2MDXA

Solution structure of the human wild type fapp1-ph domain
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
108
structure length
108
Chain Sequence
GPLGSPEFMEGVLYKWTNYLTGWQPRWFVLDNGILSYYDSQDDVCKGSKGSIKMAVCEIKVHSADNTRMELIIPGEQHFYMKAVNAAERQRWLVALGSSKACLTDTRT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the human wild type FAPP1-PH domain
rcsb
source organism Homo sapiens
molecule tags Membrane protein
molecule keywords Pleckstrin homology domain-containing family A member 3
total genus 17
structure length 108
sequence length 108
ec nomenclature
pdb deposition date 2013-09-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00169 PH PH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2mdxA00
3N7CA 5GOWB 2EJ8A 1UNPA 5L81A 1Z87A 3UZTA 1XKEA 2R09A 1EAZA 1U5FA 4GXBA 1QQGA 4MT7A 1E5WA 1LW3A 1FGYA 5HE2A 4HAWB 3FM8C 5CLQB 2X18A 3A8QA 1GC7A 3TO1A 2I5CA 1X1GA 4WVFB 3G9WA 5D3YA 3OANA 2RUKB 3X23A 2DTCA 2EMSA 2YT0A 3ZVRA 2HTHB 1SHCA 2KGXB 3FEHA 3GYPA 2LKOA 2NMBA 3F5RA 4HDOA 2IFSA 1H10A 1FHOA 2YT1A 5FI0A 4Z2NA 2N23A 4DX90 4NSWA 4K17A 4NY0A 3DXDA 1NTYA 4DBBA 2EC1A 1Q67A 1AWEA 2W2XD 3F0WA 1IRSA 2QKMA 3VIAA 4C0AA 4HB4B 1FAOA 1WGQA 1UPQA 3ML4A 3A98B 2D9WA 2M38A 4A6FB 5KQ1A 2YF0A 1FGZA 4ZRJA 3SV1A 3HW2B 4ZRKA 3ZDTA 1P3RA 1X86A 2ADZA 1U27A 5C16A 2P8VA 3AU4A 2P0HA 3MPXA 3NSUA 2ROZB 1ZC4B 1FHXA 1K5DB 4GPTB 1MIZB 1BAKA 5DHAB 1PMSA 3KSYA 3FSSA 2E2XA 1BWNA 2I1KA 4TYZA 2N0YA 1WJ1A 3IVFA 2J59M 2Y8FA 2MWNB 5LONB 5JHHA 2LYDA 4TKNA 2QKLA 1U5DA 4PQ0A 3ODWA 1PFJA 1B55A 1GG3A 3TVVA 5DH9B 1DBHA 1V88A 2V76A 1DYNA 4K81A 4KHAA 2ROVA 4HAYB 5DHFB 2RSGA 3KZ1A 3TW1A 2Z0PA 5JLJB 1MKEA 2I5FA 1WVHA 3SNHA 2D2QA 5EFXA 3MDBC 4GMVA 2Z0OA 4CYEA 1TJ6A 4HB3B 1EGXA 4F7UP 3U8ZA 1UEFA 2ELAA 4HAVB 2DX5A 2L1CA 2AEHA 4CHJA 1MPHA 2D9YA 2CY4A 5D27A 1FHWA 5C79A 2R0DA 2DLWA 1NU2A 2DHJA 1ZSQA 3PSCA 5KCVA 1XX0A 2YS1A 2ELBA 3PVUA 1OMWA 1DROA 4HATB 1FOEA 4IFSA 2DYNA 4HB0B 4A6FA 2LULA 1DDVA 1WGUA 1P6SA 2BCJA 2DFKA 2Y8GA 3PVWA 3DXCA 2LOZA 4A6KA 2DKQA 4WJ7A 3KRWA 4IOYX 2DN6A 3CIKA 3QWMA 4D0NB 1ZVRA 3WA0A 5JHGA 2LOXA 3PP2A 1WG7A 1V5UA 5KQ4A 2DA0A 4HAUB 1RJ2A 3ULBA 3LJUX 4K2OA 4YL8A 1X05A 4KHBB 1U29A 3SO6A 1QC6A 2YRYA 2OTXA 1NTVA 2MDXA 1EVHA 3RCPA 2K2JA 2KUPA 1ZC3B 1ISNA 4L6EA 1PLSA 2YSZA 2DHIA 4DXAB 4CHMA 2RNRB 3U7DA 4EKUA 2J0MA 4EJNA 3AJ4A 1V61A 4GMXB 2CODA 2UZSA 4XWXA 2L2IA 3PVLA 4YONA 1NI2A 5C5BB 5D3XA 1XR0B 4MY6A 2H7EA 3T06A 1MK7B 3P7ZA 3PEGA 3ULCA 2AL6A 5J3YA 1X1FA 1W1HA 2MKRA 5D3VA 3HK0A 3M1IB 2YS5A 1I7AA 2D10A 3A8PA 1U5GA 2VSZA 2LG1A 1MAIA 2GJYA 1DDMA 3SUZA 2KCJA 5DI9B 3SYXA 1J19A 2Y7BA 2VRWB 2P0DA 4B6HA 2XQNM 4GN1A 5HE1A 2DKPA 1WI1A 2IYBA 2EMTA 3HQCA 2J0KA 1Y5OA 1J0WA 1W1DA 2I1JA 1P5TA 4HDQA 2CRFA 2D11A 2YS3A 2RLOA 4P7IA 1M7RA 4MK0A 5C6RA 4PNKA 5CLLB 2ZPYA 2J0JA 2CY5A 2GCJA 2D9VA 4IAPA 1EF1A 1KZGA 3PG7A 4BBKA 3KY9A 4WSFA 2RGNB 3BJIA 4HHVA 2UVMA 2COFA 1V89A 2UZRA 2G35A 2DYQA 1XODA 2Q13A 1TQZA 2PZ1A 3AU5A 2K00A 2W2WA 1K5GB 5HE3A 4F7GA 2RVBB 2NZ8B 3O96A 3ODXA 2DX1A 4HB2B 2CAYA 2COAA 3D8FA 5C5BA 1XCGA 1XD4A 1KZ7A 2D9ZA 1SGHA 1UNRA 4DX8A 3D8EA 4Z2MB 5LOPB 1ZM0A 1U5EA 1V5PA 2OQBA 3DXEA 4HAZB 5HE0A 5J3QA 1FB8A 4GZUA 2COCA 2HE7A 1RRPB 3KRXA 3P6AA 1MK9B 3VOQA 2JP2A 1I2HA 1Y19B 5JP4A 4K2PA 2GCLA 3BINA 1X11A 3TFMA 1MIXA 1LB1A 2DHKA 2P0FA 5FI1A 1V5MA 3D8DA 3GYOA 3TCAA 1H4RA 2H7DA 1UNQA 1TXDA 1N3HA 1GC6A 4Y94A 1W1GA 2D9XA 1WJMA 5DIFB 2W2XC 3QIJA 2FJLA 1U2BA 1KI1B 1OY2A 5J3TA 2K2UA 5D3WA 1M7EA 3WYFB 4EMOA 4ZRIA 1AQCA 1BTKA 4H8SA 1DDWA 2GS0A 2D4QA 4KVGB 3QBVB 2Z0QA 3PZDA 3ODOA 2MFQA 3V5WA 4A5KA 1OQNA 4A6HA 4KAXB 4KHOA 2YVCA 1UPRA 4HAXB 1BTNA 4F7HA 2VKIA 3CXBB 2M14A
chains in the Genus database with same CATH superfamily
3N7CA 5GOWB 2EJ8A 1UNPA 2KIGA 5L81A 1Z87A 3UZTA 1XKEA 2R09A 1EAZA 4OSNA 1U5FA 4GXBA 1QQGA 4MT7A 1E5WA 2KR0A 1LW3A 1FGYA 5HE2A 4HAWB 3FM8C 5CLQB 2X18A 3A8QA 1GC7A 3TO1A 2I5CA 1X1GA 5I2MA 4WVFB 3G9WA 5D3YA 5LG4B 3OANA 2RUKB 3X23A 2DTCA 2EMSA 2YT0A 3ZVRA 2HTHB 1SHCA 2KGXB 3FEHA 3GYPA 2LKOA 2NMBA 4QXAB 4KHBA 3F5RA 4HDOA 2IFSA 1H10A 1FHOA 2YT1A 5FI0A 4Z2NA 2N23A 4DX90 4NSWA 4K17A 4NY0A 3DXDA 1NTYA 4DBBA 2EC1A 1Q67A 1AWEA 2W2XD 3F0WA 1IRSA 2QKMA 3VIAA 4C0AA 4HB4B 1FAOA 1WGQA 1UPQA 3ML4A 3A98B 2D9WA 2M38A 4A6FB 5KQ1A 2YF0A 1FGZA 4ZRJA 3SV1A 3HW2B 4ZRKA 3ZDTA 1P3RA 1X86A 2ADZA 4L1RA 1U27A 5C16A 2P8VA 3AU4A 2P0HA 2YT2A 3MPXA 3NSUA 2ROZB 1ZC4B 1FHXA 1K5DB 4GPTB 2K49A 1MIZB 1BAKA 5DHAB 1PMSA 3KSYA 3FSSA 2E2XA 1BWNA 2I1KA 4TYZA 2N0YA 1WJ1A 3IVFA 2J59M 2Y8FA 2MWNB 5LONB 5JHHA 4GOUA 1MI1A 2LYDA 4TKNA 2QKLA 1U5DA 4PQ0A 3ODWA 1PFJA 1B55A 1GG3A 2RRFA 3TVVA 5DH9B 1DBHA 1V88A 2V76A 1DYNA 3HIEA 4K81A 4KHAA 2ROVA 4HAYB 5DHFB 2RSGA 3KZ1A 3TW1A 2Z0PA 5JLJB 1MKEA 2I5FA 2R2YA 1WVHA 3SNHA 2D2QA 5EFXA 3MDBC 4GMVA 2Z0OA 4CYEA 4QJ5B 1TJ6A 4HB3B 1EGXA 4F7UP 3U8ZA 1UEFA 2ELAA 4QJ3B 4HAVB 2DX5A 2L1CA 3FVCA 2AEHA 2KIEA 4CHJA 1MPHA 1ZYIA 2D9YA 2CY4A 5D27A 1FHWA 5C79A 2R0DA 2DLWA 1NU2A 2DHJA 1ZSQA 3PSCA 5KCVA 1XX0A 2YS1A 2ELBA 3PVUA 1OMWA 1DROA 4HATB 1FOEA 2ZKMX 4IFSA 2DYNA 4HB0B 4A6FA 2LULA 1DDVA 1WGUA 1P6SA 2BCJA 2DFKA 2Y8GA 3PVWA 3DXCA 2LOZA 4A6KA 2DKQA 4WJ7A 3KRWA 4IOYX 2DN6A 3CIKA 3QWMA 4D0NB 1ZVRA 3WA0A 5JHGA 2LOXA 3PP2A 1WG7A 1V5UA 5KQ4A 2Z59A 2DA0A 4HAUB 1RJ2A 3ULBA 3LJUX 4K2OA 4YL8A 1T77A 1X05A 4KHBB 1U29A 3SO6A 1QC6A 2YRYA 2OTXA 1NTVA 3OHMB 2MDXA 1EVHA 5IRSA 3RCPA 2K2JA 2KUPA 1ZC3B 1ISNA 4L6EA 1PLSA 2YSZA 2DHIA 4DXAB 4CHMA 2KUQA 2RNRB 3U7DA 4EKUA 3DCXA 2J0MA 4EJNA 3AJ4A 1V61A 4GMXB 3U12A 4OT1A 2CODA 2UZSA 4XWXA 2L2IA 3PVLA 4YONA 1NI2A 5C5BB 5D3XA 1XR0B 4MY6A 2H7EA 2GUMA 3NW8A 5M4YB 3T06A 1MK7B 3P7ZA 2Z14A 3PEGA 3ULCA 2AL6A 5J3YA 1X1FA 1W1HA 2MKRA 5D3VA 3HK0A 3M1IB 2YS5A 1I7AA 2D10A 4GNKB 3A8PA 1U5GA 2VSZA 2LG1A 1MAIA 3B77A 2GJYA 1DDMA 3SUZA 2KCJA 5DI9B 3SYXA 2NBVA 1J19A 2Y7BA 2VRWB 2P0DA 4B6HA 2XQNM 4GN1A 5HE1A 2DKPA 1WI1A 2IYBA 2EMTA 3HQCA 2J0KA 1Y5OA 1J0WA 1W1DA 2I1JA 1P5TA 4HDQA 2CRFA 2D11A 2YS3A 4D6WA 2RLOA 4P7IA 1M7RA 4MK0A 5C6RA 4PNKA 5CLLB 2ZPYA 2J0JA 2CY5A 2GCJA 2D9VA 4IAPA 1EF1A 1KZGA 3PG7A 4BBKA 3KY9A 4WSFA 2RGNB 3BJIA 4HHVA 2UVMA 2COFA 1V89A 2UZRA 2G35A 2DYQA 1XODA 2Q13A 1TQZA 2PZ1A 3AU5A 4HSIA 2K00A 2W2WA 1K5GB 5HE3A 4F7GA 2RVBB 2K8EA 2NZ8B 3O96A 3ODXA 4DIXA 2DX1A 4HB2B 2CAYA 2COAA 3D8FA 5C5BA 1XCGA 1XD4A 1KZ7A 2D9ZA 1SGHA 1UNRA 2Z4DA 4DX8A 3D8EA 4Z2MB 5LOPB 1ZM0A 1U5EA 1V5PA 2OQBA 3DXEA 4HAZB 5HE0A 5J3QA 1FB8A 4GZUA 2COCA 2HE7A 1RRPB 3KRXA 3P6AA 4QJ4B 1MK9B 3VOQA 2JP2A 1I2HA 1Y19B 3HSAA 5JP4A 4K2PA 2GCLA 3A58A 3BINA 5I2SA 1X11A 3TFMA 1MIXA 1LB1A 2DHKA 2P0FA 5FI1A 1V5MA 3D8DA 3GYOA 3TCAA 1H4RA 2H7DA 1UNQA 1TXDA 1N3HA 1GC6A 4Y94A 1W1GA 2D9XA 1WJMA 5DIFB 2W2XC 3QIJA 2FJLA 1U2BA 1KI1B 1OY2A 3NWAA 5J3TA 2K2UA 5D3WA 1M7EA 3WYFB 4EMOA 4ZRIA 1AQCA 1BTKA 4H8SA 1DDWA 2GS0A 2D4QA 4KVGB 3QBVB 2Z0QA 3PZDA 3ODOA 2FJUB 2MFQA 3V5WA 4A5KA 1OQNA 4A6HA 2Z13A 4KAXB 4KHOA 2YVCA 3NWDA 1UPRA 3NWFA 4HAXB 1BTNA 4F7HA 2VKIA 3CXBB 2M14A 4CSQA
chains in the Genus database with same CATH topology
3N7CA 5GOWB 2EJ8A 1UNPA 5L81A 1Z87A 3UZTA 1XKEA 2R09A 1EAZA 1U5FA 4GXBA 1QQGA 4MT7A 1E5WA 1LW3A 1FGYA 5HE2A 4HAWB 3FM8C 5CLQB 2X18A 3A8QA 1GC7A 3TO1A 2I5CA 1X1GA 4WVFB 3G9WA 5D3YA 3OANA 2RUKB 3X23A 2DTCA 2EMSA 2YT0A 3ZVRA 2HTHB 1SHCA 2KGXB 3FEHA 3GYPA 2LKOA 2NMBA 3F5RA 4HDOA 2IFSA 1H10A 1FHOA 2YT1A 5FI0A 4Z2NA 2N23A 4DX90 4NSWA 4K17A 4NY0A 3DXDA 1NTYA 4DBBA 2EC1A 1Q67A 1AWEA 2W2XD 3F0WA 1IRSA 2QKMA 3VIAA 4C0AA 4HB4B 1FAOA 1WGQA 1UPQA 3ML4A 3A98B 2D9WA 2M38A 4A6FB 5KQ1A 2YF0A 1FGZA 4ZRJA 3SV1A 3HW2B 4ZRKA 3ZDTA 1P3RA 1X86A 2ADZA 1U27A 5C16A 2P8VA 3AU4A 2P0HA 3MPXA 3NSUA 2ROZB 1ZC4B 1FHXA 1K5DB 4GPTB 1MIZB 1BAKA 5DHAB 1PMSA 3KSYA 3FSSA 2E2XA 1BWNA 2I1KA 4TYZA 2N0YA 1WJ1A 3IVFA 2J59M 2Y8FA 2MWNB 5LONB 5JHHA 2LYDA 4TKNA 2QKLA 1U5DA 4PQ0A 3ODWA 1PFJA 1B55A 1GG3A 3TVVA 5DH9B 1DBHA 1V88A 2V76A 1DYNA 4K81A 4KHAA 2ROVA 4HAYB 5DHFB 2RSGA 3KZ1A 3TW1A 2Z0PA 5JLJB 1MKEA 2I5FA 1WVHA 3SNHA 2D2QA 5EFXA 3MDBC 4GMVA 2Z0OA 4CYEA 1TJ6A 4HB3B 1EGXA 4F7UP 3U8ZA 1UEFA 2ELAA 4HAVB 2DX5A 2L1CA 2AEHA 4CHJA 1MPHA 2D9YA 2CY4A 5D27A 1FHWA 5C79A 2R0DA 2DLWA 1NU2A 2DHJA 1ZSQA 3PSCA 5KCVA 1XX0A 2YS1A 2ELBA 3PVUA 1OMWA 1DROA 4HATB 1FOEA 4IFSA 2DYNA 4HB0B 4A6FA 2LULA 1DDVA 1WGUA 1P6SA 2BCJA 2DFKA 2Y8GA 3PVWA 3DXCA 2LOZA 4A6KA 2DKQA 4WJ7A 3KRWA 4IOYX 2DN6A 3CIKA 3QWMA 4D0NB 1ZVRA 3WA0A 5JHGA 2LOXA 3PP2A 1WG7A 1V5UA 5KQ4A 2DA0A 4HAUB 1RJ2A 3ULBA 3LJUX 4K2OA 4YL8A 1X05A 4KHBB 1U29A 3SO6A 1QC6A 2YRYA 2OTXA 1NTVA 2MDXA 1EVHA 3RCPA 2K2JA 2KUPA 1ZC3B 1ISNA 4L6EA 1PLSA 2YSZA 2DHIA 4DXAB 4CHMA 2RNRB 3U7DA 4EKUA 2J0MA 4EJNA 3AJ4A 1V61A 4GMXB 2CODA 2UZSA 4XWXA 2L2IA 3PVLA 4YONA 1NI2A 5C5BB 5D3XA 1XR0B 4MY6A 2H7EA 3T06A 1MK7B 3P7ZA 3PEGA 3ULCA 2AL6A 5J3YA 1X1FA 1W1HA 2MKRA 5D3VA 3HK0A 3M1IB 2YS5A 1I7AA 2D10A 3A8PA 1U5GA 2VSZA 2LG1A 1MAIA 2GJYA 1DDMA 3SUZA 2KCJA 5DI9B 3SYXA 1J19A 2Y7BA 2VRWB 2P0DA 4B6HA 2XQNM 4GN1A 5HE1A 2DKPA 1WI1A 2IYBA 2EMTA 3HQCA 2J0KA 1Y5OA 1J0WA 1W1DA 2I1JA 1P5TA 4HDQA 2CRFA 2D11A 2YS3A 2RLOA 4P7IA 1M7RA 4MK0A 5C6RA 4PNKA 5CLLB 2ZPYA 2J0JA 2CY5A 2GCJA 2D9VA 4IAPA 1EF1A 1KZGA 3PG7A 4BBKA 3KY9A 4WSFA 2RGNB 3BJIA 4HHVA 2UVMA 2COFA 1V89A 2UZRA 2G35A 2DYQA 1XODA 2Q13A 1TQZA 2PZ1A 3AU5A 2K00A 2W2WA 1K5GB 5HE3A 4F7GA 2RVBB 2NZ8B 3O96A 3ODXA 2DX1A 4HB2B 2CAYA 2COAA 3D8FA 5C5BA 1XCGA 1XD4A 1KZ7A 2D9ZA 1SGHA 1UNRA 4DX8A 3D8EA 4Z2MB 5LOPB 1ZM0A 1U5EA 1V5PA 2OQBA 3DXEA 4HAZB 5HE0A 5J3QA 1FB8A 4GZUA 2COCA 2HE7A 1RRPB 3KRXA 3P6AA 1MK9B 3VOQA 2JP2A 1I2HA 1Y19B 5JP4A 4K2PA 2GCLA 3BINA 1X11A 3TFMA 1MIXA 1LB1A 2DHKA 2P0FA 5FI1A 1V5MA 3D8DA 3GYOA 3TCAA 1H4RA 2H7DA 1UNQA 1TXDA 1N3HA 1GC6A 4Y94A 1W1GA 2D9XA 1WJMA 5DIFB 2W2XC 3QIJA 2FJLA 1U2BA 1KI1B 1OY2A 5J3TA 2K2UA 5D3WA 1M7EA 3WYFB 4EMOA 4ZRIA 1AQCA 1BTKA 4H8SA 1DDWA 2GS0A 2D4QA 4KVGB 3QBVB 2Z0QA 3PZDA 3ODOA 2MFQA 3V5WA 4A5KA 1OQNA 4A6HA 4KAXB 4KHOA 2YVCA 1UPRA 4HAXB 1BTNA 4F7HA 2VKIA 3CXBB 2M14A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3N7C A;  5GOW B;  2EJ8 A;  1UNP A;  5L81 A;  1Z87 A;  3UZT A;  1XKE A;  2R09 A;  1EAZ A;  1U5F A;  4GXB A;  1QQG A;  4MT7 A;  1E5W A;  1LW3 A;  1FGY A;  5HE2 A;  4HAW B;  3FM8 C;  5CLQ B;  2X18 A;  3A8Q A;  1GC7 A;  3TO1 A;  2I5C A;  1X1G A;  4WVF B;  3G9W A;  5D3Y A;  3OAN A;  2RUK B;  3X23 A;  2DTC A;  2EMS A;  2YT0 A;  3ZVR A;  2HTH B;  1SHC A;  2KGX B;  3FEH A;  3GYP A;  2LKO A;  2NMB A;  3F5R A;  4HDO A;  2IFS A;  1H10 A;  1FHO A;  2YT1 A;  5FI0 A;  4Z2N A;  2N23 A;  4DX9 0;  4NSW A;  4K17 A;  4NY0 A;  3DXD A;  1NTY A;  4DBB A;  2EC1 A;  1Q67 A;  1AWE A;  2W2X D;  3F0W A;  1IRS A;  2QKM A;  3VIA A;  4C0A A;  4HB4 B;  1FAO A;  1WGQ A;  1UPQ A;  3ML4 A;  3A98 B;  2D9W A;  2M38 A;  4A6F B;  5KQ1 A;  2YF0 A;  1FGZ A;  4ZRJ A;  3SV1 A;  3HW2 B;  4ZRK A;  3ZDT A;  1P3R A;  1X86 A;  2ADZ A;  1U27 A;  5C16 A;  2P8V A;  3AU4 A;  2P0H A;  3MPX A;  3NSU A;  2ROZ B;  1ZC4 B;  1FHX A;  1K5D B;  4GPT B;  1MIZ B;  1BAK A;  5DHA B;  1PMS A;  3KSY A;  3FSS A;  2E2X A;  1BWN A;  2I1K A;  4TYZ A;  2N0Y A;  1WJ1 A;  3IVF A;  2J59 M;  2Y8F A;  2MWN B;  5LON B;  5JHH A;  2LYD A;  4TKN A;  2QKL A;  1U5D A;  4PQ0 A;  3ODW A;  1PFJ A;  1B55 A;  1GG3 A;  3TVV A;  5DH9 B;  1DBH A;  1V88 A;  2V76 A;  1DYN A;  4K81 A;  4KHA A;  2ROV A;  4HAY B;  5DHF B;  2RSG A;  3KZ1 A;  3TW1 A;  2Z0P A;  5JLJ B;  1MKE A;  2I5F A;  1WVH A;  3SNH A;  2D2Q A;  5EFX A;  3MDB C;  4GMV A;  2Z0O A;  4CYE A;  1TJ6 A;  4HB3 B;  1EGX A;  4F7U P;  3U8Z A;  1UEF A;  2ELA A;  4HAV B;  2DX5 A;  2L1C A;  2AEH A;  4CHJ A;  1MPH A;  2D9Y A;  2CY4 A;  5D27 A;  1FHW A;  5C79 A;  2R0D A;  2DLW A;  1NU2 A;  2DHJ A;  1ZSQ A;  3PSC A;  5KCV A;  1XX0 A;  2YS1 A;  2ELB A;  3PVU A;  1OMW A;  1DRO A;  4HAT B;  1FOE A;  4IFS A;  2DYN A;  4HB0 B;  4A6F A;  2LUL A;  1DDV A;  1WGU A;  1P6S A;  2BCJ A;  2DFK A;  2Y8G A;  3PVW A;  3DXC A;  2LOZ A;  4A6K A;  2DKQ A;  4WJ7 A;  3KRW A;  4IOY X;  2DN6 A;  3CIK A;  3QWM A;  4D0N B;  1ZVR A;  3WA0 A;  5JHG A;  2LOX A;  3PP2 A;  1WG7 A;  1V5U A;  5KQ4 A;  2DA0 A;  4HAU B;  1RJ2 A;  3ULB A;  3LJU X;  4K2O A;  4YL8 A;  1X05 A;  4KHB B;  1U29 A;  3SO6 A;  1QC6 A;  2YRY A;  2OTX A;  1NTV A;  2MDX A;  1EVH A;  3RCP A;  2K2J A;  2KUP A;  1ZC3 B;  1ISN A;  4L6E A;  1PLS A;  2YSZ A;  2DHI A;  4DXA B;  4CHM A;  2RNR B;  3U7D A;  4EKU A;  2J0M A;  4EJN A;  3AJ4 A;  1V61 A;  4GMX B;  2COD A;  2UZS A;  4XWX A;  2L2I A;  3PVL A;  4YON A;  1NI2 A;  5C5B B;  5D3X A;  1XR0 B;  4MY6 A;  2H7E A;  3T06 A;  1MK7 B;  3P7Z A;  3PEG A;  3ULC A;  2AL6 A;  5J3Y A;  1X1F A;  1W1H A;  2MKR A;  5D3V A;  3HK0 A;  3M1I B;  2YS5 A;  1I7A A;  2D10 A;  3A8P A;  1U5G A;  2VSZ A;  2LG1 A;  1MAI A;  2GJY A;  1DDM A;  3SUZ A;  2KCJ A;  5DI9 B;  3SYX A;  1J19 A;  2Y7B A;  2VRW B;  2P0D A;  4B6H A;  2XQN M;  4GN1 A;  5HE1 A;  2DKP A;  1WI1 A;  2IYB A;  2EMT A;  3HQC A;  2J0K A;  1Y5O A;  1J0W A;  1W1D A;  2I1J A;  1P5T A;  4HDQ A;  2CRF A;  2D11 A;  2YS3 A;  2RLO A;  4P7I A;  1M7R A;  4MK0 A;  5C6R A;  4PNK A;  5CLL B;  2ZPY A;  2J0J A;  2CY5 A;  2GCJ A;  2D9V A;  4IAP A;  1EF1 A;  1KZG A;  3PG7 A;  4BBK A;  3KY9 A;  4WSF A;  2RGN B;  3BJI A;  4HHV A;  2UVM A;  2COF A;  1V89 A;  2UZR A;  2G35 A;  2DYQ A;  1XOD A;  2Q13 A;  1TQZ A;  2PZ1 A;  3AU5 A;  2K00 A;  2W2W A;  1K5G B;  5HE3 A;  4F7G A;  2RVB B;  2NZ8 B;  3O96 A;  3ODX A;  2DX1 A;  4HB2 B;  2CAY A;  2COA A;  3D8F A;  5C5B A;  1XCG A;  1XD4 A;  1KZ7 A;  2D9Z A;  1SGH A;  1UNR A;  4DX8 A;  3D8E A;  4Z2M B;  5LOP B;  1ZM0 A;  1U5E A;  1V5P A;  2OQB A;  3DXE A;  4HAZ B;  5HE0 A;  5J3Q A;  1FB8 A;  4GZU A;  2COC A;  2HE7 A;  1RRP B;  3KRX A;  3P6A A;  1MK9 B;  3VOQ A;  2JP2 A;  1I2H A;  1Y19 B;  5JP4 A;  4K2P A;  2GCL A;  3BIN A;  1X11 A;  3TFM A;  1MIX A;  1LB1 A;  2DHK A;  2P0F A;  5FI1 A;  1V5M A;  3D8D A;  3GYO A;  3TCA A;  1H4R A;  2H7D A;  1UNQ A;  1TXD A;  1N3H A;  1GC6 A;  4Y94 A;  1W1G A;  2D9X A;  1WJM A;  5DIF B;  2W2X C;  3QIJ A;  2FJL A;  1U2B A;  1KI1 B;  1OY2 A;  5J3T A;  2K2U A;  5D3W A;  1M7E A;  3WYF B;  4EMO A;  4ZRI A;  1AQC A;  1BTK A;  4H8S A;  1DDW A;  2GS0 A;  2D4Q A;  4KVG B;  3QBV B;  2Z0Q A;  3PZD A;  3ODO A;  2MFQ A;  3V5W A;  4A5K A;  1OQN A;  4A6H A;  4KAX B;  4KHO A;  2YVC A;  1UPR A;  4HAX B;  1BTN A;  4F7H A;  2VKI A;  3CXB B;  2M14 A; 
#chains in the Genus database with same CATH topology
 3N7C A;  5GOW B;  2EJ8 A;  1UNP A;  2KIG A;  5L81 A;  1Z87 A;  3UZT A;  1XKE A;  2R09 A;  1EAZ A;  4OSN A;  1U5F A;  4GXB A;  1QQG A;  4MT7 A;  1E5W A;  2KR0 A;  1LW3 A;  1FGY A;  5HE2 A;  4HAW B;  3FM8 C;  5CLQ B;  2X18 A;  3A8Q A;  1GC7 A;  3TO1 A;  2I5C A;  1X1G A;  5I2M A;  4WVF B;  3G9W A;  5D3Y A;  5LG4 B;  3OAN A;  2RUK B;  3X23 A;  2DTC A;  2EMS A;  2YT0 A;  3ZVR A;  2HTH B;  1SHC A;  2KGX B;  3FEH A;  3GYP A;  2LKO A;  2NMB A;  4QXA B;  4KHB A;  3F5R A;  4HDO A;  2IFS A;  1H10 A;  1FHO A;  2YT1 A;  5FI0 A;  4Z2N A;  2N23 A;  4DX9 0;  4NSW A;  4K17 A;  4NY0 A;  3DXD A;  1NTY A;  4DBB A;  2EC1 A;  1Q67 A;  1AWE A;  2W2X D;  3F0W A;  1IRS A;  2QKM A;  3VIA A;  4C0A A;  4HB4 B;  1FAO A;  1WGQ A;  1UPQ A;  3ML4 A;  3A98 B;  2D9W A;  2M38 A;  4A6F B;  5KQ1 A;  2YF0 A;  1FGZ A;  4ZRJ A;  3SV1 A;  3HW2 B;  4ZRK A;  3ZDT A;  1P3R A;  1X86 A;  2ADZ A;  4L1R A;  1U27 A;  5C16 A;  2P8V A;  3AU4 A;  2P0H A;  2YT2 A;  3MPX A;  3NSU A;  2ROZ B;  1ZC4 B;  1FHX A;  1K5D B;  4GPT B;  2K49 A;  1MIZ B;  1BAK A;  5DHA B;  1PMS A;  3KSY A;  3FSS A;  2E2X A;  1BWN A;  2I1K A;  4TYZ A;  2N0Y A;  1WJ1 A;  3IVF A;  2J59 M;  2Y8F A;  2MWN B;  5LON B;  5JHH A;  4GOU A;  1MI1 A;  2LYD A;  4TKN A;  2QKL A;  1U5D A;  4PQ0 A;  3ODW A;  1PFJ A;  1B55 A;  1GG3 A;  2RRF A;  3TVV A;  5DH9 B;  1DBH A;  1V88 A;  2V76 A;  1DYN A;  3HIE A;  4K81 A;  4KHA A;  2ROV A;  4HAY B;  5DHF B;  2RSG A;  3KZ1 A;  3TW1 A;  2Z0P A;  5JLJ B;  1MKE A;  2I5F A;  2R2Y A;  1WVH A;  3SNH A;  2D2Q A;  5EFX A;  3MDB C;  4GMV A;  2Z0O A;  4CYE A;  4QJ5 B;  1TJ6 A;  4HB3 B;  1EGX A;  4F7U P;  3U8Z A;  1UEF A;  2ELA A;  4QJ3 B;  4HAV B;  2DX5 A;  2L1C A;  3FVC A;  2AEH A;  2KIE A;  4CHJ A;  1MPH A;  1ZYI A;  2D9Y A;  2CY4 A;  5D27 A;  1FHW A;  5C79 A;  2R0D A;  2DLW A;  1NU2 A;  2DHJ A;  1ZSQ A;  3PSC A;  5KCV A;  1XX0 A;  2YS1 A;  2ELB A;  3PVU A;  1OMW A;  1DRO A;  4HAT B;  1FOE A;  2ZKM X;  4IFS A;  2DYN A;  4HB0 B;  4A6F A;  2LUL A;  1DDV A;  1WGU A;  1P6S A;  2BCJ A;  2DFK A;  2Y8G A;  3PVW A;  3DXC A;  2LOZ A;  4A6K A;  2DKQ A;  4WJ7 A;  3KRW A;  4IOY X;  2DN6 A;  3CIK A;  3QWM A;  4D0N B;  1ZVR A;  3WA0 A;  5JHG A;  2LOX A;  3PP2 A;  1WG7 A;  1V5U A;  5KQ4 A;  2Z59 A;  2DA0 A;  4HAU B;  1RJ2 A;  3ULB A;  3LJU X;  4K2O A;  4YL8 A;  1T77 A;  1X05 A;  4KHB B;  1U29 A;  3SO6 A;  1QC6 A;  2YRY A;  2OTX A;  1NTV A;  3OHM B;  2MDX A;  1EVH A;  5IRS A;  3RCP A;  2K2J A;  2KUP A;  1ZC3 B;  1ISN A;  4L6E A;  1PLS A;  2YSZ A;  2DHI A;  4DXA B;  4CHM A;  2KUQ A;  2RNR B;  3U7D A;  4EKU A;  3DCX A;  2J0M A;  4EJN A;  3AJ4 A;  1V61 A;  4GMX B;  3U12 A;  4OT1 A;  2COD A;  2UZS A;  4XWX A;  2L2I A;  3PVL A;  4YON A;  1NI2 A;  5C5B B;  5D3X A;  1XR0 B;  4MY6 A;  2H7E A;  2GUM A;  3NW8 A;  5M4Y B;  3T06 A;  1MK7 B;  3P7Z A;  2Z14 A;  3PEG A;  3ULC A;  2AL6 A;  5J3Y A;  1X1F A;  1W1H A;  2MKR A;  5D3V A;  3HK0 A;  3M1I B;  2YS5 A;  1I7A A;  2D10 A;  4GNK B;  3A8P A;  1U5G A;  2VSZ A;  2LG1 A;  1MAI A;  3B77 A;  2GJY A;  1DDM A;  3SUZ A;  2KCJ A;  5DI9 B;  3SYX A;  2NBV A;  1J19 A;  2Y7B A;  2VRW B;  2P0D A;  4B6H A;  2XQN M;  4GN1 A;  5HE1 A;  2DKP A;  1WI1 A;  2IYB A;  2EMT A;  3HQC A;  2J0K A;  1Y5O A;  1J0W A;  1W1D A;  2I1J A;  1P5T A;  4HDQ A;  2CRF A;  2D11 A;  2YS3 A;  4D6W A;  2RLO A;  4P7I A;  1M7R A;  4MK0 A;  5C6R A;  4PNK A;  5CLL B;  2ZPY A;  2J0J A;  2CY5 A;  2GCJ A;  2D9V A;  4IAP A;  1EF1 A;  1KZG A;  3PG7 A;  4BBK A;  3KY9 A;  4WSF A;  2RGN B;  3BJI A;  4HHV A;  2UVM A;  2COF A;  1V89 A;  2UZR A;  2G35 A;  2DYQ A;  1XOD A;  2Q13 A;  1TQZ A;  2PZ1 A;  3AU5 A;  4HSI A;  2K00 A;  2W2W A;  1K5G B;  5HE3 A;  4F7G A;  2RVB B;  2K8E A;  2NZ8 B;  3O96 A;  3ODX A;  4DIX A;  2DX1 A;  4HB2 B;  2CAY A;  2COA A;  3D8F A;  5C5B A;  1XCG A;  1XD4 A;  1KZ7 A;  2D9Z A;  1SGH A;  1UNR A;  2Z4D A;  4DX8 A;  3D8E A;  4Z2M B;  5LOP B;  1ZM0 A;  1U5E A;  1V5P A;  2OQB A;  3DXE A;  4HAZ B;  5HE0 A;  5J3Q A;  1FB8 A;  4GZU A;  2COC A;  2HE7 A;  1RRP B;  3KRX A;  3P6A A;  4QJ4 B;  1MK9 B;  3VOQ A;  2JP2 A;  1I2H A;  1Y19 B;  3HSA A;  5JP4 A;  4K2P A;  2GCL A;  3A58 A;  3BIN A;  5I2S A;  1X11 A;  3TFM A;  1MIX A;  1LB1 A;  2DHK A;  2P0F A;  5FI1 A;  1V5M A;  3D8D A;  3GYO A;  3TCA A;  1H4R A;  2H7D A;  1UNQ A;  1TXD A;  1N3H A;  1GC6 A;  4Y94 A;  1W1G A;  2D9X A;  1WJM A;  5DIF B;  2W2X C;  3QIJ A;  2FJL A;  1U2B A;  1KI1 B;  1OY2 A;  3NWA A;  5J3T A;  2K2U A;  5D3W A;  1M7E A;  3WYF B;  4EMO A;  4ZRI A;  1AQC A;  1BTK A;  4H8S A;  1DDW A;  2GS0 A;  2D4Q A;  4KVG B;  3QBV B;  2Z0Q A;  3PZD A;  3ODO A;  2FJU B;  2MFQ A;  3V5W A;  4A5K A;  1OQN A;  4A6H A;  2Z13 A;  4KAX B;  4KHO A;  2YVC A;  3NWD A;  1UPR A;  3NWF A;  4HAX B;  1BTN A;  4F7H A;  2VKI A;  3CXB B;  2M14 A;  4CSQ A; 
#chains in the Genus database with same CATH homology
 3N7C A;  5GOW B;  2EJ8 A;  1UNP A;  5L81 A;  1Z87 A;  3UZT A;  1XKE A;  2R09 A;  1EAZ A;  1U5F A;  4GXB A;  1QQG A;  4MT7 A;  1E5W A;  1LW3 A;  1FGY A;  5HE2 A;  4HAW B;  3FM8 C;  5CLQ B;  2X18 A;  3A8Q A;  1GC7 A;  3TO1 A;  2I5C A;  1X1G A;  4WVF B;  3G9W A;  5D3Y A;  3OAN A;  2RUK B;  3X23 A;  2DTC A;  2EMS A;  2YT0 A;  3ZVR A;  2HTH B;  1SHC A;  2KGX B;  3FEH A;  3GYP A;  2LKO A;  2NMB A;  3F5R A;  4HDO A;  2IFS A;  1H10 A;  1FHO A;  2YT1 A;  5FI0 A;  4Z2N A;  2N23 A;  4DX9 0;  4NSW A;  4K17 A;  4NY0 A;  3DXD A;  1NTY A;  4DBB A;  2EC1 A;  1Q67 A;  1AWE A;  2W2X D;  3F0W A;  1IRS A;  2QKM A;  3VIA A;  4C0A A;  4HB4 B;  1FAO A;  1WGQ A;  1UPQ A;  3ML4 A;  3A98 B;  2D9W A;  2M38 A;  4A6F B;  5KQ1 A;  2YF0 A;  1FGZ A;  4ZRJ A;  3SV1 A;  3HW2 B;  4ZRK A;  3ZDT A;  1P3R A;  1X86 A;  2ADZ A;  1U27 A;  5C16 A;  2P8V A;  3AU4 A;  2P0H A;  3MPX A;  3NSU A;  2ROZ B;  1ZC4 B;  1FHX A;  1K5D B;  4GPT B;  1MIZ B;  1BAK A;  5DHA B;  1PMS A;  3KSY A;  3FSS A;  2E2X A;  1BWN A;  2I1K A;  4TYZ A;  2N0Y A;  1WJ1 A;  3IVF A;  2J59 M;  2Y8F A;  2MWN B;  5LON B;  5JHH A;  2LYD A;  4TKN A;  2QKL A;  1U5D A;  4PQ0 A;  3ODW A;  1PFJ A;  1B55 A;  1GG3 A;  3TVV A;  5DH9 B;  1DBH A;  1V88 A;  2V76 A;  1DYN A;  4K81 A;  4KHA A;  2ROV A;  4HAY B;  5DHF B;  2RSG A;  3KZ1 A;  3TW1 A;  2Z0P A;  5JLJ B;  1MKE A;  2I5F A;  1WVH A;  3SNH A;  2D2Q A;  5EFX A;  3MDB C;  4GMV A;  2Z0O A;  4CYE A;  1TJ6 A;  4HB3 B;  1EGX A;  4F7U P;  3U8Z A;  1UEF A;  2ELA A;  4HAV B;  2DX5 A;  2L1C A;  2AEH A;  4CHJ A;  1MPH A;  2D9Y A;  2CY4 A;  5D27 A;  1FHW A;  5C79 A;  2R0D A;  2DLW A;  1NU2 A;  2DHJ A;  1ZSQ A;  3PSC A;  5KCV A;  1XX0 A;  2YS1 A;  2ELB A;  3PVU A;  1OMW A;  1DRO A;  4HAT B;  1FOE A;  4IFS A;  2DYN A;  4HB0 B;  4A6F A;  2LUL A;  1DDV A;  1WGU A;  1P6S A;  2BCJ A;  2DFK A;  2Y8G A;  3PVW A;  3DXC A;  2LOZ A;  4A6K A;  2DKQ A;  4WJ7 A;  3KRW A;  4IOY X;  2DN6 A;  3CIK A;  3QWM A;  4D0N B;  1ZVR A;  3WA0 A;  5JHG A;  2LOX A;  3PP2 A;  1WG7 A;  1V5U A;  5KQ4 A;  2DA0 A;  4HAU B;  1RJ2 A;  3ULB A;  3LJU X;  4K2O A;  4YL8 A;  1X05 A;  4KHB B;  1U29 A;  3SO6 A;  1QC6 A;  2YRY A;  2OTX A;  1NTV A;  2MDX A;  1EVH A;  3RCP A;  2K2J A;  2KUP A;  1ZC3 B;  1ISN A;  4L6E A;  1PLS A;  2YSZ A;  2DHI A;  4DXA B;  4CHM A;  2RNR B;  3U7D A;  4EKU A;  2J0M A;  4EJN A;  3AJ4 A;  1V61 A;  4GMX B;  2COD A;  2UZS A;  4XWX A;  2L2I A;  3PVL A;  4YON A;  1NI2 A;  5C5B B;  5D3X A;  1XR0 B;  4MY6 A;  2H7E A;  3T06 A;  1MK7 B;  3P7Z A;  3PEG A;  3ULC A;  2AL6 A;  5J3Y A;  1X1F A;  1W1H A;  2MKR A;  5D3V A;  3HK0 A;  3M1I B;  2YS5 A;  1I7A A;  2D10 A;  3A8P A;  1U5G A;  2VSZ A;  2LG1 A;  1MAI A;  2GJY A;  1DDM A;  3SUZ A;  2KCJ A;  5DI9 B;  3SYX A;  1J19 A;  2Y7B A;  2VRW B;  2P0D A;  4B6H A;  2XQN M;  4GN1 A;  5HE1 A;  2DKP A;  1WI1 A;  2IYB A;  2EMT A;  3HQC A;  2J0K A;  1Y5O A;  1J0W A;  1W1D A;  2I1J A;  1P5T A;  4HDQ A;  2CRF A;  2D11 A;  2YS3 A;  2RLO A;  4P7I A;  1M7R A;  4MK0 A;  5C6R A;  4PNK A;  5CLL B;  2ZPY A;  2J0J A;  2CY5 A;  2GCJ A;  2D9V A;  4IAP A;  1EF1 A;  1KZG A;  3PG7 A;  4BBK A;  3KY9 A;  4WSF A;  2RGN B;  3BJI A;  4HHV A;  2UVM A;  2COF A;  1V89 A;  2UZR A;  2G35 A;  2DYQ A;  1XOD A;  2Q13 A;  1TQZ A;  2PZ1 A;  3AU5 A;  2K00 A;  2W2W A;  1K5G B;  5HE3 A;  4F7G A;  2RVB B;  2NZ8 B;  3O96 A;  3ODX A;  2DX1 A;  4HB2 B;  2CAY A;  2COA A;  3D8F A;  5C5B A;  1XCG A;  1XD4 A;  1KZ7 A;  2D9Z A;  1SGH A;  1UNR A;  4DX8 A;  3D8E A;  4Z2M B;  5LOP B;  1ZM0 A;  1U5E A;  1V5P A;  2OQB A;  3DXE A;  4HAZ B;  5HE0 A;  5J3Q A;  1FB8 A;  4GZU A;  2COC A;  2HE7 A;  1RRP B;  3KRX A;  3P6A A;  1MK9 B;  3VOQ A;  2JP2 A;  1I2H A;  1Y19 B;  5JP4 A;  4K2P A;  2GCL A;  3BIN A;  1X11 A;  3TFM A;  1MIX A;  1LB1 A;  2DHK A;  2P0F A;  5FI1 A;  1V5M A;  3D8D A;  3GYO A;  3TCA A;  1H4R A;  2H7D A;  1UNQ A;  1TXD A;  1N3H A;  1GC6 A;  4Y94 A;  1W1G A;  2D9X A;  1WJM A;  5DIF B;  2W2X C;  3QIJ A;  2FJL A;  1U2B A;  1KI1 B;  1OY2 A;  5J3T A;  2K2U A;  5D3W A;  1M7E A;  3WYF B;  4EMO A;  4ZRI A;  1AQC A;  1BTK A;  4H8S A;  1DDW A;  2GS0 A;  2D4Q A;  4KVG B;  3QBV B;  2Z0Q A;  3PZD A;  3ODO A;  2MFQ A;  3V5W A;  4A5K A;  1OQN A;  4A6H A;  4KAX B;  4KHO A;  2YVC A;  1UPR A;  4HAX B;  1BTN A;  4F7H A;  2VKI A;  3CXB B;  2M14 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...