2QKLA

The crystal structure of fission yeast mrna decapping enzyme dcp1-dcp2 complex
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
127
structure length
121
Chain Sequence
MEDENILRNAVNLQVLKFHYPEIESIIDIASHVAVYQFWLKTSIEGTFFLVKDQRARVGYVILNRNSPENLYLFINHPSNVHLVDRYLIHRTENQHVVGLWMFDPNDMSRIFNIVKESLLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of dcp2 recognition and activation by dcp1.
pubmed doi rcsb
source organism Schizosaccharomyces pombe
molecule tags Hydrolase
molecule keywords SPBC3B9.21 protein
total genus 34
structure length 121
sequence length 127
ec nomenclature
pdb deposition date 2007-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06058 DCP1 Dcp1-like decapping family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2qklA00
1FOEA 1BTNA 1QQGA 1DDMA 3KRWA 1N3HA 2GJYA 2Q13A 4IFSA 4YL8A 1DDWA 1Y19B 3WYFB 3FSSA 2J0KA 1NI2A 1W1GA 2VSZA 2EMTA 2NMBA 4HB3B 2CY5A 1K5DB 2DFKA 4HAVB 1UNQA 3GYPA 4GZUA 3ZVRA 3OANA 2E2XA 2MDXA 1Y5OA 5LONB 3T06A 4HAWB 2JP2A 4EKUA 4K17A 1IRSA 2Y8FA 1MK7B 2MFQA 2DHIA 4K81A 2P0DA 4HAYB 3AU5A 4F7GA 1XR0B 4C0AA 2DHJA 1ZSQA 2RUKB 3KY9A 4MK0A 4A6FB 3NSUA 2W2XD 3O96A 2MWNB 5C5BB 3PVUA 4HDOA 1BAKA 1PMSA 2XQNM 5D3XA 1WGUA 3PVLA 1MK9B 1V5UA 2Y7BA 3SO6A 3PEGA 4YONA 2ROVA 2CY4A 1P6SA 2LG1A 2BCJA 1J19A 3ODXA 1FB8A 2UVMA 1LW3A 1U2BA 4A6HA 2DHKA 1QC6A 1XX0A 5KQ4A 4NSWA 1WVHA 1X1FA 4HAUB 5HE1A 1I7AA 3G9WA 1U5EA 2ELBA 2DX1A 2M38A 1AWEA 1XODA 4HATB 1ISNA 1EAZA 2D9ZA 3DXDA 2RGNB 4WJ7A 5D3YA 4EJNA 1BWNA 4KHOA 2X18A 4BBKA 5DHAB 1DROA 4NY0A 4WVFB 2PZ1A 1TJ6A 3N7CA 4P7IA 1XKEA 2DYQA 4MT7A 3M1IB 1UPRA 1ZM0A 2IYBA 2N23A 5CLLB 2DKQA 2RVBB 3MDBC 4GMVA 5DIFB 2M14A 5HE0A 1NU2A 1MPHA 2AL6A 3ULBA 2YF0A 4Z2MB 3TFMA 4CHMA 2DYNA 4A6KA 4A6FA 1EGXA 1DBHA 3D8DA 5C5BA 2CODA 2LOXA 2LOZA 2KCJA 2OQBA 1DYNA 1P3RA 3ULCA 2H7DA 2NZ8B 2RLOA 1UPQA 5JP4A 4D0NB 1EF1A 2V76A 5DH9B 3LJUX 5D27A 4PQ0A 4CHJA 5C79A 4MY6A 2HTHB 3GYOA 3AU4A 2DTCA 2COCA 3PSCA 3U7DA 2VKIA 2YVCA 5KQ1A 2GS0A 1P5TA 5J3YA 2DKPA 1GC6A 2GCLA 3HQCA 2J0MA 2DLWA 1XCGA 4DX8A 2P0FA 3PZDA 1ZC3B 1FHXA 4KHAA 2Z0PA 5KCVA 1K5GB 4HB4B 3A98B 1V5MA 2ADZA 2J59M 3VIAA 3UZTA 2LYDA 3SV1A 1OQNA 1WG7A 1WJ1A 2D11A 2ZPYA 1WGQA 2HE7A 1Q67A 4XWXA 4F7UP 3SNHA 4WSFA 2KUPA 5JHGA 1X05A 3SYXA 2I1KA 4ZRKA 2LKOA 3ODOA 4DXAB 3BINA 3TW1A 2YS3A 1ZC4B 2DN6A 4HAZB 2OTXA 2D9XA 1FGYA 2N0YA 5C6RA 3F5RA 4IOYX 4HB2B 1FAOA 1Z87A 2FJLA 2P0HA 5JLJB 4F7HA 5HE3A 5L81A 3PVWA 1MKEA 1RRPB 2YS5A 2YT0A 1PFJA 1M7EA 3KRXA 1KI1B 2K00A 4KHBB 1AQCA 2I5CA 1W1DA 1U5GA 3ZDTA 1FHOA 2EC1A 1V88A 3ODWA 1V89A 1H10A 5DI9B 1MIXA 2VRWB 3V5WA 2L2IA 1PLSA 3A8PA 5HE2A 3QBVB 2KGXB 2I1JA 1X11A 5LOPB 5CLQB 1FGZA 1NTVA 2YS1A 1DDVA 3F0WA 4HDQA 4L6EA 2R09A 1KZ7A 3BJIA 2D10A 3D8EA 2H7EA 3SUZA 2QKMA 2EMSA 2Z0OA 5FI1A 1M7RA 2D4QA 4K2OA 2P8VA 2W2WA 2GCJA 3U8ZA 1U29A 1RJ2A 5GOWB 2LULA 3A8QA 1GC7A 2D2QA 2UZRA 3QIJA 2Z0QA 3D8FA 1MIZB 5FI0A 4KVGB 1GG3A 1UNPA 5D3VA 4HHVA 4ZRJA 4DBBA 2AEHA 3CXBB 3TCAA 1U5DA 3AJ4A 1U27A 2D9YA 4IAPA 5J3TA 4ZRIA 1UEFA 1I2HA 2CRFA 1V61A 4Y94A 2R0DA 4EMOA 4HAXB 1TXDA 1H4RA 1EVHA 2QKLA 3RCPA 1XD4A 3DXEA 1SGHA 3IVFA 4TYZA 3HK0A 4HB0B 3HW2B 2COFA 5C16A 1OY2A 4A5KA 2K2JA 4Z2NA 3P7ZA 5JHHA 4DX90 1ZVRA 3MPXA 1UNRA 2K2UA 1W1HA 5EFXA 1E5WA 3P6AA 3FEHA 5D3WA 3ML4A 2DX5A 2UZSA 2D9WA 4TKNA 4CYEA 3FM8C 2YT1A 1NTYA 1V5PA 2I5FA 3WA0A 2W2XC 1X1GA 2MKRA 2EJ8A 4PNKA 2CAYA 2DA0A 1U5FA 3TVVA 3CIKA 1WI1A 2IFSA 1BTKA 1X86A 4B6HA 1J0WA 1B55A 1SHCA 1WJMA 2G35A 1TQZA 1LB1A 3QWMA 2RNRB 2ROZB 1KZGA 2D9VA 2ELAA 2L1CA 4K2PA 2COAA 5DHFB 3KSYA 1MAIA 3PP2A 3DXCA 3TO1A 4GN1A 4GMXB 3VOQA 1FHWA 5J3QA 2YRYA 3PG7A 3KZ1A 4H8SA 2Y8GA 2YSZA 4GPTB 2RSGA 2J0JA 3X23A 1OMWA 4KAXB 4GXBA
chains in the Genus database with same CATH superfamily
5I2SA 1FOEA 1BTNA 1QQGA 1DDMA 3DCXA 3KRWA 1N3HA 2GJYA 2Q13A 4IFSA 4YL8A 1DDWA 1Y19B 3WYFB 3FSSA 2J0KA 1NI2A 2KUQA 1W1GA 2VSZA 2EMTA 2NMBA 4HB3B 2CY5A 1K5DB 2DFKA 4HAVB 1UNQA 3GYPA 4GZUA 3ZVRA 3OANA 2E2XA 2MDXA 1Y5OA 5LONB 3T06A 4HAWB 2JP2A 4EKUA 4K17A 1IRSA 2Y8FA 1MK7B 2MFQA 2DHIA 4K81A 2YT2A 2P0DA 3NWFA 4HAYB 3AU5A 4F7GA 1XR0B 4C0AA 2DHJA 1ZSQA 2RUKB 3KY9A 4MK0A 4A6FB 3NSUA 2W2XD 3O96A 2MWNB 5C5BB 4OT1A 3PVUA 4HDOA 1BAKA 3NW8A 1PMSA 2XQNM 5D3XA 1WGUA 3PVLA 1MK9B 1V5UA 2Y7BA 3SO6A 3PEGA 4YONA 2ROVA 4L1RA 2CY4A 1P6SA 2LG1A 2BCJA 1J19A 3ODXA 1FB8A 3B77A 2UVMA 1LW3A 1U2BA 4A6HA 2DHKA 1QC6A 1XX0A 5KQ4A 4NSWA 1WVHA 1X1FA 4HAUB 5HE1A 1I7AA 4QJ4B 3G9WA 1U5EA 2ELBA 1ZYIA 2DX1A 2M38A 1AWEA 1XODA 4HATB 1ISNA 1EAZA 2D9ZA 3DXDA 2RGNB 4WJ7A 5D3YA 2Z14A 4EJNA 1BWNA 4KHOA 2X18A 4BBKA 5DHAB 4D6WA 4NY0A 4WVFB 1DROA 2PZ1A 1TJ6A 3N7CA 4P7IA 1XKEA 2DYQA 4MT7A 3M1IB 1UPRA 1ZM0A 3HSAA 2IYBA 2N23A 2R2YA 5CLLB 2DKQA 2RVBB 3MDBC 4GMVA 5DIFB 2M14A 5HE0A 1NU2A 1MPHA 2AL6A 3ULBA 2YF0A 4Z2MB 3TFMA 4CHMA 2DYNA 4A6KA 4A6FA 1EGXA 1DBHA 3D8DA 5C5BA 2CODA 2LOXA 2LOZA 2KCJA 2OQBA 4QJ5B 1DYNA 1P3RA 4OSNA 3ULCA 2H7DA 3U12A 2NZ8B 2RLOA 1UPQA 5JP4A 4D0NB 1EF1A 2V76A 5DH9B 3LJUX 5D27A 4PQ0A 4CHJA 5C79A 4MY6A 2HTHB 3GYOA 3AU4A 2DTCA 2COCA 3PSCA 3U7DA 2VKIA 2YVCA 5KQ1A 2GS0A 1P5TA 5J3YA 2DKPA 1GC6A 2GCLA 3HQCA 2J0MA 2DLWA 1XCGA 2Z4DA 4DX8A 2P0FA 3PZDA 1ZC3B 2Z59A 1FHXA 4KHAA 2Z0PA 5KCVA 1K5GB 4HB4B 3A98B 1V5MA 2ADZA 4CSQA 2J59M 3VIAA 3OHMB 3UZTA 2LYDA 3SV1A 1OQNA 1WG7A 1WJ1A 2D11A 2ZPYA 1WGQA 2HE7A 1Q67A 4XWXA 4F7UP 2KIGA 3SNHA 4WSFA 2KUPA 5JHGA 1X05A 3SYXA 2I1KA 4ZRKA 2LKOA 4GOUA 3ODOA 4DXAB 3BINA 3TW1A 2YS3A 1ZC4B 2DN6A 4HSIA 4HAZB 2OTXA 2D9XA 1FGYA 2N0YA 5C6RA 3F5RA 4IOYX 4HB2B 1FAOA 1Z87A 2FJLA 2P0HA 5JLJB 2RRFA 4F7HA 5HE3A 5L81A 3PVWA 1MKEA 1RRPB 2YS5A 2YT0A 1PFJA 1M7EA 3KRXA 1KI1B 2K00A 5I2MA 4KHBB 1AQCA 2I5CA 1W1DA 2NBVA 2FJUB 1U5GA 1MI1A 3ZDTA 1FHOA 2EC1A 5LG4B 1V88A 3ODWA 1V89A 1H10A 5DI9B 1MIXA 2VRWB 3V5WA 2L2IA 1PLSA 3A8PA 5HE2A 3QBVB 2KGXB 2I1JA 1X11A 5LOPB 5CLQB 3FVCA 1FGZA 1NTVA 2YS1A 1DDVA 3F0WA 4HDQA 4L6EA 2R09A 1KZ7A 3BJIA 2D10A 3D8EA 2H7EA 3SUZA 2QKMA 2EMSA 2Z0OA 5FI1A 4KHBA 1M7RA 2D4QA 4K2OA 2P8VA 2W2WA 2GCJA 3U8ZA 1U29A 1RJ2A 5GOWB 2LULA 3A8QA 1GC7A 2D2QA 3HIEA 4QJ3B 2UZRA 3QIJA 2Z0QA 3D8FA 4DIXA 1MIZB 2KIEA 5FI0A 4KVGB 1GG3A 1UNPA 5D3VA 4HHVA 4ZRJA 4DBBA 2AEHA 3CXBB 3TCAA 1U5DA 3AJ4A 1U27A 2D9YA 3NWDA 4IAPA 4QXAB 5J3TA 4ZRIA 1UEFA 1I2HA 2CRFA 1V61A 4Y94A 2R0DA 4EMOA 4HAXB 3NWAA 1TXDA 1H4RA 1EVHA 2QKLA 3RCPA 1XD4A 3A58A 3DXEA 1SGHA 3IVFA 4TYZA 3HK0A 4HB0B 3HW2B 2COFA 5C16A 1OY2A 4A5KA 2K2JA 4Z2NA 3P7ZA 5JHHA 5IRSA 4DX90 1ZVRA 3MPXA 1UNRA 2K2UA 1W1HA 5EFXA 2ZKMX 1E5WA 3P6AA 2K49A 2KR0A 3FEHA 3ML4A 5D3WA 2DX5A 2UZSA 2D9WA 4TKNA 4CYEA 3FM8C 2Z13A 2YT1A 1NTYA 1V5PA 2I5FA 3WA0A 2W2XC 1X1GA 2MKRA 2EJ8A 4PNKA 2CAYA 2DA0A 1U5FA 3TVVA 3CIKA 1WI1A 2IFSA 1BTKA 1X86A 4B6HA 1J0WA 1B55A 1SHCA 1WJMA 2G35A 2GUMA 1TQZA 4GNKB 1LB1A 3QWMA 2RNRB 2ROZB 1KZGA 2D9VA 2ELAA 2L1CA 5M4YB 4K2PA 2COAA 5DHFB 3KSYA 1MAIA 3PP2A 1T77A 3DXCA 3TO1A 4GN1A 4GMXB 3VOQA 1FHWA 5J3QA 2YRYA 3PG7A 2K8EA 3KZ1A 4H8SA 2Y8GA 2YSZA 4GPTB 2RSGA 2J0JA 3X23A 1OMWA 4KAXB 4GXBA
chains in the Genus database with same CATH topology
1FOEA 1BTNA 1QQGA 1DDMA 3KRWA 1N3HA 2GJYA 2Q13A 4IFSA 4YL8A 1DDWA 1Y19B 3WYFB 3FSSA 2J0KA 1NI2A 1W1GA 2VSZA 2EMTA 2NMBA 4HB3B 2CY5A 1K5DB 2DFKA 4HAVB 1UNQA 3GYPA 4GZUA 3ZVRA 3OANA 2E2XA 2MDXA 1Y5OA 5LONB 3T06A 4HAWB 2JP2A 4EKUA 4K17A 1IRSA 2Y8FA 1MK7B 2MFQA 2DHIA 4K81A 2P0DA 4HAYB 3AU5A 4F7GA 1XR0B 4C0AA 2DHJA 1ZSQA 2RUKB 3KY9A 4MK0A 4A6FB 3NSUA 2W2XD 3O96A 2MWNB 5C5BB 3PVUA 4HDOA 1BAKA 1PMSA 2XQNM 5D3XA 1WGUA 3PVLA 1MK9B 1V5UA 2Y7BA 3SO6A 3PEGA 4YONA 2ROVA 2CY4A 1P6SA 2LG1A 2BCJA 1J19A 3ODXA 1FB8A 2UVMA 1LW3A 1U2BA 4A6HA 2DHKA 1QC6A 1XX0A 5KQ4A 4NSWA 1WVHA 1X1FA 4HAUB 5HE1A 1I7AA 3G9WA 1U5EA 2ELBA 2DX1A 2M38A 1AWEA 1XODA 4HATB 1ISNA 1EAZA 2D9ZA 3DXDA 2RGNB 4WJ7A 5D3YA 4EJNA 1BWNA 4KHOA 2X18A 4BBKA 5DHAB 1DROA 4NY0A 4WVFB 2PZ1A 1TJ6A 3N7CA 4P7IA 1XKEA 2DYQA 4MT7A 3M1IB 1UPRA 1ZM0A 2IYBA 2N23A 5CLLB 2DKQA 2RVBB 3MDBC 4GMVA 5DIFB 2M14A 5HE0A 1NU2A 1MPHA 2AL6A 3ULBA 2YF0A 4Z2MB 3TFMA 4CHMA 2DYNA 4A6KA 4A6FA 1EGXA 1DBHA 3D8DA 5C5BA 2CODA 2LOXA 2LOZA 2KCJA 2OQBA 1DYNA 1P3RA 3ULCA 2H7DA 2NZ8B 2RLOA 1UPQA 5JP4A 4D0NB 1EF1A 2V76A 5DH9B 3LJUX 5D27A 4PQ0A 4CHJA 5C79A 4MY6A 2HTHB 3GYOA 3AU4A 2DTCA 2COCA 3PSCA 3U7DA 2VKIA 2YVCA 5KQ1A 2GS0A 1P5TA 5J3YA 2DKPA 1GC6A 2GCLA 3HQCA 2J0MA 2DLWA 1XCGA 4DX8A 2P0FA 3PZDA 1ZC3B 1FHXA 4KHAA 2Z0PA 5KCVA 1K5GB 4HB4B 3A98B 1V5MA 2ADZA 2J59M 3VIAA 3UZTA 2LYDA 3SV1A 1OQNA 1WG7A 1WJ1A 2D11A 2ZPYA 1WGQA 2HE7A 1Q67A 4XWXA 4F7UP 3SNHA 4WSFA 2KUPA 5JHGA 1X05A 3SYXA 2I1KA 4ZRKA 2LKOA 3ODOA 4DXAB 3BINA 3TW1A 2YS3A 1ZC4B 2DN6A 4HAZB 2OTXA 2D9XA 1FGYA 2N0YA 5C6RA 3F5RA 4IOYX 4HB2B 1FAOA 1Z87A 2FJLA 2P0HA 5JLJB 4F7HA 5HE3A 5L81A 3PVWA 1MKEA 1RRPB 2YS5A 2YT0A 1PFJA 1M7EA 3KRXA 1KI1B 2K00A 4KHBB 1AQCA 2I5CA 1W1DA 1U5GA 3ZDTA 1FHOA 2EC1A 1V88A 3ODWA 1V89A 1H10A 5DI9B 1MIXA 2VRWB 3V5WA 2L2IA 1PLSA 3A8PA 5HE2A 3QBVB 2KGXB 2I1JA 1X11A 5LOPB 5CLQB 1FGZA 1NTVA 2YS1A 1DDVA 3F0WA 4HDQA 4L6EA 2R09A 1KZ7A 3BJIA 2D10A 3D8EA 2H7EA 3SUZA 2QKMA 2EMSA 2Z0OA 5FI1A 1M7RA 2D4QA 4K2OA 2P8VA 2W2WA 2GCJA 3U8ZA 1U29A 1RJ2A 5GOWB 2LULA 3A8QA 1GC7A 2D2QA 2UZRA 3QIJA 2Z0QA 3D8FA 1MIZB 5FI0A 4KVGB 1GG3A 1UNPA 5D3VA 4HHVA 4ZRJA 4DBBA 2AEHA 3CXBB 3TCAA 1U5DA 3AJ4A 1U27A 2D9YA 4IAPA 5J3TA 4ZRIA 1UEFA 1I2HA 2CRFA 1V61A 4Y94A 2R0DA 4EMOA 4HAXB 1TXDA 1H4RA 1EVHA 2QKLA 3RCPA 1XD4A 3DXEA 1SGHA 3IVFA 4TYZA 3HK0A 4HB0B 3HW2B 2COFA 5C16A 1OY2A 4A5KA 2K2JA 4Z2NA 3P7ZA 5JHHA 4DX90 1ZVRA 3MPXA 1UNRA 2K2UA 1W1HA 5EFXA 1E5WA 3P6AA 3FEHA 5D3WA 3ML4A 2DX5A 2UZSA 2D9WA 4TKNA 4CYEA 3FM8C 2YT1A 1NTYA 1V5PA 2I5FA 3WA0A 2W2XC 1X1GA 2MKRA 2EJ8A 4PNKA 2CAYA 2DA0A 1U5FA 3TVVA 3CIKA 1WI1A 2IFSA 1BTKA 1X86A 4B6HA 1J0WA 1B55A 1SHCA 1WJMA 2G35A 1TQZA 1LB1A 3QWMA 2RNRB 2ROZB 1KZGA 2D9VA 2ELAA 2L1CA 4K2PA 2COAA 5DHFB 3KSYA 1MAIA 3PP2A 3DXCA 3TO1A 4GN1A 4GMXB 3VOQA 1FHWA 5J3QA 2YRYA 3PG7A 3KZ1A 4H8SA 2Y8GA 2YSZA 4GPTB 2RSGA 2J0JA 3X23A 1OMWA 4KAXB 4GXBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FOE A;  1BTN A;  1QQG A;  1DDM A;  3KRW A;  1N3H A;  2GJY A;  2Q13 A;  4IFS A;  4YL8 A;  1DDW A;  1Y19 B;  3WYF B;  3FSS A;  2J0K A;  1NI2 A;  1W1G A;  2VSZ A;  2EMT A;  2NMB A;  4HB3 B;  2CY5 A;  1K5D B;  2DFK A;  4HAV B;  1UNQ A;  3GYP A;  4GZU A;  3ZVR A;  3OAN A;  2E2X A;  2MDX A;  1Y5O A;  5LON B;  3T06 A;  4HAW B;  2JP2 A;  4EKU A;  4K17 A;  1IRS A;  2Y8F A;  1MK7 B;  2MFQ A;  2DHI A;  4K81 A;  2P0D A;  4HAY B;  3AU5 A;  4F7G A;  1XR0 B;  4C0A A;  2DHJ A;  1ZSQ A;  2RUK B;  3KY9 A;  4MK0 A;  4A6F B;  3NSU A;  2W2X D;  3O96 A;  2MWN B;  5C5B B;  3PVU A;  4HDO A;  1BAK A;  1PMS A;  2XQN M;  5D3X A;  1WGU A;  3PVL A;  1MK9 B;  1V5U A;  2Y7B A;  3SO6 A;  3PEG A;  4YON A;  2ROV A;  2CY4 A;  1P6S A;  2LG1 A;  2BCJ A;  1J19 A;  3ODX A;  1FB8 A;  2UVM A;  1LW3 A;  1U2B A;  4A6H A;  2DHK A;  1QC6 A;  1XX0 A;  5KQ4 A;  4NSW A;  1WVH A;  1X1F A;  4HAU B;  5HE1 A;  1I7A A;  3G9W A;  1U5E A;  2ELB A;  2DX1 A;  2M38 A;  1AWE A;  1XOD A;  4HAT B;  1ISN A;  1EAZ A;  2D9Z A;  3DXD A;  2RGN B;  4WJ7 A;  5D3Y A;  4EJN A;  1BWN A;  4KHO A;  2X18 A;  4BBK A;  5DHA B;  1DRO A;  4NY0 A;  4WVF B;  2PZ1 A;  1TJ6 A;  3N7C A;  4P7I A;  1XKE A;  2DYQ A;  4MT7 A;  3M1I B;  1UPR A;  1ZM0 A;  2IYB A;  2N23 A;  5CLL B;  2DKQ A;  2RVB B;  3MDB C;  4GMV A;  5DIF B;  2M14 A;  5HE0 A;  1NU2 A;  1MPH A;  2AL6 A;  3ULB A;  2YF0 A;  4Z2M B;  3TFM A;  4CHM A;  2DYN A;  4A6K A;  4A6F A;  1EGX A;  1DBH A;  3D8D A;  5C5B A;  2COD A;  2LOX A;  2LOZ A;  2KCJ A;  2OQB A;  1DYN A;  1P3R A;  3ULC A;  2H7D A;  2NZ8 B;  2RLO A;  1UPQ A;  5JP4 A;  4D0N B;  1EF1 A;  2V76 A;  5DH9 B;  3LJU X;  5D27 A;  4PQ0 A;  4CHJ A;  5C79 A;  4MY6 A;  2HTH B;  3GYO A;  3AU4 A;  2DTC A;  2COC A;  3PSC A;  3U7D A;  2VKI A;  2YVC A;  5KQ1 A;  2GS0 A;  1P5T A;  5J3Y A;  2DKP A;  1GC6 A;  2GCL A;  3HQC A;  2J0M A;  2DLW A;  1XCG A;  4DX8 A;  2P0F A;  3PZD A;  1ZC3 B;  1FHX A;  4KHA A;  2Z0P A;  5KCV A;  1K5G B;  4HB4 B;  3A98 B;  1V5M A;  2ADZ A;  2J59 M;  3VIA A;  3UZT A;  2LYD A;  3SV1 A;  1OQN A;  1WG7 A;  1WJ1 A;  2D11 A;  2ZPY A;  1WGQ A;  2HE7 A;  1Q67 A;  4XWX A;  4F7U P;  3SNH A;  4WSF A;  2KUP A;  5JHG A;  1X05 A;  3SYX A;  2I1K A;  4ZRK A;  2LKO A;  3ODO A;  4DXA B;  3BIN A;  3TW1 A;  2YS3 A;  1ZC4 B;  2DN6 A;  4HAZ B;  2OTX A;  2D9X A;  1FGY A;  2N0Y A;  5C6R A;  3F5R A;  4IOY X;  4HB2 B;  1FAO A;  1Z87 A;  2FJL A;  2P0H A;  5JLJ B;  4F7H A;  5HE3 A;  5L81 A;  3PVW A;  1MKE A;  1RRP B;  2YS5 A;  2YT0 A;  1PFJ A;  1M7E A;  3KRX A;  1KI1 B;  2K00 A;  4KHB B;  1AQC A;  2I5C A;  1W1D A;  1U5G A;  3ZDT A;  1FHO A;  2EC1 A;  1V88 A;  3ODW A;  1V89 A;  1H10 A;  5DI9 B;  1MIX A;  2VRW B;  3V5W A;  2L2I A;  1PLS A;  3A8P A;  5HE2 A;  3QBV B;  2KGX B;  2I1J A;  1X11 A;  5LOP B;  5CLQ B;  1FGZ A;  1NTV A;  2YS1 A;  1DDV A;  3F0W A;  4HDQ A;  4L6E A;  2R09 A;  1KZ7 A;  3BJI A;  2D10 A;  3D8E A;  2H7E A;  3SUZ A;  2QKM A;  2EMS A;  2Z0O A;  5FI1 A;  1M7R A;  2D4Q A;  4K2O A;  2P8V A;  2W2W A;  2GCJ A;  3U8Z A;  1U29 A;  1RJ2 A;  5GOW B;  2LUL A;  3A8Q A;  1GC7 A;  2D2Q A;  2UZR A;  3QIJ A;  2Z0Q A;  3D8F A;  1MIZ B;  5FI0 A;  4KVG B;  1GG3 A;  1UNP A;  5D3V A;  4HHV A;  4ZRJ A;  4DBB A;  2AEH A;  3CXB B;  3TCA A;  1U5D A;  3AJ4 A;  1U27 A;  2D9Y A;  4IAP A;  5J3T A;  4ZRI A;  1UEF A;  1I2H A;  2CRF A;  1V61 A;  4Y94 A;  2R0D A;  4EMO A;  4HAX B;  1TXD A;  1H4R A;  1EVH A;  2QKL A;  3RCP A;  1XD4 A;  3DXE A;  1SGH A;  3IVF A;  4TYZ A;  3HK0 A;  4HB0 B;  3HW2 B;  2COF A;  5C16 A;  1OY2 A;  4A5K A;  2K2J A;  4Z2N A;  3P7Z A;  5JHH A;  4DX9 0;  1ZVR A;  3MPX A;  1UNR A;  2K2U A;  1W1H A;  5EFX A;  1E5W A;  3P6A A;  3FEH A;  5D3W A;  3ML4 A;  2DX5 A;  2UZS A;  2D9W A;  4TKN A;  4CYE A;  3FM8 C;  2YT1 A;  1NTY A;  1V5P A;  2I5F A;  3WA0 A;  2W2X C;  1X1G A;  2MKR A;  2EJ8 A;  4PNK A;  2CAY A;  2DA0 A;  1U5F A;  3TVV A;  3CIK A;  1WI1 A;  2IFS A;  1BTK A;  1X86 A;  4B6H A;  1J0W A;  1B55 A;  1SHC A;  1WJM A;  2G35 A;  1TQZ A;  1LB1 A;  3QWM A;  2RNR B;  2ROZ B;  1KZG A;  2D9V A;  2ELA A;  2L1C A;  4K2P A;  2COA A;  5DHF B;  3KSY A;  1MAI A;  3PP2 A;  3DXC A;  3TO1 A;  4GN1 A;  4GMX B;  3VOQ A;  1FHW A;  5J3Q A;  2YRY A;  3PG7 A;  3KZ1 A;  4H8S A;  2Y8G A;  2YSZ A;  4GPT B;  2RSG A;  2J0J A;  3X23 A;  1OMW A;  4KAX B;  4GXB A; 
#chains in the Genus database with same CATH topology
 5I2S A;  1FOE A;  1BTN A;  1QQG A;  1DDM A;  3DCX A;  3KRW A;  1N3H A;  2GJY A;  2Q13 A;  4IFS A;  4YL8 A;  1DDW A;  1Y19 B;  3WYF B;  3FSS A;  2J0K A;  1NI2 A;  2KUQ A;  1W1G A;  2VSZ A;  2EMT A;  2NMB A;  4HB3 B;  2CY5 A;  1K5D B;  2DFK A;  4HAV B;  1UNQ A;  3GYP A;  4GZU A;  3ZVR A;  3OAN A;  2E2X A;  2MDX A;  1Y5O A;  5LON B;  3T06 A;  4HAW B;  2JP2 A;  4EKU A;  4K17 A;  1IRS A;  2Y8F A;  1MK7 B;  2MFQ A;  2DHI A;  4K81 A;  2YT2 A;  2P0D A;  3NWF A;  4HAY B;  3AU5 A;  4F7G A;  1XR0 B;  4C0A A;  2DHJ A;  1ZSQ A;  2RUK B;  3KY9 A;  4MK0 A;  4A6F B;  3NSU A;  2W2X D;  3O96 A;  2MWN B;  5C5B B;  4OT1 A;  3PVU A;  4HDO A;  1BAK A;  3NW8 A;  1PMS A;  2XQN M;  5D3X A;  1WGU A;  3PVL A;  1MK9 B;  1V5U A;  2Y7B A;  3SO6 A;  3PEG A;  4YON A;  2ROV A;  4L1R A;  2CY4 A;  1P6S A;  2LG1 A;  2BCJ A;  1J19 A;  3ODX A;  1FB8 A;  3B77 A;  2UVM A;  1LW3 A;  1U2B A;  4A6H A;  2DHK A;  1QC6 A;  1XX0 A;  5KQ4 A;  4NSW A;  1WVH A;  1X1F A;  4HAU B;  5HE1 A;  1I7A A;  4QJ4 B;  3G9W A;  1U5E A;  2ELB A;  1ZYI A;  2DX1 A;  2M38 A;  1AWE A;  1XOD A;  4HAT B;  1ISN A;  1EAZ A;  2D9Z A;  3DXD A;  2RGN B;  4WJ7 A;  5D3Y A;  2Z14 A;  4EJN A;  1BWN A;  4KHO A;  2X18 A;  4BBK A;  5DHA B;  4D6W A;  4NY0 A;  4WVF B;  1DRO A;  2PZ1 A;  1TJ6 A;  3N7C A;  4P7I A;  1XKE A;  2DYQ A;  4MT7 A;  3M1I B;  1UPR A;  1ZM0 A;  3HSA A;  2IYB A;  2N23 A;  2R2Y A;  5CLL B;  2DKQ A;  2RVB B;  3MDB C;  4GMV A;  5DIF B;  2M14 A;  5HE0 A;  1NU2 A;  1MPH A;  2AL6 A;  3ULB A;  2YF0 A;  4Z2M B;  3TFM A;  4CHM A;  2DYN A;  4A6K A;  4A6F A;  1EGX A;  1DBH A;  3D8D A;  5C5B A;  2COD A;  2LOX A;  2LOZ A;  2KCJ A;  2OQB A;  4QJ5 B;  1DYN A;  1P3R A;  4OSN A;  3ULC A;  2H7D A;  3U12 A;  2NZ8 B;  2RLO A;  1UPQ A;  5JP4 A;  4D0N B;  1EF1 A;  2V76 A;  5DH9 B;  3LJU X;  5D27 A;  4PQ0 A;  4CHJ A;  5C79 A;  4MY6 A;  2HTH B;  3GYO A;  3AU4 A;  2DTC A;  2COC A;  3PSC A;  3U7D A;  2VKI A;  2YVC A;  5KQ1 A;  2GS0 A;  1P5T A;  5J3Y A;  2DKP A;  1GC6 A;  2GCL A;  3HQC A;  2J0M A;  2DLW A;  1XCG A;  2Z4D A;  4DX8 A;  2P0F A;  3PZD A;  1ZC3 B;  2Z59 A;  1FHX A;  4KHA A;  2Z0P A;  5KCV A;  1K5G B;  4HB4 B;  3A98 B;  1V5M A;  2ADZ A;  4CSQ A;  2J59 M;  3VIA A;  3OHM B;  3UZT A;  2LYD A;  3SV1 A;  1OQN A;  1WG7 A;  1WJ1 A;  2D11 A;  2ZPY A;  1WGQ A;  2HE7 A;  1Q67 A;  4XWX A;  4F7U P;  2KIG A;  3SNH A;  4WSF A;  2KUP A;  5JHG A;  1X05 A;  3SYX A;  2I1K A;  4ZRK A;  2LKO A;  4GOU A;  3ODO A;  4DXA B;  3BIN A;  3TW1 A;  2YS3 A;  1ZC4 B;  2DN6 A;  4HSI A;  4HAZ B;  2OTX A;  2D9X A;  1FGY A;  2N0Y A;  5C6R A;  3F5R A;  4IOY X;  4HB2 B;  1FAO A;  1Z87 A;  2FJL A;  2P0H A;  5JLJ B;  2RRF A;  4F7H A;  5HE3 A;  5L81 A;  3PVW A;  1MKE A;  1RRP B;  2YS5 A;  2YT0 A;  1PFJ A;  1M7E A;  3KRX A;  1KI1 B;  2K00 A;  5I2M A;  4KHB B;  1AQC A;  2I5C A;  1W1D A;  2NBV A;  2FJU B;  1U5G A;  1MI1 A;  3ZDT A;  1FHO A;  2EC1 A;  5LG4 B;  1V88 A;  3ODW A;  1V89 A;  1H10 A;  5DI9 B;  1MIX A;  2VRW B;  3V5W A;  2L2I A;  1PLS A;  3A8P A;  5HE2 A;  3QBV B;  2KGX B;  2I1J A;  1X11 A;  5LOP B;  5CLQ B;  3FVC A;  1FGZ A;  1NTV A;  2YS1 A;  1DDV A;  3F0W A;  4HDQ A;  4L6E A;  2R09 A;  1KZ7 A;  3BJI A;  2D10 A;  3D8E A;  2H7E A;  3SUZ A;  2QKM A;  2EMS A;  2Z0O A;  5FI1 A;  4KHB A;  1M7R A;  2D4Q A;  4K2O A;  2P8V A;  2W2W A;  2GCJ A;  3U8Z A;  1U29 A;  1RJ2 A;  5GOW B;  2LUL A;  3A8Q A;  1GC7 A;  2D2Q A;  3HIE A;  4QJ3 B;  2UZR A;  3QIJ A;  2Z0Q A;  3D8F A;  4DIX A;  1MIZ B;  2KIE A;  5FI0 A;  4KVG B;  1GG3 A;  1UNP A;  5D3V A;  4HHV A;  4ZRJ A;  4DBB A;  2AEH A;  3CXB B;  3TCA A;  1U5D A;  3AJ4 A;  1U27 A;  2D9Y A;  3NWD A;  4IAP A;  4QXA B;  5J3T A;  4ZRI A;  1UEF A;  1I2H A;  2CRF A;  1V61 A;  4Y94 A;  2R0D A;  4EMO A;  4HAX B;  3NWA A;  1TXD A;  1H4R A;  1EVH A;  2QKL A;  3RCP A;  1XD4 A;  3A58 A;  3DXE A;  1SGH A;  3IVF A;  4TYZ A;  3HK0 A;  4HB0 B;  3HW2 B;  2COF A;  5C16 A;  1OY2 A;  4A5K A;  2K2J A;  4Z2N A;  3P7Z A;  5JHH A;  5IRS A;  4DX9 0;  1ZVR A;  3MPX A;  1UNR A;  2K2U A;  1W1H A;  5EFX A;  2ZKM X;  1E5W A;  3P6A A;  2K49 A;  2KR0 A;  3FEH A;  3ML4 A;  5D3W A;  2DX5 A;  2UZS A;  2D9W A;  4TKN A;  4CYE A;  3FM8 C;  2Z13 A;  2YT1 A;  1NTY A;  1V5P A;  2I5F A;  3WA0 A;  2W2X C;  1X1G A;  2MKR A;  2EJ8 A;  4PNK A;  2CAY A;  2DA0 A;  1U5F A;  3TVV A;  3CIK A;  1WI1 A;  2IFS A;  1BTK A;  1X86 A;  4B6H A;  1J0W A;  1B55 A;  1SHC A;  1WJM A;  2G35 A;  2GUM A;  1TQZ A;  4GNK B;  1LB1 A;  3QWM A;  2RNR B;  2ROZ B;  1KZG A;  2D9V A;  2ELA A;  2L1C A;  5M4Y B;  4K2P A;  2COA A;  5DHF B;  3KSY A;  1MAI A;  3PP2 A;  1T77 A;  3DXC A;  3TO1 A;  4GN1 A;  4GMX B;  3VOQ A;  1FHW A;  5J3Q A;  2YRY A;  3PG7 A;  2K8E A;  3KZ1 A;  4H8S A;  2Y8G A;  2YSZ A;  4GPT B;  2RSG A;  2J0J A;  3X23 A;  1OMW A;  4KAX B;  4GXB A; 
#chains in the Genus database with same CATH homology
 1FOE A;  1BTN A;  1QQG A;  1DDM A;  3KRW A;  1N3H A;  2GJY A;  2Q13 A;  4IFS A;  4YL8 A;  1DDW A;  1Y19 B;  3WYF B;  3FSS A;  2J0K A;  1NI2 A;  1W1G A;  2VSZ A;  2EMT A;  2NMB A;  4HB3 B;  2CY5 A;  1K5D B;  2DFK A;  4HAV B;  1UNQ A;  3GYP A;  4GZU A;  3ZVR A;  3OAN A;  2E2X A;  2MDX A;  1Y5O A;  5LON B;  3T06 A;  4HAW B;  2JP2 A;  4EKU A;  4K17 A;  1IRS A;  2Y8F A;  1MK7 B;  2MFQ A;  2DHI A;  4K81 A;  2P0D A;  4HAY B;  3AU5 A;  4F7G A;  1XR0 B;  4C0A A;  2DHJ A;  1ZSQ A;  2RUK B;  3KY9 A;  4MK0 A;  4A6F B;  3NSU A;  2W2X D;  3O96 A;  2MWN B;  5C5B B;  3PVU A;  4HDO A;  1BAK A;  1PMS A;  2XQN M;  5D3X A;  1WGU A;  3PVL A;  1MK9 B;  1V5U A;  2Y7B A;  3SO6 A;  3PEG A;  4YON A;  2ROV A;  2CY4 A;  1P6S A;  2LG1 A;  2BCJ A;  1J19 A;  3ODX A;  1FB8 A;  2UVM A;  1LW3 A;  1U2B A;  4A6H A;  2DHK A;  1QC6 A;  1XX0 A;  5KQ4 A;  4NSW A;  1WVH A;  1X1F A;  4HAU B;  5HE1 A;  1I7A A;  3G9W A;  1U5E A;  2ELB A;  2DX1 A;  2M38 A;  1AWE A;  1XOD A;  4HAT B;  1ISN A;  1EAZ A;  2D9Z A;  3DXD A;  2RGN B;  4WJ7 A;  5D3Y A;  4EJN A;  1BWN A;  4KHO A;  2X18 A;  4BBK A;  5DHA B;  1DRO A;  4NY0 A;  4WVF B;  2PZ1 A;  1TJ6 A;  3N7C A;  4P7I A;  1XKE A;  2DYQ A;  4MT7 A;  3M1I B;  1UPR A;  1ZM0 A;  2IYB A;  2N23 A;  5CLL B;  2DKQ A;  2RVB B;  3MDB C;  4GMV A;  5DIF B;  2M14 A;  5HE0 A;  1NU2 A;  1MPH A;  2AL6 A;  3ULB A;  2YF0 A;  4Z2M B;  3TFM A;  4CHM A;  2DYN A;  4A6K A;  4A6F A;  1EGX A;  1DBH A;  3D8D A;  5C5B A;  2COD A;  2LOX A;  2LOZ A;  2KCJ A;  2OQB A;  1DYN A;  1P3R A;  3ULC A;  2H7D A;  2NZ8 B;  2RLO A;  1UPQ A;  5JP4 A;  4D0N B;  1EF1 A;  2V76 A;  5DH9 B;  3LJU X;  5D27 A;  4PQ0 A;  4CHJ A;  5C79 A;  4MY6 A;  2HTH B;  3GYO A;  3AU4 A;  2DTC A;  2COC A;  3PSC A;  3U7D A;  2VKI A;  2YVC A;  5KQ1 A;  2GS0 A;  1P5T A;  5J3Y A;  2DKP A;  1GC6 A;  2GCL A;  3HQC A;  2J0M A;  2DLW A;  1XCG A;  4DX8 A;  2P0F A;  3PZD A;  1ZC3 B;  1FHX A;  4KHA A;  2Z0P A;  5KCV A;  1K5G B;  4HB4 B;  3A98 B;  1V5M A;  2ADZ A;  2J59 M;  3VIA A;  3UZT A;  2LYD A;  3SV1 A;  1OQN A;  1WG7 A;  1WJ1 A;  2D11 A;  2ZPY A;  1WGQ A;  2HE7 A;  1Q67 A;  4XWX A;  4F7U P;  3SNH A;  4WSF A;  2KUP A;  5JHG A;  1X05 A;  3SYX A;  2I1K A;  4ZRK A;  2LKO A;  3ODO A;  4DXA B;  3BIN A;  3TW1 A;  2YS3 A;  1ZC4 B;  2DN6 A;  4HAZ B;  2OTX A;  2D9X A;  1FGY A;  2N0Y A;  5C6R A;  3F5R A;  4IOY X;  4HB2 B;  1FAO A;  1Z87 A;  2FJL A;  2P0H A;  5JLJ B;  4F7H A;  5HE3 A;  5L81 A;  3PVW A;  1MKE A;  1RRP B;  2YS5 A;  2YT0 A;  1PFJ A;  1M7E A;  3KRX A;  1KI1 B;  2K00 A;  4KHB B;  1AQC A;  2I5C A;  1W1D A;  1U5G A;  3ZDT A;  1FHO A;  2EC1 A;  1V88 A;  3ODW A;  1V89 A;  1H10 A;  5DI9 B;  1MIX A;  2VRW B;  3V5W A;  2L2I A;  1PLS A;  3A8P A;  5HE2 A;  3QBV B;  2KGX B;  2I1J A;  1X11 A;  5LOP B;  5CLQ B;  1FGZ A;  1NTV A;  2YS1 A;  1DDV A;  3F0W A;  4HDQ A;  4L6E A;  2R09 A;  1KZ7 A;  3BJI A;  2D10 A;  3D8E A;  2H7E A;  3SUZ A;  2QKM A;  2EMS A;  2Z0O A;  5FI1 A;  1M7R A;  2D4Q A;  4K2O A;  2P8V A;  2W2W A;  2GCJ A;  3U8Z A;  1U29 A;  1RJ2 A;  5GOW B;  2LUL A;  3A8Q A;  1GC7 A;  2D2Q A;  2UZR A;  3QIJ A;  2Z0Q A;  3D8F A;  1MIZ B;  5FI0 A;  4KVG B;  1GG3 A;  1UNP A;  5D3V A;  4HHV A;  4ZRJ A;  4DBB A;  2AEH A;  3CXB B;  3TCA A;  1U5D A;  3AJ4 A;  1U27 A;  2D9Y A;  4IAP A;  5J3T A;  4ZRI A;  1UEF A;  1I2H A;  2CRF A;  1V61 A;  4Y94 A;  2R0D A;  4EMO A;  4HAX B;  1TXD A;  1H4R A;  1EVH A;  2QKL A;  3RCP A;  1XD4 A;  3DXE A;  1SGH A;  3IVF A;  4TYZ A;  3HK0 A;  4HB0 B;  3HW2 B;  2COF A;  5C16 A;  1OY2 A;  4A5K A;  2K2J A;  4Z2N A;  3P7Z A;  5JHH A;  4DX9 0;  1ZVR A;  3MPX A;  1UNR A;  2K2U A;  1W1H A;  5EFX A;  1E5W A;  3P6A A;  3FEH A;  5D3W A;  3ML4 A;  2DX5 A;  2UZS A;  2D9W A;  4TKN A;  4CYE A;  3FM8 C;  2YT1 A;  1NTY A;  1V5P A;  2I5F A;  3WA0 A;  2W2X C;  1X1G A;  2MKR A;  2EJ8 A;  4PNK A;  2CAY A;  2DA0 A;  1U5F A;  3TVV A;  3CIK A;  1WI1 A;  2IFS A;  1BTK A;  1X86 A;  4B6H A;  1J0W A;  1B55 A;  1SHC A;  1WJM A;  2G35 A;  1TQZ A;  1LB1 A;  3QWM A;  2RNR B;  2ROZ B;  1KZG A;  2D9V A;  2ELA A;  2L1C A;  4K2P A;  2COA A;  5DHF B;  3KSY A;  1MAI A;  3PP2 A;  3DXC A;  3TO1 A;  4GN1 A;  4GMX B;  3VOQ A;  1FHW A;  5J3Q A;  2YRY A;  3PG7 A;  3KZ1 A;  4H8S A;  2Y8G A;  2YSZ A;  4GPT B;  2RSG A;  2J0J A;  3X23 A;  1OMW A;  4KAX B;  4GXB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...