAQA 4K0YA 1WBSA 5DN3A 4BYJA 2XYUA 4O6EA 5A4CA 2LGCA 4JR7A 4S32A 1S9IA 1GZ8A 2XCHA 4JRNA 5HO7A 4FGRA 2F49A 3BGPA 3BHUA 4CTBA 2FYSA 5HI2A 4CMTA 3PXFA 3E88A 4IC7A 3O8PA 3RK9A 5CSPA 5F4NA 4CHJA 5E8UA 4IZAA 4KVGB 4LQMA 3B2TA 4U5JA 3SXRA 2MKRA 2R3OA 3KKVA 1RJBA 3KMMA 4JLCA 2DN6A 4BWXA 3P0MA 3ML4A 1FVVA 3BU5A 3R1NA 3S2PA 2R0IA 1FGIA 3EFWA 3EYHA 1ZYSA 3QU0A 2C5NA 5L2TA 3FLZA 4XG9A 4JL9A 5H3QA 1X86A 2CCIA 3O17A 3GYPA 5JFWA 4I3ZA 4AAAA 4WNMA 4IAYA 2XH5A 4IAIA 4DG3E 4DH7A 4M7IA 5BVEA 4HB4B 3HLLA 1QPDA 4LV8A 1Y6BA 1EH4A 5J79A 3R6XA 4EKLA 2YT1A 1X05A 4QMMA 4DBNA 3RPSA 3F2NA 4FTKA 3GQLA 4IC8A 5H2UA 5BVOA 2JKOA 3VVHA 3DU8A 1ZMWA 3EKKA 3MH2A 3Q5IA 5IH5A 1KE8A 2VX0A 3LFDA 1A06A 2JP2A 5HE3A 2C6KA 1W83A 2C0OA 2BRGA 4M0ZA 2UVXA 4YO6A 3BHTA 2QU5A 3D5UA 4J98A 1B6CB 3OD6X 2WZJA 3EYGA 3PSBA 1PHKA 3KXNA 3FXZA 3QD2B 3F61A 4ZMFA 2CRFA 4RJ5A 3LMIA 4O7TA 4EOLA 3UGCA 2GHGA 3DV3A 4I0TA 2BFXA 1UVRA 3KQ7A 3TFMA 2OJGA 3O71A 1DI8A 2X18A 4A06A 2ITNA 3N9XA 4DC2A 5M07A 5J5SA 1PYEA 2GCDA 3BKBA 1GZKA 4L3PA 1O6YA 2JDSA 3R9OA 3V8WA 1OVEA 5E8XA 3VHEA 3ZOSA 4IAPA 2QOQA 3NX8A 4DFXE 4CG9A 2R4BA 4D58A 5IQBA 2OIBA 2G1TA 4CGAA 4JAIA 4PP7A 4CHMA 3FY2A 5BVWA 2PVHA 2VWUA 4RGJA 1OL6A 5JK3A 1H27A 2I5CA 2C0IA 2R5TA 2YSZA 2K2UA 5HHWA 4A6FB 4C8BA 1U5GA 3FMJA 4FNZA 3QRJA 3FC2A 5HKMA 3U51A 2AYPA 2XNOA 3AU5A 1Q8ZA 2JIVA 3V6SA 2I1KA 5HIEA 3A7GA 4PV0A 4G5JA 3OZ6A 4BCGA 2C3KA 3NZ0A 3OW3A 2X0GA 3Q32A 3PJ3A 2UZSA 1FB8A 4IAAA 2CGWA 5I5ZA 1PF8A 4PTGA 4WNOA 2I0EA 4BB4A 3RHXA 5C03A 4GK2A 4KAXB 4TY1A 3DBCA 3D2KA 5D7VA 2WTJA 4CXAA 5CAVA 4QPMA 1H08A 3N4UA 3ZLSA 1I7AA 2B54A 2FSOX 5FTOA 3TKHA 5AUWA 3WF6A 3VW8A 4F4PA 3CBLA 1H00A 4TWOA 5DEYA 2RGNB 3UZRA 3LCOA 5EHYA 5K4IA 3LJUX 5AV2A 1E1XA 4C58A 5FI1A 3MFSA 4FUXA 5HU3A 4JQEA 4IW0A 4WIHA 4PQ0A 4JRVA 3ZXZA 4FTOA 4JT3A 5J87A 3OWPA 2DYNA 3S3IA 2OI4X 3IW7A 3W2RA 5DYJA 3ZRKA 1X8BA 5IPJA 5DI9B 3KVXA 3A7JA 2XK7A 3OFMA 4KABA 4RMZA 4AUAA 2GNJA 2VN9A 4AZTA 2OLCA 2BZHB 4BY9E 3UVRA 1XR1A 3BHYA 4FKOA 1WMKA 4IAKA 1WAKA 5TF9A 3KCFA 3R7VA 3CGOA 2UZNA 3ID6C 2XF0A 2CMWA 3ZO1A 4XHKB 4LGGA 1MQ4A 2X2KA 3O50A 3ODZX 4JQ8A 4LRJA 3RAWA 4C0TA 3RWQA 4DEDA 5M08A 3KXHA 5FP5A 4BYIA 3ORZA 3FLQA 2WELA 1Q41A 2W5AA 2PE1A 2CNVA 3FY0A 3MW1A 3ZH8A 3VS6A 3WZJA 1CKIA 1V88A 4IACA 1UNQA 3O51A 4DH5A 4LOOA 4DX90 4FSUA 4ZTNA 2R9SA 2QOIA 4GMYA 4PMSA 2GNIA 4WHZA 5GNKA 3RHKA 4EHGA 4HVDA 3SKCA 4FT0A 3C0IA 4UB7A 5E1EA 4QTEA 5CU2A 5KMOA 3EFKA 1U5QA 3MVJA 1U2BA 1J7UA 3H9OA 3F2AA 3IDCA 3ZUUA 2UV2A 4GUEA 4ASDA 4F64A 1YXSA 1OUYA 5KZ0A 3UO5A 2XKFA 3LQ5A 2UW4A 3VF8A 2E9PA 2OF4A 3PVWA 5CWZA 4O7YA 3R7IA 3VWAA 3NGAA 2P4IA 4KRCA 4OTWA 3V3VA 1H1WA 3DAKA 4K33A 3VS3A 3AGLA 5AA8A 3VNTA 4OLIA 4L44A 2LKOA 4J95A 3HKOA 3EQDA 5AR5A 5BYLA 4D2TA 3KRLA 3Q3BA 4FR4A 4G2FA 3ZEPA 2GJYA 2XEZA 5JHGA 2H9VA 4R7HA 5J8IA 5TE0A 4CCUA 1PJKA 2WPAA 1QPCA 3ODXA 5TO8A 3ZDUA 2ZMCA 1Y6AA 3LXNA 5BMSA 3OEFX 2QG7A 3P6AA 1Q99A 4DEAA 2C68A 1YDSE 3QQLA 3QTSA 4E4LA 5BUJA 2RLOA 4XWXA 1LUFA 2HZNA 4FKGA 3QRTA 5DOSA 3I5ZA 4K2RA 1MK9B 2C4GA 5JLJB 5LVNA 3SNHA 2IG7A 4QT1A 4GU6A 2VO7A 4BDDA 2P3GX 4O22A 3TZ9A 3OOGA 4YBJA 4H1MA 2Y7BA 4FV7A 3UO4A 2GQSA 4XYFA 3PJ8A 4W8EA 4TTHB 4WG4A 4M12A 4UWBA 2GS6A 5TT7A 3ZO3A 4AZWA 3DXCA 3UOKA 4IX4A 5AV4A 5DLSA 1GY3A 1P5TA 1GAGA 3OTVA 5EG3A 4ANOA 4XNEA 4AT4A 4F99A 2QOFA 2WU6A 2J51A 4MNFA 1A48A 4O7WA 1NVRA 5CY3A 2YFXA 5EFXA 1EAZA 1H1PA 2J0MA 4U0IA 1BI8A 2UW8A 4D5HA 3JXWA 4FSYA 1Y91A 5AV1A 1DROA 2VX3A 1ZAOA 1H4LA 1M52A 4I5PA 3SDJA 3FPMA 2V55A 4FA2A 2WMWA 3QX2A 3R22A 1PXMA 4IWPA 2EUFB 4M8TA 4OR5A 4UWYA 4BWPA 5BVKA 4MXCA 3NUUA 1H24A 4F7JA 4YURA 2I6LA 5FEEA 4V01A 4B8LA 2FGIA 2JIUA 3HX4A 4MH7A 3LZBA 4M14A 4BFMA 1E5WA 2WIHA 4L3LA 5EW9A 3ZC6A 2HW7A 3KFAA 4OTFA 3QD0A 3S00A 4DF3A 1OY2A 3IGGA 1NW1A 1MIXA 5T3QA 3BBTB 3V04A 5IQCA 2ZMDA 5HE2A 3DLSA 2WOTA 1E9HA 4QMNA 4MXZA 4ZTRA 3FZPA 5DVRA 1M7RA 4FTQA 2OH0E 2YZAA 3ZFYA 1OBGA 2XNNA 1PKDA 5D9HA 3V5TA 1GZNA 4F70A 4BTFA 3R21A 4EBWA 5K3YA 2EB2A 3LVPA 2XK8A 3TNHA 3S0OA 4Y8DA 4HGSA 5E1SA 3G0EA 3OROA 5BX0A 2P2HA 4Q2AA 5CU0A 1NTYA 5HBHA 4IMYA 1UKIA 5HX6A 1P6SA 4ALWA 3AD6A 3O8UA 3BQRA 5M51A 4M69B 5D3XA 2C3IB 4DBXA 3ACJA 3MN3A 3FM8C 3P7BA 4XOYA 3P5KA 2O64A 5E8VA 2IPXA 4UBAA 3ERKA 3ZHPC 5D41A 1J0WA 2FUMA 4WSFA 2VV9A 3FZTA 4TYHB 4AOTA 4BCHA 2L2IA 3N4TA 3W1FA 1OIQA 3AC4A 2IO6A 3M2WA 3JY9A 5HTIA 5EOLA 1URWA 5I9XA 5AP2A 3AC3A 5C8MA 2A4LA 4BCPA 1YXTA 1XD4A 5DR2A 3D15A 4QMQA 4BRXA 4XX9A 3OCGA 4AN2A 4YZNA 2DHKA 5EYMA 3AU4A 3TZMA 4FTRA 5K4JA 2WTKB 4ZRJA 4BDIA 4JI9A 5EDRA 2OK1A 3HP5A 4FKVA 4EYMA 2G2IA 5I9VA 2XQNM 3C4XA 3LPBA 3WOWA 1NT2A 3EQCA 4HYHA 4S2ZA 3NYXA 2JEDA 3ALOA 4FL1A 3FI2A 4MF1A 5GJGA 4FTTA 3ZSHA 3MVMA 3HQCA 2Y6OA 1IRKA 2XNBA 4XLIA 3BYOA 4HJOA 4BDGA 4BGQA 5GOWB 3MVLA 4RFZA 2VWZA 3RP9A 3GCSA 1UNPA 2HE7A 2W05A 2VTLA 4LFIA 3TDVA 2WTWA 2QQ7A 3D9VA 2ZOQA 1YXUA 2UW7A 4MX9A 2VU3A 3FQHA 2K2JA 2Z0QA 2QONA 5DFPA 2J59M 4D9TA 1LR4A 5HX8A 4O7NA 2EMSA 1PFJA 3PRFA 1OB3A 4BIDA 4RIYB 3T06A 3E64A 3OS3A 4H3PA 4MQ1A 3FLYA 4C36A 4ASXA 3WF7A 3T9TA 3TIZA 3WI6A 3EQGA 4FSTA 2H34A 4EQUA 2YM7A 3MI9A 4PP9A 3LMHA 4GKHA 3AC1A 3V6RA 2OH4A 2COAA 2DA0A 2FSTX 1CMKE 3KRWA 3QZHA 5EI8A 3BHVA 2ITVA 3QBVB 3BIZA 3O7LD 5F9EA 3BYMA 3DAEA 1W0XC 4GKIA 1AQ1A 4RIWA 4AGDA 2PE2A 2JAVA 3ZSGA 4UN0C 4JJRA 4ZK5A 2QI8A 1QPJA 2W5BA 3F3ZA 3Q04A 4USFA 3RGFA 5C01A 5C16A 3BYUA 4KRDA 5AA9A 3NUSA 1H25A 3C4WA 3FYKX 3I7BA 3QXOA 1AGWA 3FXWA 4ZTHA 2DX1A 3SG9A 3TTJA 1YDRE 3NUYA 3QKMA 1T46A 4TYHA 1DDVA 2R3MA 1ZMUA 2I1MA 3FJQE 3E5AA 4BIEA 4KNBA 2RL5A 3ZONA 3QF9A 4WRSA 3UOLA 5AUUA 1OUKA 3GB2A 3Q2JA 3GNIB 4ZTLA 4GJ2A 5E91A 5CI6A 3P7CA 5L2SA 4RQKA 3QGYA 2CLQA 2PZPA 2VUWA 5A4EA 3DQXA 4HHVA 4DFUA 5LMKC 4KSPA 3TO1A 3TCPA 1R0PA 2GU8A 2BAJA 3IONA 5JT2A 2OICA 3RAIA 2C1AA 3UNJA 3F3VA 4A5KA 2WGJA 4XCUA 1BYGA 3VS4A 2RFDA 3GGFA 3OT8A 4FOBA 2GMXA 3DS6A 4ENYA 1F0QA 3REPA 1K9AA 1MP8A 5IDNA 4AOJA 3BYVA 1DYNA 4PMTA 4UV0A 4BHZA 4O1PA 4QYEA 3R00A 3GENA 2BRHA 5KMIA 4EH2A 3P9JA 3MY0A 2J0JA 2YCSA 3ETAA 4K6ZA 4LGDA 5DT3A 4CT1A 4R1VA 1TXDA 2CCHA 4YNEA 4IX5A 5AIRA 4FZFB 1FHOA 4ID7A 4OAUC 4ZSLA 5AP7A 3MH3A 2WMUA 5TKDA 3FZOA 4AE9A 4F1OA 1W8CA 2YCFA 2PL0A 2R7IA 3G33A 5DRBA 2HYYA 2VO6A 4WD5A 5K0KA 5IH4A 5HLNA 2FO0A 3UIUA 4DX8A 2XRUA 3EQFA 2VTOA 3OVVA 2OIDA 2AL6A 3HAMA 4C62A 4WA9A 2NRYA 3PE1A 1IASA 4EH9A 4KD1A 4PNKA 3E3PA 2YT0A 2B7AA 3GC7A 3L9PA 4YJQA 1U5EA 3VS5A 3ULCA 2OTXA 3ZUVA 2ELAA 2HTHB 2IVTA 3HV5A 2WMSA 3MJ1A 1TQZA 1BL6A 1REJA 5JFSA
chains in the Genus database with same CATH superfamily
2C30A 4ASEA 2MFQA 1J7IA 4FIFA 4AQKA 4QP1A 4BBFA 2Q0BA 5DWRA 3WE4A 5KHWA 2AEHA 4NJ3A 4E4XA 1K3AA 4AZSA 2CPKE 2OJ9A 5F1ZA 5BVDA 3F3WA 2UZUE 4GW8A 2E9UA 3H0YA 1JPAA 3HEGA 1YXXA 4IJPA 5IH6A 3MPTA 3HA8A 1XBBA 5JFXA 5K0XA 4ZRIA 2JDRA 2FSLX 3LCTA 1NVSA 4J7BA 3ODOA 2GSFA 5K5NA 4PY1A 3FMEA 5DI1A 3WARA 4EH6A 3A8PA 4R3CA 1GZOA 2J4ZA 2WMVA 2EXMA 5FQDC 1GC7A 5BYZA 2R3PA 3O8TA 1O6KA 4QYFA 5AAFA 4O4BB 4AACA 4HYUA 4D2SA 4GMXB 3ZVRA 1TJ6A 4KBKA 4X2JA 1G3NA 1YWRA 2C69A 2QG5A 2WMRA 3W55A 4EK5A 5HLWA 3UG2A 1I44A 3PTGA 3IECA 3HW2B 3QQJA 3IVFA 5HNGA 4XV9A 4Y85A 4YC8A 4EJ7A 4UYNA 4R5YA 5D3VA 5CI7A 5C4KA 2XYNA 3R7YA 2CY5A 4NL0A 4U44A 5FXQA 3T3UA 1OECA 4ZTSA 5H9BA 4BZDA 4YMJA 1JOWB 5KNJA 3UIXA 3COHA 2O65A 4G6LA 4RVTA 1J91A 1BTNA 4HAXB 5CVHA 2IW8A 4JBPA 3F7ZA 4EC9A 2X0QA 4ZS0A 4IXPA 2XAMA 2XIRA 5ETIA 2OJJA 5C6RA 3B8QA 4PPBA 2M14A 4AXFA 4GVAA 4F63A 2YCQA 3CTHA 4JQ7A 5EM6A 4AGCA 4BI0A 1BMKA 5KUPA 5KX8A 1M7EA 4WUAA 3R8MA 4EYJA 3SW7A 3FI4A 4ZRKA 4C2VA 2CN8A 3DJ5A 3HMNA 2JKKA 4PDOA 4DHJA 2I0HA 2XEYA 3HRCA 1J7LA 1UNGA 2VNWA 3PP0A 1WJ1A 4FTAA 4JX3A 2C5YA 4O81A 4D1ZA 3KN5A 4CCBA 2OXXA 2QHMA 4X2NA 3JVRA 2XNGA 1PXJA 3PA3A 4KIKB 4NFNA 4R7IA 3RBWA 3G9WA 5D27A 3FKOA 3PJ1A 3SGCA 1P4FA 4B4LA 2QO7A 5GZ9A 2XB7A 4EH3A 2DYQA 4MWIA 5KQ4A 4IM3A 4LRKA 2NYAA 4IHPA 4ALUA 3A98B 3KRXA 4IVBA 5TR6A 2YM6A 4YSJA 3N7CA 5AV0A 4TL0A 4O0VA 3W2OA 1P5EA 5D7AA 4ANNA 4WSYA 1XMLA 2W4JA 4FODA 4U80A 3SC1A 3NWAA 1YXVA 3QL8A 2PUIA 4EOKA 4QO9A 2XKEA 4PPAA 4DBBA 1Q8WA 3W0SA 2X8EA 3OCBA 2P0CA 3OBJA 3OUNB 4CFFA 1ZYLA 5AX3A 4ZTMA 4IZ7A 1Q8UA 3F0WA 5CNOA 4NKSA 5BVNA 4S33A 2VWWA 5IA1A 3H9RA 3U55A 1ZYJA 4XMOA 4C2WA 4DG0E 3H10A 3IQ7A 2BR1A 3BGQA 3OBGA 4MBJA 3UPXA 2GTNA 3HRBA 4IADA 3NAYA 5L8JA 4O27B 4O0SA 2A27A 5B2KA 1STCE 1SVHA 5DR9A 3PPKA 3VS0A 4EBVA 1K5DB 2XZSA 3OCTA 2D11A 1ZRZA 2XIZA 3KY2A 4U45A 3FQEA 4QP2A 3RM7A 4BDHA 4O96A 2RSGA 2RKUA 3R04A 1UKHA 1YOJA 3HMIA 4CKRA 3HUCA 4KKGA 3FLWA 5DMZA 2XAOA 3I6UA 1X11A 1OL5A 2RVBB 4I22A 3UBDA 1MI1A 5DEWA 3HA6A 3OT3A 4BBEA 1SM2A 3C4FA 4W9XA 3DGKA 3FXXA 4MT7A 1GNGA 3UNKA 4YJSA 3AD4A 3HDNA 4O4DA 2YM5A 1Y8GA 3TACA 4B6LA 3V5QA 1WBOA 2XKDA 3L9LA 4G3GA 4R78A 4GFOA 4NYEA 1A9UA 5J7HA 4WG5A 1QL6A 3Q4TA 5HTBA 3E8DA 3KMWA 4RFYA 1I2HA 4FV5A 3OWJA 3RK7A 5J9LA 2GUMA 4O7LA 5IEVA 5CU6A 1H1SA 3U6IA 3FMNA 2QNJA 2RGPA 4ZLZA 2UVZA 3ZSIA 3BCEA 1P3RA 3MDBC 1VZOA 4TYZA 2B55A 4KS8A 4KHAA 3QHRA 2WAJA 5EOBA 4CFVA 4EOIA 4NY0A 1H07A 2VGPA 4TWNA 4RX7A 4AFJA 2QLQA 3DFCB 1B38A 4F7NA 4XOZA 3KF4A 1U59A 4AW1A 4I94A 1OM1A 2J5FA 3EJ1A 1PKGA 5EDQA 2QC6A 3GEQA 2V22A 3I5NA 4ZP5A 5HG8A 3ZM4A 3SAYA 4AA5A 5EKNA 4O91A 4UEUA 4J71A 2YRYA 4DHFA 2OBJA 3D8FA 4USEA 4HAVB 4EH8A 3ATTA 4JIKA 4ORKA 3QC9A 4F65A 4IAZA 3MIYA 5DRDA 3AKJA 4KHBB 5IA4A 3ZTXA 4JNWA 3U8WA 4PPCA 3CY3A 5LVMA 5IG1A 4ZJIA 4CZTA 3MIAA 2HWPA 4W4YA 1O6LA 2YM3A 3NNXA 3OXZA 1AD5A 4NIFA 4R5SA 4AAYA 1VYZA 3PRIA 2WXVA 3TV7A 2COFA 5BV3A 1TVOA 5AR8A 3ZFXA 2PSQA 4OBQA 4BDJA 3LHJA 2YITA 1X1GA 1PRYA 3QYZA 3TNQB 1JBPE 1M2QA 3UG1A 2Y7JA 2YWVA 2JC6A 4TKNA 4NKAA 3TTIA 3GC9A 3KC3A 3TV6A 4HYIA 3RCPA 2IFSA 5J3TA 3QTWA 4AFEA 3EQIA 2E9VA 3KIOC 3DBDA 4BCOA 2LOXA 2UZTA 3LFCA 4X3FA 2B0QA 1OMWA 2FA2A 3KN6A 3RZFA 3AT2A 4GZUA 3NUPA 5C4LA 2EWAA 5I4NA 4HDQA 4ANSA 4QMPA 4HGTA 3FC1X 3NNWA 4NCTC 4KIOA 5FDPA 1G8SA 4AE6A 2C0TA 3DXEA 3T3VA 2XJ1A 5CNNA 5ANJA 2DTCA 3F3UA 1UU3A 4IWDA 4BZNA 3POOA 4O0UA 2E9OA 4QP3A 5AM6A 4C4GA 4M97A 1PY5A 2QO2A 3AMAA 2XNPA 3VQUA 2W96B 4FZAB 4L42A 3W32A 3BPRA 3ZLYA 1OQNA 4BL1A 3UVQA 2B9HA 1XCGA 2F2CB 1NVQA 4EH4A 5FRIA 3A7IA 4MTAA 4CZYB 2HXLA 4OTHA 4QP6A 4Z3VA 5J7BA 3GC0A 5D11A 3IGOA 5I3OA 5HTCA 5JMSA 2YS1A 4FF8A 4CKJA 5M06A 4W9WA 4YJPA 4PDYA 4WO5A 5A54A 2W7XA 4AF3A 5GINE 2XM8A 3PYYA 4MKCA 3TVVA 4IFGA 4TYGA 5CYIA 3VBWA 4MCVA 4HVHA 5CEPA 1GIIA 3MV5A 4O7ZA 2RSVA 2UZLA 2X2MA 2X6EA 4OUCA 2WKMA 1H28A 4P5ZA 3RVGA 2ZFYA 4B7TA 4TWCA 2YAAA 4EOJA 1DBHA 2Z0OA 1YW2A 1JSTA 1KOAA 4NM0A 3JPVA 5IUGA 4K9YA 2X1NA 3QIJA 4A9SA 5IQHA 5AADA 4KIQA 4RWIA 4AGUA 1YI6A 3HVCA 3PG3A 5I9UA 2AUHA 4IVDA 3O7LB 5HG9A 4IX6A 4KWPA 4W4XA 4Y5HA 3TUCA 4I5HA 3TEIA 4CQEA 2LOZA 3HP2A 5CASA 3KREA 4DFBA 1Z9XA 3NSZA 5DG5A 2GHMA 4ZJVA 2G01A 2DQ7X 5DR6A 4FT7A 3C50A 1URCA 1XH8A 3A4OX 4NSWA 3PWDA 3HRFA 4J8NA 4CZUA 3I0OA 4AWIA 1YI3A 5CAPA 1MK7B 2C3JA 4YZDA 3QZGA 3NWFA 4PTEA 3R02A 3DJ6A 1FVRA 2CGVA 4JR3A 2B9FA 3GBZA 4MXYA 2PTKA 4D9UA 4DGMA 4JBQA 5E8SA 2PVKA 3ROYA 3FV8A 1KE7A 1XH4A 2V62A 2P2IA 5GJFA 5HE0A 4R6VA 3K5UA 3ZDIA 4YU2A 2YN8A 4BTKA 1FPUA 4CSQA 3R73A 3EN4A 4AOIA 1WBVA 3COKA 4UX9A 1UWHA 5HG7A 3K2LA 4NFMA 4G3FA 5CQWA 5TOZA 4JDJA 4XP2A 5BYYA 4V04A 3PVBA 3PXZA 2Z0PA 3QLFA 3CKWA 1FBNA 5IZFA 2PMNX 3E8EA 4UMRA 3UP2A 4J1RA 4X7QA 3D7ZA 4EHVA 2ZM1A 3ORIA 3TT0A 3AC8A 3H4JA 4PQNA 1EVHA 3PFQA 2ROZB 4MD9E 2QD9A 4MF0A 3FMHA 3V8SA 3EQHA 3T9IA 2YA9A 4HVIA 2EVAA 2D9VA 3VC4A 2H8HA 1LW3A 4NM5A 4BN1A 2C47A 1ZWSA 1Q97A 2PZIA 3OF0A 2ELBA 3CD8A 4V05A 2WTIA 1OKZA 1ZM0A 2Z7LA 1YWVA 4YHTA 1KOBA 4GT5A 2IZTA 2VWIA 4EH7A 5DGZA 1ISNA 5CT0A 3R63A 3P5JC 2A98A 3HUBA 2CN5A 4DT8A 2QODA 4P2KA 1U27A 3QQKA 3IG7A 5DIAA 5HBJA 2DHJA 1GIHA 4FV6A 4DE4A 1TQMA 4FG9A 4CFMA 1ZVRA 3E7OA 3ELJA 4QMZA 3MY1A 5B0XA 2H96A 1V0BA 3LQ8A 4FKPA 4UZDA 1DDWA 4LV5A 2V7OA 3AJ4A 5EDPA 4BICA 3NS9A 4QQTA 4ZY4A 5JEBA 5KKRC 4EK8A 2G35A 5LMAA 3MWUA 3KK9A 4FTCA 5CVGA 4A4OA 4NSTA 2W2WA 5JRQA 3B77A 4LL5A 5C79A 5FTGA 4DDGA 3UQGA 4GH2A 5BVFA 1XBCA 2RF9A 4DFYA 4GN1A 4GRBA 4OTPA 5A3XA 2DWBA 2XM9A 3SV0A 5BUEA 1R1WA 4G1WA 4AW2A 4KAOA 4HNFA 4F1TA 1MIZB 3QRUA 5KBRA 2Y4IC 3C51A 3AD5A 3Q4ZA 2CODA 3R1SA 2UZEA 5ICPA 3NUAA 2XK4A 3QTRA 4YLKA 4UYAA 4A4LA 1DS5A 3E92A 2Q0NA 4OW8A 4UXQA 4ACHA 3W2CA 2G2HA 3P1AA 2FSMX 2DKQA 4M3QA 3MS9A 5L2QA 3TI1A 3R1QA 2UZWE 3U9NA 4KIPA 5H8BA 2YS3A 3R9DA 4L46A 3SLSA 2DKPA 3G6HA 4CRSA 1TFFA 4O7VA 3PPZA 3OC1A 2L1CA 2O0UA 5AUYA 3CJGA 2ITUA 4XEYA 1DAYA 4J53A 4WKQA 4Q5HA 3L8SA 5CU4A 2ZJWA 2BCJA 3PY0A 5GZ8A 4RVKA 4A6FA 1GIJA 1CSNA 1V1KA 3BZ3A 4L9IA 5CTPA 2VTPA 3UOJA 5CLQB 2YAKA 4I24A 4C4IA 1JWHA 4FKWA 4NK9A 4U9AA 2D9XA 4I0SA 5LMBA 3D5WA 4DTAA 5AR3A 1I09A 4ZOGA 2C6IA 1V0PA 4O7RA 3QZIA 4GXBA 1PXLA 4BDCA 5DH9B 1KI1B 3PIYA 1EF1A 4DG2E 4ONAA 2ADZA 3W0OA 2R3NA 5I9WA 1ZYCA 1BUHA 5HCYA 5I9YA 4CD0A 4AA0A 3SUZA 2HY0A 3TYKA 4G31A 4O4FA 3V5PA 4A9YA 4H39A 2X7FA 3NLBA 3QHWA 3LCSA 2YLEA 3G9NA 2WD1A 1Y57A 2X7OA 3HV6A 1H1RA 3DB6A 3LIJA 3LJ0A 3NW6A 4FTIA 4GU9A 4AGWA 4F1MA 2WMXA 2W1EA 3L1SA 3N51A 3PIXA 2D9WA 3W0MA 4QRCA 3TIYA 3HV3A 4TYJA 4K17A 3FHIA 3V8TA 4DINA 5L8LA 3A99A 3Q4UA 3Q4CA 4RC2A 5AV3A 3ROCA 2ZYBA 3D8EA 4WVFB 3LXKA 3M1SA 4FK6A 5ACKA 1OI9A 3R30A 3U4UA 3WZKA 5CSVA 5GIPE 4LOPA 4DEIA 4MXAA 3BE2A 2YJSA 4BKJA 4D4VA 5A4LA 4L68A 4XG7A 4Y83A 3TJCA 4PMPA 1ST4A 3LQ3A 1WI1A 4FVRA 5E8ZA 3QAME 4XP3A 3VO3A 3ULZA 4EORA 2HZIA 3RTPA 2DYLA 2BIKB 2VTQA 2D9YA 1YKRA 4RJ7A 4QPAA 3B8RA 4YHFA 4F08A 3A7FA 3I79A 3F3TA 4B9DA 4LOQA 4C0AA 5JGDA 2GFCA 4DFLA 4BCQA 3NR9A 2R3IA 4BCNA 2C6OA 2W17A 4NT4A 2V5QA 3ZBFA 5LOPB 4DTBA 1Q3DA 2H6DA 3KK8A 2UZVA 4PRJA 2Y6MA 4IDVA 4L1RA 4J8MA 4DGOA 4O0YA 3P86A 3P4KA 2XIXA 5C5BB 4R3PA 3GCVA 2YZLA 4DXAB 2NZ8B 3KXMA 1XBAA 2BZKB 4FL2A 4HOKA 5JZJA 5L6OA 3ATSA 2A19B 5IQAA 2X9FA 3NPCA 3SX9A 5AEPA 4Y46A 3R0TA 4HCUA 4TKSA 1Z57A 4YHJA 4QMYA 3ODWA 2PWLA 3EKNA 4FK3A 1XHAA 4QYHA 4IQ6A 2UZBA 4FKQA 5B2MA 3C1XA 4OT5A 1H26A 1IEPA 3U8ZA 5FUTA 3DZOA 4IDTA 3EWHA 4TPTA 1PW2A 3F69A 3DBFA 3LAUA 3HMPA 3OEZA 3P7AA 4PL3A 4F7UP 3N4VA 2ZV8A 4I6QA 4L6QA 3F5UA 3AT3A 3CXWA 3G6GA 4FVQA 2PVJA 5LQFA 4ITHA 3OHMB 2LULA 5EQPA 3QA8A 2P0FA 3W0PA 4G6OA 4KKEA 2GFSA 4L45A 4LM5A 5EHOA 4HCVA 5FD2A 4BKZA 4HB2B 4IB5A 4FEXA 2A1AB 3II5A 1U54B 1OZ1A 4L7SA 5D12A 4I4FA 4R1YA 2AC3A 4E5WA 1G8KA 4L8MA 1M7NA 5EYDA 2UZRA 4XP0A 3IOPA 4CV8A 1LEZA 4UMTA 4A4XA 3WYFB 3D94A 3E87A 5HGIA 1UV5A 1PMEA 2BIYA 2R3HA 3R7GA 4RX9A 1MUOA 4WNKA 4PUZA 3R83A 2OXDA 3WF8A 4MXOA 4APCA 3RI1A 4BWKA 1W84A 5BQ0A 3ET7A 3SVVA 1L8TA 3MPXA 4O7SA 2QR8A 1CM8A 4D4YA 2DLWA 5AP1A 5EFQA 2VX1A 4IJ9A 4D1SA 2Z7RA 4DEEA 5IRSA 4EUUA 2W4OA 2AC5A 1SVEA 2XMYA 3DPKA 4FI1A 3OWKA 3SOAA 5CSWA 4K18A 3TZ7A 4GJ3A 3NRMA 3FZSA 4GIHA 1APME 4W8DA 3R9HA 4IZ5A 3EB0A 1JNKA 4EI4A 1NU2A 4YL8A 1BL7A 2OIQA 3PLSA 4ARKA 3X23A 3FI8A 3PXYA 2BDJA 4TT7A 3DCVA 3PDTA 5AUXA 4AU8A 3ZZWA 3R8ZA 1ND4A 3EL8A 4FV9A 3UO6A 4NZWB 4D1XA 3FEHA 4KSQA 1CKJA 2PU8A 3CP9A 1MPHA 4H05A 2VTJA 1LB1A 4NJDA 4EQCA 4XG8A 1FOTA 5E90A 5KMMA 3D7TB 4DN5A 4BI2A 3RCDA 5E8YA 1W1DA 1FMOE 4FYOA 5ANEA 4AP7A 5FXRA 3FSSA 2RG6A 3AMYA 3EZRA 4MWHA 4RJ6A 3OWLA 2YJRA 4J97A 1MRUA 2GNHA 2HAKA 3TNWA 5EM5A 4RT7A 2PUUA 3UVPA 5J9ZA 1P2AA 4ASZA 2OW3A 1WBTA 4D4SA 2CJMA 1U5FA 4IM0A 3EH9A 2WTVA 4N70A 3QUPA 1OPLA 4KS7A 3RPOA 1ZMVA 4BTJA 1RDQE 2RIOA 1ATPE 3LOKA 3QUEA 5HO6A 3DTWA 3UZPA 4RLKA 4XG4A 1AWEA 4L53A 4Z7GA 5KMNA 4Z2NA 4YJUA 1QQGA 3O2MA 2F7ZE 4PDPA 3CD3A 3ORTA 4QNYA 1SNUA 4DEGA 2P8VA 5L81A 3BQCA 4M69A 4EWHA 3ZCLA 1VJYA 4H58A 4D2PA 3WZUA 1V89A 3AGMA 2KR0A 3ZDTA 4AXDA 3MH1A 4I5CA 1T45A 2J9MA 4RWJA 3VS7A 1QC6A 4HAWB 5C8KA 1BAKA 5E9EA 2X0PA 5DA3A 5L6WL 1R3CA 4FSWA 4S34A 3UPZA 3K54A 2GQRA 3VOQA 4HB0B 1R0EA 4U40A 4WRGA 2X81A 5EM7A 4RX5A 5J5TA 3BLRA 1YHSA 3NW7A 4HNIA 2CHLA 2RFEA 5HNBA 3JR1A 3LJ2A 3Q6UA 4ANLA 5J1VA 3UJGA 3FWQA 4ZY6A 2XK9A 4EC8A 1B39A 2YWPA 3BWJA 1U46A 2PHKA 3HDMA 5ITAA 3UIBA 5L4QA 1AQCA 3CTJA 4F7HA 4ZEGA 4BHNA 4DH8A 4B99A 2VO3A 5AM7A 4FGBA 4LRMA 1OIRA 5AMNA 3UE4A 1ZOHA 4JG6A 3A8WA 2ERKA 5HCXA 2K00A 1NY3A 3RJCA 4ZMEA 3FSFA 2HZ4A 2OSCA 4FTNA 4FKRA 1WGQA 2VKIA 1OBDA 4FG7A 1JKLA 4E8AA 1UPRA 3A8XA 2HK5A 3SXFA 3ZS5A 2HW6A 3PZEA 4NEUA 2ITOA 3DDQA 3ZO4A 4E93A 1GC6A 4QEBA 1IAHA 2X4ZA 5LCKA 2ONLA 3R71A 3ANRA 4LGHA 1J1BA 4DEHA 4RIYA 4QYGA 4I0RA 1GG3A 1IRSA 2ERZE 2ZPYA 3LFQA 2QOHA 3W18A 5E8WA 4WJ7A 1REKA 2WFYA 5C9CA 3OCSA 3GU4A 1YHVA 3UDBA 2KUPA 4V0GB 2IF8A 3D83A 1J3HA 4U43A 4XG2A 5I2MA 3R7EA 2BZJA 3UDTA 4UZHA 1MQBA 3EQPA 4BF2A 4C3RA 5KO1A 3QC4A 5I2SA 4ACMA 3H0ZA 3QCYA 1FGZA 2ZDTA 1YVJA 3DK3A 3VUIA 4DFZE 2KCJA 3L9NA 4C4FA 4GMVA 3A4PA 1Q8TA 1Y19B 4FKSA 3OP5A 2GDOA 4LL0A 5E7RA 3SO6A 3VBYA 1W2DA 4RA5A 3PUFC 4Z2MB 1W98A 3KA0A 2C6DA 3PP1A 4CTCA 2EJ8A 5L2IA 2NO3A 3L8PA 1WVHA 2J0KA 5AUVA 1DM2A 4GVJA 2HCKA 1PMNA 2WTCA 3DY7A 4R7BA 4PX6A 2OGVA 3KCKA 3NDMA 1QPEA 1W1GA 1GOLA 3IO7A 4DCAA 3G90X 4BJJA 2B1PA 5C1QB 4BR3A 4I21A 3LJ1A 3QA0A 4G3CA 5E4HA 3SYXA 4RVLA 4XG3A 5HCZA 5CLPA 3Q53A 1XODA 4GL9A 3L9MA 4ZS4A 5F20A 3TJDA 3K5VA 2IVSA 4YJRA 5KMJA 2BDFA 2RRFA 1VR2A 3RM6A 3OANA 3PWYA 1Q8YA 4KBAA 3ZEWA 5IMEA 2X39A 3QCSA 5HD7A 2GQGA 4ITJA 1U5DA 4OSNA 2QLUA 3CLYA 2W9FB 3ORNA 4FT9A 1ZC4B 2EXCX 2O63A 3HMMA 4QMSA 3LLTA 4MY6A 4QJ3B 2R3QA 3HYHA 4WG3A 5D3WA 4TWPA 4QMXA 4FEUA 3DK6A 4I92A 4BCKA 4F9YA 2RG5A 5KKRB 2XA4A 2C6MA 2PVYA 4R8QA 5AP5A 3V5JA 1WG7A 5IU2A 1UPQA 3DKFA 2P55A 1UU8A 1RQQA 3WIKA 4JXFA 3QQUA 4BGHA 2P0HA 1WZYA 2OU7A 5CSXA 2EC1A 1W7HA 4BDBA 5LOHA 2BPMA 2HY81 4V0GA 5IQIA 2O5KA 3Q60A 5CEIA 2Z2WA 4CV9A 3P7ZA 2QR7A 2CKEA 2LAVA