2MDXA

Solution structure of the human wild type fapp1-ph domain
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
108
structure length
108
Chain Sequence
GPLGSPEFMEGVLYKWTNYLTGWQPRWFVLDNGILSYYDSQDDVCKGSKGSIKMAVCEIKVHSADNTRMELIIPGEQHFYMKAVNAAERQRWLVALGSSKACLTDTRT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Membrane protein
molecule keywords Pleckstrin homology domain-containing family A member 3
publication title Solution structure of the human wild type FAPP1-PH domain
rcsb
source organism Homo sapiens
total genus 17
structure length 108
sequence length 108
ec nomenclature
pdb deposition date 2013-09-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00169 PH PH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2mdxA00
1V5PA 4GMXB 1OQNA 4K81A 4D0NB 5KCVA 2GCJA 4MY6A 1K5GB 2D4QA 4PNKA 5J3YA 3G9WA 4DXAB 2Z0PA 4KVGB 1NU2A 1DBHA 5FI0A 3PVUA 2QKLA 2G35A 1W1DA 4K17A 4DBBA 1J0WA 2HE7A 2P8VA 1XCGA 5JHGA 2Y8GA 5J3TA 2VKIA 2CY4A 2R0DA 4NSWA 2VRWB 2D10A 3F5RA 4K2OA 1NTVA 3TVVA 2K2JA 4HB2B 1TXDA 2LKOA 1M7RA 3HW2B 1UNQA 3PSCA 1RRPB 4IOYX 2YRYA 4F7UP 1KZ7A 4Z2MB 1KZGA 5LONB 1Z87A 1X86A 1UNPA 3HK0A 3P6AA 3DXCA 4HAXB 1J19A 1U5EA 2GJYA 1BTNA 1V5MA 5JHHA 2YS1A 2VSZA 2Y7BA 2D9YA 5C79A 1QC6A 2EMSA 5L81A 4WSFA 2AL6A 1WGQA 2QKMA 1ZC4B 2J0KA 4MT7A 2XQNM 3PG7A 1GG3A 2D11A 1PFJA 2D9VA 3O96A 4A6FA 4EJNA 2V76A 3VOQA 1FB8A 4CHMA 2LG1A 1KI1B 2LOZA 4HAYB 3DXDA 2DX5A 1WG7A 4H8SA 3TO1A 3SO6A 4ZRKA 5DHFB 1Y5OA 2H7DA 2ELAA 4KAXB 1MIXA 2L2IA 1DDMA 5CLQB 3WYFB 1AWEA 3QBVB 2FJLA 2KUPA 2OQBA 3PEGA 4A6HA 3GYOA 2DHKA 4GMVA 4K2PA 1U5GA 3ULBA 2EC1A 1X11A 3BINA 4HAZB 1MK9B 3PZDA 5D3VA 4B6HA 2PZ1A 1FGZA 2K00A 3AU5A 5DIFB 1WJ1A 4GN1A 1I2HA 2N0YA 2ROZB 2W2XC 3IVFA 4BBKA 1N3HA 3PVLA 2ADZA 1DDWA 5GOWB 2D2QA 3QWMA 1FHOA 2CY5A 4HAWB 3ULCA 1W1GA 1PLSA 2LULA 5C5BA 3HQCA 1TQZA 1FGYA 1XR0B 4HATB 5D27A 1DYNA 1P3RA 2I1JA 3QIJA 3SYXA 2OTXA 1I7AA 4YL8A 4A6FB 2NZ8B 5J3QA 1BTKA 3MDBC 2COAA 4Y94A 1DROA 2X18A 3ML4A 1Q67A 4F7HA 1BWNA 3TCAA 3P7ZA 1MPHA 1NI2A 3KRXA 2ELBA 2LOXA 2JP2A 2MFQA 3CIKA 3ODOA 3OANA 2RNRB 1ZC3B 4WJ7A 1B55A 1MKEA 1DDVA 4EKUA 2IYBA 1NTYA 1EAZA 5HE3A 2DN6A 4A5KA 4C0AA 1V89A 3KSYA 2RUKB 4IFSA 2YT1A 3U7DA 2R09A 4DX8A 1GC6A 1V88A 2EMTA 3AJ4A 3DXEA 3ODXA 1XODA 1FAOA 3ODWA 1OMWA 2N23A 4NY0A 1V5UA 2NMBA 1U2BA 3V5WA 2RVBB 1FHXA 1WI1A 1U27A 5DHAB 1U5DA 2LYDA 1MIZB 1UPRA 2P0DA 2P0FA 1BAKA 4TKNA 5FI1A 3PP2A 3D8FA 1X1GA 3A8QA 3NSUA 3PVWA 3KY9A 2DYNA 2MKRA 2CAYA 5C5BB 1ISNA 2P0HA 2YS3A 2RSGA 2Y8FA 2I5FA 3LJUX 4CYEA 1SGHA 3VIAA 3M1IB 4HB4B 1P6SA 3T06A 2D9XA 3KZ1A 4ZRIA 1K5DB 4PQ0A 1AQCA 1MK7B 1MAIA 2DTCA 5D3WA 2W2XD 3D8EA 3ZDTA 4CHJA 4KHAA 1EVHA 2W2WA 1XX0A 1X1FA 4P7IA 2GS0A 3FM8C 3RCPA 1PMSA 1ZM0A 1IRSA 4MK0A 2COCA 4TYZA 1FHWA 2DKQA 3CXBB 4F7GA 1Y19B 3U8ZA 2MWNB 4KHOA 2H7EA 2DX1A 2KGXB 5CLLB 5KQ1A 5HE2A 2IFSA 1EGXA 5DI9B 3N7CA 3A98B 3TFMA 2DYQA 1U5FA 2KCJA 2DA0A 3A8PA 2E2XA 5HE0A 1P5TA 2DKPA 1UNRA 3KRWA 2MDXA 2BCJA 2DLWA 1OY2A 4HB0B 1W1HA 2YF0A 2D9WA 3ZVRA 4DX90 3MPXA 2K2UA 3SV1A 3WA0A 2L1CA 2EJ8A 4GXBA 3F0WA 2AEHA 4HAUB 4HDQA 5LOPB 2J59M 1WGUA 4GPTB 2UVMA 3BJIA 4YONA 4HB3B 4A6KA 5D3XA 1XKEA 5D3YA 5C6RA 2J0JA 4XWXA 5DH9B 3X23A 1H10A 1QQGA 2Z0QA 2YSZA 4WVFB 3FEHA 1V61A 2DFKA 4ZRJA 1EF1A 1X05A 5JLJB 2ROVA 4EMOA 2DHIA 1TJ6A 3D8DA 2I5CA 1UEFA 5KQ4A 2CRFA 2UZRA 1ZVRA 2YT0A 1U29A 1GC7A 4IAPA 4KHBB 2YVCA 4Z2NA 2D9ZA 2YS5A 3UZTA 2M38A 2CODA 2Q13A 2COFA 5C16A 2I1KA 4HAVB 1SHCA 4L6EA 2Z0OA 4HHVA 5HE1A 1H4RA 3TW1A 1XD4A 3SUZA 2GCLA 1UPQA 2UZSA 3AU4A 1E5WA 4GZUA 4HDOA 1WJMA 1LB1A 1LW3A 3GYPA 2HTHB 5EFXA 2RLOA 3FSSA 1RJ2A 2RGNB 5JP4A 2ZPYA 2J0MA 1ZSQA 1M7EA 1FOEA 1WVHA 2M14A 3SNHA 2DHJA
chains in the Genus database with same CATH superfamily
1V5PA 4GMXB 1OQNA 4K81A 4D0NB 4GOUA 5KCVA 2GCJA 4MY6A 1K5GB 2D4QA 1T77A 4PNKA 5J3YA 3G9WA 4QJ3B 4DXAB 2Z0PA 4KVGB 1NU2A 1DBHA 5FI0A 3PVUA 2QKLA 2G35A 1W1DA 4K17A 4DBBA 1J0WA 2HE7A 2P8VA 1XCGA 5JHGA 2Y8GA 5J3TA 2VKIA 2CY4A 2R0DA 4NSWA 2VRWB 3FVCA 2D10A 3F5RA 4K2OA 1NTVA 3TVVA 2K2JA 5I2MA 4HB2B 1TXDA 2LKOA 1M7RA 3HW2B 1UNQA 3PSCA 1RRPB 4OSNA 4IOYX 2YRYA 4F7UP 1KZ7A 4Z2MB 1KZGA 5LONB 1Z87A 1X86A 1UNPA 3HK0A 3P6AA 3DXCA 4HAXB 1J19A 1U5EA 2GJYA 1BTNA 3A58A 1ZYIA 1V5MA 5JHHA 2YS1A 2VSZA 2Y7BA 2KUQA 2D9YA 4DIXA 5C79A 1QC6A 2EMSA 2K49A 5L81A 4WSFA 2AL6A 1WGQA 2QKMA 1ZC4B 2J0KA 4MT7A 2XQNM 3PG7A 1GG3A 2YT2A 2FJUB 2D11A 3OHMB 1PFJA 2D9VA 3O96A 4A6FA 4EJNA 2V76A 3VOQA 1FB8A 4CHMA 2LG1A 1KI1B 2LOZA 4QXAB 4HAYB 3DXDA 2DX5A 1WG7A 4H8SA 3TO1A 3SO6A 4ZRKA 5DHFB 1Y5OA 2H7DA 2ELAA 4KAXB 1MIXA 4D6WA 2L2IA 1DDMA 5CLQB 3WYFB 2Z59A 3DCXA 2KIGA 1AWEA 3QBVB 4QJ5B 2FJLA 2KUPA 2OQBA 3PEGA 4A6HA 3GYOA 2DHKA 4GMVA 4K2PA 1U5GA 2GUMA 3ULBA 2EC1A 1X11A 3BINA 4HAZB 1MK9B 3PZDA 5D3VA 4B6HA 2PZ1A 1FGZA 2K00A 3AU5A 2KR0A 5DIFB 1WJ1A 4GN1A 1I2HA 2RRFA 2N0YA 2NBVA 2ROZB 2W2XC 3IVFA 4BBKA 1N3HA 3PVLA 2ADZA 1DDWA 5GOWB 2D2QA 3QWMA 1FHOA 2CY5A 4HAWB 3ULCA 1W1GA 1PLSA 2LULA 5C5BA 3HQCA 4GNKB 1TQZA 1FGYA 2Z4DA 1XR0B 4HATB 5D27A 1DYNA 1P3RA 2I1JA 3QIJA 3SYXA 3B77A 4L1RA 2OTXA 1I7AA 4YL8A 4A6FB 2NZ8B 5J3QA 1BTKA 3MDBC 3NWDA 5I2SA 2COAA 4Y94A 1DROA 2X18A 3ML4A 1Q67A 5M4YB 4F7HA 1BWNA 3TCAA 3P7ZA 1MPHA 1NI2A 3KRXA 2ELBA 2LOXA 2JP2A 3NW8A 2MFQA 3CIKA 3ODOA 3OANA 2RNRB 1ZC3B 2R2YA 4WJ7A 3HIEA 1B55A 1MKEA 1DDVA 4EKUA 2IYBA 1NTYA 1EAZA 5HE3A 2DN6A 4A5KA 4C0AA 1V89A 3KSYA 2RUKB 4IFSA 2YT1A 3U7DA 2R09A 4DX8A 1GC6A 1V88A 2EMTA 3AJ4A 3DXEA 3ODXA 1XODA 1FAOA 3ODWA 1OMWA 2N23A 4NY0A 1V5UA 2NMBA 1U2BA 3V5WA 2RVBB 1FHXA 1WI1A 1U27A 5DHAB 1U5DA 2LYDA 1MIZB 1UPRA 2P0DA 2P0FA 1BAKA 4TKNA 4HSIA 5FI1A 3PP2A 3D8FA 1X1GA 3A8QA 3NSUA 3U12A 3PVWA 3KY9A 2DYNA 2MKRA 2CAYA 5C5BB 1ISNA 2P0HA 2YS3A 4OT1A 2RSGA 2Y8FA 2I5FA 3LJUX 4CYEA 1SGHA 3VIAA 3M1IB 4HB4B 1P6SA 3T06A 2D9XA 3KZ1A 4ZRIA 1K5DB 4PQ0A 1AQCA 1MK7B 1MAIA 2DTCA 2KIEA 5D3WA 2W2XD 3D8EA 3ZDTA 4CHJA 4KHAA 1EVHA 2W2WA 1XX0A 1X1FA 4P7IA 2GS0A 3HSAA 3FM8C 3RCPA 1PMSA 1ZM0A 1IRSA 4MK0A 4QJ4B 2COCA 4TYZA 1FHWA 2DKQA 3CXBB 4F7GA 1Y19B 3U8ZA 2Z14A 4KHBA 2MWNB 4KHOA 2H7EA 1MI1A 2DX1A 2KGXB 5CLLB 5KQ1A 5HE2A 2IFSA 1EGXA 5LG4B 5DI9B 3N7CA 3A98B 3TFMA 2DYQA 1U5FA 2KCJA 2DA0A 3A8PA 2E2XA 5HE0A 1P5TA 2DKPA 1UNRA 3KRWA 2MDXA 2Z13A 2BCJA 2DLWA 1OY2A 4HB0B 1W1HA 2YF0A 2D9WA 3ZVRA 4DX90 3MPXA 2K2UA 3SV1A 3WA0A 2L1CA 2EJ8A 4GXBA 3F0WA 2AEHA 4HAUB 4HDQA 5LOPB 2J59M 1WGUA 4GPTB 2UVMA 3BJIA 4YONA 4HB3B 4A6KA 5D3XA 5IRSA 3NWAA 1XKEA 5D3YA 5C6RA 2J0JA 4XWXA 5DH9B 3X23A 1H10A 1QQGA 3NWFA 2Z0QA 2YSZA 4WVFB 3FEHA 1V61A 2DFKA 4ZRJA 1EF1A 1X05A 5JLJB 2ROVA 4EMOA 2K8EA 2DHIA 1TJ6A 3D8DA 2I5CA 1UEFA 5KQ4A 2CRFA 2UZRA 1ZVRA 2YT0A 1U29A 1GC7A 4IAPA 4KHBB 4CSQA 2YVCA 4Z2NA 2D9ZA 2YS5A 3UZTA 2M38A 2CODA 2Q13A 2COFA 5C16A 2I1KA 4HAVB 1SHCA 4L6EA 2Z0OA 4HHVA 5HE1A 1H4RA 3TW1A 1XD4A 3SUZA 2GCLA 1UPQA 2UZSA 3AU4A 1E5WA 4GZUA 4HDOA 1WJMA 1LB1A 1LW3A 3GYPA 2HTHB 5EFXA 2RLOA 2ZKMX 3FSSA 1RJ2A 2RGNB 5JP4A 2ZPYA 2J0MA 1ZSQA 1M7EA 1FOEA 1WVHA 2M14A 3SNHA 2DHJA
chains in the Genus database with same CATH topology
1V5PA 4GMXB 1OQNA 4K81A 4D0NB 5KCVA 2GCJA 4MY6A 1K5GB 2D4QA 4PNKA 5J3YA 3G9WA 4DXAB 2Z0PA 4KVGB 1NU2A 1DBHA 5FI0A 3PVUA 2QKLA 2G35A 1W1DA 4K17A 4DBBA 1J0WA 2HE7A 2P8VA 1XCGA 5JHGA 2Y8GA 5J3TA 2VKIA 2CY4A 2R0DA 4NSWA 2VRWB 2D10A 3F5RA 4K2OA 1NTVA 3TVVA 2K2JA 4HB2B 1TXDA 2LKOA 1M7RA 3HW2B 1UNQA 3PSCA 1RRPB 4IOYX 2YRYA 4F7UP 1KZ7A 4Z2MB 1KZGA 5LONB 1Z87A 1X86A 1UNPA 3HK0A 3P6AA 3DXCA 4HAXB 1J19A 1U5EA 2GJYA 1BTNA 1V5MA 5JHHA 2YS1A 2VSZA 2Y7BA 2D9YA 5C79A 1QC6A 2EMSA 5L81A 4WSFA 2AL6A 1WGQA 2QKMA 1ZC4B 2J0KA 4MT7A 2XQNM 3PG7A 1GG3A 2D11A 1PFJA 2D9VA 3O96A 4A6FA 4EJNA 2V76A 3VOQA 1FB8A 4CHMA 2LG1A 1KI1B 2LOZA 4HAYB 3DXDA 2DX5A 1WG7A 4H8SA 3TO1A 3SO6A 4ZRKA 5DHFB 1Y5OA 2H7DA 2ELAA 4KAXB 1MIXA 2L2IA 1DDMA 5CLQB 3WYFB 1AWEA 3QBVB 2FJLA 2KUPA 2OQBA 3PEGA 4A6HA 3GYOA 2DHKA 4GMVA 4K2PA 1U5GA 3ULBA 2EC1A 1X11A 3BINA 4HAZB 1MK9B 3PZDA 5D3VA 4B6HA 2PZ1A 1FGZA 2K00A 3AU5A 5DIFB 1WJ1A 4GN1A 1I2HA 2N0YA 2ROZB 2W2XC 3IVFA 4BBKA 1N3HA 3PVLA 2ADZA 1DDWA 5GOWB 2D2QA 3QWMA 1FHOA 2CY5A 4HAWB 3ULCA 1W1GA 1PLSA 2LULA 5C5BA 3HQCA 1TQZA 1FGYA 1XR0B 4HATB 5D27A 1DYNA 1P3RA 2I1JA 3QIJA 3SYXA 2OTXA 1I7AA 4YL8A 4A6FB 2NZ8B 5J3QA 1BTKA 3MDBC 2COAA 4Y94A 1DROA 2X18A 3ML4A 1Q67A 4F7HA 1BWNA 3TCAA 3P7ZA 1MPHA 1NI2A 3KRXA 2ELBA 2LOXA 2JP2A 2MFQA 3CIKA 3ODOA 3OANA 2RNRB 1ZC3B 4WJ7A 1B55A 1MKEA 1DDVA 4EKUA 2IYBA 1NTYA 1EAZA 5HE3A 2DN6A 4A5KA 4C0AA 1V89A 3KSYA 2RUKB 4IFSA 2YT1A 3U7DA 2R09A 4DX8A 1GC6A 1V88A 2EMTA 3AJ4A 3DXEA 3ODXA 1XODA 1FAOA 3ODWA 1OMWA 2N23A 4NY0A 1V5UA 2NMBA 1U2BA 3V5WA 2RVBB 1FHXA 1WI1A 1U27A 5DHAB 1U5DA 2LYDA 1MIZB 1UPRA 2P0DA 2P0FA 1BAKA 4TKNA 5FI1A 3PP2A 3D8FA 1X1GA 3A8QA 3NSUA 3PVWA 3KY9A 2DYNA 2MKRA 2CAYA 5C5BB 1ISNA 2P0HA 2YS3A 2RSGA 2Y8FA 2I5FA 3LJUX 4CYEA 1SGHA 3VIAA 3M1IB 4HB4B 1P6SA 3T06A 2D9XA 3KZ1A 4ZRIA 1K5DB 4PQ0A 1AQCA 1MK7B 1MAIA 2DTCA 5D3WA 2W2XD 3D8EA 3ZDTA 4CHJA 4KHAA 1EVHA 2W2WA 1XX0A 1X1FA 4P7IA 2GS0A 3FM8C 3RCPA 1PMSA 1ZM0A 1IRSA 4MK0A 2COCA 4TYZA 1FHWA 2DKQA 3CXBB 4F7GA 1Y19B 3U8ZA 2MWNB 4KHOA 2H7EA 2DX1A 2KGXB 5CLLB 5KQ1A 5HE2A 2IFSA 1EGXA 5DI9B 3N7CA 3A98B 3TFMA 2DYQA 1U5FA 2KCJA 2DA0A 3A8PA 2E2XA 5HE0A 1P5TA 2DKPA 1UNRA 3KRWA 2MDXA 2BCJA 2DLWA 1OY2A 4HB0B 1W1HA 2YF0A 2D9WA 3ZVRA 4DX90 3MPXA 2K2UA 3SV1A 3WA0A 2L1CA 2EJ8A 4GXBA 3F0WA 2AEHA 4HAUB 4HDQA 5LOPB 2J59M 1WGUA 4GPTB 2UVMA 3BJIA 4YONA 4HB3B 4A6KA 5D3XA 1XKEA 5D3YA 5C6RA 2J0JA 4XWXA 5DH9B 3X23A 1H10A 1QQGA 2Z0QA 2YSZA 4WVFB 3FEHA 1V61A 2DFKA 4ZRJA 1EF1A 1X05A 5JLJB 2ROVA 4EMOA 2DHIA 1TJ6A 3D8DA 2I5CA 1UEFA 5KQ4A 2CRFA 2UZRA 1ZVRA 2YT0A 1U29A 1GC7A 4IAPA 4KHBB 2YVCA 4Z2NA 2D9ZA 2YS5A 3UZTA 2M38A 2CODA 2Q13A 2COFA 5C16A 2I1KA 4HAVB 1SHCA 4L6EA 2Z0OA 4HHVA 5HE1A 1H4RA 3TW1A 1XD4A 3SUZA 2GCLA 1UPQA 2UZSA 3AU4A 1E5WA 4GZUA 4HDOA 1WJMA 1LB1A 1LW3A 3GYPA 2HTHB 5EFXA 2RLOA 3FSSA 1RJ2A 2RGNB 5JP4A 2ZPYA 2J0MA 1ZSQA 1M7EA 1FOEA 1WVHA 2M14A 3SNHA 2DHJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1V5P A;  4GMX B;  1OQN A;  4K81 A;  4D0N B;  5KCV A;  2GCJ A;  4MY6 A;  1K5G B;  2D4Q A;  4PNK A;  5J3Y A;  3G9W A;  4DXA B;  2Z0P A;  4KVG B;  1NU2 A;  1DBH A;  5FI0 A;  3PVU A;  2QKL A;  2G35 A;  1W1D A;  4K17 A;  4DBB A;  1J0W A;  2HE7 A;  2P8V A;  1XCG A;  5JHG A;  2Y8G A;  5J3T A;  2VKI A;  2CY4 A;  2R0D A;  4NSW A;  2VRW B;  2D10 A;  3F5R A;  4K2O A;  1NTV A;  3TVV A;  2K2J A;  4HB2 B;  1TXD A;  2LKO A;  1M7R A;  3HW2 B;  1UNQ A;  3PSC A;  1RRP B;  4IOY X;  2YRY A;  4F7U P;  1KZ7 A;  4Z2M B;  1KZG A;  5LON B;  1Z87 A;  1X86 A;  1UNP A;  3HK0 A;  3P6A A;  3DXC A;  4HAX B;  1J19 A;  1U5E A;  2GJY A;  1BTN A;  1V5M A;  5JHH A;  2YS1 A;  2VSZ A;  2Y7B A;  2D9Y A;  5C79 A;  1QC6 A;  2EMS A;  5L81 A;  4WSF A;  2AL6 A;  1WGQ A;  2QKM A;  1ZC4 B;  2J0K A;  4MT7 A;  2XQN M;  3PG7 A;  1GG3 A;  2D11 A;  1PFJ A;  2D9V A;  3O96 A;  4A6F A;  4EJN A;  2V76 A;  3VOQ A;  1FB8 A;  4CHM A;  2LG1 A;  1KI1 B;  2LOZ A;  4HAY B;  3DXD A;  2DX5 A;  1WG7 A;  4H8S A;  3TO1 A;  3SO6 A;  4ZRK A;  5DHF B;  1Y5O A;  2H7D A;  2ELA A;  4KAX B;  1MIX A;  2L2I A;  1DDM A;  5CLQ B;  3WYF B;  1AWE A;  3QBV B;  2FJL A;  2KUP A;  2OQB A;  3PEG A;  4A6H A;  3GYO A;  2DHK A;  4GMV A;  4K2P A;  1U5G A;  3ULB A;  2EC1 A;  1X11 A;  3BIN A;  4HAZ B;  1MK9 B;  3PZD A;  5D3V A;  4B6H A;  2PZ1 A;  1FGZ A;  2K00 A;  3AU5 A;  5DIF B;  1WJ1 A;  4GN1 A;  1I2H A;  2N0Y A;  2ROZ B;  2W2X C;  3IVF A;  4BBK A;  1N3H A;  3PVL A;  2ADZ A;  1DDW A;  5GOW B;  2D2Q A;  3QWM A;  1FHO A;  2CY5 A;  4HAW B;  3ULC A;  1W1G A;  1PLS A;  2LUL A;  5C5B A;  3HQC A;  1TQZ A;  1FGY A;  1XR0 B;  4HAT B;  5D27 A;  1DYN A;  1P3R A;  2I1J A;  3QIJ A;  3SYX A;  2OTX A;  1I7A A;  4YL8 A;  4A6F B;  2NZ8 B;  5J3Q A;  1BTK A;  3MDB C;  2COA A;  4Y94 A;  1DRO A;  2X18 A;  3ML4 A;  1Q67 A;  4F7H A;  1BWN A;  3TCA A;  3P7Z A;  1MPH A;  1NI2 A;  3KRX A;  2ELB A;  2LOX A;  2JP2 A;  2MFQ A;  3CIK A;  3ODO A;  3OAN A;  2RNR B;  1ZC3 B;  4WJ7 A;  1B55 A;  1MKE A;  1DDV A;  4EKU A;  2IYB A;  1NTY A;  1EAZ A;  5HE3 A;  2DN6 A;  4A5K A;  4C0A A;  1V89 A;  3KSY A;  2RUK B;  4IFS A;  2YT1 A;  3U7D A;  2R09 A;  4DX8 A;  1GC6 A;  1V88 A;  2EMT A;  3AJ4 A;  3DXE A;  3ODX A;  1XOD A;  1FAO A;  3ODW A;  1OMW A;  2N23 A;  4NY0 A;  1V5U A;  2NMB A;  1U2B A;  3V5W A;  2RVB B;  1FHX A;  1WI1 A;  1U27 A;  5DHA B;  1U5D A;  2LYD A;  1MIZ B;  1UPR A;  2P0D A;  2P0F A;  1BAK A;  4TKN A;  5FI1 A;  3PP2 A;  3D8F A;  1X1G A;  3A8Q A;  3NSU A;  3PVW A;  3KY9 A;  2DYN A;  2MKR A;  2CAY A;  5C5B B;  1ISN A;  2P0H A;  2YS3 A;  2RSG A;  2Y8F A;  2I5F A;  3LJU X;  4CYE A;  1SGH A;  3VIA A;  3M1I B;  4HB4 B;  1P6S A;  3T06 A;  2D9X A;  3KZ1 A;  4ZRI A;  1K5D B;  4PQ0 A;  1AQC A;  1MK7 B;  1MAI A;  2DTC A;  5D3W A;  2W2X D;  3D8E A;  3ZDT A;  4CHJ A;  4KHA A;  1EVH A;  2W2W A;  1XX0 A;  1X1F A;  4P7I A;  2GS0 A;  3FM8 C;  3RCP A;  1PMS A;  1ZM0 A;  1IRS A;  4MK0 A;  2COC A;  4TYZ A;  1FHW A;  2DKQ A;  3CXB B;  4F7G A;  1Y19 B;  3U8Z A;  2MWN B;  4KHO A;  2H7E A;  2DX1 A;  2KGX B;  5CLL B;  5KQ1 A;  5HE2 A;  2IFS A;  1EGX A;  5DI9 B;  3N7C A;  3A98 B;  3TFM A;  2DYQ A;  1U5F A;  2KCJ A;  2DA0 A;  3A8P A;  2E2X A;  5HE0 A;  1P5T A;  2DKP A;  1UNR A;  3KRW A;  2MDX A;  2BCJ A;  2DLW A;  1OY2 A;  4HB0 B;  1W1H A;  2YF0 A;  2D9W A;  3ZVR A;  4DX9 0;  3MPX A;  2K2U A;  3SV1 A;  3WA0 A;  2L1C A;  2EJ8 A;  4GXB A;  3F0W A;  2AEH A;  4HAU B;  4HDQ A;  5LOP B;  2J59 M;  1WGU A;  4GPT B;  2UVM A;  3BJI A;  4YON A;  4HB3 B;  4A6K A;  5D3X A;  1XKE A;  5D3Y A;  5C6R A;  2J0J A;  4XWX A;  5DH9 B;  3X23 A;  1H10 A;  1QQG A;  2Z0Q A;  2YSZ A;  4WVF B;  3FEH A;  1V61 A;  2DFK A;  4ZRJ A;  1EF1 A;  1X05 A;  5JLJ B;  2ROV A;  4EMO A;  2DHI A;  1TJ6 A;  3D8D A;  2I5C A;  1UEF A;  5KQ4 A;  2CRF A;  2UZR A;  1ZVR A;  2YT0 A;  1U29 A;  1GC7 A;  4IAP A;  4KHB B;  2YVC A;  4Z2N A;  2D9Z A;  2YS5 A;  3UZT A;  2M38 A;  2COD A;  2Q13 A;  2COF A;  5C16 A;  2I1K A;  4HAV B;  1SHC A;  4L6E A;  2Z0O A;  4HHV A;  5HE1 A;  1H4R A;  3TW1 A;  1XD4 A;  3SUZ A;  2GCL A;  1UPQ A;  2UZS A;  3AU4 A;  1E5W A;  4GZU A;  4HDO A;  1WJM A;  1LB1 A;  1LW3 A;  3GYP A;  2HTH B;  5EFX A;  2RLO A;  3FSS A;  1RJ2 A;  2RGN B;  5JP4 A;  2ZPY A;  2J0M A;  1ZSQ A;  1M7E A;  1FOE A;  1WVH A;  2M14 A;  3SNH A;  2DHJ A; 
#chains in the Genus database with same CATH topology
 1V5P A;  4GMX B;  1OQN A;  4K81 A;  4D0N B;  4GOU A;  5KCV A;  2GCJ A;  4MY6 A;  1K5G B;  2D4Q A;  1T77 A;  4PNK A;  5J3Y A;  3G9W A;  4QJ3 B;  4DXA B;  2Z0P A;  4KVG B;  1NU2 A;  1DBH A;  5FI0 A;  3PVU A;  2QKL A;  2G35 A;  1W1D A;  4K17 A;  4DBB A;  1J0W A;  2HE7 A;  2P8V A;  1XCG A;  5JHG A;  2Y8G A;  5J3T A;  2VKI A;  2CY4 A;  2R0D A;  4NSW A;  2VRW B;  3FVC A;  2D10 A;  3F5R A;  4K2O A;  1NTV A;  3TVV A;  2K2J A;  5I2M A;  4HB2 B;  1TXD A;  2LKO A;  1M7R A;  3HW2 B;  1UNQ A;  3PSC A;  1RRP B;  4OSN A;  4IOY X;  2YRY A;  4F7U P;  1KZ7 A;  4Z2M B;  1KZG A;  5LON B;  1Z87 A;  1X86 A;  1UNP A;  3HK0 A;  3P6A A;  3DXC A;  4HAX B;  1J19 A;  1U5E A;  2GJY A;  1BTN A;  3A58 A;  1ZYI A;  1V5M A;  5JHH A;  2YS1 A;  2VSZ A;  2Y7B A;  2KUQ A;  2D9Y A;  4DIX A;  5C79 A;  1QC6 A;  2EMS A;  2K49 A;  5L81 A;  4WSF A;  2AL6 A;  1WGQ A;  2QKM A;  1ZC4 B;  2J0K A;  4MT7 A;  2XQN M;  3PG7 A;  1GG3 A;  2YT2 A;  2FJU B;  2D11 A;  3OHM B;  1PFJ A;  2D9V A;  3O96 A;  4A6F A;  4EJN A;  2V76 A;  3VOQ A;  1FB8 A;  4CHM A;  2LG1 A;  1KI1 B;  2LOZ A;  4QXA B;  4HAY B;  3DXD A;  2DX5 A;  1WG7 A;  4H8S A;  3TO1 A;  3SO6 A;  4ZRK A;  5DHF B;  1Y5O A;  2H7D A;  2ELA A;  4KAX B;  1MIX A;  4D6W A;  2L2I A;  1DDM A;  5CLQ B;  3WYF B;  2Z59 A;  3DCX A;  2KIG A;  1AWE A;  3QBV B;  4QJ5 B;  2FJL A;  2KUP A;  2OQB A;  3PEG A;  4A6H A;  3GYO A;  2DHK A;  4GMV A;  4K2P A;  1U5G A;  2GUM A;  3ULB A;  2EC1 A;  1X11 A;  3BIN A;  4HAZ B;  1MK9 B;  3PZD A;  5D3V A;  4B6H A;  2PZ1 A;  1FGZ A;  2K00 A;  3AU5 A;  2KR0 A;  5DIF B;  1WJ1 A;  4GN1 A;  1I2H A;  2RRF A;  2N0Y A;  2NBV A;  2ROZ B;  2W2X C;  3IVF A;  4BBK A;  1N3H A;  3PVL A;  2ADZ A;  1DDW A;  5GOW B;  2D2Q A;  3QWM A;  1FHO A;  2CY5 A;  4HAW B;  3ULC A;  1W1G A;  1PLS A;  2LUL A;  5C5B A;  3HQC A;  4GNK B;  1TQZ A;  1FGY A;  2Z4D A;  1XR0 B;  4HAT B;  5D27 A;  1DYN A;  1P3R A;  2I1J A;  3QIJ A;  3SYX A;  3B77 A;  4L1R A;  2OTX A;  1I7A A;  4YL8 A;  4A6F B;  2NZ8 B;  5J3Q A;  1BTK A;  3MDB C;  3NWD A;  5I2S A;  2COA A;  4Y94 A;  1DRO A;  2X18 A;  3ML4 A;  1Q67 A;  5M4Y B;  4F7H A;  1BWN A;  3TCA A;  3P7Z A;  1MPH A;  1NI2 A;  3KRX A;  2ELB A;  2LOX A;  2JP2 A;  3NW8 A;  2MFQ A;  3CIK A;  3ODO A;  3OAN A;  2RNR B;  1ZC3 B;  2R2Y A;  4WJ7 A;  3HIE A;  1B55 A;  1MKE A;  1DDV A;  4EKU A;  2IYB A;  1NTY A;  1EAZ A;  5HE3 A;  2DN6 A;  4A5K A;  4C0A A;  1V89 A;  3KSY A;  2RUK B;  4IFS A;  2YT1 A;  3U7D A;  2R09 A;  4DX8 A;  1GC6 A;  1V88 A;  2EMT A;  3AJ4 A;  3DXE A;  3ODX A;  1XOD A;  1FAO A;  3ODW A;  1OMW A;  2N23 A;  4NY0 A;  1V5U A;  2NMB A;  1U2B A;  3V5W A;  2RVB B;  1FHX A;  1WI1 A;  1U27 A;  5DHA B;  1U5D A;  2LYD A;  1MIZ B;  1UPR A;  2P0D A;  2P0F A;  1BAK A;  4TKN A;  4HSI A;  5FI1 A;  3PP2 A;  3D8F A;  1X1G A;  3A8Q A;  3NSU A;  3U12 A;  3PVW A;  3KY9 A;  2DYN A;  2MKR A;  2CAY A;  5C5B B;  1ISN A;  2P0H A;  2YS3 A;  4OT1 A;  2RSG A;  2Y8F A;  2I5F A;  3LJU X;  4CYE A;  1SGH A;  3VIA A;  3M1I B;  4HB4 B;  1P6S A;  3T06 A;  2D9X A;  3KZ1 A;  4ZRI A;  1K5D B;  4PQ0 A;  1AQC A;  1MK7 B;  1MAI A;  2DTC A;  2KIE A;  5D3W A;  2W2X D;  3D8E A;  3ZDT A;  4CHJ A;  4KHA A;  1EVH A;  2W2W A;  1XX0 A;  1X1F A;  4P7I A;  2GS0 A;  3HSA A;  3FM8 C;  3RCP A;  1PMS A;  1ZM0 A;  1IRS A;  4MK0 A;  4QJ4 B;  2COC A;  4TYZ A;  1FHW A;  2DKQ A;  3CXB B;  4F7G A;  1Y19 B;  3U8Z A;  2Z14 A;  4KHB A;  2MWN B;  4KHO A;  2H7E A;  1MI1 A;  2DX1 A;  2KGX B;  5CLL B;  5KQ1 A;  5HE2 A;  2IFS A;  1EGX A;  5LG4 B;  5DI9 B;  3N7C A;  3A98 B;  3TFM A;  2DYQ A;  1U5F A;  2KCJ A;  2DA0 A;  3A8P A;  2E2X A;  5HE0 A;  1P5T A;  2DKP A;  1UNR A;  3KRW A;  2MDX A;  2Z13 A;  2BCJ A;  2DLW A;  1OY2 A;  4HB0 B;  1W1H A;  2YF0 A;  2D9W A;  3ZVR A;  4DX9 0;  3MPX A;  2K2U A;  3SV1 A;  3WA0 A;  2L1C A;  2EJ8 A;  4GXB A;  3F0W A;  2AEH A;  4HAU B;  4HDQ A;  5LOP B;  2J59 M;  1WGU A;  4GPT B;  2UVM A;  3BJI A;  4YON A;  4HB3 B;  4A6K A;  5D3X A;  5IRS A;  3NWA A;  1XKE A;  5D3Y A;  5C6R A;  2J0J A;  4XWX A;  5DH9 B;  3X23 A;  1H10 A;  1QQG A;  3NWF A;  2Z0Q A;  2YSZ A;  4WVF B;  3FEH A;  1V61 A;  2DFK A;  4ZRJ A;  1EF1 A;  1X05 A;  5JLJ B;  2ROV A;  4EMO A;  2K8E A;  2DHI A;  1TJ6 A;  3D8D A;  2I5C A;  1UEF A;  5KQ4 A;  2CRF A;  2UZR A;  1ZVR A;  2YT0 A;  1U29 A;  1GC7 A;  4IAP A;  4KHB B;  4CSQ A;  2YVC A;  4Z2N A;  2D9Z A;  2YS5 A;  3UZT A;  2M38 A;  2COD A;  2Q13 A;  2COF A;  5C16 A;  2I1K A;  4HAV B;  1SHC A;  4L6E A;  2Z0O A;  4HHV A;  5HE1 A;  1H4R A;  3TW1 A;  1XD4 A;  3SUZ A;  2GCL A;  1UPQ A;  2UZS A;  3AU4 A;  1E5W A;  4GZU A;  4HDO A;  1WJM A;  1LB1 A;  1LW3 A;  3GYP A;  2HTH B;  5EFX A;  2RLO A;  2ZKM X;  3FSS A;  1RJ2 A;  2RGN B;  5JP4 A;  2ZPY A;  2J0M A;  1ZSQ A;  1M7E A;  1FOE A;  1WVH A;  2M14 A;  3SNH A;  2DHJ A; 
#chains in the Genus database with same CATH homology
 1V5P A;  4GMX B;  1OQN A;  4K81 A;  4D0N B;  5KCV A;  2GCJ A;  4MY6 A;  1K5G B;  2D4Q A;  4PNK A;  5J3Y A;  3G9W A;  4DXA B;  2Z0P A;  4KVG B;  1NU2 A;  1DBH A;  5FI0 A;  3PVU A;  2QKL A;  2G35 A;  1W1D A;  4K17 A;  4DBB A;  1J0W A;  2HE7 A;  2P8V A;  1XCG A;  5JHG A;  2Y8G A;  5J3T A;  2VKI A;  2CY4 A;  2R0D A;  4NSW A;  2VRW B;  2D10 A;  3F5R A;  4K2O A;  1NTV A;  3TVV A;  2K2J A;  4HB2 B;  1TXD A;  2LKO A;  1M7R A;  3HW2 B;  1UNQ A;  3PSC A;  1RRP B;  4IOY X;  2YRY A;  4F7U P;  1KZ7 A;  4Z2M B;  1KZG A;  5LON B;  1Z87 A;  1X86 A;  1UNP A;  3HK0 A;  3P6A A;  3DXC A;  4HAX B;  1J19 A;  1U5E A;  2GJY A;  1BTN A;  1V5M A;  5JHH A;  2YS1 A;  2VSZ A;  2Y7B A;  2D9Y A;  5C79 A;  1QC6 A;  2EMS A;  5L81 A;  4WSF A;  2AL6 A;  1WGQ A;  2QKM A;  1ZC4 B;  2J0K A;  4MT7 A;  2XQN M;  3PG7 A;  1GG3 A;  2D11 A;  1PFJ A;  2D9V A;  3O96 A;  4A6F A;  4EJN A;  2V76 A;  3VOQ A;  1FB8 A;  4CHM A;  2LG1 A;  1KI1 B;  2LOZ A;  4HAY B;  3DXD A;  2DX5 A;  1WG7 A;  4H8S A;  3TO1 A;  3SO6 A;  4ZRK A;  5DHF B;  1Y5O A;  2H7D A;  2ELA A;  4KAX B;  1MIX A;  2L2I A;  1DDM A;  5CLQ B;  3WYF B;  1AWE A;  3QBV B;  2FJL A;  2KUP A;  2OQB A;  3PEG A;  4A6H A;  3GYO A;  2DHK A;  4GMV A;  4K2P A;  1U5G A;  3ULB A;  2EC1 A;  1X11 A;  3BIN A;  4HAZ B;  1MK9 B;  3PZD A;  5D3V A;  4B6H A;  2PZ1 A;  1FGZ A;  2K00 A;  3AU5 A;  5DIF B;  1WJ1 A;  4GN1 A;  1I2H A;  2N0Y A;  2ROZ B;  2W2X C;  3IVF A;  4BBK A;  1N3H A;  3PVL A;  2ADZ A;  1DDW A;  5GOW B;  2D2Q A;  3QWM A;  1FHO A;  2CY5 A;  4HAW B;  3ULC A;  1W1G A;  1PLS A;  2LUL A;  5C5B A;  3HQC A;  1TQZ A;  1FGY A;  1XR0 B;  4HAT B;  5D27 A;  1DYN A;  1P3R A;  2I1J A;  3QIJ A;  3SYX A;  2OTX A;  1I7A A;  4YL8 A;  4A6F B;  2NZ8 B;  5J3Q A;  1BTK A;  3MDB C;  2COA A;  4Y94 A;  1DRO A;  2X18 A;  3ML4 A;  1Q67 A;  4F7H A;  1BWN A;  3TCA A;  3P7Z A;  1MPH A;  1NI2 A;  3KRX A;  2ELB A;  2LOX A;  2JP2 A;  2MFQ A;  3CIK A;  3ODO A;  3OAN A;  2RNR B;  1ZC3 B;  4WJ7 A;  1B55 A;  1MKE A;  1DDV A;  4EKU A;  2IYB A;  1NTY A;  1EAZ A;  5HE3 A;  2DN6 A;  4A5K A;  4C0A A;  1V89 A;  3KSY A;  2RUK B;  4IFS A;  2YT1 A;  3U7D A;  2R09 A;  4DX8 A;  1GC6 A;  1V88 A;  2EMT A;  3AJ4 A;  3DXE A;  3ODX A;  1XOD A;  1FAO A;  3ODW A;  1OMW A;  2N23 A;  4NY0 A;  1V5U A;  2NMB A;  1U2B A;  3V5W A;  2RVB B;  1FHX A;  1WI1 A;  1U27 A;  5DHA B;  1U5D A;  2LYD A;  1MIZ B;  1UPR A;  2P0D A;  2P0F A;  1BAK A;  4TKN A;  5FI1 A;  3PP2 A;  3D8F A;  1X1G A;  3A8Q A;  3NSU A;  3PVW A;  3KY9 A;  2DYN A;  2MKR A;  2CAY A;  5C5B B;  1ISN A;  2P0H A;  2YS3 A;  2RSG A;  2Y8F A;  2I5F A;  3LJU X;  4CYE A;  1SGH A;  3VIA A;  3M1I B;  4HB4 B;  1P6S A;  3T06 A;  2D9X A;  3KZ1 A;  4ZRI A;  1K5D B;  4PQ0 A;  1AQC A;  1MK7 B;  1MAI A;  2DTC A;  5D3W A;  2W2X D;  3D8E A;  3ZDT A;  4CHJ A;  4KHA A;  1EVH A;  2W2W A;  1XX0 A;  1X1F A;  4P7I A;  2GS0 A;  3FM8 C;  3RCP A;  1PMS A;  1ZM0 A;  1IRS A;  4MK0 A;  2COC A;  4TYZ A;  1FHW A;  2DKQ A;  3CXB B;  4F7G A;  1Y19 B;  3U8Z A;  2MWN B;  4KHO A;  2H7E A;  2DX1 A;  2KGX B;  5CLL B;  5KQ1 A;  5HE2 A;  2IFS A;  1EGX A;  5DI9 B;  3N7C A;  3A98 B;  3TFM A;  2DYQ A;  1U5F A;  2KCJ A;  2DA0 A;  3A8P A;  2E2X A;  5HE0 A;  1P5T A;  2DKP A;  1UNR A;  3KRW A;  2MDX A;  2BCJ A;  2DLW A;  1OY2 A;  4HB0 B;  1W1H A;  2YF0 A;  2D9W A;  3ZVR A;  4DX9 0;  3MPX A;  2K2U A;  3SV1 A;  3WA0 A;  2L1C A;  2EJ8 A;  4GXB A;  3F0W A;  2AEH A;  4HAU B;  4HDQ A;  5LOP B;  2J59 M;  1WGU A;  4GPT B;  2UVM A;  3BJI A;  4YON A;  4HB3 B;  4A6K A;  5D3X A;  1XKE A;  5D3Y A;  5C6R A;  2J0J A;  4XWX A;  5DH9 B;  3X23 A;  1H10 A;  1QQG A;  2Z0Q A;  2YSZ A;  4WVF B;  3FEH A;  1V61 A;  2DFK A;  4ZRJ A;  1EF1 A;  1X05 A;  5JLJ B;  2ROV A;  4EMO A;  2DHI A;  1TJ6 A;  3D8D A;  2I5C A;  1UEF A;  5KQ4 A;  2CRF A;  2UZR A;  1ZVR A;  2YT0 A;  1U29 A;  1GC7 A;  4IAP A;  4KHB B;  2YVC A;  4Z2N A;  2D9Z A;  2YS5 A;  3UZT A;  2M38 A;  2COD A;  2Q13 A;  2COF A;  5C16 A;  2I1K A;  4HAV B;  1SHC A;  4L6E A;  2Z0O A;  4HHV A;  5HE1 A;  1H4R A;  3TW1 A;  1XD4 A;  3SUZ A;  2GCL A;  1UPQ A;  2UZS A;  3AU4 A;  1E5W A;  4GZU A;  4HDO A;  1WJM A;  1LB1 A;  1LW3 A;  3GYP A;  2HTH B;  5EFX A;  2RLO A;  3FSS A;  1RJ2 A;  2RGN B;  5JP4 A;  2ZPY A;  2J0M A;  1ZSQ A;  1M7E A;  1FOE A;  1WVH A;  2M14 A;  3SNH A;  2DHJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...