2QKLA

The crystal structure of fission yeast mrna decapping enzyme dcp1-dcp2 complex
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
127
structure length
121
Chain Sequence
MEDENILRNAVNLQVLKFHYPEIESIIDIASHVAVYQFWLKTSIEGTFFLVKDQRARVGYVILNRNSPENLYLFINHPSNVHLVDRYLIHRTENQHVVGLWMFDPNDMSRIFNIVKESLLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SPBC3B9.21 protein
publication title Structural basis of dcp2 recognition and activation by dcp1.
pubmed doi rcsb
source organism Schizosaccharomyces pombe
molecule tags Hydrolase
total genus 34
structure length 121
sequence length 127
ec nomenclature
pdb deposition date 2007-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06058 DCP1 Dcp1-like decapping family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2qklA00
1W1DA 2UVMA 2D2QA 3HQCA 1LB1A 2KCJA 2GCJA 3FM8C 4EMOA 3AJ4A 5J3QA 2CRFA 2D10A 2BCJA 2DHJA 2M38A 2RUKB 2D9VA 2CY5A 3GYOA 2DFKA 4B6HA 2AL6A 3TCAA 3VIAA 1MPHA 2X18A 2ROZB 1AWEA 3TO1A 1N3HA 2QKMA 3F0WA 4ZRKA 3TVVA 2DYNA 4HAWB 3MDBC 2YSZA 2H7EA 1WJMA 1MK9B 2DX5A 4K17A 5CLQB 2DKPA 2RVBB 5KQ1A 1M7RA 3ODXA 4MT7A 2ELAA 1M7EA 1V5PA 3ULCA 1ISNA 4HB4B 1FOEA 1AQCA 2DN6A 4HB2B 2K00A 2UZSA 4GN1A 2YS5A 4L6EA 1MK7B 2I1KA 4PNKA 2MFQA 1EAZA 4HB3B 2EJ8A 1QC6A 5C6RA 3T06A 3PG7A 3A8PA 4D0NB 1NTVA 5DHFB 3PP2A 4WSFA 2JP2A 2W2XC 3BJIA 4GMVA 3A98B 4A5KA 3PEGA 4Z2NA 2LYDA 3KY9A 1DBHA 3QBVB 5JP4A 1FGZA 1ZC3B 4MK0A 1WJ1A 3PVWA 1XODA 5KQ4A 1DDWA 5J3TA 3ZDTA 1X1GA 4DBBA 2L1CA 2COCA 2LOXA 2KUPA 4A6FA 3LJUX 3NSUA 2I1JA 3O96A 3N7CA 2VKIA 3HW2B 2COFA 1UPQA 5HE1A 3TW1A 2OTXA 4A6HA 1V5UA 2Z0OA 3KRXA 2RNRB 1E5WA 1FHOA 5DIFB 3D8EA 3QWMA 4IAPA 1UNPA 1V89A 3SYXA 4A6KA 2YS3A 3WA0A 4ZRJA 1V61A 4GPTB 1B55A 2GCLA 4HAUB 3KZ1A 5JLJB 5HE3A 2NMBA 2K2UA 4A6FB 1BAKA 4HB0B 5LONB 3ODWA 1U27A 2YT0A 2H7DA 4IFSA 4KHOA 3PVLA 1BTNA 2ROVA 2LG1A 5C5BA 1PMSA 3CXBB 4TKNA 1W1HA 3AU5A 1EVHA 2MDXA 1LW3A 2MWNB 3SV1A 5C79A 4CHMA 2DX1A 4HAXB 2VRWB 4CYEA 4KVGB 4Z2MB 2D9WA 2N23A 1FAOA 4YONA 1MAIA 2GJYA 1QQGA 4IOYX 2NZ8B 1RJ2A 1NU2A 1IRSA 2YS1A 2EMTA 4EKUA 3P7ZA 3X23A 1X05A 2Y8FA 3P6AA 2RGNB 5D3VA 2HTHB 3PVUA 2J0JA 5DI9B 2DLWA 3ULBA 5C5BB 3BINA 1MIZB 1K5GB 1TQZA 4KHBB 4KAXB 1OMWA 1U29A 1GC6A 4KHAA 2COAA 3TFMA 2YT1A 1XKEA 4F7HA 1SGHA 3F5RA 3A8QA 3ZVRA 1FGYA 3FEHA 3G9WA 2EMSA 3FSSA 4DX90 1WI1A 3RCPA 2P0FA 1I7AA 4H8SA 1XCGA 1WGUA 1NI2A 2P0DA 1H4RA 4HDOA 2ADZA 1RRPB 5HE2A 1TJ6A 2YVCA 4NSWA 5FI0A 1UEFA 2D9YA 1MKEA 3ML4A 1V5MA 3DXDA 3KSYA 3SO6A 4EJNA 2RSGA 2YF0A 1ZC4B 1P3RA 1DDMA 4DXAB 4HDQA 2DYQA 3PSCA 1KI1B 2DKQA 2E2XA 2IYBA 4F7UP 4K2PA 1ZSQA 2CODA 1U5EA 4ZRIA 2OQBA 2DHKA 2W2XD 2P0HA 2RLOA 1J19A 2EC1A 2ZPYA 2V76A 2D9ZA 4GMXB 2YRYA 4K81A 2CAYA 5FI1A 4GZUA 5LOPB 2Y8GA 1SHCA 1UNQA 5CLLB 3HK0A 3WYFB 4GXBA 4YL8A 2MKRA 4HAVB 5DH9B 1PLSA 1EGXA 1U5DA 2UZRA 2J59M 4WVFB 2FJLA 1Y19B 1P6SA 5C16A 2I5CA 1GC7A 4WJ7A 2LOZA 2Q13A 3DXCA 2GS0A 5D3XA 2J0MA 1PFJA 2Z0QA 3SNHA 3D8FA 5JHHA 2QKLA 2D4QA 1J0WA 3SUZA 3M1IB 1DYNA 1U5FA 1KZGA 5D27A 4K2OA 1XD4A 4BBKA 5DHAB 3GYPA 1I2HA 5D3WA 1WG7A 1Z87A 1V88A 2DTCA 3VOQA 1Y5OA 4HHVA 1EF1A 2G35A 2D11A 5JHGA 4Y94A 2L2IA 2N0YA 1XR0B 2DA0A 2R09A 2R0DA 5EFXA 4NY0A 5GOWB 3OANA 2D9XA 4TYZA 2W2WA 1DROA 1H10A 1UNRA 1BTKA 1OY2A 1TXDA 2AEHA 1P5TA 1MIXA 5L81A 5D3YA 3DXEA 2LKOA 1WVHA 2PZ1A 3U7DA 2P8VA 2M14A 4MY6A 2Z0PA 2DHIA 1K5DB 4XWXA 4CHJA 3MPXA 1GG3A 3V5WA 5J3YA 2VSZA 4HATB 1WGQA 4PQ0A 2Y7BA 1U2BA 4F7GA 1KZ7A 2I5FA 1FHXA 3UZTA 2HE7A 2CY4A 1Q67A 2XQNM 1XX0A 4DX8A 1W1GA 1FB8A 3IVFA 1BWNA 2LULA 2J0KA 3KRWA 1ZVRA 3D8DA 3ODOA 3PZDA 5KCVA 4HAZB 2K2JA 4P7IA 3U8ZA 1UPRA 1OQNA 3CIKA 3QIJA 1DDVA 2KGXB 2IFSA 1X86A 1X11A 1X1FA 3AU4A 1NTYA 1U5GA 2ELBA 5HE0A 1FHWA 4HAYB 4C0AA 1ZM0A
chains in the Genus database with same CATH superfamily
1W1DA 2UVMA 1T77A 3B77A 3DCXA 2D2QA 3HQCA 1LB1A 2KCJA 2GCJA 3FM8C 4EMOA 3AJ4A 5J3QA 2CRFA 2D10A 2BCJA 2DHJA 2M38A 2RUKB 2D9VA 2CY5A 3GYOA 2DFKA 4B6HA 2AL6A 3TCAA 2KUQA 3VIAA 1MPHA 2X18A 2ROZB 1AWEA 3TO1A 1N3HA 2QKMA 3F0WA 4ZRKA 3TVVA 3OHMB 2DYNA 4HAWB 3MDBC 2YSZA 2H7EA 1WJMA 1MK9B 2DX5A 4K17A 5CLQB 2DKPA 2RVBB 5KQ1A 1M7RA 3ODXA 4OSNA 4MT7A 2ELAA 1M7EA 3HIEA 1V5PA 3ULCA 1ISNA 4HB4B 5I2SA 1FOEA 1AQCA 2DN6A 4GOUA 4CSQA 4HB2B 4OT1A 2K00A 2UZSA 4GN1A 2YS5A 4L6EA 1MK7B 2I1KA 4PNKA 2MFQA 2R2YA 1EAZA 4HB3B 2EJ8A 1QC6A 5C6RA 3T06A 3PG7A 3A8PA 4D0NB 1NTVA 5DHFB 3PP2A 4WSFA 2JP2A 2W2XC 3BJIA 4GMVA 3A98B 4A5KA 3PEGA 4Z2NA 2LYDA 3KY9A 1DBHA 3QBVB 5JP4A 1MI1A 1FGZA 1ZC3B 5I2MA 4DIXA 4MK0A 1WJ1A 3PVWA 1XODA 5KQ4A 1DDWA 5J3TA 3ZDTA 1X1GA 4DBBA 2L1CA 2COCA 2LOXA 2KUPA 4A6FA 3LJUX 3NSUA 2I1JA 3N7CA 3O96A 2VKIA 3HW2B 2COFA 1UPQA 5HE1A 5M4YB 3TW1A 2OTXA 4A6HA 1V5UA 2Z0OA 3KRXA 2RNRB 1E5WA 1FHOA 5DIFB 3D8EA 3QWMA 4IAPA 1UNPA 1V89A 3SYXA 4A6KA 2YS3A 3WA0A 4QJ4B 4ZRJA 1V61A 4GPTB 1B55A 2ZKMX 2GCLA 4HAUB 3KZ1A 5JLJB 5HE3A 2NMBA 2K2UA 4A6FB 1BAKA 4HB0B 5LONB 2Z13A 3ODWA 1U27A 2YT0A 2H7DA 2FJUB 4IFSA 4KHOA 3PVLA 1BTNA 2ROVA 2LG1A 5C5BA 1PMSA 3CXBB 4TKNA 1W1HA 3AU5A 1EVHA 4KHBA 2MDXA 1LW3A 2MWNB 3SV1A 5C79A 4CHMA 2DX1A 4HAXB 2VRWB 4CYEA 4KVGB 4Z2MB 2D9WA 2N23A 1FAOA 4YONA 1MAIA 2GJYA 4D6WA 1QQGA 4IOYX 2NZ8B 1RJ2A 3NWFA 1NU2A 1IRSA 2YS1A 2EMTA 4EKUA 3P7ZA 3X23A 1X05A 2Y8FA 3P6AA 2RGNB 5D3VA 2Z59A 2HTHB 3PVUA 2J0JA 5DI9B 2DLWA 3ULBA 5C5BB 3BINA 1MIZB 1K5GB 1TQZA 4KHBB 2RRFA 4KAXB 1OMWA 1U29A 1GC6A 4KHAA 2COAA 3TFMA 2YT1A 1XKEA 4F7HA 1SGHA 3F5RA 3A8QA 3ZVRA 5IRSA 1FGYA 3FEHA 3G9WA 2EMSA 3FSSA 4DX90 1WI1A 3RCPA 2P0FA 1I7AA 4H8SA 1XCGA 1WGUA 3HSAA 1NI2A 2P0DA 1H4RA 4HDOA 2ADZA 1RRPB 2NBVA 1ZYIA 5HE2A 1TJ6A 2YVCA 4NSWA 5FI0A 1UEFA 2D9YA 1MKEA 3ML4A 1V5MA 3DXDA 3KSYA 3SO6A 3NW8A 4EJNA 2RSGA 2YF0A 1ZC4B 1P3RA 1DDMA 4DXAB 2Z4DA 4HDQA 2DYQA 3PSCA 1KI1B 2DKQA 2E2XA 2IYBA 4F7UP 4K2PA 1ZSQA 2CODA 1U5EA 2KIGA 4ZRIA 2OQBA 2DHKA 2W2XD 2P0HA 2RLOA 1J19A 2EC1A 4HSIA 2ZPYA 2YT2A 2V76A 2D9ZA 4GMXB 2YRYA 4K81A 2CAYA 5FI1A 4GZUA 5LOPB 2Y8GA 1SHCA 1UNQA 5CLLB 3HK0A 3WYFB 4GXBA 4YL8A 2MKRA 3A58A 4HAVB 5DH9B 1PLSA 1EGXA 1U5DA 5LG4B 2UZRA 2J59M 4QJ3B 4WVFB 2FJLA 1Y19B 1P6SA 5C16A 2I5CA 1GC7A 4WJ7A 2LOZA 2Q13A 3DXCA 2GS0A 5D3XA 2J0MA 1PFJA 2Z0QA 3SNHA 3D8FA 3NWAA 5JHHA 2QKLA 2D4QA 1J0WA 3SUZA 3M1IB 1DYNA 1U5FA 1KZGA 5D27A 4QJ5B 4K2OA 1XD4A 4BBKA 5DHAB 3GYPA 1I2HA 4QXAB 5D3WA 1WG7A 1Z87A 1V88A 2DTCA 3VOQA 2KR0A 2GUMA 1Y5OA 4HHVA 1EF1A 2G35A 2D11A 5JHGA 4Y94A 2L2IA 2N0YA 1XR0B 2DA0A 2R09A 2R0DA 5EFXA 4NY0A 5GOWB 3OANA 2D9XA 4TYZA 2W2WA 1DROA 1H10A 1UNRA 1BTKA 1OY2A 1TXDA 2AEHA 1P5TA 1MIXA 5L81A 5D3YA 3DXEA 2KIEA 2LKOA 1WVHA 2PZ1A 3U7DA 2P8VA 2M14A 4MY6A 2Z0PA 2DHIA 1K5DB 4XWXA 4CHJA 3MPXA 1GG3A 3V5WA 5J3YA 2VSZA 4HATB 1WGQA 4PQ0A 2Y7BA 1U2BA 4F7GA 1KZ7A 2I5FA 1FHXA 3UZTA 2HE7A 2CY4A 1Q67A 2XQNM 1XX0A 3U12A 4DX8A 1W1GA 1FB8A 3IVFA 4GNKB 1BWNA 2LULA 2J0KA 3KRWA 1ZVRA 3D8DA 3NWDA 3ODOA 3PZDA 5KCVA 2K49A 4HAZB 2K2JA 4P7IA 2Z14A 4L1RA 3U8ZA 1UPRA 1OQNA 3CIKA 3QIJA 1DDVA 2KGXB 2IFSA 2K8EA 1X86A 1X11A 1X1FA 3AU4A 1NTYA 1U5GA 2ELBA 3FVCA 5HE0A 1FHWA 4HAYB 4C0AA 1ZM0A
chains in the Genus database with same CATH topology
1W1DA 2UVMA 2D2QA 3HQCA 1LB1A 2KCJA 2GCJA 3FM8C 4EMOA 3AJ4A 5J3QA 2CRFA 2D10A 2BCJA 2DHJA 2M38A 2RUKB 2D9VA 2CY5A 3GYOA 2DFKA 4B6HA 2AL6A 3TCAA 3VIAA 1MPHA 2X18A 2ROZB 1AWEA 3TO1A 1N3HA 2QKMA 3F0WA 4ZRKA 3TVVA 2DYNA 4HAWB 3MDBC 2YSZA 2H7EA 1WJMA 1MK9B 2DX5A 4K17A 5CLQB 2DKPA 2RVBB 5KQ1A 1M7RA 3ODXA 4MT7A 2ELAA 1M7EA 1V5PA 3ULCA 1ISNA 4HB4B 1FOEA 1AQCA 2DN6A 4HB2B 2K00A 2UZSA 4GN1A 2YS5A 4L6EA 1MK7B 2I1KA 4PNKA 2MFQA 1EAZA 4HB3B 2EJ8A 1QC6A 5C6RA 3T06A 3PG7A 3A8PA 4D0NB 1NTVA 5DHFB 3PP2A 4WSFA 2JP2A 2W2XC 3BJIA 4GMVA 3A98B 4A5KA 3PEGA 4Z2NA 2LYDA 3KY9A 1DBHA 3QBVB 5JP4A 1FGZA 1ZC3B 4MK0A 1WJ1A 3PVWA 1XODA 5KQ4A 1DDWA 5J3TA 3ZDTA 1X1GA 4DBBA 2L1CA 2COCA 2LOXA 2KUPA 4A6FA 3LJUX 3NSUA 2I1JA 3O96A 3N7CA 2VKIA 3HW2B 2COFA 1UPQA 5HE1A 3TW1A 2OTXA 4A6HA 1V5UA 2Z0OA 3KRXA 2RNRB 1E5WA 1FHOA 5DIFB 3D8EA 3QWMA 4IAPA 1UNPA 1V89A 3SYXA 4A6KA 2YS3A 3WA0A 4ZRJA 1V61A 4GPTB 1B55A 2GCLA 4HAUB 3KZ1A 5JLJB 5HE3A 2NMBA 2K2UA 4A6FB 1BAKA 4HB0B 5LONB 3ODWA 1U27A 2YT0A 2H7DA 4IFSA 4KHOA 3PVLA 1BTNA 2ROVA 2LG1A 5C5BA 1PMSA 3CXBB 4TKNA 1W1HA 3AU5A 1EVHA 2MDXA 1LW3A 2MWNB 3SV1A 5C79A 4CHMA 2DX1A 4HAXB 2VRWB 4CYEA 4KVGB 4Z2MB 2D9WA 2N23A 1FAOA 4YONA 1MAIA 2GJYA 1QQGA 4IOYX 2NZ8B 1RJ2A 1NU2A 1IRSA 2YS1A 2EMTA 4EKUA 3P7ZA 3X23A 1X05A 2Y8FA 3P6AA 2RGNB 5D3VA 2HTHB 3PVUA 2J0JA 5DI9B 2DLWA 3ULBA 5C5BB 3BINA 1MIZB 1K5GB 1TQZA 4KHBB 4KAXB 1OMWA 1U29A 1GC6A 4KHAA 2COAA 3TFMA 2YT1A 1XKEA 4F7HA 1SGHA 3F5RA 3A8QA 3ZVRA 1FGYA 3FEHA 3G9WA 2EMSA 3FSSA 4DX90 1WI1A 3RCPA 2P0FA 1I7AA 4H8SA 1XCGA 1WGUA 1NI2A 2P0DA 1H4RA 4HDOA 2ADZA 1RRPB 5HE2A 1TJ6A 2YVCA 4NSWA 5FI0A 1UEFA 2D9YA 1MKEA 3ML4A 1V5MA 3DXDA 3KSYA 3SO6A 4EJNA 2RSGA 2YF0A 1ZC4B 1P3RA 1DDMA 4DXAB 4HDQA 2DYQA 3PSCA 1KI1B 2DKQA 2E2XA 2IYBA 4F7UP 4K2PA 1ZSQA 2CODA 1U5EA 4ZRIA 2OQBA 2DHKA 2W2XD 2P0HA 2RLOA 1J19A 2EC1A 2ZPYA 2V76A 2D9ZA 4GMXB 2YRYA 4K81A 2CAYA 5FI1A 4GZUA 5LOPB 2Y8GA 1SHCA 1UNQA 5CLLB 3HK0A 3WYFB 4GXBA 4YL8A 2MKRA 4HAVB 5DH9B 1PLSA 1EGXA 1U5DA 2UZRA 2J59M 4WVFB 2FJLA 1Y19B 1P6SA 5C16A 2I5CA 1GC7A 4WJ7A 2LOZA 2Q13A 3DXCA 2GS0A 5D3XA 2J0MA 1PFJA 2Z0QA 3SNHA 3D8FA 5JHHA 2QKLA 2D4QA 1J0WA 3SUZA 3M1IB 1DYNA 1U5FA 1KZGA 5D27A 4K2OA 1XD4A 4BBKA 5DHAB 3GYPA 1I2HA 5D3WA 1WG7A 1Z87A 1V88A 2DTCA 3VOQA 1Y5OA 4HHVA 1EF1A 2G35A 2D11A 5JHGA 4Y94A 2L2IA 2N0YA 1XR0B 2DA0A 2R09A 2R0DA 5EFXA 4NY0A 5GOWB 3OANA 2D9XA 4TYZA 2W2WA 1DROA 1H10A 1UNRA 1BTKA 1OY2A 1TXDA 2AEHA 1P5TA 1MIXA 5L81A 5D3YA 3DXEA 2LKOA 1WVHA 2PZ1A 3U7DA 2P8VA 2M14A 4MY6A 2Z0PA 2DHIA 1K5DB 4XWXA 4CHJA 3MPXA 1GG3A 3V5WA 5J3YA 2VSZA 4HATB 1WGQA 4PQ0A 2Y7BA 1U2BA 4F7GA 1KZ7A 2I5FA 1FHXA 3UZTA 2HE7A 2CY4A 1Q67A 2XQNM 1XX0A 4DX8A 1W1GA 1FB8A 3IVFA 1BWNA 2LULA 2J0KA 3KRWA 1ZVRA 3D8DA 3ODOA 3PZDA 5KCVA 4HAZB 2K2JA 4P7IA 3U8ZA 1UPRA 1OQNA 3CIKA 3QIJA 1DDVA 2KGXB 2IFSA 1X86A 1X11A 1X1FA 3AU4A 1NTYA 1U5GA 2ELBA 5HE0A 1FHWA 4HAYB 4C0AA 1ZM0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1W1D A;  2UVM A;  2D2Q A;  3HQC A;  1LB1 A;  2KCJ A;  2GCJ A;  3FM8 C;  4EMO A;  3AJ4 A;  5J3Q A;  2CRF A;  2D10 A;  2BCJ A;  2DHJ A;  2M38 A;  2RUK B;  2D9V A;  2CY5 A;  3GYO A;  2DFK A;  4B6H A;  2AL6 A;  3TCA A;  3VIA A;  1MPH A;  2X18 A;  2ROZ B;  1AWE A;  3TO1 A;  1N3H A;  2QKM A;  3F0W A;  4ZRK A;  3TVV A;  2DYN A;  4HAW B;  3MDB C;  2YSZ A;  2H7E A;  1WJM A;  1MK9 B;  2DX5 A;  4K17 A;  5CLQ B;  2DKP A;  2RVB B;  5KQ1 A;  1M7R A;  3ODX A;  4MT7 A;  2ELA A;  1M7E A;  1V5P A;  3ULC A;  1ISN A;  4HB4 B;  1FOE A;  1AQC A;  2DN6 A;  4HB2 B;  2K00 A;  2UZS A;  4GN1 A;  2YS5 A;  4L6E A;  1MK7 B;  2I1K A;  4PNK A;  2MFQ A;  1EAZ A;  4HB3 B;  2EJ8 A;  1QC6 A;  5C6R A;  3T06 A;  3PG7 A;  3A8P A;  4D0N B;  1NTV A;  5DHF B;  3PP2 A;  4WSF A;  2JP2 A;  2W2X C;  3BJI A;  4GMV A;  3A98 B;  4A5K A;  3PEG A;  4Z2N A;  2LYD A;  3KY9 A;  1DBH A;  3QBV B;  5JP4 A;  1FGZ A;  1ZC3 B;  4MK0 A;  1WJ1 A;  3PVW A;  1XOD A;  5KQ4 A;  1DDW A;  5J3T A;  3ZDT A;  1X1G A;  4DBB A;  2L1C A;  2COC A;  2LOX A;  2KUP A;  4A6F A;  3LJU X;  3NSU A;  2I1J A;  3O96 A;  3N7C A;  2VKI A;  3HW2 B;  2COF A;  1UPQ A;  5HE1 A;  3TW1 A;  2OTX A;  4A6H A;  1V5U A;  2Z0O A;  3KRX A;  2RNR B;  1E5W A;  1FHO A;  5DIF B;  3D8E A;  3QWM A;  4IAP A;  1UNP A;  1V89 A;  3SYX A;  4A6K A;  2YS3 A;  3WA0 A;  4ZRJ A;  1V61 A;  4GPT B;  1B55 A;  2GCL A;  4HAU B;  3KZ1 A;  5JLJ B;  5HE3 A;  2NMB A;  2K2U A;  4A6F B;  1BAK A;  4HB0 B;  5LON B;  3ODW A;  1U27 A;  2YT0 A;  2H7D A;  4IFS A;  4KHO A;  3PVL A;  1BTN A;  2ROV A;  2LG1 A;  5C5B A;  1PMS A;  3CXB B;  4TKN A;  1W1H A;  3AU5 A;  1EVH A;  2MDX A;  1LW3 A;  2MWN B;  3SV1 A;  5C79 A;  4CHM A;  2DX1 A;  4HAX B;  2VRW B;  4CYE A;  4KVG B;  4Z2M B;  2D9W A;  2N23 A;  1FAO A;  4YON A;  1MAI A;  2GJY A;  1QQG A;  4IOY X;  2NZ8 B;  1RJ2 A;  1NU2 A;  1IRS A;  2YS1 A;  2EMT A;  4EKU A;  3P7Z A;  3X23 A;  1X05 A;  2Y8F A;  3P6A A;  2RGN B;  5D3V A;  2HTH B;  3PVU A;  2J0J A;  5DI9 B;  2DLW A;  3ULB A;  5C5B B;  3BIN A;  1MIZ B;  1K5G B;  1TQZ A;  4KHB B;  4KAX B;  1OMW A;  1U29 A;  1GC6 A;  4KHA A;  2COA A;  3TFM A;  2YT1 A;  1XKE A;  4F7H A;  1SGH A;  3F5R A;  3A8Q A;  3ZVR A;  1FGY A;  3FEH A;  3G9W A;  2EMS A;  3FSS A;  4DX9 0;  1WI1 A;  3RCP A;  2P0F A;  1I7A A;  4H8S A;  1XCG A;  1WGU A;  1NI2 A;  2P0D A;  1H4R A;  4HDO A;  2ADZ A;  1RRP B;  5HE2 A;  1TJ6 A;  2YVC A;  4NSW A;  5FI0 A;  1UEF A;  2D9Y A;  1MKE A;  3ML4 A;  1V5M A;  3DXD A;  3KSY A;  3SO6 A;  4EJN A;  2RSG A;  2YF0 A;  1ZC4 B;  1P3R A;  1DDM A;  4DXA B;  4HDQ A;  2DYQ A;  3PSC A;  1KI1 B;  2DKQ A;  2E2X A;  2IYB A;  4F7U P;  4K2P A;  1ZSQ A;  2COD A;  1U5E A;  4ZRI A;  2OQB A;  2DHK A;  2W2X D;  2P0H A;  2RLO A;  1J19 A;  2EC1 A;  2ZPY A;  2V76 A;  2D9Z A;  4GMX B;  2YRY A;  4K81 A;  2CAY A;  5FI1 A;  4GZU A;  5LOP B;  2Y8G A;  1SHC A;  1UNQ A;  5CLL B;  3HK0 A;  3WYF B;  4GXB A;  4YL8 A;  2MKR A;  4HAV B;  5DH9 B;  1PLS A;  1EGX A;  1U5D A;  2UZR A;  2J59 M;  4WVF B;  2FJL A;  1Y19 B;  1P6S A;  5C16 A;  2I5C A;  1GC7 A;  4WJ7 A;  2LOZ A;  2Q13 A;  3DXC A;  2GS0 A;  5D3X A;  2J0M A;  1PFJ A;  2Z0Q A;  3SNH A;  3D8F A;  5JHH A;  2QKL A;  2D4Q A;  1J0W A;  3SUZ A;  3M1I B;  1DYN A;  1U5F A;  1KZG A;  5D27 A;  4K2O A;  1XD4 A;  4BBK A;  5DHA B;  3GYP A;  1I2H A;  5D3W A;  1WG7 A;  1Z87 A;  1V88 A;  2DTC A;  3VOQ A;  1Y5O A;  4HHV A;  1EF1 A;  2G35 A;  2D11 A;  5JHG A;  4Y94 A;  2L2I A;  2N0Y A;  1XR0 B;  2DA0 A;  2R09 A;  2R0D A;  5EFX A;  4NY0 A;  5GOW B;  3OAN A;  2D9X A;  4TYZ A;  2W2W A;  1DRO A;  1H10 A;  1UNR A;  1BTK A;  1OY2 A;  1TXD A;  2AEH A;  1P5T A;  1MIX A;  5L81 A;  5D3Y A;  3DXE A;  2LKO A;  1WVH A;  2PZ1 A;  3U7D A;  2P8V A;  2M14 A;  4MY6 A;  2Z0P A;  2DHI A;  1K5D B;  4XWX A;  4CHJ A;  3MPX A;  1GG3 A;  3V5W A;  5J3Y A;  2VSZ A;  4HAT B;  1WGQ A;  4PQ0 A;  2Y7B A;  1U2B A;  4F7G A;  1KZ7 A;  2I5F A;  1FHX A;  3UZT A;  2HE7 A;  2CY4 A;  1Q67 A;  2XQN M;  1XX0 A;  4DX8 A;  1W1G A;  1FB8 A;  3IVF A;  1BWN A;  2LUL A;  2J0K A;  3KRW A;  1ZVR A;  3D8D A;  3ODO A;  3PZD A;  5KCV A;  4HAZ B;  2K2J A;  4P7I A;  3U8Z A;  1UPR A;  1OQN A;  3CIK A;  3QIJ A;  1DDV A;  2KGX B;  2IFS A;  1X86 A;  1X11 A;  1X1F A;  3AU4 A;  1NTY A;  1U5G A;  2ELB A;  5HE0 A;  1FHW A;  4HAY B;  4C0A A;  1ZM0 A; 
#chains in the Genus database with same CATH topology
 1W1D A;  2UVM A;  1T77 A;  3B77 A;  3DCX A;  2D2Q A;  3HQC A;  1LB1 A;  2KCJ A;  2GCJ A;  3FM8 C;  4EMO A;  3AJ4 A;  5J3Q A;  2CRF A;  2D10 A;  2BCJ A;  2DHJ A;  2M38 A;  2RUK B;  2D9V A;  2CY5 A;  3GYO A;  2DFK A;  4B6H A;  2AL6 A;  3TCA A;  2KUQ A;  3VIA A;  1MPH A;  2X18 A;  2ROZ B;  1AWE A;  3TO1 A;  1N3H A;  2QKM A;  3F0W A;  4ZRK A;  3TVV A;  3OHM B;  2DYN A;  4HAW B;  3MDB C;  2YSZ A;  2H7E A;  1WJM A;  1MK9 B;  2DX5 A;  4K17 A;  5CLQ B;  2DKP A;  2RVB B;  5KQ1 A;  1M7R A;  3ODX A;  4OSN A;  4MT7 A;  2ELA A;  1M7E A;  3HIE A;  1V5P A;  3ULC A;  1ISN A;  4HB4 B;  5I2S A;  1FOE A;  1AQC A;  2DN6 A;  4GOU A;  4CSQ A;  4HB2 B;  4OT1 A;  2K00 A;  2UZS A;  4GN1 A;  2YS5 A;  4L6E A;  1MK7 B;  2I1K A;  4PNK A;  2MFQ A;  2R2Y A;  1EAZ A;  4HB3 B;  2EJ8 A;  1QC6 A;  5C6R A;  3T06 A;  3PG7 A;  3A8P A;  4D0N B;  1NTV A;  5DHF B;  3PP2 A;  4WSF A;  2JP2 A;  2W2X C;  3BJI A;  4GMV A;  3A98 B;  4A5K A;  3PEG A;  4Z2N A;  2LYD A;  3KY9 A;  1DBH A;  3QBV B;  5JP4 A;  1MI1 A;  1FGZ A;  1ZC3 B;  5I2M A;  4DIX A;  4MK0 A;  1WJ1 A;  3PVW A;  1XOD A;  5KQ4 A;  1DDW A;  5J3T A;  3ZDT A;  1X1G A;  4DBB A;  2L1C A;  2COC A;  2LOX A;  2KUP A;  4A6F A;  3LJU X;  3NSU A;  2I1J A;  3N7C A;  3O96 A;  2VKI A;  3HW2 B;  2COF A;  1UPQ A;  5HE1 A;  5M4Y B;  3TW1 A;  2OTX A;  4A6H A;  1V5U A;  2Z0O A;  3KRX A;  2RNR B;  1E5W A;  1FHO A;  5DIF B;  3D8E A;  3QWM A;  4IAP A;  1UNP A;  1V89 A;  3SYX A;  4A6K A;  2YS3 A;  3WA0 A;  4QJ4 B;  4ZRJ A;  1V61 A;  4GPT B;  1B55 A;  2ZKM X;  2GCL A;  4HAU B;  3KZ1 A;  5JLJ B;  5HE3 A;  2NMB A;  2K2U A;  4A6F B;  1BAK A;  4HB0 B;  5LON B;  2Z13 A;  3ODW A;  1U27 A;  2YT0 A;  2H7D A;  2FJU B;  4IFS A;  4KHO A;  3PVL A;  1BTN A;  2ROV A;  2LG1 A;  5C5B A;  1PMS A;  3CXB B;  4TKN A;  1W1H A;  3AU5 A;  1EVH A;  4KHB A;  2MDX A;  1LW3 A;  2MWN B;  3SV1 A;  5C79 A;  4CHM A;  2DX1 A;  4HAX B;  2VRW B;  4CYE A;  4KVG B;  4Z2M B;  2D9W A;  2N23 A;  1FAO A;  4YON A;  1MAI A;  2GJY A;  4D6W A;  1QQG A;  4IOY X;  2NZ8 B;  1RJ2 A;  3NWF A;  1NU2 A;  1IRS A;  2YS1 A;  2EMT A;  4EKU A;  3P7Z A;  3X23 A;  1X05 A;  2Y8F A;  3P6A A;  2RGN B;  5D3V A;  2Z59 A;  2HTH B;  3PVU A;  2J0J A;  5DI9 B;  2DLW A;  3ULB A;  5C5B B;  3BIN A;  1MIZ B;  1K5G B;  1TQZ A;  4KHB B;  2RRF A;  4KAX B;  1OMW A;  1U29 A;  1GC6 A;  4KHA A;  2COA A;  3TFM A;  2YT1 A;  1XKE A;  4F7H A;  1SGH A;  3F5R A;  3A8Q A;  3ZVR A;  5IRS A;  1FGY A;  3FEH A;  3G9W A;  2EMS A;  3FSS A;  4DX9 0;  1WI1 A;  3RCP A;  2P0F A;  1I7A A;  4H8S A;  1XCG A;  1WGU A;  3HSA A;  1NI2 A;  2P0D A;  1H4R A;  4HDO A;  2ADZ A;  1RRP B;  2NBV A;  1ZYI A;  5HE2 A;  1TJ6 A;  2YVC A;  4NSW A;  5FI0 A;  1UEF A;  2D9Y A;  1MKE A;  3ML4 A;  1V5M A;  3DXD A;  3KSY A;  3SO6 A;  3NW8 A;  4EJN A;  2RSG A;  2YF0 A;  1ZC4 B;  1P3R A;  1DDM A;  4DXA B;  2Z4D A;  4HDQ A;  2DYQ A;  3PSC A;  1KI1 B;  2DKQ A;  2E2X A;  2IYB A;  4F7U P;  4K2P A;  1ZSQ A;  2COD A;  1U5E A;  2KIG A;  4ZRI A;  2OQB A;  2DHK A;  2W2X D;  2P0H A;  2RLO A;  1J19 A;  2EC1 A;  4HSI A;  2ZPY A;  2YT2 A;  2V76 A;  2D9Z A;  4GMX B;  2YRY A;  4K81 A;  2CAY A;  5FI1 A;  4GZU A;  5LOP B;  2Y8G A;  1SHC A;  1UNQ A;  5CLL B;  3HK0 A;  3WYF B;  4GXB A;  4YL8 A;  2MKR A;  3A58 A;  4HAV B;  5DH9 B;  1PLS A;  1EGX A;  1U5D A;  5LG4 B;  2UZR A;  2J59 M;  4QJ3 B;  4WVF B;  2FJL A;  1Y19 B;  1P6S A;  5C16 A;  2I5C A;  1GC7 A;  4WJ7 A;  2LOZ A;  2Q13 A;  3DXC A;  2GS0 A;  5D3X A;  2J0M A;  1PFJ A;  2Z0Q A;  3SNH A;  3D8F A;  3NWA A;  5JHH A;  2QKL A;  2D4Q A;  1J0W A;  3SUZ A;  3M1I B;  1DYN A;  1U5F A;  1KZG A;  5D27 A;  4QJ5 B;  4K2O A;  1XD4 A;  4BBK A;  5DHA B;  3GYP A;  1I2H A;  4QXA B;  5D3W A;  1WG7 A;  1Z87 A;  1V88 A;  2DTC A;  3VOQ A;  2KR0 A;  2GUM A;  1Y5O A;  4HHV A;  1EF1 A;  2G35 A;  2D11 A;  5JHG A;  4Y94 A;  2L2I A;  2N0Y A;  1XR0 B;  2DA0 A;  2R09 A;  2R0D A;  5EFX A;  4NY0 A;  5GOW B;  3OAN A;  2D9X A;  4TYZ A;  2W2W A;  1DRO A;  1H10 A;  1UNR A;  1BTK A;  1OY2 A;  1TXD A;  2AEH A;  1P5T A;  1MIX A;  5L81 A;  5D3Y A;  3DXE A;  2KIE A;  2LKO A;  1WVH A;  2PZ1 A;  3U7D A;  2P8V A;  2M14 A;  4MY6 A;  2Z0P A;  2DHI A;  1K5D B;  4XWX A;  4CHJ A;  3MPX A;  1GG3 A;  3V5W A;  5J3Y A;  2VSZ A;  4HAT B;  1WGQ A;  4PQ0 A;  2Y7B A;  1U2B A;  4F7G A;  1KZ7 A;  2I5F A;  1FHX A;  3UZT A;  2HE7 A;  2CY4 A;  1Q67 A;  2XQN M;  1XX0 A;  3U12 A;  4DX8 A;  1W1G A;  1FB8 A;  3IVF A;  4GNK B;  1BWN A;  2LUL A;  2J0K A;  3KRW A;  1ZVR A;  3D8D A;  3NWD A;  3ODO A;  3PZD A;  5KCV A;  2K49 A;  4HAZ B;  2K2J A;  4P7I A;  2Z14 A;  4L1R A;  3U8Z A;  1UPR A;  1OQN A;  3CIK A;  3QIJ A;  1DDV A;  2KGX B;  2IFS A;  2K8E A;  1X86 A;  1X11 A;  1X1F A;  3AU4 A;  1NTY A;  1U5G A;  2ELB A;  3FVC A;  5HE0 A;  1FHW A;  4HAY B;  4C0A A;  1ZM0 A; 
#chains in the Genus database with same CATH homology
 1W1D A;  2UVM A;  2D2Q A;  3HQC A;  1LB1 A;  2KCJ A;  2GCJ A;  3FM8 C;  4EMO A;  3AJ4 A;  5J3Q A;  2CRF A;  2D10 A;  2BCJ A;  2DHJ A;  2M38 A;  2RUK B;  2D9V A;  2CY5 A;  3GYO A;  2DFK A;  4B6H A;  2AL6 A;  3TCA A;  3VIA A;  1MPH A;  2X18 A;  2ROZ B;  1AWE A;  3TO1 A;  1N3H A;  2QKM A;  3F0W A;  4ZRK A;  3TVV A;  2DYN A;  4HAW B;  3MDB C;  2YSZ A;  2H7E A;  1WJM A;  1MK9 B;  2DX5 A;  4K17 A;  5CLQ B;  2DKP A;  2RVB B;  5KQ1 A;  1M7R A;  3ODX A;  4MT7 A;  2ELA A;  1M7E A;  1V5P A;  3ULC A;  1ISN A;  4HB4 B;  1FOE A;  1AQC A;  2DN6 A;  4HB2 B;  2K00 A;  2UZS A;  4GN1 A;  2YS5 A;  4L6E A;  1MK7 B;  2I1K A;  4PNK A;  2MFQ A;  1EAZ A;  4HB3 B;  2EJ8 A;  1QC6 A;  5C6R A;  3T06 A;  3PG7 A;  3A8P A;  4D0N B;  1NTV A;  5DHF B;  3PP2 A;  4WSF A;  2JP2 A;  2W2X C;  3BJI A;  4GMV A;  3A98 B;  4A5K A;  3PEG A;  4Z2N A;  2LYD A;  3KY9 A;  1DBH A;  3QBV B;  5JP4 A;  1FGZ A;  1ZC3 B;  4MK0 A;  1WJ1 A;  3PVW A;  1XOD A;  5KQ4 A;  1DDW A;  5J3T A;  3ZDT A;  1X1G A;  4DBB A;  2L1C A;  2COC A;  2LOX A;  2KUP A;  4A6F A;  3LJU X;  3NSU A;  2I1J A;  3O96 A;  3N7C A;  2VKI A;  3HW2 B;  2COF A;  1UPQ A;  5HE1 A;  3TW1 A;  2OTX A;  4A6H A;  1V5U A;  2Z0O A;  3KRX A;  2RNR B;  1E5W A;  1FHO A;  5DIF B;  3D8E A;  3QWM A;  4IAP A;  1UNP A;  1V89 A;  3SYX A;  4A6K A;  2YS3 A;  3WA0 A;  4ZRJ A;  1V61 A;  4GPT B;  1B55 A;  2GCL A;  4HAU B;  3KZ1 A;  5JLJ B;  5HE3 A;  2NMB A;  2K2U A;  4A6F B;  1BAK A;  4HB0 B;  5LON B;  3ODW A;  1U27 A;  2YT0 A;  2H7D A;  4IFS A;  4KHO A;  3PVL A;  1BTN A;  2ROV A;  2LG1 A;  5C5B A;  1PMS A;  3CXB B;  4TKN A;  1W1H A;  3AU5 A;  1EVH A;  2MDX A;  1LW3 A;  2MWN B;  3SV1 A;  5C79 A;  4CHM A;  2DX1 A;  4HAX B;  2VRW B;  4CYE A;  4KVG B;  4Z2M B;  2D9W A;  2N23 A;  1FAO A;  4YON A;  1MAI A;  2GJY A;  1QQG A;  4IOY X;  2NZ8 B;  1RJ2 A;  1NU2 A;  1IRS A;  2YS1 A;  2EMT A;  4EKU A;  3P7Z A;  3X23 A;  1X05 A;  2Y8F A;  3P6A A;  2RGN B;  5D3V A;  2HTH B;  3PVU A;  2J0J A;  5DI9 B;  2DLW A;  3ULB A;  5C5B B;  3BIN A;  1MIZ B;  1K5G B;  1TQZ A;  4KHB B;  4KAX B;  1OMW A;  1U29 A;  1GC6 A;  4KHA A;  2COA A;  3TFM A;  2YT1 A;  1XKE A;  4F7H A;  1SGH A;  3F5R A;  3A8Q A;  3ZVR A;  1FGY A;  3FEH A;  3G9W A;  2EMS A;  3FSS A;  4DX9 0;  1WI1 A;  3RCP A;  2P0F A;  1I7A A;  4H8S A;  1XCG A;  1WGU A;  1NI2 A;  2P0D A;  1H4R A;  4HDO A;  2ADZ A;  1RRP B;  5HE2 A;  1TJ6 A;  2YVC A;  4NSW A;  5FI0 A;  1UEF A;  2D9Y A;  1MKE A;  3ML4 A;  1V5M A;  3DXD A;  3KSY A;  3SO6 A;  4EJN A;  2RSG A;  2YF0 A;  1ZC4 B;  1P3R A;  1DDM A;  4DXA B;  4HDQ A;  2DYQ A;  3PSC A;  1KI1 B;  2DKQ A;  2E2X A;  2IYB A;  4F7U P;  4K2P A;  1ZSQ A;  2COD A;  1U5E A;  4ZRI A;  2OQB A;  2DHK A;  2W2X D;  2P0H A;  2RLO A;  1J19 A;  2EC1 A;  2ZPY A;  2V76 A;  2D9Z A;  4GMX B;  2YRY A;  4K81 A;  2CAY A;  5FI1 A;  4GZU A;  5LOP B;  2Y8G A;  1SHC A;  1UNQ A;  5CLL B;  3HK0 A;  3WYF B;  4GXB A;  4YL8 A;  2MKR A;  4HAV B;  5DH9 B;  1PLS A;  1EGX A;  1U5D A;  2UZR A;  2J59 M;  4WVF B;  2FJL A;  1Y19 B;  1P6S A;  5C16 A;  2I5C A;  1GC7 A;  4WJ7 A;  2LOZ A;  2Q13 A;  3DXC A;  2GS0 A;  5D3X A;  2J0M A;  1PFJ A;  2Z0Q A;  3SNH A;  3D8F A;  5JHH A;  2QKL A;  2D4Q A;  1J0W A;  3SUZ A;  3M1I B;  1DYN A;  1U5F A;  1KZG A;  5D27 A;  4K2O A;  1XD4 A;  4BBK A;  5DHA B;  3GYP A;  1I2H A;  5D3W A;  1WG7 A;  1Z87 A;  1V88 A;  2DTC A;  3VOQ A;  1Y5O A;  4HHV A;  1EF1 A;  2G35 A;  2D11 A;  5JHG A;  4Y94 A;  2L2I A;  2N0Y A;  1XR0 B;  2DA0 A;  2R09 A;  2R0D A;  5EFX A;  4NY0 A;  5GOW B;  3OAN A;  2D9X A;  4TYZ A;  2W2W A;  1DRO A;  1H10 A;  1UNR A;  1BTK A;  1OY2 A;  1TXD A;  2AEH A;  1P5T A;  1MIX A;  5L81 A;  5D3Y A;  3DXE A;  2LKO A;  1WVH A;  2PZ1 A;  3U7D A;  2P8V A;  2M14 A;  4MY6 A;  2Z0P A;  2DHI A;  1K5D B;  4XWX A;  4CHJ A;  3MPX A;  1GG3 A;  3V5W A;  5J3Y A;  2VSZ A;  4HAT B;  1WGQ A;  4PQ0 A;  2Y7B A;  1U2B A;  4F7G A;  1KZ7 A;  2I5F A;  1FHX A;  3UZT A;  2HE7 A;  2CY4 A;  1Q67 A;  2XQN M;  1XX0 A;  4DX8 A;  1W1G A;  1FB8 A;  3IVF A;  1BWN A;  2LUL A;  2J0K A;  3KRW A;  1ZVR A;  3D8D A;  3ODO A;  3PZD A;  5KCV A;  4HAZ B;  2K2J A;  4P7I A;  3U8Z A;  1UPR A;  1OQN A;  3CIK A;  3QIJ A;  1DDV A;  2KGX B;  2IFS A;  1X86 A;  1X11 A;  1X1F A;  3AU4 A;  1NTY A;  1U5G A;  2ELB A;  5HE0 A;  1FHW A;  4HAY B;  4C0A A;  1ZM0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...