2QKLA

The crystal structure of fission yeast mrna decapping enzyme dcp1-dcp2 complex
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
127
structure length
121
Chain Sequence
MEDENILRNAVNLQVLKFHYPEIESIIDIASHVAVYQFWLKTSIEGTFFLVKDQRARVGYVILNRNSPENLYLFINHPSNVHLVDRYLIHRTENQHVVGLWMFDPNDMSRIFNIVKESLLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords SPBC3B9.21 protein
publication title Structural basis of dcp2 recognition and activation by dcp1.
pubmed doi rcsb
source organism Schizosaccharomyces pombe
total genus 34
structure length 121
sequence length 127
ec nomenclature
pdb deposition date 2007-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06058 DCP1 Dcp1-like decapping family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2qklA00
1Q67A 4EKUA 2LOXA 2X18A 3KRXA 3DXEA 1UNPA 5HE1A 1W1GA 1OMWA 1RRPB 2AL6A 1DDWA 4GMVA 2P0FA 3LJUX 1AQCA 4CHMA 1BWNA 3PVUA 1KI1B 3PEGA 2HTHB 2LOZA 2DA0A 3D8FA 3G9WA 3TCAA 3D8EA 2YVCA 2BCJA 2GCJA 2M14A 3RCPA 3TO1A 3V5WA 1IRSA 2UZSA 2D11A 4PQ0A 3QBVB 4HB2B 2Y8GA 4K81A 3D8DA 4P7IA 1GG3A 4A6HA 1WGUA 4TYZA 1XCGA 2P0DA 1TXDA 2D9WA 3BINA 5GOWB 2J0KA 2OQBA 4K2OA 1MAIA 4B6HA 2D9XA 2ROVA 5C16A 3PP2A 2EJ8A 2PZ1A 4DX90 1V89A 2D9YA 1WGQA 1ZC3B 2COFA 2J0MA 1M7RA 4DBBA 2Y7BA 2QKLA 1XODA 3P7ZA 1NI2A 2MFQA 4EJNA 2GS0A 2W2XD 2COAA 4L6EA 3FSSA 3PVLA 1SGHA 1GC7A 1PFJA 1U5FA 2KUPA 2VSZA 3KSYA 1MIXA 2W2WA 1XX0A 2YRYA 2I5FA 1U5EA 4A6FA 2EMSA 4HB0B 1MPHA 4GXBA 4HB3B 3ODXA 5KQ4A 5L81A 3KRWA 1X1GA 3DXDA 1OQNA 1FOEA 2DYQA 3PVWA 5D3YA 5DHAB 1FGYA 1ZC4B 3ML4A 1U5GA 2IYBA 2DFKA 2DLWA 1MIZB 2YF0A 1UNRA 2DKQA 5J3TA 1E5WA 3KY9A 1FAOA 4HAZB 1U5DA 2RLOA 4WJ7A 1UNQA 3P6AA 1Y19B 2CAYA 2RGNB 3ZDTA 2CODA 2IFSA 1XKEA 2RVBB 4HAUB 1V61A 4KHBB 4YONA 2DHKA 3FM8C 3HK0A 1W1HA 1J19A 1K5DB 4HAVB 2MKRA 5C6RA 3AU5A 4KHOA 1UPQA 3TW1A 4XWXA 3A8QA 3WA0A 3M1IB 5HE0A 3U8ZA 2J0JA 4ZRJA 2CY4A 1U27A 2G35A 1M7EA 2D2QA 4MY6A 2CY5A 2J59M 5C79A 1LB1A 2LKOA 5JLJB 4K2PA 2AEHA 2N0YA 4NY0A 2GJYA 2XQNM 2LYDA 1U29A 5HE2A 4EMOA 2GCLA 3CIKA 1DROA 3GYPA 4HDQA 2UVMA 4WSFA 2FJLA 4IFSA 5JHHA 5D3VA 1FB8A 1LW3A 1Z87A 1DDVA 5JHGA 4PNKA 2D9VA 1B55A 2V76A 4DXAB 3TFMA 1MK7B 1PMSA 1X05A 1I2HA 3SV1A 2R09A 3PZDA 3UZTA 2DN6A 1FHXA 3AU4A 3ODWA 3QIJA 4F7UP 4IAPA 2Z0OA 4KHAA 3PSCA 2QKMA 3ZVRA 4HB4B 2I1JA 3PG7A 1K5GB 3AJ4A 2ZPYA 3TVVA 3ODOA 3GYOA 1N3HA 3A8PA 4A5KA 1V5PA 5DHFB 2I1KA 2P0HA 2W2XC 3KZ1A 2L1CA 4HAWB 1TQZA 3X23A 4CHJA 1NTYA 1V88A 1ZSQA 1XD4A 4GPTB 2DHIA 3HQCA 1WG7A 1EAZA 2Q13A 2R0DA 2LULA 1UEFA 1DDMA 1FHOA 3IVFA 1EF1A 1H10A 2M38A 1DBHA 1P6SA 2D4QA 3MDBC 1EGXA 4MK0A 1U2BA 4ZRIA 4H8SA 2YSZA 2RSGA 3DXCA 4NSWA 2ROZB 1I7AA 2MDXA 2DX1A 1SHCA 5D3WA 1ZM0A 3SNHA 1QC6A 2KCJA 5DH9B 4HATB 4WVFB 5D27A 5LOPB 1P5TA 1Y5OA 1H4RA 1BTNA 2I5CA 2KGXB 2YS5A 3NSUA 1QQGA 1KZ7A 5J3YA 5C5BB 2OTXA 2JP2A 2Y8FA 1BAKA 3FEHA 4F7GA 1OY2A 2P8VA 2YS1A 1XR0B 5FI1A 4Z2NA 5D3XA 2DTCA 3SYXA 2LG1A 1X1FA 1GC6A 4HAXB 4KVGB 2ADZA 1ZVRA 4CYEA 3F5RA 4MT7A 2NMBA 3VOQA 2YT0A 2DKPA 5DIFB 5CLQB 4Y94A 2K2UA 4IOYX 4HAYB 1FGZA 2NZ8B 1X86A 1MK9B 1DYNA 4A6FB 3MPXA 2HE7A 2UZRA 4KAXB 1WVHA 3VIAA 3ULCA 1W1DA 3OANA 2H7EA 4GZUA 5FI0A 3ULBA 3BJIA 1V5MA 2DHJA 4Z2MB 1AWEA 3N7CA 3SO6A 3T06A 1WJMA 2Z0QA 3HW2B 2COCA 1WJ1A 5C5BA 1J0WA 2RNRB 4D0NB 5KCVA 2DYNA 2N23A 1V5UA 4BBKA 1NTVA 4C0AA 2E2XA 2H7DA 4TKNA 2DX5A 1FHWA 4A6KA 2CRFA 1NU2A 2VKIA 1P3RA 5HE3A 2D9ZA 3WYFB 2RUKB 4F7HA 2YS3A 3U7DA 1RJ2A 4GMXB 2L2IA 3F0WA 4K17A 2YT1A 2D10A 5J3QA 5CLLB 1EVHA 2ELAA 3SUZA 4GN1A 2EC1A 2VRWB 1WI1A 2K2JA 2Z0PA 1TJ6A 1PLSA 4DX8A 3QWMA 3A98B 2K00A 1KZGA 1MKEA 5LONB 3O96A 5JP4A 2MWNB 3CXBB 2ELBA 1ISNA 4HDOA 4YL8A 1UPRA 2EMTA 5DI9B 5EFXA 5KQ1A 1X11A 1BTKA 4ZRKA 4HHVA
chains in the Genus database with same CATH superfamily
1Q67A 4EKUA 2LOXA 2X18A 3KRXA 3DXEA 1UNPA 5HE1A 1W1GA 1OMWA 1RRPB 2AL6A 2KIGA 1DDWA 4GMVA 2P0FA 3LJUX 1AQCA 4CHMA 1BWNA 3PVUA 1KI1B 3PEGA 2HTHB 2LOZA 2DA0A 3D8FA 3DCXA 3G9WA 3TCAA 3D8EA 2YVCA 2BCJA 2GCJA 2M14A 2R2YA 3RCPA 3TO1A 3V5WA 1IRSA 2UZSA 2D11A 4PQ0A 3QBVB 4HB2B 2Y8GA 4K81A 3D8DA 4P7IA 1GG3A 4A6HA 1WGUA 4TYZA 1XCGA 2P0DA 1TXDA 2D9WA 3BINA 5GOWB 2J0KA 3HSAA 2OQBA 4K2OA 1MAIA 4B6HA 2D9XA 2ROVA 5C16A 3PP2A 2EJ8A 2PZ1A 3NWFA 1V89A 2D9YA 4DX90 1WGQA 1ZC3B 2COFA 2J0MA 1M7RA 4DBBA 5I2MA 2Y7BA 2NBVA 4OT1A 2QKLA 1XODA 5M4YB 3P7ZA 1NI2A 2MFQA 4EJNA 2GS0A 2W2XD 3U12A 2KIEA 4HSIA 2COAA 4L6EA 3FSSA 3PVLA 1SGHA 1GC7A 1PFJA 1U5FA 2KUPA 2VSZA 3KSYA 1MIXA 2W2WA 1XX0A 2YRYA 2I5FA 4DIXA 1U5EA 4A6FA 2EMSA 4HB0B 1MPHA 4GXBA 4HB3B 3ODXA 5KQ4A 5L81A 3KRWA 1X1GA 3DXDA 1OQNA 1FOEA 2DYQA 3PVWA 5D3YA 2RRFA 5DHAB 1FGYA 1ZC4B 3ML4A 1U5GA 2IYBA 2DFKA 2DLWA 5IRSA 1MIZB 2YF0A 1UNRA 2DKQA 5J3TA 1E5WA 3KY9A 1FAOA 4HAZB 1U5DA 2RLOA 2Z13A 1UNQA 4WJ7A 3P6AA 1Y19B 2CAYA 2RGNB 3ZDTA 2CODA 2IFSA 1XKEA 2RVBB 4HAUB 1V61A 4KHBB 4YONA 2DHKA 3FM8C 3HK0A 1W1HA 1J19A 1K5DB 4HAVB 2MKRA 5C6RA 3AU5A 4KHOA 1UPQA 3TW1A 4XWXA 3A8QA 4GNKB 3WA0A 3M1IB 5HE0A 3U8ZA 2J0JA 2Z4DA 4ZRJA 2CY4A 1U27A 2G35A 1M7EA 2D2QA 4MY6A 2CY5A 3NW8A 2J59M 5C79A 1MI1A 1LB1A 2LKOA 5JLJB 2GUMA 4K2PA 2AEHA 2N0YA 4NY0A 2GJYA 2XQNM 2LYDA 1U29A 5HE2A 4EMOA 4QJ4B 2GCLA 3B77A 3CIKA 1DROA 3GYPA 4HDQA 2UVMA 4WSFA 2FJLA 4IFSA 5JHHA 5D3VA 1T77A 1FB8A 1LW3A 4CSQA 1Z87A 1DDVA 5JHGA 4PNKA 2D9VA 1B55A 2V76A 4DXAB 3TFMA 5LG4B 1MK7B 1PMSA 1X05A 1I2HA 3SV1A 2R09A 3PZDA 3UZTA 2DN6A 1FHXA 3AU4A 3ODWA 3QIJA 4F7UP 3NWAA 4IAPA 2Z0OA 4KHAA 3PSCA 2QKMA 3ZVRA 4HB4B 2I1JA 3PG7A 1K5GB 3AJ4A 2ZPYA 4GOUA 3TVVA 3ODOA 3GYOA 1N3HA 3A8PA 4A5KA 1V5PA 2Z14A 5DHFB 2I1KA 2P0HA 2W2XC 3KZ1A 2K49A 2L1CA 4HAWB 1TQZA 3X23A 4CHJA 1NTYA 1V88A 1ZSQA 1XD4A 4GPTB 2DHIA 3HQCA 1WG7A 1EAZA 2Q13A 1ZYIA 2LULA 2R0DA 1UEFA 1DDMA 1FHOA 3IVFA 1EF1A 1H10A 2M38A 3NWDA 1DBHA 1P6SA 2D4QA 3MDBC 1EGXA 4MK0A 1U2BA 4ZRIA 4H8SA 2YSZA 2RSGA 3DXCA 4NSWA 2ROZB 1I7AA 2MDXA 2DX1A 1SHCA 4OSNA 5D3WA 1ZM0A 3SNHA 1QC6A 2KCJA 5DH9B 4HATB 4WVFB 5D27A 4QJ5B 5LOPB 4L1RA 1P5TA 1Y5OA 1H4RA 1BTNA 2I5CA 2KGXB 2YS5A 2Z59A 1QQGA 1KZ7A 3NSUA 4QJ3B 5J3YA 2OTXA 2JP2A 5C5BB 2Y8FA 1BAKA 2K8EA 3FEHA 4F7GA 1OY2A 2P8VA 2YS1A 1XR0B 5FI1A 4Z2NA 5D3XA 2DTCA 3SYXA 2LG1A 1X1FA 1GC6A 4HAXB 4KVGB 2ADZA 2KR0A 1ZVRA 4CYEA 3F5RA 4MT7A 2NMBA 3VOQA 2YT0A 2DKPA 5DIFB 5CLQB 4D6WA 4Y94A 2K2UA 4IOYX 4HAYB 1FGZA 2NZ8B 1X86A 1MK9B 1DYNA 4A6FB 3MPXA 2HE7A 2UZRA 4KAXB 1WVHA 3VIAA 3ULCA 1W1DA 3OANA 2H7EA 4GZUA 5FI0A 3ULBA 3BJIA 1V5MA 2DHJA 4Z2MB 1AWEA 2FJUB 3N7CA 3SO6A 3T06A 1WJMA 4KHBA 2Z0QA 3HW2B 2COCA 2YT2A 1WJ1A 3HIEA 5C5BA 1J0WA 2RNRB 4D0NB 5KCVA 2DYNA 2N23A 1V5UA 4BBKA 3FVCA 1NTVA 4C0AA 2E2XA 2H7DA 4TKNA 2DX5A 4QXAB 1FHWA 4A6KA 2CRFA 1NU2A 2VKIA 1P3RA 5HE3A 2D9ZA 3WYFB 2RUKB 4F7HA 2YS3A 3U7DA 2KUQA 1RJ2A 4GMXB 2L2IA 3F0WA 4K17A 2YT1A 2D10A 5J3QA 5CLLB 1EVHA 2ELAA 3SUZA 4GN1A 2EC1A 2VRWB 1WI1A 2K2JA 2Z0PA 1TJ6A 1PLSA 4DX8A 3QWMA 3A98B 3OHMB 2K00A 1KZGA 1MKEA 5LONB 3O96A 5JP4A 2MWNB 3CXBB 2ELBA 2ZKMX 1ISNA 4HDOA 4YL8A 1UPRA 3A58A 2EMTA 5DI9B 5EFXA 5KQ1A 1X11A 1BTKA 5I2SA 4ZRKA 4HHVA
chains in the Genus database with same CATH topology
1Q67A 4EKUA 2LOXA 2X18A 3KRXA 3DXEA 1UNPA 5HE1A 1W1GA 1OMWA 1RRPB 2AL6A 1DDWA 4GMVA 2P0FA 3LJUX 1AQCA 4CHMA 1BWNA 3PVUA 1KI1B 3PEGA 2HTHB 2LOZA 2DA0A 3D8FA 3G9WA 3TCAA 3D8EA 2YVCA 2BCJA 2GCJA 2M14A 3RCPA 3TO1A 3V5WA 1IRSA 2UZSA 2D11A 4PQ0A 3QBVB 4HB2B 2Y8GA 4K81A 3D8DA 4P7IA 1GG3A 4A6HA 1WGUA 4TYZA 1XCGA 2P0DA 1TXDA 2D9WA 3BINA 5GOWB 2J0KA 2OQBA 4K2OA 1MAIA 4B6HA 2D9XA 2ROVA 5C16A 3PP2A 2EJ8A 2PZ1A 4DX90 1V89A 2D9YA 1WGQA 1ZC3B 2COFA 2J0MA 1M7RA 4DBBA 2Y7BA 2QKLA 1XODA 3P7ZA 1NI2A 2MFQA 4EJNA 2GS0A 2W2XD 2COAA 4L6EA 3FSSA 3PVLA 1SGHA 1GC7A 1PFJA 1U5FA 2KUPA 2VSZA 3KSYA 1MIXA 2W2WA 1XX0A 2YRYA 2I5FA 1U5EA 4A6FA 2EMSA 4HB0B 1MPHA 4GXBA 4HB3B 3ODXA 5KQ4A 5L81A 3KRWA 1X1GA 3DXDA 1OQNA 1FOEA 2DYQA 3PVWA 5D3YA 5DHAB 1FGYA 1ZC4B 3ML4A 1U5GA 2IYBA 2DFKA 2DLWA 1MIZB 2YF0A 1UNRA 2DKQA 5J3TA 1E5WA 3KY9A 1FAOA 4HAZB 1U5DA 2RLOA 4WJ7A 1UNQA 3P6AA 1Y19B 2CAYA 2RGNB 3ZDTA 2CODA 2IFSA 1XKEA 2RVBB 4HAUB 1V61A 4KHBB 4YONA 2DHKA 3FM8C 3HK0A 1W1HA 1J19A 1K5DB 4HAVB 2MKRA 5C6RA 3AU5A 4KHOA 1UPQA 3TW1A 4XWXA 3A8QA 3WA0A 3M1IB 5HE0A 3U8ZA 2J0JA 4ZRJA 2CY4A 1U27A 2G35A 1M7EA 2D2QA 4MY6A 2CY5A 2J59M 5C79A 1LB1A 2LKOA 5JLJB 4K2PA 2AEHA 2N0YA 4NY0A 2GJYA 2XQNM 2LYDA 1U29A 5HE2A 4EMOA 2GCLA 3CIKA 1DROA 3GYPA 4HDQA 2UVMA 4WSFA 2FJLA 4IFSA 5JHHA 5D3VA 1FB8A 1LW3A 1Z87A 1DDVA 5JHGA 4PNKA 2D9VA 1B55A 2V76A 4DXAB 3TFMA 1MK7B 1PMSA 1X05A 1I2HA 3SV1A 2R09A 3PZDA 3UZTA 2DN6A 1FHXA 3AU4A 3ODWA 3QIJA 4F7UP 4IAPA 2Z0OA 4KHAA 3PSCA 2QKMA 3ZVRA 4HB4B 2I1JA 3PG7A 1K5GB 3AJ4A 2ZPYA 3TVVA 3ODOA 3GYOA 1N3HA 3A8PA 4A5KA 1V5PA 5DHFB 2I1KA 2P0HA 2W2XC 3KZ1A 2L1CA 4HAWB 1TQZA 3X23A 4CHJA 1NTYA 1V88A 1ZSQA 1XD4A 4GPTB 2DHIA 3HQCA 1WG7A 1EAZA 2Q13A 2R0DA 2LULA 1UEFA 1DDMA 1FHOA 3IVFA 1EF1A 1H10A 2M38A 1DBHA 1P6SA 2D4QA 3MDBC 1EGXA 4MK0A 1U2BA 4ZRIA 4H8SA 2YSZA 2RSGA 3DXCA 4NSWA 2ROZB 1I7AA 2MDXA 2DX1A 1SHCA 5D3WA 1ZM0A 3SNHA 1QC6A 2KCJA 5DH9B 4HATB 4WVFB 5D27A 5LOPB 1P5TA 1Y5OA 1H4RA 1BTNA 2I5CA 2KGXB 2YS5A 3NSUA 1QQGA 1KZ7A 5J3YA 5C5BB 2OTXA 2JP2A 2Y8FA 1BAKA 3FEHA 4F7GA 1OY2A 2P8VA 2YS1A 1XR0B 5FI1A 4Z2NA 5D3XA 2DTCA 3SYXA 2LG1A 1X1FA 1GC6A 4HAXB 4KVGB 2ADZA 1ZVRA 4CYEA 3F5RA 4MT7A 2NMBA 3VOQA 2YT0A 2DKPA 5DIFB 5CLQB 4Y94A 2K2UA 4IOYX 4HAYB 1FGZA 2NZ8B 1X86A 1MK9B 1DYNA 4A6FB 3MPXA 2HE7A 2UZRA 4KAXB 1WVHA 3VIAA 3ULCA 1W1DA 3OANA 2H7EA 4GZUA 5FI0A 3ULBA 3BJIA 1V5MA 2DHJA 4Z2MB 1AWEA 3N7CA 3SO6A 3T06A 1WJMA 2Z0QA 3HW2B 2COCA 1WJ1A 5C5BA 1J0WA 2RNRB 4D0NB 5KCVA 2DYNA 2N23A 1V5UA 4BBKA 1NTVA 4C0AA 2E2XA 2H7DA 4TKNA 2DX5A 1FHWA 4A6KA 2CRFA 1NU2A 2VKIA 1P3RA 5HE3A 2D9ZA 3WYFB 2RUKB 4F7HA 2YS3A 3U7DA 1RJ2A 4GMXB 2L2IA 3F0WA 4K17A 2YT1A 2D10A 5J3QA 5CLLB 1EVHA 2ELAA 3SUZA 4GN1A 2EC1A 2VRWB 1WI1A 2K2JA 2Z0PA 1TJ6A 1PLSA 4DX8A 3QWMA 3A98B 2K00A 1KZGA 1MKEA 5LONB 3O96A 5JP4A 2MWNB 3CXBB 2ELBA 1ISNA 4HDOA 4YL8A 1UPRA 2EMTA 5DI9B 5EFXA 5KQ1A 1X11A 1BTKA 4ZRKA 4HHVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Q67 A;  4EKU A;  2LOX A;  2X18 A;  3KRX A;  3DXE A;  1UNP A;  5HE1 A;  1W1G A;  1OMW A;  1RRP B;  2AL6 A;  1DDW A;  4GMV A;  2P0F A;  3LJU X;  1AQC A;  4CHM A;  1BWN A;  3PVU A;  1KI1 B;  3PEG A;  2HTH B;  2LOZ A;  2DA0 A;  3D8F A;  3G9W A;  3TCA A;  3D8E A;  2YVC A;  2BCJ A;  2GCJ A;  2M14 A;  3RCP A;  3TO1 A;  3V5W A;  1IRS A;  2UZS A;  2D11 A;  4PQ0 A;  3QBV B;  4HB2 B;  2Y8G A;  4K81 A;  3D8D A;  4P7I A;  1GG3 A;  4A6H A;  1WGU A;  4TYZ A;  1XCG A;  2P0D A;  1TXD A;  2D9W A;  3BIN A;  5GOW B;  2J0K A;  2OQB A;  4K2O A;  1MAI A;  4B6H A;  2D9X A;  2ROV A;  5C16 A;  3PP2 A;  2EJ8 A;  2PZ1 A;  4DX9 0;  1V89 A;  2D9Y A;  1WGQ A;  1ZC3 B;  2COF A;  2J0M A;  1M7R A;  4DBB A;  2Y7B A;  2QKL A;  1XOD A;  3P7Z A;  1NI2 A;  2MFQ A;  4EJN A;  2GS0 A;  2W2X D;  2COA A;  4L6E A;  3FSS A;  3PVL A;  1SGH A;  1GC7 A;  1PFJ A;  1U5F A;  2KUP A;  2VSZ A;  3KSY A;  1MIX A;  2W2W A;  1XX0 A;  2YRY A;  2I5F A;  1U5E A;  4A6F A;  2EMS A;  4HB0 B;  1MPH A;  4GXB A;  4HB3 B;  3ODX A;  5KQ4 A;  5L81 A;  3KRW A;  1X1G A;  3DXD A;  1OQN A;  1FOE A;  2DYQ A;  3PVW A;  5D3Y A;  5DHA B;  1FGY A;  1ZC4 B;  3ML4 A;  1U5G A;  2IYB A;  2DFK A;  2DLW A;  1MIZ B;  2YF0 A;  1UNR A;  2DKQ A;  5J3T A;  1E5W A;  3KY9 A;  1FAO A;  4HAZ B;  1U5D A;  2RLO A;  4WJ7 A;  1UNQ A;  3P6A A;  1Y19 B;  2CAY A;  2RGN B;  3ZDT A;  2COD A;  2IFS A;  1XKE A;  2RVB B;  4HAU B;  1V61 A;  4KHB B;  4YON A;  2DHK A;  3FM8 C;  3HK0 A;  1W1H A;  1J19 A;  1K5D B;  4HAV B;  2MKR A;  5C6R A;  3AU5 A;  4KHO A;  1UPQ A;  3TW1 A;  4XWX A;  3A8Q A;  3WA0 A;  3M1I B;  5HE0 A;  3U8Z A;  2J0J A;  4ZRJ A;  2CY4 A;  1U27 A;  2G35 A;  1M7E A;  2D2Q A;  4MY6 A;  2CY5 A;  2J59 M;  5C79 A;  1LB1 A;  2LKO A;  5JLJ B;  4K2P A;  2AEH A;  2N0Y A;  4NY0 A;  2GJY A;  2XQN M;  2LYD A;  1U29 A;  5HE2 A;  4EMO A;  2GCL A;  3CIK A;  1DRO A;  3GYP A;  4HDQ A;  2UVM A;  4WSF A;  2FJL A;  4IFS A;  5JHH A;  5D3V A;  1FB8 A;  1LW3 A;  1Z87 A;  1DDV A;  5JHG A;  4PNK A;  2D9V A;  1B55 A;  2V76 A;  4DXA B;  3TFM A;  1MK7 B;  1PMS A;  1X05 A;  1I2H A;  3SV1 A;  2R09 A;  3PZD A;  3UZT A;  2DN6 A;  1FHX A;  3AU4 A;  3ODW A;  3QIJ A;  4F7U P;  4IAP A;  2Z0O A;  4KHA A;  3PSC A;  2QKM A;  3ZVR A;  4HB4 B;  2I1J A;  3PG7 A;  1K5G B;  3AJ4 A;  2ZPY A;  3TVV A;  3ODO A;  3GYO A;  1N3H A;  3A8P A;  4A5K A;  1V5P A;  5DHF B;  2I1K A;  2P0H A;  2W2X C;  3KZ1 A;  2L1C A;  4HAW B;  1TQZ A;  3X23 A;  4CHJ A;  1NTY A;  1V88 A;  1ZSQ A;  1XD4 A;  4GPT B;  2DHI A;  3HQC A;  1WG7 A;  1EAZ A;  2Q13 A;  2R0D A;  2LUL A;  1UEF A;  1DDM A;  1FHO A;  3IVF A;  1EF1 A;  1H10 A;  2M38 A;  1DBH A;  1P6S A;  2D4Q A;  3MDB C;  1EGX A;  4MK0 A;  1U2B A;  4ZRI A;  4H8S A;  2YSZ A;  2RSG A;  3DXC A;  4NSW A;  2ROZ B;  1I7A A;  2MDX A;  2DX1 A;  1SHC A;  5D3W A;  1ZM0 A;  3SNH A;  1QC6 A;  2KCJ A;  5DH9 B;  4HAT B;  4WVF B;  5D27 A;  5LOP B;  1P5T A;  1Y5O A;  1H4R A;  1BTN A;  2I5C A;  2KGX B;  2YS5 A;  3NSU A;  1QQG A;  1KZ7 A;  5J3Y A;  5C5B B;  2OTX A;  2JP2 A;  2Y8F A;  1BAK A;  3FEH A;  4F7G A;  1OY2 A;  2P8V A;  2YS1 A;  1XR0 B;  5FI1 A;  4Z2N A;  5D3X A;  2DTC A;  3SYX A;  2LG1 A;  1X1F A;  1GC6 A;  4HAX B;  4KVG B;  2ADZ A;  1ZVR A;  4CYE A;  3F5R A;  4MT7 A;  2NMB A;  3VOQ A;  2YT0 A;  2DKP A;  5DIF B;  5CLQ B;  4Y94 A;  2K2U A;  4IOY X;  4HAY B;  1FGZ A;  2NZ8 B;  1X86 A;  1MK9 B;  1DYN A;  4A6F B;  3MPX A;  2HE7 A;  2UZR A;  4KAX B;  1WVH A;  3VIA A;  3ULC A;  1W1D A;  3OAN A;  2H7E A;  4GZU A;  5FI0 A;  3ULB A;  3BJI A;  1V5M A;  2DHJ A;  4Z2M B;  1AWE A;  3N7C A;  3SO6 A;  3T06 A;  1WJM A;  2Z0Q A;  3HW2 B;  2COC A;  1WJ1 A;  5C5B A;  1J0W A;  2RNR B;  4D0N B;  5KCV A;  2DYN A;  2N23 A;  1V5U A;  4BBK A;  1NTV A;  4C0A A;  2E2X A;  2H7D A;  4TKN A;  2DX5 A;  1FHW A;  4A6K A;  2CRF A;  1NU2 A;  2VKI A;  1P3R A;  5HE3 A;  2D9Z A;  3WYF B;  2RUK B;  4F7H A;  2YS3 A;  3U7D A;  1RJ2 A;  4GMX B;  2L2I A;  3F0W A;  4K17 A;  2YT1 A;  2D10 A;  5J3Q A;  5CLL B;  1EVH A;  2ELA A;  3SUZ A;  4GN1 A;  2EC1 A;  2VRW B;  1WI1 A;  2K2J A;  2Z0P A;  1TJ6 A;  1PLS A;  4DX8 A;  3QWM A;  3A98 B;  2K00 A;  1KZG A;  1MKE A;  5LON B;  3O96 A;  5JP4 A;  2MWN B;  3CXB B;  2ELB A;  1ISN A;  4HDO A;  4YL8 A;  1UPR A;  2EMT A;  5DI9 B;  5EFX A;  5KQ1 A;  1X11 A;  1BTK A;  4ZRK A;  4HHV A; 
#chains in the Genus database with same CATH topology
 1Q67 A;  4EKU A;  2LOX A;  2X18 A;  3KRX A;  3DXE A;  1UNP A;  5HE1 A;  1W1G A;  1OMW A;  1RRP B;  2AL6 A;  2KIG A;  1DDW A;  4GMV A;  2P0F A;  3LJU X;  1AQC A;  4CHM A;  1BWN A;  3PVU A;  1KI1 B;  3PEG A;  2HTH B;  2LOZ A;  2DA0 A;  3D8F A;  3DCX A;  3G9W A;  3TCA A;  3D8E A;  2YVC A;  2BCJ A;  2GCJ A;  2M14 A;  2R2Y A;  3RCP A;  3TO1 A;  3V5W A;  1IRS A;  2UZS A;  2D11 A;  4PQ0 A;  3QBV B;  4HB2 B;  2Y8G A;  4K81 A;  3D8D A;  4P7I A;  1GG3 A;  4A6H A;  1WGU A;  4TYZ A;  1XCG A;  2P0D A;  1TXD A;  2D9W A;  3BIN A;  5GOW B;  2J0K A;  3HSA A;  2OQB A;  4K2O A;  1MAI A;  4B6H A;  2D9X A;  2ROV A;  5C16 A;  3PP2 A;  2EJ8 A;  2PZ1 A;  3NWF A;  1V89 A;  2D9Y A;  4DX9 0;  1WGQ A;  1ZC3 B;  2COF A;  2J0M A;  1M7R A;  4DBB A;  5I2M A;  2Y7B A;  2NBV A;  4OT1 A;  2QKL A;  1XOD A;  5M4Y B;  3P7Z A;  1NI2 A;  2MFQ A;  4EJN A;  2GS0 A;  2W2X D;  3U12 A;  2KIE A;  4HSI A;  2COA A;  4L6E A;  3FSS A;  3PVL A;  1SGH A;  1GC7 A;  1PFJ A;  1U5F A;  2KUP A;  2VSZ A;  3KSY A;  1MIX A;  2W2W A;  1XX0 A;  2YRY A;  2I5F A;  4DIX A;  1U5E A;  4A6F A;  2EMS A;  4HB0 B;  1MPH A;  4GXB A;  4HB3 B;  3ODX A;  5KQ4 A;  5L81 A;  3KRW A;  1X1G A;  3DXD A;  1OQN A;  1FOE A;  2DYQ A;  3PVW A;  5D3Y A;  2RRF A;  5DHA B;  1FGY A;  1ZC4 B;  3ML4 A;  1U5G A;  2IYB A;  2DFK A;  2DLW A;  5IRS A;  1MIZ B;  2YF0 A;  1UNR A;  2DKQ A;  5J3T A;  1E5W A;  3KY9 A;  1FAO A;  4HAZ B;  1U5D A;  2RLO A;  2Z13 A;  1UNQ A;  4WJ7 A;  3P6A A;  1Y19 B;  2CAY A;  2RGN B;  3ZDT A;  2COD A;  2IFS A;  1XKE A;  2RVB B;  4HAU B;  1V61 A;  4KHB B;  4YON A;  2DHK A;  3FM8 C;  3HK0 A;  1W1H A;  1J19 A;  1K5D B;  4HAV B;  2MKR A;  5C6R A;  3AU5 A;  4KHO A;  1UPQ A;  3TW1 A;  4XWX A;  3A8Q A;  4GNK B;  3WA0 A;  3M1I B;  5HE0 A;  3U8Z A;  2J0J A;  2Z4D A;  4ZRJ A;  2CY4 A;  1U27 A;  2G35 A;  1M7E A;  2D2Q A;  4MY6 A;  2CY5 A;  3NW8 A;  2J59 M;  5C79 A;  1MI1 A;  1LB1 A;  2LKO A;  5JLJ B;  2GUM A;  4K2P A;  2AEH A;  2N0Y A;  4NY0 A;  2GJY A;  2XQN M;  2LYD A;  1U29 A;  5HE2 A;  4EMO A;  4QJ4 B;  2GCL A;  3B77 A;  3CIK A;  1DRO A;  3GYP A;  4HDQ A;  2UVM A;  4WSF A;  2FJL A;  4IFS A;  5JHH A;  5D3V A;  1T77 A;  1FB8 A;  1LW3 A;  4CSQ A;  1Z87 A;  1DDV A;  5JHG A;  4PNK A;  2D9V A;  1B55 A;  2V76 A;  4DXA B;  3TFM A;  5LG4 B;  1MK7 B;  1PMS A;  1X05 A;  1I2H A;  3SV1 A;  2R09 A;  3PZD A;  3UZT A;  2DN6 A;  1FHX A;  3AU4 A;  3ODW A;  3QIJ A;  4F7U P;  3NWA A;  4IAP A;  2Z0O A;  4KHA A;  3PSC A;  2QKM A;  3ZVR A;  4HB4 B;  2I1J A;  3PG7 A;  1K5G B;  3AJ4 A;  2ZPY A;  4GOU A;  3TVV A;  3ODO A;  3GYO A;  1N3H A;  3A8P A;  4A5K A;  1V5P A;  2Z14 A;  5DHF B;  2I1K A;  2P0H A;  2W2X C;  3KZ1 A;  2K49 A;  2L1C A;  4HAW B;  1TQZ A;  3X23 A;  4CHJ A;  1NTY A;  1V88 A;  1ZSQ A;  1XD4 A;  4GPT B;  2DHI A;  3HQC A;  1WG7 A;  1EAZ A;  2Q13 A;  1ZYI A;  2LUL A;  2R0D A;  1UEF A;  1DDM A;  1FHO A;  3IVF A;  1EF1 A;  1H10 A;  2M38 A;  3NWD A;  1DBH A;  1P6S A;  2D4Q A;  3MDB C;  1EGX A;  4MK0 A;  1U2B A;  4ZRI A;  4H8S A;  2YSZ A;  2RSG A;  3DXC A;  4NSW A;  2ROZ B;  1I7A A;  2MDX A;  2DX1 A;  1SHC A;  4OSN A;  5D3W A;  1ZM0 A;  3SNH A;  1QC6 A;  2KCJ A;  5DH9 B;  4HAT B;  4WVF B;  5D27 A;  4QJ5 B;  5LOP B;  4L1R A;  1P5T A;  1Y5O A;  1H4R A;  1BTN A;  2I5C A;  2KGX B;  2YS5 A;  2Z59 A;  1QQG A;  1KZ7 A;  3NSU A;  4QJ3 B;  5J3Y A;  2OTX A;  2JP2 A;  5C5B B;  2Y8F A;  1BAK A;  2K8E A;  3FEH A;  4F7G A;  1OY2 A;  2P8V A;  2YS1 A;  1XR0 B;  5FI1 A;  4Z2N A;  5D3X A;  2DTC A;  3SYX A;  2LG1 A;  1X1F A;  1GC6 A;  4HAX B;  4KVG B;  2ADZ A;  2KR0 A;  1ZVR A;  4CYE A;  3F5R A;  4MT7 A;  2NMB A;  3VOQ A;  2YT0 A;  2DKP A;  5DIF B;  5CLQ B;  4D6W A;  4Y94 A;  2K2U A;  4IOY X;  4HAY B;  1FGZ A;  2NZ8 B;  1X86 A;  1MK9 B;  1DYN A;  4A6F B;  3MPX A;  2HE7 A;  2UZR A;  4KAX B;  1WVH A;  3VIA A;  3ULC A;  1W1D A;  3OAN A;  2H7E A;  4GZU A;  5FI0 A;  3ULB A;  3BJI A;  1V5M A;  2DHJ A;  4Z2M B;  1AWE A;  2FJU B;  3N7C A;  3SO6 A;  3T06 A;  1WJM A;  4KHB A;  2Z0Q A;  3HW2 B;  2COC A;  2YT2 A;  1WJ1 A;  3HIE A;  5C5B A;  1J0W A;  2RNR B;  4D0N B;  5KCV A;  2DYN A;  2N23 A;  1V5U A;  4BBK A;  3FVC A;  1NTV A;  4C0A A;  2E2X A;  2H7D A;  4TKN A;  2DX5 A;  4QXA B;  1FHW A;  4A6K A;  2CRF A;  1NU2 A;  2VKI A;  1P3R A;  5HE3 A;  2D9Z A;  3WYF B;  2RUK B;  4F7H A;  2YS3 A;  3U7D A;  2KUQ A;  1RJ2 A;  4GMX B;  2L2I A;  3F0W A;  4K17 A;  2YT1 A;  2D10 A;  5J3Q A;  5CLL B;  1EVH A;  2ELA A;  3SUZ A;  4GN1 A;  2EC1 A;  2VRW B;  1WI1 A;  2K2J A;  2Z0P A;  1TJ6 A;  1PLS A;  4DX8 A;  3QWM A;  3A98 B;  3OHM B;  2K00 A;  1KZG A;  1MKE A;  5LON B;  3O96 A;  5JP4 A;  2MWN B;  3CXB B;  2ELB A;  2ZKM X;  1ISN A;  4HDO A;  4YL8 A;  1UPR A;  3A58 A;  2EMT A;  5DI9 B;  5EFX A;  5KQ1 A;  1X11 A;  1BTK A;  5I2S A;  4ZRK A;  4HHV A; 
#chains in the Genus database with same CATH homology
 1Q67 A;  4EKU A;  2LOX A;  2X18 A;  3KRX A;  3DXE A;  1UNP A;  5HE1 A;  1W1G A;  1OMW A;  1RRP B;  2AL6 A;  1DDW A;  4GMV A;  2P0F A;  3LJU X;  1AQC A;  4CHM A;  1BWN A;  3PVU A;  1KI1 B;  3PEG A;  2HTH B;  2LOZ A;  2DA0 A;  3D8F A;  3G9W A;  3TCA A;  3D8E A;  2YVC A;  2BCJ A;  2GCJ A;  2M14 A;  3RCP A;  3TO1 A;  3V5W A;  1IRS A;  2UZS A;  2D11 A;  4PQ0 A;  3QBV B;  4HB2 B;  2Y8G A;  4K81 A;  3D8D A;  4P7I A;  1GG3 A;  4A6H A;  1WGU A;  4TYZ A;  1XCG A;  2P0D A;  1TXD A;  2D9W A;  3BIN A;  5GOW B;  2J0K A;  2OQB A;  4K2O A;  1MAI A;  4B6H A;  2D9X A;  2ROV A;  5C16 A;  3PP2 A;  2EJ8 A;  2PZ1 A;  4DX9 0;  1V89 A;  2D9Y A;  1WGQ A;  1ZC3 B;  2COF A;  2J0M A;  1M7R A;  4DBB A;  2Y7B A;  2QKL A;  1XOD A;  3P7Z A;  1NI2 A;  2MFQ A;  4EJN A;  2GS0 A;  2W2X D;  2COA A;  4L6E A;  3FSS A;  3PVL A;  1SGH A;  1GC7 A;  1PFJ A;  1U5F A;  2KUP A;  2VSZ A;  3KSY A;  1MIX A;  2W2W A;  1XX0 A;  2YRY A;  2I5F A;  1U5E A;  4A6F A;  2EMS A;  4HB0 B;  1MPH A;  4GXB A;  4HB3 B;  3ODX A;  5KQ4 A;  5L81 A;  3KRW A;  1X1G A;  3DXD A;  1OQN A;  1FOE A;  2DYQ A;  3PVW A;  5D3Y A;  5DHA B;  1FGY A;  1ZC4 B;  3ML4 A;  1U5G A;  2IYB A;  2DFK A;  2DLW A;  1MIZ B;  2YF0 A;  1UNR A;  2DKQ A;  5J3T A;  1E5W A;  3KY9 A;  1FAO A;  4HAZ B;  1U5D A;  2RLO A;  4WJ7 A;  1UNQ A;  3P6A A;  1Y19 B;  2CAY A;  2RGN B;  3ZDT A;  2COD A;  2IFS A;  1XKE A;  2RVB B;  4HAU B;  1V61 A;  4KHB B;  4YON A;  2DHK A;  3FM8 C;  3HK0 A;  1W1H A;  1J19 A;  1K5D B;  4HAV B;  2MKR A;  5C6R A;  3AU5 A;  4KHO A;  1UPQ A;  3TW1 A;  4XWX A;  3A8Q A;  3WA0 A;  3M1I B;  5HE0 A;  3U8Z A;  2J0J A;  4ZRJ A;  2CY4 A;  1U27 A;  2G35 A;  1M7E A;  2D2Q A;  4MY6 A;  2CY5 A;  2J59 M;  5C79 A;  1LB1 A;  2LKO A;  5JLJ B;  4K2P A;  2AEH A;  2N0Y A;  4NY0 A;  2GJY A;  2XQN M;  2LYD A;  1U29 A;  5HE2 A;  4EMO A;  2GCL A;  3CIK A;  1DRO A;  3GYP A;  4HDQ A;  2UVM A;  4WSF A;  2FJL A;  4IFS A;  5JHH A;  5D3V A;  1FB8 A;  1LW3 A;  1Z87 A;  1DDV A;  5JHG A;  4PNK A;  2D9V A;  1B55 A;  2V76 A;  4DXA B;  3TFM A;  1MK7 B;  1PMS A;  1X05 A;  1I2H A;  3SV1 A;  2R09 A;  3PZD A;  3UZT A;  2DN6 A;  1FHX A;  3AU4 A;  3ODW A;  3QIJ A;  4F7U P;  4IAP A;  2Z0O A;  4KHA A;  3PSC A;  2QKM A;  3ZVR A;  4HB4 B;  2I1J A;  3PG7 A;  1K5G B;  3AJ4 A;  2ZPY A;  3TVV A;  3ODO A;  3GYO A;  1N3H A;  3A8P A;  4A5K A;  1V5P A;  5DHF B;  2I1K A;  2P0H A;  2W2X C;  3KZ1 A;  2L1C A;  4HAW B;  1TQZ A;  3X23 A;  4CHJ A;  1NTY A;  1V88 A;  1ZSQ A;  1XD4 A;  4GPT B;  2DHI A;  3HQC A;  1WG7 A;  1EAZ A;  2Q13 A;  2R0D A;  2LUL A;  1UEF A;  1DDM A;  1FHO A;  3IVF A;  1EF1 A;  1H10 A;  2M38 A;  1DBH A;  1P6S A;  2D4Q A;  3MDB C;  1EGX A;  4MK0 A;  1U2B A;  4ZRI A;  4H8S A;  2YSZ A;  2RSG A;  3DXC A;  4NSW A;  2ROZ B;  1I7A A;  2MDX A;  2DX1 A;  1SHC A;  5D3W A;  1ZM0 A;  3SNH A;  1QC6 A;  2KCJ A;  5DH9 B;  4HAT B;  4WVF B;  5D27 A;  5LOP B;  1P5T A;  1Y5O A;  1H4R A;  1BTN A;  2I5C A;  2KGX B;  2YS5 A;  3NSU A;  1QQG A;  1KZ7 A;  5J3Y A;  5C5B B;  2OTX A;  2JP2 A;  2Y8F A;  1BAK A;  3FEH A;  4F7G A;  1OY2 A;  2P8V A;  2YS1 A;  1XR0 B;  5FI1 A;  4Z2N A;  5D3X A;  2DTC A;  3SYX A;  2LG1 A;  1X1F A;  1GC6 A;  4HAX B;  4KVG B;  2ADZ A;  1ZVR A;  4CYE A;  3F5R A;  4MT7 A;  2NMB A;  3VOQ A;  2YT0 A;  2DKP A;  5DIF B;  5CLQ B;  4Y94 A;  2K2U A;  4IOY X;  4HAY B;  1FGZ A;  2NZ8 B;  1X86 A;  1MK9 B;  1DYN A;  4A6F B;  3MPX A;  2HE7 A;  2UZR A;  4KAX B;  1WVH A;  3VIA A;  3ULC A;  1W1D A;  3OAN A;  2H7E A;  4GZU A;  5FI0 A;  3ULB A;  3BJI A;  1V5M A;  2DHJ A;  4Z2M B;  1AWE A;  3N7C A;  3SO6 A;  3T06 A;  1WJM A;  2Z0Q A;  3HW2 B;  2COC A;  1WJ1 A;  5C5B A;  1J0W A;  2RNR B;  4D0N B;  5KCV A;  2DYN A;  2N23 A;  1V5U A;  4BBK A;  1NTV A;  4C0A A;  2E2X A;  2H7D A;  4TKN A;  2DX5 A;  1FHW A;  4A6K A;  2CRF A;  1NU2 A;  2VKI A;  1P3R A;  5HE3 A;  2D9Z A;  3WYF B;  2RUK B;  4F7H A;  2YS3 A;  3U7D A;  1RJ2 A;  4GMX B;  2L2I A;  3F0W A;  4K17 A;  2YT1 A;  2D10 A;  5J3Q A;  5CLL B;  1EVH A;  2ELA A;  3SUZ A;  4GN1 A;  2EC1 A;  2VRW B;  1WI1 A;  2K2J A;  2Z0P A;  1TJ6 A;  1PLS A;  4DX8 A;  3QWM A;  3A98 B;  2K00 A;  1KZG A;  1MKE A;  5LON B;  3O96 A;  5JP4 A;  2MWN B;  3CXB B;  2ELB A;  1ISN A;  4HDO A;  4YL8 A;  1UPR A;  2EMT A;  5DI9 B;  5EFX A;  5KQ1 A;  1X11 A;  1BTK A;  4ZRK A;  4HHV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...