2MDXA

Solution structure of the human wild type fapp1-ph domain
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
108
structure length
108
Chain Sequence
b'GPLGSPEFMEGVLYKWTNYLTGWQPRWFVLDNGILSYYDSQDDVCKGSKGSIKMAVCEIKVHSADNTRMELIIPGEQHFYMKAVNAAERQRWLVALGSSKACLTDTRT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pleckstrin homology domain-containing family A member 3
publication title Solution structure of the human wild type FAPP1-PH domain
rcsb
source organism Homo sapiens
molecule tags Membrane protein
total genus 17
structure length 108
sequence length 108
ec nomenclature
pdb deposition date 2013-09-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00169 PH PH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2mdxA00
3PSCA 1P3RA 4HHVA 4XWXA 1V88A 1UNPA 1XCGA 5CLQB 1Q67A 2M14A 2Y8GA 5DH9B 3AU4A 2J0JA 3GYPA 1V5UA 1MK9B 3FSSA 2D9YA 4DX8A 2VKIA 4K17A 2YT1A 4HAYB 2D9ZA 1RRPB 1M7EA 2YSZA 3SYXA 3N7CA 3F5RA 1MKEA 4GPTB 3TCAA 1BTNA 5D3WA 2HTHB 2AEHA 1DYNA 2H7EA 3ODOA 1Y19B 4HB2B 3A8PA 2N23A 2CY4A 1U29A 1W1HA 3TVVA 1PLSA 1KI1B 1FHWA 3BINA 5C5BA 4KHOA 3G9WA 1XKEA 5C6RA 4CYEA 4Z2MB 4TKNA 2YT0A 4HDQA 3PP2A 1BTKA 4ZRIA 3SNHA 4GZUA 2GCJA 4DXAB 3ZDTA 2NZ8B 3ZVRA 2W2WA 3DXDA 3D8EA 4F7HA 4B6HA 2BCJA 2LULA 4MT7A 2X18A 4MK0A 1K5DB 3P6AA 1FGYA 2RGNB 2W2XD 5DHAB 1LW3A 2DX5A 1U2BA 3O96A 1ZM0A 4IOYX 5HE1A 4A6KA 4GXBA 5LOPB 2YVCA 2UZRA 1RJ2A 2Z0OA 2P0HA 4DBBA 4NSWA 5J3TA 3ML4A 3SV1A 3D8FA 3KRWA 2J0KA 2GS0A 2MWNB 4WJ7A 1J19A 4ZRJA 4A6FB 4PNKA 2P0DA 1OQNA 1EGXA 2CODA 5JHGA 3AJ4A 2RSGA 3CIKA 1FGZA 3HK0A 5LONB 2R09A 2CAYA 1P5TA 1V5PA 4YL8A 5JLJB 1KZ7A 3F0WA 3A98B 1U5GA 1EVHA 3M1IB 3TW1A 2GCLA 1WJMA 2YS5A 2ROVA 2OQBA 5EFXA 1K5GB 2DA0A 3ULCA 5HE2A 3FM8C 1X05A 2MDXA 1ZSQA 2COCA 1WGUA 1Y5OA 1UPQA 3ODWA 1NTVA 2EJ8A 1BAKA 1X1GA 3IVFA 2V76A 1IRSA 4HB0B 2LYDA 2QKMA 2DKQA 5KCVA 4HATB 1TJ6A 2J59M 5C79A 2I1KA 2XQNM 4MY6A 5FI1A 2P0FA 2ZPYA 2ROZB 1H10A 3ULBA 5KQ1A 2DTCA 4ZRKA 2DKPA 2COFA 2Y8FA 2I5FA 3PVLA 4H8SA 4KHBB 2LG1A 2RVBB 3QIJA 4P7IA 5L81A 2R0DA 3CXBB 5KQ4A 1MAIA 2RUKB 3QBVB 2I1JA 2H7DA 1ZVRA 1WGQA 2LOXA 3D8DA 1I7AA 1LB1A 1XODA 2DFKA 1ZC3B 2D9XA 2VRWB 2COAA 1U5DA 2FJLA 2EC1A 2HE7A 2D4QA 3PVUA 4L6EA 2UZSA 4HB4B 2MKRA 2AL6A 3PZDA 2D10A 2RNRB 1ISNA 2L2IA 4Z2NA 4A6FA 1XR0B 1B55A 2YS3A 2YF0A 1E5WA 4GMXB 4HAUB 1DDVA 1DDMA 2IFSA 1V5MA 3ODXA 3QWMA 2DHKA 2LOZA 4EMOA 2YS1A 1OY2A 1N3HA 3HQCA 1ZC4B 5J3YA 1UNRA 4CHMA 4HAVB 3HW2B 2RLOA 4F7UP 4C0AA 3FEHA 5JP4A 2EMSA 2YRYA 2Z0QA 1OMWA 2D9WA 3P7ZA 2I5CA 4WSFA 4EKUA 1PMSA 3NSUA 4GN1A 1MK7B 1QC6A 1NI2A 4NY0A 1DDWA 4Y94A 4K2OA 1M7RA 1X1FA 4IAPA 1DROA 4D0NB 3U8ZA 2GJYA 2LKOA 4HB3B 2DX1A 2ADZA 5DHFB 3SUZA 4IFSA 2EMTA 2PZ1A 4KAXB 3PVWA 3PEGA 1UEFA 3AU5A 1NU2A 2DYQA 3OANA 2KCJA 4KVGB 1V61A 1U5FA 5D3YA 2Z0PA 1TQZA 1MPHA 4F7GA 3KRXA 2G35A 5JHHA 1Z87A 1KZGA 1GC7A 4HAZB 4K81A 1BWNA 1H4RA 5C16A 3VOQA 4K2PA 2DN6A 3BJIA 4KHAA 1FHOA 1FAOA 2ELAA 3UZTA 1GC6A 2OTXA 2KUPA 1FHXA 1UPRA 1AQCA 2W2XC 1XD4A 4PQ0A 2KGXB 2E2XA 1AWEA 1DBHA 3WA0A 4HDOA 3A8QA 3V5WA 1I2HA 4DX90 3SO6A 2N0YA 2DHIA 1MIXA 4A5KA 4GMVA 2QKLA 3U7DA 1WJ1A 3GYOA 5HE3A 3MDBC 1MIZB 4WVFB 4BBKA 2Q13A 1EF1A 2K00A 2IYBA 5GOWB 1UNQA 1SHCA 4HAWB 3VIAA 3DXCA 4A6HA 4CHJA 1U27A 5C5BB 3KSYA 2CRFA 2DHJA 4HAXB 2VSZA 5FI0A 1PFJA 3X23A 2DYNA 2D2QA 2D11A 2J0MA 1WVHA 1U5EA 1EAZA 1NTYA 1FOEA 2M38A 1XX0A 5DI9B 4EJNA 1TXDA 2JP2A 5D27A 2K2UA 1X86A 3KY9A 2NMBA 3TFMA 5J3QA 2ELBA 3WYFB 3MPXA 3DXEA 2DLWA 3LJUX 1SGHA 1WG7A 2D9VA 5DIFB 3RCPA 4YONA 1FB8A 3TO1A 1W1DA 2Y7BA 5CLLB 1W1GA 3T06A 1J0WA 2K2JA 2L1CA 3KZ1A 1X11A 1QQGA 1V89A 2P8VA 5D3XA 1WI1A 2CY5A 4TYZA 3PG7A 2MFQA 5D3VA 5HE0A 1P6SA 2UVMA 1GG3A
chains in the Genus database with same CATH superfamily
3PSCA 1P3RA 3OHMB 2Z4DA 4HHVA 4HSIA 4XWXA 1V88A 1UNPA 1XCGA 2K8EA 5CLQB 1Q67A 2M14A 2Y8GA 2KUQA 5DH9B 3AU4A 2J0JA 3GYPA 1V5UA 1MK9B 3FSSA 3NW8A 2D9YA 4DX8A 2VKIA 4K17A 2YT1A 4HAYB 2D9ZA 1RRPB 1M7EA 2YSZA 3SYXA 3N7CA 3F5RA 1MKEA 3NWAA 4GPTB 3TCAA 1BTNA 5D3WA 2HTHB 2AEHA 2ZKMX 1DYNA 2H7EA 2YT2A 3ODOA 1Y19B 4HB2B 3A8PA 2N23A 2CY4A 1U29A 1W1HA 3TVVA 1PLSA 1KI1B 1FHWA 3BINA 5C5BA 2KR0A 4KHOA 3G9WA 3U12A 1XKEA 5C6RA 4CYEA 4Z2MB 4TKNA 2YT0A 4HDQA 3PP2A 1BTKA 4ZRIA 3SNHA 4GZUA 2GCJA 4DXAB 3ZDTA 2NZ8B 3ZVRA 2W2WA 3DXDA 3D8EA 4F7HA 4B6HA 2BCJA 2LULA 4MT7A 2X18A 4MK0A 1K5DB 4GNKB 3P6AA 1FGYA 2RGNB 2W2XD 5DHAB 1LW3A 2DX5A 3FVCA 1U2BA 3O96A 1ZM0A 4IOYX 5HE1A 4A6KA 4GXBA 5LOPB 2YVCA 2UZRA 1RJ2A 2Z0OA 2P0HA 4DBBA 3HIEA 4NSWA 5J3TA 3ML4A 3SV1A 3D8FA 3KRWA 2J0KA 2GS0A 2MWNB 4WJ7A 1J19A 4ZRJA 4A6FB 4PNKA 2FJUB 2P0DA 1OQNA 1EGXA 2CODA 5JHGA 1ZYIA 2RSGA 3AJ4A 3CIKA 1FGZA 3HK0A 5LONB 2R09A 2CAYA 1P5TA 1V5PA 4YL8A 5JLJB 1KZ7A 3F0WA 3A98B 1U5GA 1EVHA 3M1IB 3TW1A 2GCLA 1WJMA 2YS5A 2ROVA 2OQBA 5EFXA 1K5GB 2DA0A 3ULCA 4QJ5B 5HE2A 3FM8C 1X05A 2MDXA 1ZSQA 2COCA 1WGUA 1Y5OA 1UPQA 3ODWA 1NTVA 2EJ8A 1BAKA 1X1GA 3IVFA 2V76A 1IRSA 4HB0B 2LYDA 2QKMA 2DKQA 5KCVA 4HATB 1TJ6A 2J59M 5C79A 2I1KA 2XQNM 2R2YA 4MY6A 2RRFA 5FI1A 2P0FA 2ZPYA 2ROZB 1H10A 5LG4B 3ULBA 5KQ1A 2DTCA 4ZRKA 2DKPA 2COFA 2Y8FA 4L1RA 2I5FA 3PVLA 4H8SA 4KHBB 2GUMA 2LG1A 2RVBB 3QIJA 4P7IA 5L81A 2R0DA 3CXBB 5I2SA 5KQ4A 1MAIA 3DCXA 2RUKB 2NBVA 2I1JA 3QBVB 2H7DA 1ZVRA 1WGQA 2LOXA 3D8DA 1I7AA 1LB1A 1XODA 2DFKA 1ZC3B 2D9XA 2Z59A 2VRWB 2COAA 1U5DA 2FJLA 2EC1A 2HE7A 2D4QA 3PVUA 4L6EA 2UZSA 4HB4B 2MKRA 2AL6A 3PZDA 4QJ3B 2D10A 2RNRB 1ISNA 2L2IA 4Z2NA 4A6FA 1XR0B 1B55A 2YS3A 2YF0A 1E5WA 4GMXB 4HAUB 4DIXA 1DDVA 1DDMA 2IFSA 1V5MA 3ODXA 3QWMA 4QXAB 4CSQA 2DHKA 2LOZA 4EMOA 2KIGA 2YS1A 1OY2A 1N3HA 3HQCA 1ZC4B 5J3YA 1UNRA 2Z13A 4CHMA 4HAVB 3HW2B 2RLOA 4GOUA 4C0AA 4F7UP 3FEHA 5JP4A 2EMSA 2YRYA 2Z0QA 1OMWA 2D9WA 3NWFA 3P7ZA 2I5CA 3B77A 4WSFA 4EKUA 1PMSA 3NSUA 4GN1A 1MK7B 1QC6A 1NI2A 4NY0A 1DDWA 4Y94A 4K2OA 1M7RA 1X1FA 4D6WA 4IAPA 1DROA 4D0NB 3U8ZA 2GJYA 2LKOA 4HB3B 2DX1A 2ADZA 5DHFB 3SUZA 4IFSA 2EMTA 1T77A 2PZ1A 4KAXB 3PVWA 3PEGA 1UEFA 3AU5A 1NU2A 2DYQA 3OANA 2KCJA 4KVGB 1V61A 1U5FA 2K49A 2Z0PA 5D3YA 4KHBA 1TQZA 1MPHA 4F7GA 3KRXA 2G35A 5JHHA 1Z87A 1KZGA 1GC7A 4HAZB 4K81A 1BWNA 1H4RA 5C16A 3VOQA 4K2PA 2DN6A 3BJIA 4KHAA 1FHOA 1FAOA 2ELAA 3UZTA 1GC6A 2OTXA 2KUPA 5IRSA 1FHXA 1UPRA 1AQCA 2W2XC 5M4YB 1XD4A 4PQ0A 2KGXB 2E2XA 1AWEA 1DBHA 3WA0A 4HDOA 3A8QA 3V5WA 1I2HA 5I2MA 4DX90 3SO6A 2N0YA 4OSNA 2DHIA 1MIXA 4A5KA 4GMVA 2QKLA 3U7DA 1WJ1A 3GYOA 5HE3A 3MDBC 1MIZB 4WVFB 4BBKA 2Q13A 1EF1A 2K00A 2IYBA 5GOWB 1UNQA 1SHCA 4HAWB 3VIAA 3DXCA 4A6HA 4CHJA 1U27A 5C5BB 3KSYA 2CRFA 2DHJA 4HAXB 2VSZA 5FI0A 4OT1A 1PFJA 3X23A 2DYNA 2D2QA 2D11A 2J0MA 1WVHA 1U5EA 1EAZA 1NTYA 1FOEA 2M38A 1XX0A 5DI9B 4EJNA 1TXDA 2JP2A 5D27A 1MI1A 3A58A 2K2UA 1X86A 3KY9A 2NMBA 3TFMA 5J3QA 2ELBA 3WYFB 3MPXA 3DXEA 2DLWA 3LJUX 1SGHA 4QJ4B 1WG7A 2D9VA 5DIFB 3RCPA 4YONA 3NWDA 1FB8A 3TO1A 1W1DA 2Z14A 2Y7BA 5CLLB 1W1GA 3T06A 1J0WA 2K2JA 2L1CA 2KIEA 1X11A 3KZ1A 1QQGA 3HSAA 1V89A 2P8VA 5D3XA 1WI1A 2CY5A 4TYZA 3PG7A 2MFQA 5D3VA 5HE0A 1P6SA 2UVMA 1GG3A
chains in the Genus database with same CATH topology
3PSCA 1P3RA 4HHVA 4XWXA 1V88A 1UNPA 1XCGA 5CLQB 1Q67A 2M14A 2Y8GA 5DH9B 3AU4A 2J0JA 3GYPA 1V5UA 1MK9B 3FSSA 2D9YA 4DX8A 2VKIA 4K17A 2YT1A 4HAYB 2D9ZA 1RRPB 1M7EA 2YSZA 3SYXA 3N7CA 3F5RA 1MKEA 4GPTB 3TCAA 1BTNA 5D3WA 2HTHB 2AEHA 1DYNA 2H7EA 3ODOA 1Y19B 4HB2B 3A8PA 2N23A 2CY4A 1U29A 1W1HA 3TVVA 1PLSA 1KI1B 1FHWA 3BINA 5C5BA 4KHOA 3G9WA 1XKEA 5C6RA 4CYEA 4Z2MB 4TKNA 2YT0A 4HDQA 3PP2A 1BTKA 4ZRIA 3SNHA 4GZUA 2GCJA 4DXAB 3ZDTA 2NZ8B 3ZVRA 2W2WA 3DXDA 3D8EA 4F7HA 4B6HA 2BCJA 2LULA 4MT7A 2X18A 4MK0A 1K5DB 3P6AA 1FGYA 2RGNB 2W2XD 5DHAB 1LW3A 2DX5A 1U2BA 3O96A 1ZM0A 4IOYX 5HE1A 4A6KA 4GXBA 5LOPB 2YVCA 2UZRA 1RJ2A 2Z0OA 2P0HA 4DBBA 4NSWA 5J3TA 3ML4A 3SV1A 3D8FA 3KRWA 2J0KA 2GS0A 2MWNB 4WJ7A 1J19A 4ZRJA 4A6FB 4PNKA 2P0DA 1OQNA 1EGXA 2CODA 5JHGA 3AJ4A 2RSGA 3CIKA 1FGZA 3HK0A 5LONB 2R09A 2CAYA 1P5TA 1V5PA 4YL8A 5JLJB 1KZ7A 3F0WA 3A98B 1U5GA 1EVHA 3M1IB 3TW1A 2GCLA 1WJMA 2YS5A 2ROVA 2OQBA 5EFXA 1K5GB 2DA0A 3ULCA 5HE2A 3FM8C 1X05A 2MDXA 1ZSQA 2COCA 1WGUA 1Y5OA 1UPQA 3ODWA 1NTVA 2EJ8A 1BAKA 1X1GA 3IVFA 2V76A 1IRSA 4HB0B 2LYDA 2QKMA 2DKQA 5KCVA 4HATB 1TJ6A 2J59M 5C79A 2I1KA 2XQNM 4MY6A 5FI1A 2P0FA 2ZPYA 2ROZB 1H10A 3ULBA 5KQ1A 2DTCA 4ZRKA 2DKPA 2COFA 2Y8FA 2I5FA 3PVLA 4H8SA 4KHBB 2LG1A 2RVBB 3QIJA 4P7IA 5L81A 2R0DA 3CXBB 5KQ4A 1MAIA 2RUKB 3QBVB 2I1JA 2H7DA 1ZVRA 1WGQA 2LOXA 3D8DA 1I7AA 1LB1A 1XODA 2DFKA 1ZC3B 2D9XA 2VRWB 2COAA 1U5DA 2FJLA 2EC1A 2HE7A 2D4QA 3PVUA 4L6EA 2UZSA 4HB4B 2MKRA 2AL6A 3PZDA 2D10A 2RNRB 1ISNA 2L2IA 4Z2NA 4A6FA 1XR0B 1B55A 2YS3A 2YF0A 1E5WA 4GMXB 4HAUB 1DDVA 1DDMA 2IFSA 1V5MA 3ODXA 3QWMA 2DHKA 2LOZA 4EMOA 2YS1A 1OY2A 1N3HA 3HQCA 1ZC4B 5J3YA 1UNRA 4CHMA 4HAVB 3HW2B 2RLOA 4F7UP 4C0AA 3FEHA 5JP4A 2EMSA 2YRYA 2Z0QA 1OMWA 2D9WA 3P7ZA 2I5CA 4WSFA 4EKUA 1PMSA 3NSUA 4GN1A 1MK7B 1QC6A 1NI2A 4NY0A 1DDWA 4Y94A 4K2OA 1M7RA 1X1FA 4IAPA 1DROA 4D0NB 3U8ZA 2GJYA 2LKOA 4HB3B 2DX1A 2ADZA 5DHFB 3SUZA 4IFSA 2EMTA 2PZ1A 4KAXB 3PVWA 3PEGA 1UEFA 3AU5A 1NU2A 2DYQA 3OANA 2KCJA 4KVGB 1V61A 1U5FA 5D3YA 2Z0PA 1TQZA 1MPHA 4F7GA 3KRXA 2G35A 5JHHA 1Z87A 1KZGA 1GC7A 4HAZB 4K81A 1BWNA 1H4RA 5C16A 3VOQA 4K2PA 2DN6A 3BJIA 4KHAA 1FHOA 1FAOA 2ELAA 3UZTA 1GC6A 2OTXA 2KUPA 1FHXA 1UPRA 1AQCA 2W2XC 1XD4A 4PQ0A 2KGXB 2E2XA 1AWEA 1DBHA 3WA0A 4HDOA 3A8QA 3V5WA 1I2HA 4DX90 3SO6A 2N0YA 2DHIA 1MIXA 4A5KA 4GMVA 2QKLA 3U7DA 1WJ1A 3GYOA 5HE3A 3MDBC 1MIZB 4WVFB 4BBKA 2Q13A 1EF1A 2K00A 2IYBA 5GOWB 1UNQA 1SHCA 4HAWB 3VIAA 3DXCA 4A6HA 4CHJA 1U27A 5C5BB 3KSYA 2CRFA 2DHJA 4HAXB 2VSZA 5FI0A 1PFJA 3X23A 2DYNA 2D2QA 2D11A 2J0MA 1WVHA 1U5EA 1EAZA 1NTYA 1FOEA 2M38A 1XX0A 5DI9B 4EJNA 1TXDA 2JP2A 5D27A 2K2UA 1X86A 3KY9A 2NMBA 3TFMA 5J3QA 2ELBA 3WYFB 3MPXA 3DXEA 2DLWA 3LJUX 1SGHA 1WG7A 2D9VA 5DIFB 3RCPA 4YONA 1FB8A 3TO1A 1W1DA 2Y7BA 5CLLB 1W1GA 3T06A 1J0WA 2K2JA 2L1CA 3KZ1A 1X11A 1QQGA 1V89A 2P8VA 5D3XA 1WI1A 2CY5A 4TYZA 3PG7A 2MFQA 5D3VA 5HE0A 1P6SA 2UVMA 1GG3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PSC A;  1P3R A;  4HHV A;  4XWX A;  1V88 A;  1UNP A;  1XCG A;  5CLQ B;  1Q67 A;  2M14 A;  2Y8G A;  5DH9 B;  3AU4 A;  2J0J A;  3GYP A;  1V5U A;  1MK9 B;  3FSS A;  2D9Y A;  4DX8 A;  2VKI A;  4K17 A;  2YT1 A;  4HAY B;  2D9Z A;  1RRP B;  1M7E A;  2YSZ A;  3SYX A;  3N7C A;  3F5R A;  1MKE A;  4GPT B;  3TCA A;  1BTN A;  5D3W A;  2HTH B;  2AEH A;  1DYN A;  2H7E A;  3ODO A;  1Y19 B;  4HB2 B;  3A8P A;  2N23 A;  2CY4 A;  1U29 A;  1W1H A;  3TVV A;  1PLS A;  1KI1 B;  1FHW A;  3BIN A;  5C5B A;  4KHO A;  3G9W A;  1XKE A;  5C6R A;  4CYE A;  4Z2M B;  4TKN A;  2YT0 A;  4HDQ A;  3PP2 A;  1BTK A;  4ZRI A;  3SNH A;  4GZU A;  2GCJ A;  4DXA B;  3ZDT A;  2NZ8 B;  3ZVR A;  2W2W A;  3DXD A;  3D8E A;  4F7H A;  4B6H A;  2BCJ A;  2LUL A;  4MT7 A;  2X18 A;  4MK0 A;  1K5D B;  3P6A A;  1FGY A;  2RGN B;  2W2X D;  5DHA B;  1LW3 A;  2DX5 A;  1U2B A;  3O96 A;  1ZM0 A;  4IOY X;  5HE1 A;  4A6K A;  4GXB A;  5LOP B;  2YVC A;  2UZR A;  1RJ2 A;  2Z0O A;  2P0H A;  4DBB A;  4NSW A;  5J3T A;  3ML4 A;  3SV1 A;  3D8F A;  3KRW A;  2J0K A;  2GS0 A;  2MWN B;  4WJ7 A;  1J19 A;  4ZRJ A;  4A6F B;  4PNK A;  2P0D A;  1OQN A;  1EGX A;  2COD A;  5JHG A;  3AJ4 A;  2RSG A;  3CIK A;  1FGZ A;  3HK0 A;  5LON B;  2R09 A;  2CAY A;  1P5T A;  1V5P A;  4YL8 A;  5JLJ B;  1KZ7 A;  3F0W A;  3A98 B;  1U5G A;  1EVH A;  3M1I B;  3TW1 A;  2GCL A;  1WJM A;  2YS5 A;  2ROV A;  2OQB A;  5EFX A;  1K5G B;  2DA0 A;  3ULC A;  5HE2 A;  3FM8 C;  1X05 A;  2MDX A;  1ZSQ A;  2COC A;  1WGU A;  1Y5O A;  1UPQ A;  3ODW A;  1NTV A;  2EJ8 A;  1BAK A;  1X1G A;  3IVF A;  2V76 A;  1IRS A;  4HB0 B;  2LYD A;  2QKM A;  2DKQ A;  5KCV A;  4HAT B;  1TJ6 A;  2J59 M;  5C79 A;  2I1K A;  2XQN M;  4MY6 A;  5FI1 A;  2P0F A;  2ZPY A;  2ROZ B;  1H10 A;  3ULB A;  5KQ1 A;  2DTC A;  4ZRK A;  2DKP A;  2COF A;  2Y8F A;  2I5F A;  3PVL A;  4H8S A;  4KHB B;  2LG1 A;  2RVB B;  3QIJ A;  4P7I A;  5L81 A;  2R0D A;  3CXB B;  5KQ4 A;  1MAI A;  2RUK B;  3QBV B;  2I1J A;  2H7D A;  1ZVR A;  1WGQ A;  2LOX A;  3D8D A;  1I7A A;  1LB1 A;  1XOD A;  2DFK A;  1ZC3 B;  2D9X A;  2VRW B;  2COA A;  1U5D A;  2FJL A;  2EC1 A;  2HE7 A;  2D4Q A;  3PVU A;  4L6E A;  2UZS A;  4HB4 B;  2MKR A;  2AL6 A;  3PZD A;  2D10 A;  2RNR B;  1ISN A;  2L2I A;  4Z2N A;  4A6F A;  1XR0 B;  1B55 A;  2YS3 A;  2YF0 A;  1E5W A;  4GMX B;  4HAU B;  1DDV A;  1DDM A;  2IFS A;  1V5M A;  3ODX A;  3QWM A;  2DHK A;  2LOZ A;  4EMO A;  2YS1 A;  1OY2 A;  1N3H A;  3HQC A;  1ZC4 B;  5J3Y A;  1UNR A;  4CHM A;  4HAV B;  3HW2 B;  2RLO A;  4F7U P;  4C0A A;  3FEH A;  5JP4 A;  2EMS A;  2YRY A;  2Z0Q A;  1OMW A;  2D9W A;  3P7Z A;  2I5C A;  4WSF A;  4EKU A;  1PMS A;  3NSU A;  4GN1 A;  1MK7 B;  1QC6 A;  1NI2 A;  4NY0 A;  1DDW A;  4Y94 A;  4K2O A;  1M7R A;  1X1F A;  4IAP A;  1DRO A;  4D0N B;  3U8Z A;  2GJY A;  2LKO A;  4HB3 B;  2DX1 A;  2ADZ A;  5DHF B;  3SUZ A;  4IFS A;  2EMT A;  2PZ1 A;  4KAX B;  3PVW A;  3PEG A;  1UEF A;  3AU5 A;  1NU2 A;  2DYQ A;  3OAN A;  2KCJ A;  4KVG B;  1V61 A;  1U5F A;  5D3Y A;  2Z0P A;  1TQZ A;  1MPH A;  4F7G A;  3KRX A;  2G35 A;  5JHH A;  1Z87 A;  1KZG A;  1GC7 A;  4HAZ B;  4K81 A;  1BWN A;  1H4R A;  5C16 A;  3VOQ A;  4K2P A;  2DN6 A;  3BJI A;  4KHA A;  1FHO A;  1FAO A;  2ELA A;  3UZT A;  1GC6 A;  2OTX A;  2KUP A;  1FHX A;  1UPR A;  1AQC A;  2W2X C;  1XD4 A;  4PQ0 A;  2KGX B;  2E2X A;  1AWE A;  1DBH A;  3WA0 A;  4HDO A;  3A8Q A;  3V5W A;  1I2H A;  4DX9 0;  3SO6 A;  2N0Y A;  2DHI A;  1MIX A;  4A5K A;  4GMV A;  2QKL A;  3U7D A;  1WJ1 A;  3GYO A;  5HE3 A;  3MDB C;  1MIZ B;  4WVF B;  4BBK A;  2Q13 A;  1EF1 A;  2K00 A;  2IYB A;  5GOW B;  1UNQ A;  1SHC A;  4HAW B;  3VIA A;  3DXC A;  4A6H A;  4CHJ A;  1U27 A;  5C5B B;  3KSY A;  2CRF A;  2DHJ A;  4HAX B;  2VSZ A;  5FI0 A;  1PFJ A;  3X23 A;  2DYN A;  2D2Q A;  2D11 A;  2J0M A;  1WVH A;  1U5E A;  1EAZ A;  1NTY A;  1FOE A;  2M38 A;  1XX0 A;  5DI9 B;  4EJN A;  1TXD A;  2JP2 A;  5D27 A;  2K2U A;  1X86 A;  3KY9 A;  2NMB A;  3TFM A;  5J3Q A;  2ELB A;  3WYF B;  3MPX A;  3DXE A;  2DLW A;  3LJU X;  1SGH A;  1WG7 A;  2D9V A;  5DIF B;  3RCP A;  4YON A;  1FB8 A;  3TO1 A;  1W1D A;  2Y7B A;  5CLL B;  1W1G A;  3T06 A;  1J0W A;  2K2J A;  2L1C A;  3KZ1 A;  1X11 A;  1QQG A;  1V89 A;  2P8V A;  5D3X A;  1WI1 A;  2CY5 A;  4TYZ A;  3PG7 A;  2MFQ A;  5D3V A;  5HE0 A;  1P6S A;  2UVM A;  1GG3 A; 
#chains in the Genus database with same CATH topology
 3PSC A;  1P3R A;  3OHM B;  2Z4D A;  4HHV A;  4HSI A;  4XWX A;  1V88 A;  1UNP A;  1XCG A;  2K8E A;  5CLQ B;  1Q67 A;  2M14 A;  2Y8G A;  2KUQ A;  5DH9 B;  3AU4 A;  2J0J A;  3GYP A;  1V5U A;  1MK9 B;  3FSS A;  3NW8 A;  2D9Y A;  4DX8 A;  2VKI A;  4K17 A;  2YT1 A;  4HAY B;  2D9Z A;  1RRP B;  1M7E A;  2YSZ A;  3SYX A;  3N7C A;  3F5R A;  1MKE A;  3NWA A;  4GPT B;  3TCA A;  1BTN A;  5D3W A;  2HTH B;  2AEH A;  2ZKM X;  1DYN A;  2H7E A;  2YT2 A;  3ODO A;  1Y19 B;  4HB2 B;  3A8P A;  2N23 A;  2CY4 A;  1U29 A;  1W1H A;  3TVV A;  1PLS A;  1KI1 B;  1FHW A;  3BIN A;  5C5B A;  2KR0 A;  4KHO A;  3G9W A;  3U12 A;  1XKE A;  5C6R A;  4CYE A;  4Z2M B;  4TKN A;  2YT0 A;  4HDQ A;  3PP2 A;  1BTK A;  4ZRI A;  3SNH A;  4GZU A;  2GCJ A;  4DXA B;  3ZDT A;  2NZ8 B;  3ZVR A;  2W2W A;  3DXD A;  3D8E A;  4F7H A;  4B6H A;  2BCJ A;  2LUL A;  4MT7 A;  2X18 A;  4MK0 A;  1K5D B;  4GNK B;  3P6A A;  1FGY A;  2RGN B;  2W2X D;  5DHA B;  1LW3 A;  2DX5 A;  3FVC A;  1U2B A;  3O96 A;  1ZM0 A;  4IOY X;  5HE1 A;  4A6K A;  4GXB A;  5LOP B;  2YVC A;  2UZR A;  1RJ2 A;  2Z0O A;  2P0H A;  4DBB A;  3HIE A;  4NSW A;  5J3T A;  3ML4 A;  3SV1 A;  3D8F A;  3KRW A;  2J0K A;  2GS0 A;  2MWN B;  4WJ7 A;  1J19 A;  4ZRJ A;  4A6F B;  4PNK A;  2FJU B;  2P0D A;  1OQN A;  1EGX A;  2COD A;  5JHG A;  1ZYI A;  2RSG A;  3AJ4 A;  3CIK A;  1FGZ A;  3HK0 A;  5LON B;  2R09 A;  2CAY A;  1P5T A;  1V5P A;  4YL8 A;  5JLJ B;  1KZ7 A;  3F0W A;  3A98 B;  1U5G A;  1EVH A;  3M1I B;  3TW1 A;  2GCL A;  1WJM A;  2YS5 A;  2ROV A;  2OQB A;  5EFX A;  1K5G B;  2DA0 A;  3ULC A;  4QJ5 B;  5HE2 A;  3FM8 C;  1X05 A;  2MDX A;  1ZSQ A;  2COC A;  1WGU A;  1Y5O A;  1UPQ A;  3ODW A;  1NTV A;  2EJ8 A;  1BAK A;  1X1G A;  3IVF A;  2V76 A;  1IRS A;  4HB0 B;  2LYD A;  2QKM A;  2DKQ A;  5KCV A;  4HAT B;  1TJ6 A;  2J59 M;  5C79 A;  2I1K A;  2XQN M;  2R2Y A;  4MY6 A;  2RRF A;  5FI1 A;  2P0F A;  2ZPY A;  2ROZ B;  1H10 A;  5LG4 B;  3ULB A;  5KQ1 A;  2DTC A;  4ZRK A;  2DKP A;  2COF A;  2Y8F A;  4L1R A;  2I5F A;  3PVL A;  4H8S A;  4KHB B;  2GUM A;  2LG1 A;  2RVB B;  3QIJ A;  4P7I A;  5L81 A;  2R0D A;  3CXB B;  5I2S A;  5KQ4 A;  1MAI A;  3DCX A;  2RUK B;  2NBV A;  2I1J A;  3QBV B;  2H7D A;  1ZVR A;  1WGQ A;  2LOX A;  3D8D A;  1I7A A;  1LB1 A;  1XOD A;  2DFK A;  1ZC3 B;  2D9X A;  2Z59 A;  2VRW B;  2COA A;  1U5D A;  2FJL A;  2EC1 A;  2HE7 A;  2D4Q A;  3PVU A;  4L6E A;  2UZS A;  4HB4 B;  2MKR A;  2AL6 A;  3PZD A;  4QJ3 B;  2D10 A;  2RNR B;  1ISN A;  2L2I A;  4Z2N A;  4A6F A;  1XR0 B;  1B55 A;  2YS3 A;  2YF0 A;  1E5W A;  4GMX B;  4HAU B;  4DIX A;  1DDV A;  1DDM A;  2IFS A;  1V5M A;  3ODX A;  3QWM A;  4QXA B;  4CSQ A;  2DHK A;  2LOZ A;  4EMO A;  2KIG A;  2YS1 A;  1OY2 A;  1N3H A;  3HQC A;  1ZC4 B;  5J3Y A;  1UNR A;  2Z13 A;  4CHM A;  4HAV B;  3HW2 B;  2RLO A;  4GOU A;  4C0A A;  4F7U P;  3FEH A;  5JP4 A;  2EMS A;  2YRY A;  2Z0Q A;  1OMW A;  2D9W A;  3NWF A;  3P7Z A;  2I5C A;  3B77 A;  4WSF A;  4EKU A;  1PMS A;  3NSU A;  4GN1 A;  1MK7 B;  1QC6 A;  1NI2 A;  4NY0 A;  1DDW A;  4Y94 A;  4K2O A;  1M7R A;  1X1F A;  4D6W A;  4IAP A;  1DRO A;  4D0N B;  3U8Z A;  2GJY A;  2LKO A;  4HB3 B;  2DX1 A;  2ADZ A;  5DHF B;  3SUZ A;  4IFS A;  2EMT A;  1T77 A;  2PZ1 A;  4KAX B;  3PVW A;  3PEG A;  1UEF A;  3AU5 A;  1NU2 A;  2DYQ A;  3OAN A;  2KCJ A;  4KVG B;  1V61 A;  1U5F A;  2K49 A;  2Z0P A;  5D3Y A;  4KHB A;  1TQZ A;  1MPH A;  4F7G A;  3KRX A;  2G35 A;  5JHH A;  1Z87 A;  1KZG A;  1GC7 A;  4HAZ B;  4K81 A;  1BWN A;  1H4R A;  5C16 A;  3VOQ A;  4K2P A;  2DN6 A;  3BJI A;  4KHA A;  1FHO A;  1FAO A;  2ELA A;  3UZT A;  1GC6 A;  2OTX A;  2KUP A;  5IRS A;  1FHX A;  1UPR A;  1AQC A;  2W2X C;  5M4Y B;  1XD4 A;  4PQ0 A;  2KGX B;  2E2X A;  1AWE A;  1DBH A;  3WA0 A;  4HDO A;  3A8Q A;  3V5W A;  1I2H A;  5I2M A;  4DX9 0;  3SO6 A;  2N0Y A;  4OSN A;  2DHI A;  1MIX A;  4A5K A;  4GMV A;  2QKL A;  3U7D A;  1WJ1 A;  3GYO A;  5HE3 A;  3MDB C;  1MIZ B;  4WVF B;  4BBK A;  2Q13 A;  1EF1 A;  2K00 A;  2IYB A;  5GOW B;  1UNQ A;  1SHC A;  4HAW B;  3VIA A;  3DXC A;  4A6H A;  4CHJ A;  1U27 A;  5C5B B;  3KSY A;  2CRF A;  2DHJ A;  4HAX B;  2VSZ A;  5FI0 A;  4OT1 A;  1PFJ A;  3X23 A;  2DYN A;  2D2Q A;  2D11 A;  2J0M A;  1WVH A;  1U5E A;  1EAZ A;  1NTY A;  1FOE A;  2M38 A;  1XX0 A;  5DI9 B;  4EJN A;  1TXD A;  2JP2 A;  5D27 A;  1MI1 A;  3A58 A;  2K2U A;  1X86 A;  3KY9 A;  2NMB A;  3TFM A;  5J3Q A;  2ELB A;  3WYF B;  3MPX A;  3DXE A;  2DLW A;  3LJU X;  1SGH A;  4QJ4 B;  1WG7 A;  2D9V A;  5DIF B;  3RCP A;  4YON A;  3NWD A;  1FB8 A;  3TO1 A;  1W1D A;  2Z14 A;  2Y7B A;  5CLL B;  1W1G A;  3T06 A;  1J0W A;  2K2J A;  2L1C A;  2KIE A;  1X11 A;  3KZ1 A;  1QQG A;  3HSA A;  1V89 A;  2P8V A;  5D3X A;  1WI1 A;  2CY5 A;  4TYZ A;  3PG7 A;  2MFQ A;  5D3V A;  5HE0 A;  1P6S A;  2UVM A;  1GG3 A; 
#chains in the Genus database with same CATH homology
 3PSC A;  1P3R A;  4HHV A;  4XWX A;  1V88 A;  1UNP A;  1XCG A;  5CLQ B;  1Q67 A;  2M14 A;  2Y8G A;  5DH9 B;  3AU4 A;  2J0J A;  3GYP A;  1V5U A;  1MK9 B;  3FSS A;  2D9Y A;  4DX8 A;  2VKI A;  4K17 A;  2YT1 A;  4HAY B;  2D9Z A;  1RRP B;  1M7E A;  2YSZ A;  3SYX A;  3N7C A;  3F5R A;  1MKE A;  4GPT B;  3TCA A;  1BTN A;  5D3W A;  2HTH B;  2AEH A;  1DYN A;  2H7E A;  3ODO A;  1Y19 B;  4HB2 B;  3A8P A;  2N23 A;  2CY4 A;  1U29 A;  1W1H A;  3TVV A;  1PLS A;  1KI1 B;  1FHW A;  3BIN A;  5C5B A;  4KHO A;  3G9W A;  1XKE A;  5C6R A;  4CYE A;  4Z2M B;  4TKN A;  2YT0 A;  4HDQ A;  3PP2 A;  1BTK A;  4ZRI A;  3SNH A;  4GZU A;  2GCJ A;  4DXA B;  3ZDT A;  2NZ8 B;  3ZVR A;  2W2W A;  3DXD A;  3D8E A;  4F7H A;  4B6H A;  2BCJ A;  2LUL A;  4MT7 A;  2X18 A;  4MK0 A;  1K5D B;  3P6A A;  1FGY A;  2RGN B;  2W2X D;  5DHA B;  1LW3 A;  2DX5 A;  1U2B A;  3O96 A;  1ZM0 A;  4IOY X;  5HE1 A;  4A6K A;  4GXB A;  5LOP B;  2YVC A;  2UZR A;  1RJ2 A;  2Z0O A;  2P0H A;  4DBB A;  4NSW A;  5J3T A;  3ML4 A;  3SV1 A;  3D8F A;  3KRW A;  2J0K A;  2GS0 A;  2MWN B;  4WJ7 A;  1J19 A;  4ZRJ A;  4A6F B;  4PNK A;  2P0D A;  1OQN A;  1EGX A;  2COD A;  5JHG A;  3AJ4 A;  2RSG A;  3CIK A;  1FGZ A;  3HK0 A;  5LON B;  2R09 A;  2CAY A;  1P5T A;  1V5P A;  4YL8 A;  5JLJ B;  1KZ7 A;  3F0W A;  3A98 B;  1U5G A;  1EVH A;  3M1I B;  3TW1 A;  2GCL A;  1WJM A;  2YS5 A;  2ROV A;  2OQB A;  5EFX A;  1K5G B;  2DA0 A;  3ULC A;  5HE2 A;  3FM8 C;  1X05 A;  2MDX A;  1ZSQ A;  2COC A;  1WGU A;  1Y5O A;  1UPQ A;  3ODW A;  1NTV A;  2EJ8 A;  1BAK A;  1X1G A;  3IVF A;  2V76 A;  1IRS A;  4HB0 B;  2LYD A;  2QKM A;  2DKQ A;  5KCV A;  4HAT B;  1TJ6 A;  2J59 M;  5C79 A;  2I1K A;  2XQN M;  4MY6 A;  5FI1 A;  2P0F A;  2ZPY A;  2ROZ B;  1H10 A;  3ULB A;  5KQ1 A;  2DTC A;  4ZRK A;  2DKP A;  2COF A;  2Y8F A;  2I5F A;  3PVL A;  4H8S A;  4KHB B;  2LG1 A;  2RVB B;  3QIJ A;  4P7I A;  5L81 A;  2R0D A;  3CXB B;  5KQ4 A;  1MAI A;  2RUK B;  3QBV B;  2I1J A;  2H7D A;  1ZVR A;  1WGQ A;  2LOX A;  3D8D A;  1I7A A;  1LB1 A;  1XOD A;  2DFK A;  1ZC3 B;  2D9X A;  2VRW B;  2COA A;  1U5D A;  2FJL A;  2EC1 A;  2HE7 A;  2D4Q A;  3PVU A;  4L6E A;  2UZS A;  4HB4 B;  2MKR A;  2AL6 A;  3PZD A;  2D10 A;  2RNR B;  1ISN A;  2L2I A;  4Z2N A;  4A6F A;  1XR0 B;  1B55 A;  2YS3 A;  2YF0 A;  1E5W A;  4GMX B;  4HAU B;  1DDV A;  1DDM A;  2IFS A;  1V5M A;  3ODX A;  3QWM A;  2DHK A;  2LOZ A;  4EMO A;  2YS1 A;  1OY2 A;  1N3H A;  3HQC A;  1ZC4 B;  5J3Y A;  1UNR A;  4CHM A;  4HAV B;  3HW2 B;  2RLO A;  4F7U P;  4C0A A;  3FEH A;  5JP4 A;  2EMS A;  2YRY A;  2Z0Q A;  1OMW A;  2D9W A;  3P7Z A;  2I5C A;  4WSF A;  4EKU A;  1PMS A;  3NSU A;  4GN1 A;  1MK7 B;  1QC6 A;  1NI2 A;  4NY0 A;  1DDW A;  4Y94 A;  4K2O A;  1M7R A;  1X1F A;  4IAP A;  1DRO A;  4D0N B;  3U8Z A;  2GJY A;  2LKO A;  4HB3 B;  2DX1 A;  2ADZ A;  5DHF B;  3SUZ A;  4IFS A;  2EMT A;  2PZ1 A;  4KAX B;  3PVW A;  3PEG A;  1UEF A;  3AU5 A;  1NU2 A;  2DYQ A;  3OAN A;  2KCJ A;  4KVG B;  1V61 A;  1U5F A;  5D3Y A;  2Z0P A;  1TQZ A;  1MPH A;  4F7G A;  3KRX A;  2G35 A;  5JHH A;  1Z87 A;  1KZG A;  1GC7 A;  4HAZ B;  4K81 A;  1BWN A;  1H4R A;  5C16 A;  3VOQ A;  4K2P A;  2DN6 A;  3BJI A;  4KHA A;  1FHO A;  1FAO A;  2ELA A;  3UZT A;  1GC6 A;  2OTX A;  2KUP A;  1FHX A;  1UPR A;  1AQC A;  2W2X C;  1XD4 A;  4PQ0 A;  2KGX B;  2E2X A;  1AWE A;  1DBH A;  3WA0 A;  4HDO A;  3A8Q A;  3V5W A;  1I2H A;  4DX9 0;  3SO6 A;  2N0Y A;  2DHI A;  1MIX A;  4A5K A;  4GMV A;  2QKL A;  3U7D A;  1WJ1 A;  3GYO A;  5HE3 A;  3MDB C;  1MIZ B;  4WVF B;  4BBK A;  2Q13 A;  1EF1 A;  2K00 A;  2IYB A;  5GOW B;  1UNQ A;  1SHC A;  4HAW B;  3VIA A;  3DXC A;  4A6H A;  4CHJ A;  1U27 A;  5C5B B;  3KSY A;  2CRF A;  2DHJ A;  4HAX B;  2VSZ A;  5FI0 A;  1PFJ A;  3X23 A;  2DYN A;  2D2Q A;  2D11 A;  2J0M A;  1WVH A;  1U5E A;  1EAZ A;  1NTY A;  1FOE A;  2M38 A;  1XX0 A;  5DI9 B;  4EJN A;  1TXD A;  2JP2 A;  5D27 A;  2K2U A;  1X86 A;  3KY9 A;  2NMB A;  3TFM A;  5J3Q A;  2ELB A;  3WYF B;  3MPX A;  3DXE A;  2DLW A;  3LJU X;  1SGH A;  1WG7 A;  2D9V A;  5DIF B;  3RCP A;  4YON A;  1FB8 A;  3TO1 A;  1W1D A;  2Y7B A;  5CLL B;  1W1G A;  3T06 A;  1J0W A;  2K2J A;  2L1C A;  3KZ1 A;  1X11 A;  1QQG A;  1V89 A;  2P8V A;  5D3X A;  1WI1 A;  2CY5 A;  4TYZ A;  3PG7 A;  2MFQ A;  5D3V A;  5HE0 A;  1P6S A;  2UVM A;  1GG3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...