2MDXA

Solution structure of the human wild type fapp1-ph domain
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
108
structure length
108
Chain Sequence
GPLGSPEFMEGVLYKWTNYLTGWQPRWFVLDNGILSYYDSQDDVCKGSKGSIKMAVCEIKVHSADNTRMELIIPGEQHFYMKAVNAAERQRWLVALGSSKACLTDTRT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the human wild type FAPP1-PH domain
rcsb
source organism Homo sapiens
molecule tags Membrane protein
molecule keywords Pleckstrin homology domain-containing family A member 3
total genus 17
structure length 108
sequence length 108
ec nomenclature
pdb deposition date 2013-09-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00169 PH PH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2mdxA00
4NY0A 3DXDA 4KAXB 3SUZA 5FI0A 5HE3A 3PVUA 1ISNA 4A6FB 5JP4A 3HK0A 2N0YA 4ZRJA 3AU5A 3T06A 4GZUA 5DHAB 3SYXA 2E2XA 1TXDA 1AQCA 1ZM0A 1NTYA 1KZ7A 1GG3A 3TFMA 1X05A 2J59M 4MT7A 5D27A 2ADZA 2HTHB 2I1KA 5HE0A 1U5EA 2MWNB 3F5RA 4A5KA 2OTXA 2RLOA 1OQNA 2MFQA 4KHOA 4BBKA 2Q13A 2NZ8B 3U8ZA 5DHFB 4EMOA 3VOQA 1X11A 4HAUB 3PG7A 3O96A 2VKIA 4F7HA 4CYEA 3IVFA 5C79A 2AEHA 1ZSQA 2YT0A 4KVGB 1EVHA 2LYDA 3BJIA 1I2HA 1PLSA 3FEHA 4MK0A 4Y94A 1FAOA 3FM8C 1TQZA 1WVHA 2P0HA 2N23A 3WYFB 1FHWA 1U5FA 3P6AA 2UZRA 2J0MA 2COCA 3MDBC 1NI2A 4GPTB 5C16A 4F7GA 2K00A 3KSYA 3ODOA 3ODXA 1Y19B 4HDOA 3SNHA 3GYPA 1P5TA 2FJLA 1FGZA 2DYQA 1Q67A 1N3HA 3SV1A 4HB3B 4K17A 3DXEA 2LOXA 3CIKA 1LW3A 5LONB 1V89A 4GMVA 1M7RA 1V61A 2H7DA 3NSUA 3PVWA 3A8QA 5D3XA 1FB8A 4MY6A 1W1GA 5J3QA 5J3TA 1KZGA 1EF1A 4GMXB 2BCJA 1W1DA 2CODA 5L81A 1V88A 1RRPB 2LKOA 5HE1A 1J19A 3AJ4A 5DIFB 3TVVA 3TW1A 1V5PA 1XODA 3GYOA 2CY5A 1XR0B 2KCJA 4H8SA 4D0NB 5DH9B 1KI1B 4HDQA 4A6FA 2ELBA 4TYZA 4ZRIA 3V5WA 1U27A 1DDMA 2DX1A 2Y8GA 3TO1A 4EJNA 1FOEA 2DYNA 1GC7A 1TJ6A 2GCLA 2NMBA 2Z0OA 3ODWA 3D8DA 3LJUX 2KUPA 2KGXB 5KCVA 1PFJA 2CRFA 2OQBA 3CXBB 1J0WA 3HQCA 2IYBA 2D2QA 1K5DB 1UNRA 2W2XD 2DLWA 5EFXA 3RCPA 2DKPA 1XD4A 2W2WA 2Y7BA 4HAVB 2QKLA 4ZRKA 3OANA 3HW2B 4GN1A 4WVFB 1OMWA 1E5WA 4Z2NA 2ZPYA 2RNRB 5GOWB 1M7EA 2DFKA 3TCAA 4DX8A 2RUKB 2Z0QA 2M38A 1MPHA 2D9YA 2MDXA 2DA0A 5C5BB 1WJMA 1U2BA 3AU4A 1B55A 1UEFA 1BWNA 2L1CA 2P0DA 2YS1A 4HAZB 2R0DA 4A6HA 2YS3A 2ELAA 2Z0PA 3KRXA 2MKRA 4K81A 4XWXA 1W1HA 1FHOA 4HB0B 3UZTA 1SHCA 3M1IB 1AWEA 1ZC3B 2G35A 4Z2MB 2YRYA 2DHKA 1MK9B 1H10A 1DDVA 1ZC4B 2XQNM 5KQ4A 2EMTA 1U5DA 2UVMA 3PVLA 4WJ7A 4DXAB 1MIZB 3FSSA 3A98B 1DDWA 4IFSA 1WJ1A 3PSCA 1WI1A 2L2IA 4B6HA 2R09A 2DKQA 4YL8A 5LOPB 1XX0A 1MIXA 3D8FA 4L6EA 4GXBA 4HB4B 1Y5OA 4CHMA 2DHIA 2CY4A 5C5BA 1XCGA 4DBBA 3PEGA 2UZSA 3P7ZA 3ZVRA 1WG7A 1BTKA 1IRSA 4HATB 4HHVA 1DBHA 1NU2A 3A8PA 5FI1A 1MAIA 3KRWA 2V76A 1QQGA 2J0JA 1X86A 2COAA 4IOYX 1SGHA 3DXCA 2RVBB 3BINA 1U29A 2HE7A 3D8EA 4HAWB 1I7AA 1EGXA 5JHHA 5HE2A 2PZ1A 4F7UP 4DX90 1P3RA 2DTCA 3WA0A 3N7CA 3ULBA 3ML4A 2I1JA 1UNQA 2LULA 4K2OA 4IAPA 2D9XA 4A6KA 2YSZA 2D11A 2J0KA 1WGUA 1UPQA 2RGNB 4HAYB 2YVCA 2YS5A 2D4QA 1GC6A 4K2PA 4WSFA 1ZVRA 2P0FA 2CAYA 5JLJB 3VIAA 1BTNA 1U5GA 1PMSA 3U7DA 1LB1A 1OY2A 4P7IA 2LOZA 2D9ZA 1DYNA 1FGYA 3ZDTA 2H7EA 5D3YA 2ROVA 2X18A 5J3YA 2AL6A 3QIJA 1K5GB 5JHGA 3QBVB 2DN6A 2D9WA 1MK7B 3KY9A 1UNPA 2M14A 3SO6A 2EC1A 3PP2A 4TKNA 3X23A 3KZ1A 2GCJA 2VSZA 2P8VA 2EJ8A 2EMSA 4KHAA 2RSGA 1H4RA 2YF0A 3F0WA 2QKMA 2DHJA 2DX5A 5KQ1A 4PQ0A 4EKUA 4HB2B 2COFA 2VRWB 1V5UA 2I5CA 1NTVA 2K2JA 3PZDA 2D10A 1WGQA 4YONA 2YT1A 5C6RA 2JP2A 1XKEA 1X1GA 2D9VA 5CLQB 1QC6A 4C0AA 5DI9B 2I5FA 1X1FA 3QWMA 5CLLB 4CHJA 2IFSA 4PNKA 3ULCA 1DROA 1V5MA 2GS0A 1FHXA 1P6SA 2ROZB 2W2XC 3MPXA 4NSWA 1UPRA 2GJYA 5D3WA 1EAZA 1MKEA 2K2UA 4KHBB 2Y8FA 1RJ2A 4HAXB 2LG1A 1BAKA 5D3VA 3G9WA 1Z87A
chains in the Genus database with same CATH superfamily
4NY0A 3DXDA 4KAXB 3SUZA 5FI0A 5HE3A 3PVUA 1ISNA 4A6FB 5JP4A 3HK0A 3HSAA 4QXAB 2N0YA 4ZRJA 3AU5A 5IRSA 3T06A 4GZUA 5DHAB 3SYXA 2KIGA 2E2XA 1TXDA 1AQCA 1ZM0A 1NTYA 1KZ7A 1GG3A 3TFMA 1X05A 2J59M 4MT7A 5D27A 2ADZA 2HTHB 2I1KA 5HE0A 1U5EA 2MWNB 3F5RA 4A5KA 2OTXA 2RLOA 1OQNA 2MFQA 4KHOA 4BBKA 2Q13A 2NZ8B 3U8ZA 5DHFB 4QJ4B 4EMOA 3VOQA 3OHMB 1X11A 4HAUB 3PG7A 3O96A 2VKIA 4F7HA 4CYEA 3IVFA 5C79A 2GUMA 2AEHA 1ZSQA 2YT0A 2ZKMX 1EVHA 4KVGB 2LYDA 3BJIA 1I2HA 1PLSA 3U12A 1MI1A 3FEHA 3NWAA 4MK0A 4Y94A 1FAOA 3FM8C 1TQZA 1WVHA 2P0HA 2N23A 3WYFB 1FHWA 1U5FA 3P6AA 2UZRA 2J0MA 2COCA 3MDBC 1NI2A 2YT2A 4GPTB 4GOUA 5C16A 4F7GA 2K00A 3KSYA 3ODOA 3ODXA 1Y19B 4HDOA 3SNHA 3A58A 3GYPA 1P5TA 2FJLA 1FGZA 2DYQA 1Q67A 1N3HA 3SV1A 2NBVA 4HB3B 4K17A 3DXEA 2LOXA 3CIKA 1LW3A 5LONB 1V89A 1M7RA 1V61A 4GMVA 2H7DA 3NSUA 3PVWA 3A8QA 5D3XA 1FB8A 4MY6A 1W1GA 5J3QA 5J3TA 1KZGA 1EF1A 4GMXB 2BCJA 1W1DA 2CODA 5L81A 1V88A 1RRPB 2LKOA 5HE1A 1J19A 3AJ4A 5DIFB 3TVVA 3TW1A 1V5PA 1XODA 3GYOA 2CY5A 1XR0B 2KCJA 4H8SA 4D0NB 5DH9B 4D6WA 1KI1B 4HDQA 3NWDA 4A6FA 2ELBA 4TYZA 4ZRIA 3V5WA 1U27A 1DDMA 5M4YB 2DX1A 2Y8GA 3TO1A 4EJNA 1FOEA 2DYNA 1GC7A 1TJ6A 2GCLA 2NMBA 2Z0OA 3ODWA 1T77A 3D8DA 3LJUX 2KUPA 2KGXB 3NW8A 5KCVA 1PFJA 2CRFA 2OQBA 3CXBB 1J0WA 2R2YA 4DIXA 3HQCA 2IYBA 2D2QA 1K5DB 2K49A 1UNRA 2W2XD 2DLWA 5EFXA 3RCPA 2DKPA 1XD4A 2W2WA 2FJUB 2Y7BA 4HAVB 2QKLA 4ZRKA 3OANA 3HW2B 4GN1A 4WVFB 1OMWA 1E5WA 4Z2NA 2ZPYA 2RNRB 5GOWB 1M7EA 2DFKA 3TCAA 4DX8A 2RUKB 2Z0QA 2M38A 1MPHA 2D9YA 2MDXA 2DA0A 5C5BB 1WJMA 1U2BA 3AU4A 3DCXA 1B55A 1UEFA 1BWNA 2L1CA 2P0DA 2YS1A 4HAZB 2R0DA 4A6HA 2YS3A 2ELAA 2Z59A 2Z0PA 3KRXA 2MKRA 4K81A 4XWXA 1W1HA 1FHOA 4HB0B 4CSQA 3UZTA 1SHCA 3M1IB 1AWEA 1ZC3B 2G35A 4Z2MB 4HSIA 2YRYA 2DHKA 1MK9B 1H10A 1DDVA 1ZC4B 2XQNM 5KQ4A 2EMTA 1U5DA 2UVMA 3PVLA 4WJ7A 4DXAB 1MIZB 3FSSA 3A98B 1DDWA 4IFSA 1WJ1A 2KUQA 3PSCA 1WI1A 2L2IA 4B6HA 2R09A 2DKQA 4YL8A 5LOPB 1XX0A 1MIXA 3D8FA 4L6EA 4GXBA 4HB4B 1Y5OA 4CHMA 5I2SA 4L1RA 2DHIA 2CY4A 5C5BA 1XCGA 4DBBA 3PEGA 2UZSA 3P7ZA 3ZVRA 1WG7A 2KR0A 1BTKA 1IRSA 4HATB 4GNKB 4HHVA 1DBHA 1NU2A 3A8PA 5FI1A 1ZYIA 1MAIA 2RRFA 3KRWA 2V76A 1QQGA 2J0JA 1X86A 2COAA 4IOYX 1SGHA 3DXCA 2RVBB 3BINA 1U29A 2HE7A 3D8EA 4HAWB 1I7AA 1EGXA 5JHHA 5HE2A 2PZ1A 4F7UP 4DX90 1P3RA 2DTCA 3WA0A 3N7CA 3FVCA 3ULBA 3ML4A 2I1JA 1UNQA 2LULA 4K2OA 4IAPA 2D9XA 4A6KA 2KIEA 2YSZA 2D11A 2J0KA 1WGUA 1UPQA 3B77A 2RGNB 4HAYB 2YVCA 2YS5A 2D4QA 4QJ3B 1GC6A 4K2PA 4WSFA 1ZVRA 2P0FA 2CAYA 5JLJB 3VIAA 1BTNA 1U5GA 5I2MA 1PMSA 3U7DA 1LB1A 1OY2A 4P7IA 5LG4B 2LOZA 2D9ZA 1DYNA 1FGYA 3ZDTA 2H7EA 5D3YA 4OT1A 2ROVA 2X18A 5J3YA 2AL6A 3QIJA 4QJ5B 1K5GB 5JHGA 3QBVB 2DN6A 2D9WA 1MK7B 3KY9A 1UNPA 2M14A 3SO6A 2EC1A 2K8EA 3PP2A 4TKNA 3X23A 3KZ1A 2GCJA 2VSZA 2P8VA 2EJ8A 2EMSA 4KHAA 2RSGA 3HIEA 1H4RA 3NWFA 2YF0A 3F0WA 2QKMA 2DHJA 2DX5A 5KQ1A 4PQ0A 4EKUA 4HB2B 2COFA 4OSNA 2VRWB 1V5UA 2I5CA 1NTVA 2K2JA 2Z13A 3PZDA 2D10A 1WGQA 4YONA 2YT1A 5C6RA 2JP2A 4KHBA 1XKEA 1X1GA 2D9VA 5CLQB 1QC6A 4C0AA 5DI9B 2I5FA 1X1FA 3QWMA 5CLLB 4CHJA 2IFSA 4PNKA 3ULCA 1DROA 1V5MA 2GS0A 1FHXA 1P6SA 2ROZB 2W2XC 2Z4DA 3MPXA 4NSWA 1UPRA 2GJYA 5D3WA 1EAZA 1MKEA 2K2UA 4KHBB 2Y8FA 2Z14A 1RJ2A 4HAXB 2LG1A 1BAKA 5D3VA 3G9WA 1Z87A
chains in the Genus database with same CATH topology
4NY0A 3DXDA 4KAXB 3SUZA 5FI0A 5HE3A 3PVUA 1ISNA 4A6FB 5JP4A 3HK0A 2N0YA 4ZRJA 3AU5A 3T06A 4GZUA 5DHAB 3SYXA 2E2XA 1TXDA 1AQCA 1ZM0A 1NTYA 1KZ7A 1GG3A 3TFMA 1X05A 2J59M 4MT7A 5D27A 2ADZA 2HTHB 2I1KA 5HE0A 1U5EA 2MWNB 3F5RA 4A5KA 2OTXA 2RLOA 1OQNA 2MFQA 4KHOA 4BBKA 2Q13A 2NZ8B 3U8ZA 5DHFB 4EMOA 3VOQA 1X11A 4HAUB 3PG7A 3O96A 2VKIA 4F7HA 4CYEA 3IVFA 5C79A 2AEHA 1ZSQA 2YT0A 4KVGB 1EVHA 2LYDA 3BJIA 1I2HA 1PLSA 3FEHA 4MK0A 4Y94A 1FAOA 3FM8C 1TQZA 1WVHA 2P0HA 2N23A 3WYFB 1FHWA 1U5FA 3P6AA 2UZRA 2J0MA 2COCA 3MDBC 1NI2A 4GPTB 5C16A 4F7GA 2K00A 3KSYA 3ODOA 3ODXA 1Y19B 4HDOA 3SNHA 3GYPA 1P5TA 2FJLA 1FGZA 2DYQA 1Q67A 1N3HA 3SV1A 4HB3B 4K17A 3DXEA 2LOXA 3CIKA 1LW3A 5LONB 1V89A 4GMVA 1M7RA 1V61A 2H7DA 3NSUA 3PVWA 3A8QA 5D3XA 1FB8A 4MY6A 1W1GA 5J3QA 5J3TA 1KZGA 1EF1A 4GMXB 2BCJA 1W1DA 2CODA 5L81A 1V88A 1RRPB 2LKOA 5HE1A 1J19A 3AJ4A 5DIFB 3TVVA 3TW1A 1V5PA 1XODA 3GYOA 2CY5A 1XR0B 2KCJA 4H8SA 4D0NB 5DH9B 1KI1B 4HDQA 4A6FA 2ELBA 4TYZA 4ZRIA 3V5WA 1U27A 1DDMA 2DX1A 2Y8GA 3TO1A 4EJNA 1FOEA 2DYNA 1GC7A 1TJ6A 2GCLA 2NMBA 2Z0OA 3ODWA 3D8DA 3LJUX 2KUPA 2KGXB 5KCVA 1PFJA 2CRFA 2OQBA 3CXBB 1J0WA 3HQCA 2IYBA 2D2QA 1K5DB 1UNRA 2W2XD 2DLWA 5EFXA 3RCPA 2DKPA 1XD4A 2W2WA 2Y7BA 4HAVB 2QKLA 4ZRKA 3OANA 3HW2B 4GN1A 4WVFB 1OMWA 1E5WA 4Z2NA 2ZPYA 2RNRB 5GOWB 1M7EA 2DFKA 3TCAA 4DX8A 2RUKB 2Z0QA 2M38A 1MPHA 2D9YA 2MDXA 2DA0A 5C5BB 1WJMA 1U2BA 3AU4A 1B55A 1UEFA 1BWNA 2L1CA 2P0DA 2YS1A 4HAZB 2R0DA 4A6HA 2YS3A 2ELAA 2Z0PA 3KRXA 2MKRA 4K81A 4XWXA 1W1HA 1FHOA 4HB0B 3UZTA 1SHCA 3M1IB 1AWEA 1ZC3B 2G35A 4Z2MB 2YRYA 2DHKA 1MK9B 1H10A 1DDVA 1ZC4B 2XQNM 5KQ4A 2EMTA 1U5DA 2UVMA 3PVLA 4WJ7A 4DXAB 1MIZB 3FSSA 3A98B 1DDWA 4IFSA 1WJ1A 3PSCA 1WI1A 2L2IA 4B6HA 2R09A 2DKQA 4YL8A 5LOPB 1XX0A 1MIXA 3D8FA 4L6EA 4GXBA 4HB4B 1Y5OA 4CHMA 2DHIA 2CY4A 5C5BA 1XCGA 4DBBA 3PEGA 2UZSA 3P7ZA 3ZVRA 1WG7A 1BTKA 1IRSA 4HATB 4HHVA 1DBHA 1NU2A 3A8PA 5FI1A 1MAIA 3KRWA 2V76A 1QQGA 2J0JA 1X86A 2COAA 4IOYX 1SGHA 3DXCA 2RVBB 3BINA 1U29A 2HE7A 3D8EA 4HAWB 1I7AA 1EGXA 5JHHA 5HE2A 2PZ1A 4F7UP 4DX90 1P3RA 2DTCA 3WA0A 3N7CA 3ULBA 3ML4A 2I1JA 1UNQA 2LULA 4K2OA 4IAPA 2D9XA 4A6KA 2YSZA 2D11A 2J0KA 1WGUA 1UPQA 2RGNB 4HAYB 2YVCA 2YS5A 2D4QA 1GC6A 4K2PA 4WSFA 1ZVRA 2P0FA 2CAYA 5JLJB 3VIAA 1BTNA 1U5GA 1PMSA 3U7DA 1LB1A 1OY2A 4P7IA 2LOZA 2D9ZA 1DYNA 1FGYA 3ZDTA 2H7EA 5D3YA 2ROVA 2X18A 5J3YA 2AL6A 3QIJA 1K5GB 5JHGA 3QBVB 2DN6A 2D9WA 1MK7B 3KY9A 1UNPA 2M14A 3SO6A 2EC1A 3PP2A 4TKNA 3X23A 3KZ1A 2GCJA 2VSZA 2P8VA 2EJ8A 2EMSA 4KHAA 2RSGA 1H4RA 2YF0A 3F0WA 2QKMA 2DHJA 2DX5A 5KQ1A 4PQ0A 4EKUA 4HB2B 2COFA 2VRWB 1V5UA 2I5CA 1NTVA 2K2JA 3PZDA 2D10A 1WGQA 4YONA 2YT1A 5C6RA 2JP2A 1XKEA 1X1GA 2D9VA 5CLQB 1QC6A 4C0AA 5DI9B 2I5FA 1X1FA 3QWMA 5CLLB 4CHJA 2IFSA 4PNKA 3ULCA 1DROA 1V5MA 2GS0A 1FHXA 1P6SA 2ROZB 2W2XC 3MPXA 4NSWA 1UPRA 2GJYA 5D3WA 1EAZA 1MKEA 2K2UA 4KHBB 2Y8FA 1RJ2A 4HAXB 2LG1A 1BAKA 5D3VA 3G9WA 1Z87A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NY0 A;  3DXD A;  4KAX B;  3SUZ A;  5FI0 A;  5HE3 A;  3PVU A;  1ISN A;  4A6F B;  5JP4 A;  3HK0 A;  2N0Y A;  4ZRJ A;  3AU5 A;  3T06 A;  4GZU A;  5DHA B;  3SYX A;  2E2X A;  1TXD A;  1AQC A;  1ZM0 A;  1NTY A;  1KZ7 A;  1GG3 A;  3TFM A;  1X05 A;  2J59 M;  4MT7 A;  5D27 A;  2ADZ A;  2HTH B;  2I1K A;  5HE0 A;  1U5E A;  2MWN B;  3F5R A;  4A5K A;  2OTX A;  2RLO A;  1OQN A;  2MFQ A;  4KHO A;  4BBK A;  2Q13 A;  2NZ8 B;  3U8Z A;  5DHF B;  4EMO A;  3VOQ A;  1X11 A;  4HAU B;  3PG7 A;  3O96 A;  2VKI A;  4F7H A;  4CYE A;  3IVF A;  5C79 A;  2AEH A;  1ZSQ A;  2YT0 A;  4KVG B;  1EVH A;  2LYD A;  3BJI A;  1I2H A;  1PLS A;  3FEH A;  4MK0 A;  4Y94 A;  1FAO A;  3FM8 C;  1TQZ A;  1WVH A;  2P0H A;  2N23 A;  3WYF B;  1FHW A;  1U5F A;  3P6A A;  2UZR A;  2J0M A;  2COC A;  3MDB C;  1NI2 A;  4GPT B;  5C16 A;  4F7G A;  2K00 A;  3KSY A;  3ODO A;  3ODX A;  1Y19 B;  4HDO A;  3SNH A;  3GYP A;  1P5T A;  2FJL A;  1FGZ A;  2DYQ A;  1Q67 A;  1N3H A;  3SV1 A;  4HB3 B;  4K17 A;  3DXE A;  2LOX A;  3CIK A;  1LW3 A;  5LON B;  1V89 A;  4GMV A;  1M7R A;  1V61 A;  2H7D A;  3NSU A;  3PVW A;  3A8Q A;  5D3X A;  1FB8 A;  4MY6 A;  1W1G A;  5J3Q A;  5J3T A;  1KZG A;  1EF1 A;  4GMX B;  2BCJ A;  1W1D A;  2COD A;  5L81 A;  1V88 A;  1RRP B;  2LKO A;  5HE1 A;  1J19 A;  3AJ4 A;  5DIF B;  3TVV A;  3TW1 A;  1V5P A;  1XOD A;  3GYO A;  2CY5 A;  1XR0 B;  2KCJ A;  4H8S A;  4D0N B;  5DH9 B;  1KI1 B;  4HDQ A;  4A6F A;  2ELB A;  4TYZ A;  4ZRI A;  3V5W A;  1U27 A;  1DDM A;  2DX1 A;  2Y8G A;  3TO1 A;  4EJN A;  1FOE A;  2DYN A;  1GC7 A;  1TJ6 A;  2GCL A;  2NMB A;  2Z0O A;  3ODW A;  3D8D A;  3LJU X;  2KUP A;  2KGX B;  5KCV A;  1PFJ A;  2CRF A;  2OQB A;  3CXB B;  1J0W A;  3HQC A;  2IYB A;  2D2Q A;  1K5D B;  1UNR A;  2W2X D;  2DLW A;  5EFX A;  3RCP A;  2DKP A;  1XD4 A;  2W2W A;  2Y7B A;  4HAV B;  2QKL A;  4ZRK A;  3OAN A;  3HW2 B;  4GN1 A;  4WVF B;  1OMW A;  1E5W A;  4Z2N A;  2ZPY A;  2RNR B;  5GOW B;  1M7E A;  2DFK A;  3TCA A;  4DX8 A;  2RUK B;  2Z0Q A;  2M38 A;  1MPH A;  2D9Y A;  2MDX A;  2DA0 A;  5C5B B;  1WJM A;  1U2B A;  3AU4 A;  1B55 A;  1UEF A;  1BWN A;  2L1C A;  2P0D A;  2YS1 A;  4HAZ B;  2R0D A;  4A6H A;  2YS3 A;  2ELA A;  2Z0P A;  3KRX A;  2MKR A;  4K81 A;  4XWX A;  1W1H A;  1FHO A;  4HB0 B;  3UZT A;  1SHC A;  3M1I B;  1AWE A;  1ZC3 B;  2G35 A;  4Z2M B;  2YRY A;  2DHK A;  1MK9 B;  1H10 A;  1DDV A;  1ZC4 B;  2XQN M;  5KQ4 A;  2EMT A;  1U5D A;  2UVM A;  3PVL A;  4WJ7 A;  4DXA B;  1MIZ B;  3FSS A;  3A98 B;  1DDW A;  4IFS A;  1WJ1 A;  3PSC A;  1WI1 A;  2L2I A;  4B6H A;  2R09 A;  2DKQ A;  4YL8 A;  5LOP B;  1XX0 A;  1MIX A;  3D8F A;  4L6E A;  4GXB A;  4HB4 B;  1Y5O A;  4CHM A;  2DHI A;  2CY4 A;  5C5B A;  1XCG A;  4DBB A;  3PEG A;  2UZS A;  3P7Z A;  3ZVR A;  1WG7 A;  1BTK A;  1IRS A;  4HAT B;  4HHV A;  1DBH A;  1NU2 A;  3A8P A;  5FI1 A;  1MAI A;  3KRW A;  2V76 A;  1QQG A;  2J0J A;  1X86 A;  2COA A;  4IOY X;  1SGH A;  3DXC A;  2RVB B;  3BIN A;  1U29 A;  2HE7 A;  3D8E A;  4HAW B;  1I7A A;  1EGX A;  5JHH A;  5HE2 A;  2PZ1 A;  4F7U P;  4DX9 0;  1P3R A;  2DTC A;  3WA0 A;  3N7C A;  3ULB A;  3ML4 A;  2I1J A;  1UNQ A;  2LUL A;  4K2O A;  4IAP A;  2D9X A;  4A6K A;  2YSZ A;  2D11 A;  2J0K A;  1WGU A;  1UPQ A;  2RGN B;  4HAY B;  2YVC A;  2YS5 A;  2D4Q A;  1GC6 A;  4K2P A;  4WSF A;  1ZVR A;  2P0F A;  2CAY A;  5JLJ B;  3VIA A;  1BTN A;  1U5G A;  1PMS A;  3U7D A;  1LB1 A;  1OY2 A;  4P7I A;  2LOZ A;  2D9Z A;  1DYN A;  1FGY A;  3ZDT A;  2H7E A;  5D3Y A;  2ROV A;  2X18 A;  5J3Y A;  2AL6 A;  3QIJ A;  1K5G B;  5JHG A;  3QBV B;  2DN6 A;  2D9W A;  1MK7 B;  3KY9 A;  1UNP A;  2M14 A;  3SO6 A;  2EC1 A;  3PP2 A;  4TKN A;  3X23 A;  3KZ1 A;  2GCJ A;  2VSZ A;  2P8V A;  2EJ8 A;  2EMS A;  4KHA A;  2RSG A;  1H4R A;  2YF0 A;  3F0W A;  2QKM A;  2DHJ A;  2DX5 A;  5KQ1 A;  4PQ0 A;  4EKU A;  4HB2 B;  2COF A;  2VRW B;  1V5U A;  2I5C A;  1NTV A;  2K2J A;  3PZD A;  2D10 A;  1WGQ A;  4YON A;  2YT1 A;  5C6R A;  2JP2 A;  1XKE A;  1X1G A;  2D9V A;  5CLQ B;  1QC6 A;  4C0A A;  5DI9 B;  2I5F A;  1X1F A;  3QWM A;  5CLL B;  4CHJ A;  2IFS A;  4PNK A;  3ULC A;  1DRO A;  1V5M A;  2GS0 A;  1FHX A;  1P6S A;  2ROZ B;  2W2X C;  3MPX A;  4NSW A;  1UPR A;  2GJY A;  5D3W A;  1EAZ A;  1MKE A;  2K2U A;  4KHB B;  2Y8F A;  1RJ2 A;  4HAX B;  2LG1 A;  1BAK A;  5D3V A;  3G9W A;  1Z87 A; 
#chains in the Genus database with same CATH topology
 4NY0 A;  3DXD A;  4KAX B;  3SUZ A;  5FI0 A;  5HE3 A;  3PVU A;  1ISN A;  4A6F B;  5JP4 A;  3HK0 A;  3HSA A;  4QXA B;  2N0Y A;  4ZRJ A;  3AU5 A;  5IRS A;  3T06 A;  4GZU A;  5DHA B;  3SYX A;  2KIG A;  2E2X A;  1TXD A;  1AQC A;  1ZM0 A;  1NTY A;  1KZ7 A;  1GG3 A;  3TFM A;  1X05 A;  2J59 M;  4MT7 A;  5D27 A;  2ADZ A;  2HTH B;  2I1K A;  5HE0 A;  1U5E A;  2MWN B;  3F5R A;  4A5K A;  2OTX A;  2RLO A;  1OQN A;  2MFQ A;  4KHO A;  4BBK A;  2Q13 A;  2NZ8 B;  3U8Z A;  5DHF B;  4QJ4 B;  4EMO A;  3VOQ A;  3OHM B;  1X11 A;  4HAU B;  3PG7 A;  3O96 A;  2VKI A;  4F7H A;  4CYE A;  3IVF A;  5C79 A;  2GUM A;  2AEH A;  1ZSQ A;  2YT0 A;  2ZKM X;  1EVH A;  4KVG B;  2LYD A;  3BJI A;  1I2H A;  1PLS A;  3U12 A;  1MI1 A;  3FEH A;  3NWA A;  4MK0 A;  4Y94 A;  1FAO A;  3FM8 C;  1TQZ A;  1WVH A;  2P0H A;  2N23 A;  3WYF B;  1FHW A;  1U5F A;  3P6A A;  2UZR A;  2J0M A;  2COC A;  3MDB C;  1NI2 A;  2YT2 A;  4GPT B;  4GOU A;  5C16 A;  4F7G A;  2K00 A;  3KSY A;  3ODO A;  3ODX A;  1Y19 B;  4HDO A;  3SNH A;  3A58 A;  3GYP A;  1P5T A;  2FJL A;  1FGZ A;  2DYQ A;  1Q67 A;  1N3H A;  3SV1 A;  2NBV A;  4HB3 B;  4K17 A;  3DXE A;  2LOX A;  3CIK A;  1LW3 A;  5LON B;  1V89 A;  1M7R A;  1V61 A;  4GMV A;  2H7D A;  3NSU A;  3PVW A;  3A8Q A;  5D3X A;  1FB8 A;  4MY6 A;  1W1G A;  5J3Q A;  5J3T A;  1KZG A;  1EF1 A;  4GMX B;  2BCJ A;  1W1D A;  2COD A;  5L81 A;  1V88 A;  1RRP B;  2LKO A;  5HE1 A;  1J19 A;  3AJ4 A;  5DIF B;  3TVV A;  3TW1 A;  1V5P A;  1XOD A;  3GYO A;  2CY5 A;  1XR0 B;  2KCJ A;  4H8S A;  4D0N B;  5DH9 B;  4D6W A;  1KI1 B;  4HDQ A;  3NWD A;  4A6F A;  2ELB A;  4TYZ A;  4ZRI A;  3V5W A;  1U27 A;  1DDM A;  5M4Y B;  2DX1 A;  2Y8G A;  3TO1 A;  4EJN A;  1FOE A;  2DYN A;  1GC7 A;  1TJ6 A;  2GCL A;  2NMB A;  2Z0O A;  3ODW A;  1T77 A;  3D8D A;  3LJU X;  2KUP A;  2KGX B;  3NW8 A;  5KCV A;  1PFJ A;  2CRF A;  2OQB A;  3CXB B;  1J0W A;  2R2Y A;  4DIX A;  3HQC A;  2IYB A;  2D2Q A;  1K5D B;  2K49 A;  1UNR A;  2W2X D;  2DLW A;  5EFX A;  3RCP A;  2DKP A;  1XD4 A;  2W2W A;  2FJU B;  2Y7B A;  4HAV B;  2QKL A;  4ZRK A;  3OAN A;  3HW2 B;  4GN1 A;  4WVF B;  1OMW A;  1E5W A;  4Z2N A;  2ZPY A;  2RNR B;  5GOW B;  1M7E A;  2DFK A;  3TCA A;  4DX8 A;  2RUK B;  2Z0Q A;  2M38 A;  1MPH A;  2D9Y A;  2MDX A;  2DA0 A;  5C5B B;  1WJM A;  1U2B A;  3AU4 A;  3DCX A;  1B55 A;  1UEF A;  1BWN A;  2L1C A;  2P0D A;  2YS1 A;  4HAZ B;  2R0D A;  4A6H A;  2YS3 A;  2ELA A;  2Z59 A;  2Z0P A;  3KRX A;  2MKR A;  4K81 A;  4XWX A;  1W1H A;  1FHO A;  4HB0 B;  4CSQ A;  3UZT A;  1SHC A;  3M1I B;  1AWE A;  1ZC3 B;  2G35 A;  4Z2M B;  4HSI A;  2YRY A;  2DHK A;  1MK9 B;  1H10 A;  1DDV A;  1ZC4 B;  2XQN M;  5KQ4 A;  2EMT A;  1U5D A;  2UVM A;  3PVL A;  4WJ7 A;  4DXA B;  1MIZ B;  3FSS A;  3A98 B;  1DDW A;  4IFS A;  1WJ1 A;  2KUQ A;  3PSC A;  1WI1 A;  2L2I A;  4B6H A;  2R09 A;  2DKQ A;  4YL8 A;  5LOP B;  1XX0 A;  1MIX A;  3D8F A;  4L6E A;  4GXB A;  4HB4 B;  1Y5O A;  4CHM A;  5I2S A;  4L1R A;  2DHI A;  2CY4 A;  5C5B A;  1XCG A;  4DBB A;  3PEG A;  2UZS A;  3P7Z A;  3ZVR A;  1WG7 A;  2KR0 A;  1BTK A;  1IRS A;  4HAT B;  4GNK B;  4HHV A;  1DBH A;  1NU2 A;  3A8P A;  5FI1 A;  1ZYI A;  1MAI A;  2RRF A;  3KRW A;  2V76 A;  1QQG A;  2J0J A;  1X86 A;  2COA A;  4IOY X;  1SGH A;  3DXC A;  2RVB B;  3BIN A;  1U29 A;  2HE7 A;  3D8E A;  4HAW B;  1I7A A;  1EGX A;  5JHH A;  5HE2 A;  2PZ1 A;  4F7U P;  4DX9 0;  1P3R A;  2DTC A;  3WA0 A;  3N7C A;  3FVC A;  3ULB A;  3ML4 A;  2I1J A;  1UNQ A;  2LUL A;  4K2O A;  4IAP A;  2D9X A;  4A6K A;  2KIE A;  2YSZ A;  2D11 A;  2J0K A;  1WGU A;  1UPQ A;  3B77 A;  2RGN B;  4HAY B;  2YVC A;  2YS5 A;  2D4Q A;  4QJ3 B;  1GC6 A;  4K2P A;  4WSF A;  1ZVR A;  2P0F A;  2CAY A;  5JLJ B;  3VIA A;  1BTN A;  1U5G A;  5I2M A;  1PMS A;  3U7D A;  1LB1 A;  1OY2 A;  4P7I A;  5LG4 B;  2LOZ A;  2D9Z A;  1DYN A;  1FGY A;  3ZDT A;  2H7E A;  5D3Y A;  4OT1 A;  2ROV A;  2X18 A;  5J3Y A;  2AL6 A;  3QIJ A;  4QJ5 B;  1K5G B;  5JHG A;  3QBV B;  2DN6 A;  2D9W A;  1MK7 B;  3KY9 A;  1UNP A;  2M14 A;  3SO6 A;  2EC1 A;  2K8E A;  3PP2 A;  4TKN A;  3X23 A;  3KZ1 A;  2GCJ A;  2VSZ A;  2P8V A;  2EJ8 A;  2EMS A;  4KHA A;  2RSG A;  3HIE A;  1H4R A;  3NWF A;  2YF0 A;  3F0W A;  2QKM A;  2DHJ A;  2DX5 A;  5KQ1 A;  4PQ0 A;  4EKU A;  4HB2 B;  2COF A;  4OSN A;  2VRW B;  1V5U A;  2I5C A;  1NTV A;  2K2J A;  2Z13 A;  3PZD A;  2D10 A;  1WGQ A;  4YON A;  2YT1 A;  5C6R A;  2JP2 A;  4KHB A;  1XKE A;  1X1G A;  2D9V A;  5CLQ B;  1QC6 A;  4C0A A;  5DI9 B;  2I5F A;  1X1F A;  3QWM A;  5CLL B;  4CHJ A;  2IFS A;  4PNK A;  3ULC A;  1DRO A;  1V5M A;  2GS0 A;  1FHX A;  1P6S A;  2ROZ B;  2W2X C;  2Z4D A;  3MPX A;  4NSW A;  1UPR A;  2GJY A;  5D3W A;  1EAZ A;  1MKE A;  2K2U A;  4KHB B;  2Y8F A;  2Z14 A;  1RJ2 A;  4HAX B;  2LG1 A;  1BAK A;  5D3V A;  3G9W A;  1Z87 A; 
#chains in the Genus database with same CATH homology
 4NY0 A;  3DXD A;  4KAX B;  3SUZ A;  5FI0 A;  5HE3 A;  3PVU A;  1ISN A;  4A6F B;  5JP4 A;  3HK0 A;  2N0Y A;  4ZRJ A;  3AU5 A;  3T06 A;  4GZU A;  5DHA B;  3SYX A;  2E2X A;  1TXD A;  1AQC A;  1ZM0 A;  1NTY A;  1KZ7 A;  1GG3 A;  3TFM A;  1X05 A;  2J59 M;  4MT7 A;  5D27 A;  2ADZ A;  2HTH B;  2I1K A;  5HE0 A;  1U5E A;  2MWN B;  3F5R A;  4A5K A;  2OTX A;  2RLO A;  1OQN A;  2MFQ A;  4KHO A;  4BBK A;  2Q13 A;  2NZ8 B;  3U8Z A;  5DHF B;  4EMO A;  3VOQ A;  1X11 A;  4HAU B;  3PG7 A;  3O96 A;  2VKI A;  4F7H A;  4CYE A;  3IVF A;  5C79 A;  2AEH A;  1ZSQ A;  2YT0 A;  4KVG B;  1EVH A;  2LYD A;  3BJI A;  1I2H A;  1PLS A;  3FEH A;  4MK0 A;  4Y94 A;  1FAO A;  3FM8 C;  1TQZ A;  1WVH A;  2P0H A;  2N23 A;  3WYF B;  1FHW A;  1U5F A;  3P6A A;  2UZR A;  2J0M A;  2COC A;  3MDB C;  1NI2 A;  4GPT B;  5C16 A;  4F7G A;  2K00 A;  3KSY A;  3ODO A;  3ODX A;  1Y19 B;  4HDO A;  3SNH A;  3GYP A;  1P5T A;  2FJL A;  1FGZ A;  2DYQ A;  1Q67 A;  1N3H A;  3SV1 A;  4HB3 B;  4K17 A;  3DXE A;  2LOX A;  3CIK A;  1LW3 A;  5LON B;  1V89 A;  4GMV A;  1M7R A;  1V61 A;  2H7D A;  3NSU A;  3PVW A;  3A8Q A;  5D3X A;  1FB8 A;  4MY6 A;  1W1G A;  5J3Q A;  5J3T A;  1KZG A;  1EF1 A;  4GMX B;  2BCJ A;  1W1D A;  2COD A;  5L81 A;  1V88 A;  1RRP B;  2LKO A;  5HE1 A;  1J19 A;  3AJ4 A;  5DIF B;  3TVV A;  3TW1 A;  1V5P A;  1XOD A;  3GYO A;  2CY5 A;  1XR0 B;  2KCJ A;  4H8S A;  4D0N B;  5DH9 B;  1KI1 B;  4HDQ A;  4A6F A;  2ELB A;  4TYZ A;  4ZRI A;  3V5W A;  1U27 A;  1DDM A;  2DX1 A;  2Y8G A;  3TO1 A;  4EJN A;  1FOE A;  2DYN A;  1GC7 A;  1TJ6 A;  2GCL A;  2NMB A;  2Z0O A;  3ODW A;  3D8D A;  3LJU X;  2KUP A;  2KGX B;  5KCV A;  1PFJ A;  2CRF A;  2OQB A;  3CXB B;  1J0W A;  3HQC A;  2IYB A;  2D2Q A;  1K5D B;  1UNR A;  2W2X D;  2DLW A;  5EFX A;  3RCP A;  2DKP A;  1XD4 A;  2W2W A;  2Y7B A;  4HAV B;  2QKL A;  4ZRK A;  3OAN A;  3HW2 B;  4GN1 A;  4WVF B;  1OMW A;  1E5W A;  4Z2N A;  2ZPY A;  2RNR B;  5GOW B;  1M7E A;  2DFK A;  3TCA A;  4DX8 A;  2RUK B;  2Z0Q A;  2M38 A;  1MPH A;  2D9Y A;  2MDX A;  2DA0 A;  5C5B B;  1WJM A;  1U2B A;  3AU4 A;  1B55 A;  1UEF A;  1BWN A;  2L1C A;  2P0D A;  2YS1 A;  4HAZ B;  2R0D A;  4A6H A;  2YS3 A;  2ELA A;  2Z0P A;  3KRX A;  2MKR A;  4K81 A;  4XWX A;  1W1H A;  1FHO A;  4HB0 B;  3UZT A;  1SHC A;  3M1I B;  1AWE A;  1ZC3 B;  2G35 A;  4Z2M B;  2YRY A;  2DHK A;  1MK9 B;  1H10 A;  1DDV A;  1ZC4 B;  2XQN M;  5KQ4 A;  2EMT A;  1U5D A;  2UVM A;  3PVL A;  4WJ7 A;  4DXA B;  1MIZ B;  3FSS A;  3A98 B;  1DDW A;  4IFS A;  1WJ1 A;  3PSC A;  1WI1 A;  2L2I A;  4B6H A;  2R09 A;  2DKQ A;  4YL8 A;  5LOP B;  1XX0 A;  1MIX A;  3D8F A;  4L6E A;  4GXB A;  4HB4 B;  1Y5O A;  4CHM A;  2DHI A;  2CY4 A;  5C5B A;  1XCG A;  4DBB A;  3PEG A;  2UZS A;  3P7Z A;  3ZVR A;  1WG7 A;  1BTK A;  1IRS A;  4HAT B;  4HHV A;  1DBH A;  1NU2 A;  3A8P A;  5FI1 A;  1MAI A;  3KRW A;  2V76 A;  1QQG A;  2J0J A;  1X86 A;  2COA A;  4IOY X;  1SGH A;  3DXC A;  2RVB B;  3BIN A;  1U29 A;  2HE7 A;  3D8E A;  4HAW B;  1I7A A;  1EGX A;  5JHH A;  5HE2 A;  2PZ1 A;  4F7U P;  4DX9 0;  1P3R A;  2DTC A;  3WA0 A;  3N7C A;  3ULB A;  3ML4 A;  2I1J A;  1UNQ A;  2LUL A;  4K2O A;  4IAP A;  2D9X A;  4A6K A;  2YSZ A;  2D11 A;  2J0K A;  1WGU A;  1UPQ A;  2RGN B;  4HAY B;  2YVC A;  2YS5 A;  2D4Q A;  1GC6 A;  4K2P A;  4WSF A;  1ZVR A;  2P0F A;  2CAY A;  5JLJ B;  3VIA A;  1BTN A;  1U5G A;  1PMS A;  3U7D A;  1LB1 A;  1OY2 A;  4P7I A;  2LOZ A;  2D9Z A;  1DYN A;  1FGY A;  3ZDT A;  2H7E A;  5D3Y A;  2ROV A;  2X18 A;  5J3Y A;  2AL6 A;  3QIJ A;  1K5G B;  5JHG A;  3QBV B;  2DN6 A;  2D9W A;  1MK7 B;  3KY9 A;  1UNP A;  2M14 A;  3SO6 A;  2EC1 A;  3PP2 A;  4TKN A;  3X23 A;  3KZ1 A;  2GCJ A;  2VSZ A;  2P8V A;  2EJ8 A;  2EMS A;  4KHA A;  2RSG A;  1H4R A;  2YF0 A;  3F0W A;  2QKM A;  2DHJ A;  2DX5 A;  5KQ1 A;  4PQ0 A;  4EKU A;  4HB2 B;  2COF A;  2VRW B;  1V5U A;  2I5C A;  1NTV A;  2K2J A;  3PZD A;  2D10 A;  1WGQ A;  4YON A;  2YT1 A;  5C6R A;  2JP2 A;  1XKE A;  1X1G A;  2D9V A;  5CLQ B;  1QC6 A;  4C0A A;  5DI9 B;  2I5F A;  1X1F A;  3QWM A;  5CLL B;  4CHJ A;  2IFS A;  4PNK A;  3ULC A;  1DRO A;  1V5M A;  2GS0 A;  1FHX A;  1P6S A;  2ROZ B;  2W2X C;  3MPX A;  4NSW A;  1UPR A;  2GJY A;  5D3W A;  1EAZ A;  1MKE A;  2K2U A;  4KHB B;  2Y8F A;  1RJ2 A;  4HAX B;  2LG1 A;  1BAK A;  5D3V A;  3G9W A;  1Z87 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...