2MDXA

Solution structure of the human wild type fapp1-ph domain
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
108
structure length
108
Chain Sequence
GPLGSPEFMEGVLYKWTNYLTGWQPRWFVLDNGILSYYDSQDDVCKGSKGSIKMAVCEIKVHSADNTRMELIIPGEQHFYMKAVNAAERQRWLVALGSSKACLTDTRT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pleckstrin homology domain-containing family A member 3
publication title Solution structure of the human wild type FAPP1-PH domain
rcsb
source organism Homo sapiens
molecule tags Membrane protein
total genus 17
structure length 108
sequence length 108
ec nomenclature
pdb deposition date 2013-09-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00169 PH PH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2mdxA00
3D8DA 1BWNA 2OTXA 2PZ1A 3SO6A 2RVBB 3TCAA 1DYNA 4XWXA 5C6RA 4HHVA 1J0WA 1TXDA 2J0JA 2K2JA 1X86A 4L6EA 4GXBA 1U29A 2YSZA 2D9ZA 1V61A 2Z0PA 1OMWA 5J3TA 5DI9B 4Z2NA 1WGQA 4C0AA 1TJ6A 3FEHA 3RCPA 4EJNA 4NSWA 2N0YA 1EF1A 5D3XA 2RSGA 1WJ1A 2CRFA 1I2HA 2ADZA 2I5FA 4HAYB 3KSYA 1U5GA 1BTNA 1LB1A 3WA0A 4DXAB 2LKOA 4HB3B 4WJ7A 4P7IA 1UNQA 2M38A 1WG7A 2DKPA 3V5WA 1W1GA 5DHAB 4YONA 1AQCA 5LOPB 3T06A 4CHJA 2AEHA 2EJ8A 4F7UP 1RJ2A 3TW1A 4HAVB 2KGXB 1X1FA 4GMXB 1IRSA 2LG1A 2RLOA 2P0FA 5FI1A 5JHHA 4ZRIA 1FHWA 1V88A 1ISNA 2UVMA 2ROVA 3A8PA 1EAZA 5D27A 4IOYX 2J0KA 2CODA 2Z0QA 1P5TA 3OANA 4DBBA 2IFSA 3AU5A 5FI0A 1ZSQA 2DLWA 2VRWB 4GN1A 1X11A 3DXCA 1U5EA 2EMTA 5L81A 4WSFA 1FB8A 3QBVB 2N23A 3D8EA 3G9WA 2X18A 2W2WA 4IAPA 2YS5A 2KCJA 3PZDA 2DYNA 3P7ZA 4D0NB 4GMVA 2D9VA 4HAUB 2COAA 1DDMA 1H10A 1QQGA 1I7AA 3ULBA 1MAIA 4KHAA 5JHGA 1NTVA 5HE3A 3WYFB 2NZ8B 1ZM0A 3PVWA 1H4RA 1Y5OA 2JP2A 1FOEA 1MK7B 4ZRKA 2HTHB 1FHOA 1WVHA 3KRWA 3IVFA 3PVLA 1GC6A 2I5CA 3A98B 2DHIA 3LJUX 1BAKA 5D3WA 2LOZA 4IFSA 1GG3A 4MK0A 1KI1B 1M7EA 2EMSA 1N3HA 4BBKA 3PP2A 4KHOA 4K2PA 2ELAA 2MDXA 3FSSA 4KHBB 1E5WA 5HE2A 1WJMA 3PSCA 4HB2B 2W2XC 3SNHA 4PNKA 2YS3A 4F7GA 4Y94A 2DA0A 4HB4B 1P3RA 1TQZA 3X23A 1B55A 2XQNM 4A6KA 1AWEA 2D9YA 3U7DA 2DHKA 2UZRA 3D8FA 3SYXA 1SGHA 2MKRA 1UPRA 2D9XA 3FM8C 4EMOA 1KZGA 5EFXA 5C5BA 2YT0A 1X1GA 4HAZB 4KAXB 2G35A 4CHMA 1XX0A 2CAYA 1XKEA 3KZ1A 2YVCA 2M14A 3U8ZA 3BINA 4B6HA 2COCA 1XR0B 5C16A 2YS1A 2ROZB 3KY9A 2P0HA 4ZRJA 5HE1A 2KUPA 2I1KA 4K81A 3UZTA 4H8SA 2RUKB 4HDQA 1FGYA 2YT1A 2R09A 3VIAA 4A6HA 1GC7A 2DHJA 4HDOA 1UNPA 1P6SA 2YRYA 1NTYA 2QKMA 4TKNA 3VOQA 2GS0A 1K5DB 1Q67A 3ZVRA 2AL6A 1OY2A 3F5RA 2Y8GA 2H7DA 3PVUA 1DDWA 1Z87A 3GYOA 2K2UA 4CYEA 3ZDTA 4GPTB 1K5GB 2CY4A 4EKUA 4K17A 5D3VA 4Z2MB 3HQCA 1W1HA 4KVGB 2MWNB 2H7EA 1M7RA 2Y8FA 3ODWA 4DX8A 2QKLA 3P6AA 3ODXA 3N7CA 1ZVRA 5C5BB 3TO1A 2DTCA 5HE0A 2GCLA 1PFJA 3KRXA 1MPHA 1U2BA 1QC6A 2UZSA 4WVFB 2ELBA 2K00A 1J19A 5DH9B 4F7HA 2VSZA 2W2XD 1DDVA 1XCGA 4HATB 5CLLB 1MK9B 2DYQA 2EC1A 4HB0B 1V5MA 1W1DA 2GJYA 2RGNB 2COFA 2YF0A 1BTKA 1V89A 3M1IB 1LW3A 2DKQA 3AU4A 5JLJB 2Z0OA 4NY0A 5DHFB 1FHXA 2ZPYA 5D3YA 1SHCA 2I1JA 2R0DA 2D2QA 3SV1A 4DX90 2D9WA 4PQ0A 3DXEA 3QWMA 2NMBA 2CY5A 1KZ7A 3BJIA 1WGUA 1EVHA 2MFQA 2DX5A 1NU2A 2IYBA 4A6FB 3MDBC 1UEFA 3AJ4A 1V5UA 1X05A 3PEGA 2LULA 1DBHA 2E2XA 3F0WA 3GYPA 3HK0A 2Q13A 1V5PA 5DIFB 2VKIA 1NI2A 4A5KA 4GZUA 1U5DA 4HAXB 3NSUA 2LOXA 2P0DA 4K2OA 2RNRB 2D4QA 5JP4A 3PG7A 4MT7A 2LYDA 1OQNA 3CXBB 1PMSA 1WI1A 1Y19B 5LONB 3SUZA 3QIJA 2P8VA 2Y7BA 2V76A 2FJLA 5CLQB 5J3YA 3TFMA 4MY6A 1U5FA 4A6FA 1MKEA 2L2IA 2D11A 1EGXA 3MPXA 3O96A 3CIKA 2BCJA 4HAWB 3DXDA 1MIXA 5KCVA 2DX1A 1PLSA 3A8QA 2DN6A 2DFKA 5GOWB 2HE7A 4YL8A 1DROA 4TYZA 3ULCA 5KQ4A 2OQBA 1RRPB 1ZC3B 1UNRA 2L1CA 1UPQA 1XODA 5J3QA 1ZC4B 2D10A 5KQ1A 3HW2B 5C79A 3ODOA 2J59M 1FGZA 1U27A 1XD4A 3TVVA 2GCJA 1MIZB 2J0MA 3ML4A 1FAOA
chains in the Genus database with same CATH superfamily
3D8DA 1BWNA 2OTXA 2PZ1A 3SO6A 2RVBB 3TCAA 1DYNA 4XWXA 5C6RA 4HHVA 1J0WA 1TXDA 2J0JA 2K2JA 1X86A 4L6EA 4GXBA 1U29A 2YSZA 2D9ZA 1V61A 2Z0PA 1OMWA 5J3TA 5DI9B 4Z2NA 1WGQA 4C0AA 1TJ6A 3FEHA 3RCPA 1ZYIA 4EJNA 4NSWA 2N0YA 1EF1A 5D3XA 2RSGA 1WJ1A 2CRFA 1I2HA 2ADZA 2I5FA 4HAYB 3KSYA 1U5GA 5I2MA 1BTNA 3DCXA 1LB1A 3WA0A 4DXAB 2LKOA 4HB3B 4WJ7A 4P7IA 1UNQA 2M38A 1WG7A 2DKPA 3V5WA 1W1GA 5DHAB 4YONA 1AQCA 5LOPB 3T06A 4CHJA 2AEHA 2EJ8A 4F7UP 1RJ2A 3TW1A 4HAVB 2KGXB 2KUQA 1X1FA 4GMXB 1IRSA 2LG1A 4L1RA 2RLOA 2P0FA 5FI1A 5JHHA 4ZRIA 1FHWA 1V88A 1ISNA 2UVMA 2ROVA 3A8PA 1EAZA 5D27A 4IOYX 4KHBA 2J0KA 2CODA 2Z0QA 3U12A 1P5TA 3OANA 4DBBA 2IFSA 2Z14A 3AU5A 5FI0A 1ZSQA 2DLWA 2VRWB 4GN1A 1X11A 3DXCA 1U5EA 2EMTA 5L81A 4WSFA 1FB8A 2R2YA 3QBVB 2KIGA 1T77A 2N23A 5LG4B 3D8EA 3G9WA 2X18A 2W2WA 4IAPA 2YS5A 2KCJA 2NBVA 3PZDA 2DYNA 3P7ZA 4D0NB 4GMVA 2D9VA 4HAUB 2COAA 1DDMA 1H10A 1QQGA 1I7AA 3ULBA 1MAIA 4KHAA 4DIXA 5JHGA 1NTVA 5HE3A 3WYFB 2NZ8B 1ZM0A 3PVWA 1H4RA 1Y5OA 2JP2A 1FOEA 1MK7B 4ZRKA 2HTHB 3FVCA 2ZKMX 1FHOA 1WVHA 3KRWA 3IVFA 3PVLA 1GC6A 2GUMA 2I5CA 3A98B 2DHIA 4OT1A 3LJUX 1BAKA 5D3WA 2K49A 4QJ5B 2LOZA 4IFSA 1GG3A 4MK0A 1KI1B 1M7EA 2EMSA 4CSQA 2FJUB 1N3HA 4BBKA 3PP2A 4KHOA 4K2PA 3HIEA 2ELAA 2MDXA 3FSSA 4KHBB 1E5WA 5HE2A 1WJMA 2Z59A 3PSCA 4HB2B 2W2XC 3SNHA 4PNKA 2YS3A 4F7GA 4Y94A 2DA0A 4HB4B 1P3RA 1TQZA 3X23A 1B55A 2XQNM 4A6KA 1AWEA 2D9YA 3U7DA 2DHKA 2UZRA 3D8FA 3SYXA 1SGHA 2MKRA 1UPRA 2D9XA 3FM8C 4EMOA 1KZGA 5EFXA 5C5BA 2YT0A 1X1GA 4HAZB 4KAXB 2G35A 4CHMA 1XX0A 2CAYA 1XKEA 3KZ1A 2YVCA 3A58A 2M14A 3U8ZA 3BINA 4B6HA 2COCA 1XR0B 5C16A 2YS1A 2ROZB 3KY9A 2P0HA 4ZRJA 5HE1A 2KUPA 2I1KA 4K81A 3UZTA 2KR0A 4H8SA 4OSNA 2RUKB 4HDQA 1FGYA 2YT1A 2R09A 3VIAA 4A6HA 1GC7A 2DHJA 3ML4A 4QXAB 4HDOA 1UNPA 1P6SA 2YRYA 1NTYA 2QKMA 4TKNA 3VOQA 2GS0A 4GNKB 4D6WA 1K5DB 4QJ3B 1Q67A 3ZVRA 2AL6A 1OY2A 3F5RA 2Y8GA 2H7DA 3PVUA 1DDWA 1Z87A 3GYOA 2K2UA 4CYEA 3ZDTA 4GPTB 1K5GB 2CY4A 4EKUA 4K17A 5D3VA 4Z2MB 3HQCA 1W1HA 3NWFA 4KVGB 2MWNB 2H7EA 1M7RA 2Y8FA 3ODWA 4DX8A 2QKLA 3P6AA 3ODXA 3N7CA 1ZVRA 5C5BB 3TO1A 2DTCA 5HE0A 2GCLA 1PFJA 2RRFA 3KRXA 1MPHA 1U2BA 1QC6A 2UZSA 4WVFB 2ELBA 2K00A 1J19A 5DH9B 4F7HA 2VSZA 2W2XD 1DDVA 1XCGA 4HATB 5CLLB 1MK9B 2DYQA 2EC1A 4HB0B 1V5MA 1W1DA 2GJYA 2RGNB 2COFA 2YF0A 1BTKA 1V89A 3M1IB 1LW3A 2DKQA 3AU4A 5JLJB 2Z0OA 4NY0A 5DHFB 1FHXA 2ZPYA 5D3YA 1SHCA 2I1JA 2R0DA 2D2QA 3SV1A 5M4YB 4DX90 2YT2A 2D9WA 4PQ0A 3DXEA 3QWMA 2NMBA 2CY5A 1KZ7A 3BJIA 1WGUA 1EVHA 2MFQA 2DX5A 1NU2A 2IYBA 2Z13A 4A6FB 5IRSA 3MDBC 1MI1A 1UEFA 3AJ4A 1V5UA 1X05A 2KIEA 3PEGA 3NWAA 3NWDA 2LULA 1DBHA 2E2XA 3OHMB 3F0WA 3GYPA 3HK0A 2Q13A 5I2SA 1V5PA 5DIFB 2VKIA 4HSIA 1NI2A 4GOUA 4A5KA 4GZUA 1U5DA 4HAXB 3NSUA 2LOXA 2P0DA 4K2OA 2RNRB 2Z4DA 2D4QA 5JP4A 3PG7A 4MT7A 2LYDA 1OQNA 3CXBB 1PMSA 1WI1A 1Y19B 5LONB 3SUZA 3QIJA 2P8VA 2Y7BA 2V76A 2FJLA 5CLQB 5J3YA 3TFMA 4MY6A 1U5FA 4A6FA 1MKEA 2L2IA 2D11A 2K8EA 1EGXA 3MPXA 3O96A 3CIKA 2BCJA 4HAWB 3DXDA 1MIXA 5KCVA 2DX1A 3A8QA 2DN6A 2DFKA 5GOWB 4QJ4B 2HE7A 4YL8A 1DROA 4TYZA 3ULCA 5KQ4A 2OQBA 1RRPB 1ZC3B 1UNRA 2L1CA 1UPQA 3HSAA 3B77A 1XODA 5J3QA 1ZC4B 2D10A 5KQ1A 3HW2B 3NW8A 5C79A 3ODOA 2J59M 1FGZA 1U27A 1XD4A 3TVVA 2GCJA 1MIZB 2J0MA 1PLSA 1FAOA
chains in the Genus database with same CATH topology
3D8DA 1BWNA 2OTXA 2PZ1A 3SO6A 2RVBB 3TCAA 1DYNA 4XWXA 5C6RA 4HHVA 1J0WA 1TXDA 2J0JA 2K2JA 1X86A 4L6EA 4GXBA 1U29A 2YSZA 2D9ZA 1V61A 2Z0PA 1OMWA 5J3TA 5DI9B 4Z2NA 1WGQA 4C0AA 1TJ6A 3FEHA 3RCPA 4EJNA 4NSWA 2N0YA 1EF1A 5D3XA 2RSGA 1WJ1A 2CRFA 1I2HA 2ADZA 2I5FA 4HAYB 3KSYA 1U5GA 1BTNA 1LB1A 3WA0A 4DXAB 2LKOA 4HB3B 4WJ7A 4P7IA 1UNQA 2M38A 1WG7A 2DKPA 3V5WA 1W1GA 5DHAB 4YONA 1AQCA 5LOPB 3T06A 4CHJA 2AEHA 2EJ8A 4F7UP 1RJ2A 3TW1A 4HAVB 2KGXB 1X1FA 4GMXB 1IRSA 2LG1A 2RLOA 2P0FA 5FI1A 5JHHA 4ZRIA 1FHWA 1V88A 1ISNA 2UVMA 2ROVA 3A8PA 1EAZA 5D27A 4IOYX 2J0KA 2CODA 2Z0QA 1P5TA 3OANA 4DBBA 2IFSA 3AU5A 5FI0A 1ZSQA 2DLWA 2VRWB 4GN1A 1X11A 3DXCA 1U5EA 2EMTA 5L81A 4WSFA 1FB8A 3QBVB 2N23A 3D8EA 3G9WA 2X18A 2W2WA 4IAPA 2YS5A 2KCJA 3PZDA 2DYNA 3P7ZA 4D0NB 4GMVA 2D9VA 4HAUB 2COAA 1DDMA 1H10A 1QQGA 1I7AA 3ULBA 1MAIA 4KHAA 5JHGA 1NTVA 5HE3A 3WYFB 2NZ8B 1ZM0A 3PVWA 1H4RA 1Y5OA 2JP2A 1FOEA 1MK7B 4ZRKA 2HTHB 1FHOA 1WVHA 3KRWA 3IVFA 3PVLA 1GC6A 2I5CA 3A98B 2DHIA 3LJUX 1BAKA 5D3WA 2LOZA 4IFSA 1GG3A 4MK0A 1KI1B 1M7EA 2EMSA 1N3HA 4BBKA 3PP2A 4KHOA 4K2PA 2ELAA 2MDXA 3FSSA 4KHBB 1E5WA 5HE2A 1WJMA 3PSCA 4HB2B 2W2XC 3SNHA 4PNKA 2YS3A 4F7GA 4Y94A 2DA0A 4HB4B 1P3RA 1TQZA 3X23A 1B55A 2XQNM 4A6KA 1AWEA 2D9YA 3U7DA 2DHKA 2UZRA 3D8FA 3SYXA 1SGHA 2MKRA 1UPRA 2D9XA 3FM8C 4EMOA 1KZGA 5EFXA 5C5BA 2YT0A 1X1GA 4HAZB 4KAXB 2G35A 4CHMA 1XX0A 2CAYA 1XKEA 3KZ1A 2YVCA 2M14A 3U8ZA 3BINA 4B6HA 2COCA 1XR0B 5C16A 2YS1A 2ROZB 3KY9A 2P0HA 4ZRJA 5HE1A 2KUPA 2I1KA 4K81A 3UZTA 4H8SA 2RUKB 4HDQA 1FGYA 2YT1A 2R09A 3VIAA 4A6HA 1GC7A 2DHJA 4HDOA 1UNPA 1P6SA 2YRYA 1NTYA 2QKMA 4TKNA 3VOQA 2GS0A 1K5DB 1Q67A 3ZVRA 2AL6A 1OY2A 3F5RA 2Y8GA 2H7DA 3PVUA 1DDWA 1Z87A 3GYOA 2K2UA 4CYEA 3ZDTA 4GPTB 1K5GB 2CY4A 4EKUA 4K17A 5D3VA 4Z2MB 3HQCA 1W1HA 4KVGB 2MWNB 2H7EA 1M7RA 2Y8FA 3ODWA 4DX8A 2QKLA 3P6AA 3ODXA 3N7CA 1ZVRA 5C5BB 3TO1A 2DTCA 5HE0A 2GCLA 1PFJA 3KRXA 1MPHA 1U2BA 1QC6A 2UZSA 4WVFB 2ELBA 2K00A 1J19A 5DH9B 4F7HA 2VSZA 2W2XD 1DDVA 1XCGA 4HATB 5CLLB 1MK9B 2DYQA 2EC1A 4HB0B 1V5MA 1W1DA 2GJYA 2RGNB 2COFA 2YF0A 1BTKA 1V89A 3M1IB 1LW3A 2DKQA 3AU4A 5JLJB 2Z0OA 4NY0A 5DHFB 1FHXA 2ZPYA 5D3YA 1SHCA 2I1JA 2R0DA 2D2QA 3SV1A 4DX90 2D9WA 4PQ0A 3DXEA 3QWMA 2NMBA 2CY5A 1KZ7A 3BJIA 1WGUA 1EVHA 2MFQA 2DX5A 1NU2A 2IYBA 4A6FB 3MDBC 1UEFA 3AJ4A 1V5UA 1X05A 3PEGA 2LULA 1DBHA 2E2XA 3F0WA 3GYPA 3HK0A 2Q13A 1V5PA 5DIFB 2VKIA 1NI2A 4A5KA 4GZUA 1U5DA 4HAXB 3NSUA 2LOXA 2P0DA 4K2OA 2RNRB 2D4QA 5JP4A 3PG7A 4MT7A 2LYDA 1OQNA 3CXBB 1PMSA 1WI1A 1Y19B 5LONB 3SUZA 3QIJA 2P8VA 2Y7BA 2V76A 2FJLA 5CLQB 5J3YA 3TFMA 4MY6A 1U5FA 4A6FA 1MKEA 2L2IA 2D11A 1EGXA 3MPXA 3O96A 3CIKA 2BCJA 4HAWB 3DXDA 1MIXA 5KCVA 2DX1A 1PLSA 3A8QA 2DN6A 2DFKA 5GOWB 2HE7A 4YL8A 1DROA 4TYZA 3ULCA 5KQ4A 2OQBA 1RRPB 1ZC3B 1UNRA 2L1CA 1UPQA 1XODA 5J3QA 1ZC4B 2D10A 5KQ1A 3HW2B 5C79A 3ODOA 2J59M 1FGZA 1U27A 1XD4A 3TVVA 2GCJA 1MIZB 2J0MA 3ML4A 1FAOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3D8D A;  1BWN A;  2OTX A;  2PZ1 A;  3SO6 A;  2RVB B;  3TCA A;  1DYN A;  4XWX A;  5C6R A;  4HHV A;  1J0W A;  1TXD A;  2J0J A;  2K2J A;  1X86 A;  4L6E A;  4GXB A;  1U29 A;  2YSZ A;  2D9Z A;  1V61 A;  2Z0P A;  1OMW A;  5J3T A;  5DI9 B;  4Z2N A;  1WGQ A;  4C0A A;  1TJ6 A;  3FEH A;  3RCP A;  4EJN A;  4NSW A;  2N0Y A;  1EF1 A;  5D3X A;  2RSG A;  1WJ1 A;  2CRF A;  1I2H A;  2ADZ A;  2I5F A;  4HAY B;  3KSY A;  1U5G A;  1BTN A;  1LB1 A;  3WA0 A;  4DXA B;  2LKO A;  4HB3 B;  4WJ7 A;  4P7I A;  1UNQ A;  2M38 A;  1WG7 A;  2DKP A;  3V5W A;  1W1G A;  5DHA B;  4YON A;  1AQC A;  5LOP B;  3T06 A;  4CHJ A;  2AEH A;  2EJ8 A;  4F7U P;  1RJ2 A;  3TW1 A;  4HAV B;  2KGX B;  1X1F A;  4GMX B;  1IRS A;  2LG1 A;  2RLO A;  2P0F A;  5FI1 A;  5JHH A;  4ZRI A;  1FHW A;  1V88 A;  1ISN A;  2UVM A;  2ROV A;  3A8P A;  1EAZ A;  5D27 A;  4IOY X;  2J0K A;  2COD A;  2Z0Q A;  1P5T A;  3OAN A;  4DBB A;  2IFS A;  3AU5 A;  5FI0 A;  1ZSQ A;  2DLW A;  2VRW B;  4GN1 A;  1X11 A;  3DXC A;  1U5E A;  2EMT A;  5L81 A;  4WSF A;  1FB8 A;  3QBV B;  2N23 A;  3D8E A;  3G9W A;  2X18 A;  2W2W A;  4IAP A;  2YS5 A;  2KCJ A;  3PZD A;  2DYN A;  3P7Z A;  4D0N B;  4GMV A;  2D9V A;  4HAU B;  2COA A;  1DDM A;  1H10 A;  1QQG A;  1I7A A;  3ULB A;  1MAI A;  4KHA A;  5JHG A;  1NTV A;  5HE3 A;  3WYF B;  2NZ8 B;  1ZM0 A;  3PVW A;  1H4R A;  1Y5O A;  2JP2 A;  1FOE A;  1MK7 B;  4ZRK A;  2HTH B;  1FHO A;  1WVH A;  3KRW A;  3IVF A;  3PVL A;  1GC6 A;  2I5C A;  3A98 B;  2DHI A;  3LJU X;  1BAK A;  5D3W A;  2LOZ A;  4IFS A;  1GG3 A;  4MK0 A;  1KI1 B;  1M7E A;  2EMS A;  1N3H A;  4BBK A;  3PP2 A;  4KHO A;  4K2P A;  2ELA A;  2MDX A;  3FSS A;  4KHB B;  1E5W A;  5HE2 A;  1WJM A;  3PSC A;  4HB2 B;  2W2X C;  3SNH A;  4PNK A;  2YS3 A;  4F7G A;  4Y94 A;  2DA0 A;  4HB4 B;  1P3R A;  1TQZ A;  3X23 A;  1B55 A;  2XQN M;  4A6K A;  1AWE A;  2D9Y A;  3U7D A;  2DHK A;  2UZR A;  3D8F A;  3SYX A;  1SGH A;  2MKR A;  1UPR A;  2D9X A;  3FM8 C;  4EMO A;  1KZG A;  5EFX A;  5C5B A;  2YT0 A;  1X1G A;  4HAZ B;  4KAX B;  2G35 A;  4CHM A;  1XX0 A;  2CAY A;  1XKE A;  3KZ1 A;  2YVC A;  2M14 A;  3U8Z A;  3BIN A;  4B6H A;  2COC A;  1XR0 B;  5C16 A;  2YS1 A;  2ROZ B;  3KY9 A;  2P0H A;  4ZRJ A;  5HE1 A;  2KUP A;  2I1K A;  4K81 A;  3UZT A;  4H8S A;  2RUK B;  4HDQ A;  1FGY A;  2YT1 A;  2R09 A;  3VIA A;  4A6H A;  1GC7 A;  2DHJ A;  4HDO A;  1UNP A;  1P6S A;  2YRY A;  1NTY A;  2QKM A;  4TKN A;  3VOQ A;  2GS0 A;  1K5D B;  1Q67 A;  3ZVR A;  2AL6 A;  1OY2 A;  3F5R A;  2Y8G A;  2H7D A;  3PVU A;  1DDW A;  1Z87 A;  3GYO A;  2K2U A;  4CYE A;  3ZDT A;  4GPT B;  1K5G B;  2CY4 A;  4EKU A;  4K17 A;  5D3V A;  4Z2M B;  3HQC A;  1W1H A;  4KVG B;  2MWN B;  2H7E A;  1M7R A;  2Y8F A;  3ODW A;  4DX8 A;  2QKL A;  3P6A A;  3ODX A;  3N7C A;  1ZVR A;  5C5B B;  3TO1 A;  2DTC A;  5HE0 A;  2GCL A;  1PFJ A;  3KRX A;  1MPH A;  1U2B A;  1QC6 A;  2UZS A;  4WVF B;  2ELB A;  2K00 A;  1J19 A;  5DH9 B;  4F7H A;  2VSZ A;  2W2X D;  1DDV A;  1XCG A;  4HAT B;  5CLL B;  1MK9 B;  2DYQ A;  2EC1 A;  4HB0 B;  1V5M A;  1W1D A;  2GJY A;  2RGN B;  2COF A;  2YF0 A;  1BTK A;  1V89 A;  3M1I B;  1LW3 A;  2DKQ A;  3AU4 A;  5JLJ B;  2Z0O A;  4NY0 A;  5DHF B;  1FHX A;  2ZPY A;  5D3Y A;  1SHC A;  2I1J A;  2R0D A;  2D2Q A;  3SV1 A;  4DX9 0;  2D9W A;  4PQ0 A;  3DXE A;  3QWM A;  2NMB A;  2CY5 A;  1KZ7 A;  3BJI A;  1WGU A;  1EVH A;  2MFQ A;  2DX5 A;  1NU2 A;  2IYB A;  4A6F B;  3MDB C;  1UEF A;  3AJ4 A;  1V5U A;  1X05 A;  3PEG A;  2LUL A;  1DBH A;  2E2X A;  3F0W A;  3GYP A;  3HK0 A;  2Q13 A;  1V5P A;  5DIF B;  2VKI A;  1NI2 A;  4A5K A;  4GZU A;  1U5D A;  4HAX B;  3NSU A;  2LOX A;  2P0D A;  4K2O A;  2RNR B;  2D4Q A;  5JP4 A;  3PG7 A;  4MT7 A;  2LYD A;  1OQN A;  3CXB B;  1PMS A;  1WI1 A;  1Y19 B;  5LON B;  3SUZ A;  3QIJ A;  2P8V A;  2Y7B A;  2V76 A;  2FJL A;  5CLQ B;  5J3Y A;  3TFM A;  4MY6 A;  1U5F A;  4A6F A;  1MKE A;  2L2I A;  2D11 A;  1EGX A;  3MPX A;  3O96 A;  3CIK A;  2BCJ A;  4HAW B;  3DXD A;  1MIX A;  5KCV A;  2DX1 A;  1PLS A;  3A8Q A;  2DN6 A;  2DFK A;  5GOW B;  2HE7 A;  4YL8 A;  1DRO A;  4TYZ A;  3ULC A;  5KQ4 A;  2OQB A;  1RRP B;  1ZC3 B;  1UNR A;  2L1C A;  1UPQ A;  1XOD A;  5J3Q A;  1ZC4 B;  2D10 A;  5KQ1 A;  3HW2 B;  5C79 A;  3ODO A;  2J59 M;  1FGZ A;  1U27 A;  1XD4 A;  3TVV A;  2GCJ A;  1MIZ B;  2J0M A;  3ML4 A;  1FAO A; 
#chains in the Genus database with same CATH topology
 3D8D A;  1BWN A;  2OTX A;  2PZ1 A;  3SO6 A;  2RVB B;  3TCA A;  1DYN A;  4XWX A;  5C6R A;  4HHV A;  1J0W A;  1TXD A;  2J0J A;  2K2J A;  1X86 A;  4L6E A;  4GXB A;  1U29 A;  2YSZ A;  2D9Z A;  1V61 A;  2Z0P A;  1OMW A;  5J3T A;  5DI9 B;  4Z2N A;  1WGQ A;  4C0A A;  1TJ6 A;  3FEH A;  3RCP A;  1ZYI A;  4EJN A;  4NSW A;  2N0Y A;  1EF1 A;  5D3X A;  2RSG A;  1WJ1 A;  2CRF A;  1I2H A;  2ADZ A;  2I5F A;  4HAY B;  3KSY A;  1U5G A;  5I2M A;  1BTN A;  3DCX A;  1LB1 A;  3WA0 A;  4DXA B;  2LKO A;  4HB3 B;  4WJ7 A;  4P7I A;  1UNQ A;  2M38 A;  1WG7 A;  2DKP A;  3V5W A;  1W1G A;  5DHA B;  4YON A;  1AQC A;  5LOP B;  3T06 A;  4CHJ A;  2AEH A;  2EJ8 A;  4F7U P;  1RJ2 A;  3TW1 A;  4HAV B;  2KGX B;  2KUQ A;  1X1F A;  4GMX B;  1IRS A;  2LG1 A;  4L1R A;  2RLO A;  2P0F A;  5FI1 A;  5JHH A;  4ZRI A;  1FHW A;  1V88 A;  1ISN A;  2UVM A;  2ROV A;  3A8P A;  1EAZ A;  5D27 A;  4IOY X;  4KHB A;  2J0K A;  2COD A;  2Z0Q A;  3U12 A;  1P5T A;  3OAN A;  4DBB A;  2IFS A;  2Z14 A;  3AU5 A;  5FI0 A;  1ZSQ A;  2DLW A;  2VRW B;  4GN1 A;  1X11 A;  3DXC A;  1U5E A;  2EMT A;  5L81 A;  4WSF A;  1FB8 A;  2R2Y A;  3QBV B;  2KIG A;  1T77 A;  2N23 A;  5LG4 B;  3D8E A;  3G9W A;  2X18 A;  2W2W A;  4IAP A;  2YS5 A;  2KCJ A;  2NBV A;  3PZD A;  2DYN A;  3P7Z A;  4D0N B;  4GMV A;  2D9V A;  4HAU B;  2COA A;  1DDM A;  1H10 A;  1QQG A;  1I7A A;  3ULB A;  1MAI A;  4KHA A;  4DIX A;  5JHG A;  1NTV A;  5HE3 A;  3WYF B;  2NZ8 B;  1ZM0 A;  3PVW A;  1H4R A;  1Y5O A;  2JP2 A;  1FOE A;  1MK7 B;  4ZRK A;  2HTH B;  3FVC A;  2ZKM X;  1FHO A;  1WVH A;  3KRW A;  3IVF A;  3PVL A;  1GC6 A;  2GUM A;  2I5C A;  3A98 B;  2DHI A;  4OT1 A;  3LJU X;  1BAK A;  5D3W A;  2K49 A;  4QJ5 B;  2LOZ A;  4IFS A;  1GG3 A;  4MK0 A;  1KI1 B;  1M7E A;  2EMS A;  4CSQ A;  2FJU B;  1N3H A;  4BBK A;  3PP2 A;  4KHO A;  4K2P A;  3HIE A;  2ELA A;  2MDX A;  3FSS A;  4KHB B;  1E5W A;  5HE2 A;  1WJM A;  2Z59 A;  3PSC A;  4HB2 B;  2W2X C;  3SNH A;  4PNK A;  2YS3 A;  4F7G A;  4Y94 A;  2DA0 A;  4HB4 B;  1P3R A;  1TQZ A;  3X23 A;  1B55 A;  2XQN M;  4A6K A;  1AWE A;  2D9Y A;  3U7D A;  2DHK A;  2UZR A;  3D8F A;  3SYX A;  1SGH A;  2MKR A;  1UPR A;  2D9X A;  3FM8 C;  4EMO A;  1KZG A;  5EFX A;  5C5B A;  2YT0 A;  1X1G A;  4HAZ B;  4KAX B;  2G35 A;  4CHM A;  1XX0 A;  2CAY A;  1XKE A;  3KZ1 A;  2YVC A;  3A58 A;  2M14 A;  3U8Z A;  3BIN A;  4B6H A;  2COC A;  1XR0 B;  5C16 A;  2YS1 A;  2ROZ B;  3KY9 A;  2P0H A;  4ZRJ A;  5HE1 A;  2KUP A;  2I1K A;  4K81 A;  3UZT A;  2KR0 A;  4H8S A;  4OSN A;  2RUK B;  4HDQ A;  1FGY A;  2YT1 A;  2R09 A;  3VIA A;  4A6H A;  1GC7 A;  2DHJ A;  3ML4 A;  4QXA B;  4HDO A;  1UNP A;  1P6S A;  2YRY A;  1NTY A;  2QKM A;  4TKN A;  3VOQ A;  2GS0 A;  4GNK B;  4D6W A;  1K5D B;  4QJ3 B;  1Q67 A;  3ZVR A;  2AL6 A;  1OY2 A;  3F5R A;  2Y8G A;  2H7D A;  3PVU A;  1DDW A;  1Z87 A;  3GYO A;  2K2U A;  4CYE A;  3ZDT A;  4GPT B;  1K5G B;  2CY4 A;  4EKU A;  4K17 A;  5D3V A;  4Z2M B;  3HQC A;  1W1H A;  3NWF A;  4KVG B;  2MWN B;  2H7E A;  1M7R A;  2Y8F A;  3ODW A;  4DX8 A;  2QKL A;  3P6A A;  3ODX A;  3N7C A;  1ZVR A;  5C5B B;  3TO1 A;  2DTC A;  5HE0 A;  2GCL A;  1PFJ A;  2RRF A;  3KRX A;  1MPH A;  1U2B A;  1QC6 A;  2UZS A;  4WVF B;  2ELB A;  2K00 A;  1J19 A;  5DH9 B;  4F7H A;  2VSZ A;  2W2X D;  1DDV A;  1XCG A;  4HAT B;  5CLL B;  1MK9 B;  2DYQ A;  2EC1 A;  4HB0 B;  1V5M A;  1W1D A;  2GJY A;  2RGN B;  2COF A;  2YF0 A;  1BTK A;  1V89 A;  3M1I B;  1LW3 A;  2DKQ A;  3AU4 A;  5JLJ B;  2Z0O A;  4NY0 A;  5DHF B;  1FHX A;  2ZPY A;  5D3Y A;  1SHC A;  2I1J A;  2R0D A;  2D2Q A;  3SV1 A;  5M4Y B;  4DX9 0;  2YT2 A;  2D9W A;  4PQ0 A;  3DXE A;  3QWM A;  2NMB A;  2CY5 A;  1KZ7 A;  3BJI A;  1WGU A;  1EVH A;  2MFQ A;  2DX5 A;  1NU2 A;  2IYB A;  2Z13 A;  4A6F B;  5IRS A;  3MDB C;  1MI1 A;  1UEF A;  3AJ4 A;  1V5U A;  1X05 A;  2KIE A;  3PEG A;  3NWA A;  3NWD A;  2LUL A;  1DBH A;  2E2X A;  3OHM B;  3F0W A;  3GYP A;  3HK0 A;  2Q13 A;  5I2S A;  1V5P A;  5DIF B;  2VKI A;  4HSI A;  1NI2 A;  4GOU A;  4A5K A;  4GZU A;  1U5D A;  4HAX B;  3NSU A;  2LOX A;  2P0D A;  4K2O A;  2RNR B;  2Z4D A;  2D4Q A;  5JP4 A;  3PG7 A;  4MT7 A;  2LYD A;  1OQN A;  3CXB B;  1PMS A;  1WI1 A;  1Y19 B;  5LON B;  3SUZ A;  3QIJ A;  2P8V A;  2Y7B A;  2V76 A;  2FJL A;  5CLQ B;  5J3Y A;  3TFM A;  4MY6 A;  1U5F A;  4A6F A;  1MKE A;  2L2I A;  2D11 A;  2K8E A;  1EGX A;  3MPX A;  3O96 A;  3CIK A;  2BCJ A;  4HAW B;  3DXD A;  1MIX A;  5KCV A;  2DX1 A;  3A8Q A;  2DN6 A;  2DFK A;  5GOW B;  4QJ4 B;  2HE7 A;  4YL8 A;  1DRO A;  4TYZ A;  3ULC A;  5KQ4 A;  2OQB A;  1RRP B;  1ZC3 B;  1UNR A;  2L1C A;  1UPQ A;  3HSA A;  3B77 A;  1XOD A;  5J3Q A;  1ZC4 B;  2D10 A;  5KQ1 A;  3HW2 B;  3NW8 A;  5C79 A;  3ODO A;  2J59 M;  1FGZ A;  1U27 A;  1XD4 A;  3TVV A;  2GCJ A;  1MIZ B;  2J0M A;  1PLS A;  1FAO A; 
#chains in the Genus database with same CATH homology
 3D8D A;  1BWN A;  2OTX A;  2PZ1 A;  3SO6 A;  2RVB B;  3TCA A;  1DYN A;  4XWX A;  5C6R A;  4HHV A;  1J0W A;  1TXD A;  2J0J A;  2K2J A;  1X86 A;  4L6E A;  4GXB A;  1U29 A;  2YSZ A;  2D9Z A;  1V61 A;  2Z0P A;  1OMW A;  5J3T A;  5DI9 B;  4Z2N A;  1WGQ A;  4C0A A;  1TJ6 A;  3FEH A;  3RCP A;  4EJN A;  4NSW A;  2N0Y A;  1EF1 A;  5D3X A;  2RSG A;  1WJ1 A;  2CRF A;  1I2H A;  2ADZ A;  2I5F A;  4HAY B;  3KSY A;  1U5G A;  1BTN A;  1LB1 A;  3WA0 A;  4DXA B;  2LKO A;  4HB3 B;  4WJ7 A;  4P7I A;  1UNQ A;  2M38 A;  1WG7 A;  2DKP A;  3V5W A;  1W1G A;  5DHA B;  4YON A;  1AQC A;  5LOP B;  3T06 A;  4CHJ A;  2AEH A;  2EJ8 A;  4F7U P;  1RJ2 A;  3TW1 A;  4HAV B;  2KGX B;  1X1F A;  4GMX B;  1IRS A;  2LG1 A;  2RLO A;  2P0F A;  5FI1 A;  5JHH A;  4ZRI A;  1FHW A;  1V88 A;  1ISN A;  2UVM A;  2ROV A;  3A8P A;  1EAZ A;  5D27 A;  4IOY X;  2J0K A;  2COD A;  2Z0Q A;  1P5T A;  3OAN A;  4DBB A;  2IFS A;  3AU5 A;  5FI0 A;  1ZSQ A;  2DLW A;  2VRW B;  4GN1 A;  1X11 A;  3DXC A;  1U5E A;  2EMT A;  5L81 A;  4WSF A;  1FB8 A;  3QBV B;  2N23 A;  3D8E A;  3G9W A;  2X18 A;  2W2W A;  4IAP A;  2YS5 A;  2KCJ A;  3PZD A;  2DYN A;  3P7Z A;  4D0N B;  4GMV A;  2D9V A;  4HAU B;  2COA A;  1DDM A;  1H10 A;  1QQG A;  1I7A A;  3ULB A;  1MAI A;  4KHA A;  5JHG A;  1NTV A;  5HE3 A;  3WYF B;  2NZ8 B;  1ZM0 A;  3PVW A;  1H4R A;  1Y5O A;  2JP2 A;  1FOE A;  1MK7 B;  4ZRK A;  2HTH B;  1FHO A;  1WVH A;  3KRW A;  3IVF A;  3PVL A;  1GC6 A;  2I5C A;  3A98 B;  2DHI A;  3LJU X;  1BAK A;  5D3W A;  2LOZ A;  4IFS A;  1GG3 A;  4MK0 A;  1KI1 B;  1M7E A;  2EMS A;  1N3H A;  4BBK A;  3PP2 A;  4KHO A;  4K2P A;  2ELA A;  2MDX A;  3FSS A;  4KHB B;  1E5W A;  5HE2 A;  1WJM A;  3PSC A;  4HB2 B;  2W2X C;  3SNH A;  4PNK A;  2YS3 A;  4F7G A;  4Y94 A;  2DA0 A;  4HB4 B;  1P3R A;  1TQZ A;  3X23 A;  1B55 A;  2XQN M;  4A6K A;  1AWE A;  2D9Y A;  3U7D A;  2DHK A;  2UZR A;  3D8F A;  3SYX A;  1SGH A;  2MKR A;  1UPR A;  2D9X A;  3FM8 C;  4EMO A;  1KZG A;  5EFX A;  5C5B A;  2YT0 A;  1X1G A;  4HAZ B;  4KAX B;  2G35 A;  4CHM A;  1XX0 A;  2CAY A;  1XKE A;  3KZ1 A;  2YVC A;  2M14 A;  3U8Z A;  3BIN A;  4B6H A;  2COC A;  1XR0 B;  5C16 A;  2YS1 A;  2ROZ B;  3KY9 A;  2P0H A;  4ZRJ A;  5HE1 A;  2KUP A;  2I1K A;  4K81 A;  3UZT A;  4H8S A;  2RUK B;  4HDQ A;  1FGY A;  2YT1 A;  2R09 A;  3VIA A;  4A6H A;  1GC7 A;  2DHJ A;  4HDO A;  1UNP A;  1P6S A;  2YRY A;  1NTY A;  2QKM A;  4TKN A;  3VOQ A;  2GS0 A;  1K5D B;  1Q67 A;  3ZVR A;  2AL6 A;  1OY2 A;  3F5R A;  2Y8G A;  2H7D A;  3PVU A;  1DDW A;  1Z87 A;  3GYO A;  2K2U A;  4CYE A;  3ZDT A;  4GPT B;  1K5G B;  2CY4 A;  4EKU A;  4K17 A;  5D3V A;  4Z2M B;  3HQC A;  1W1H A;  4KVG B;  2MWN B;  2H7E A;  1M7R A;  2Y8F A;  3ODW A;  4DX8 A;  2QKL A;  3P6A A;  3ODX A;  3N7C A;  1ZVR A;  5C5B B;  3TO1 A;  2DTC A;  5HE0 A;  2GCL A;  1PFJ A;  3KRX A;  1MPH A;  1U2B A;  1QC6 A;  2UZS A;  4WVF B;  2ELB A;  2K00 A;  1J19 A;  5DH9 B;  4F7H A;  2VSZ A;  2W2X D;  1DDV A;  1XCG A;  4HAT B;  5CLL B;  1MK9 B;  2DYQ A;  2EC1 A;  4HB0 B;  1V5M A;  1W1D A;  2GJY A;  2RGN B;  2COF A;  2YF0 A;  1BTK A;  1V89 A;  3M1I B;  1LW3 A;  2DKQ A;  3AU4 A;  5JLJ B;  2Z0O A;  4NY0 A;  5DHF B;  1FHX A;  2ZPY A;  5D3Y A;  1SHC A;  2I1J A;  2R0D A;  2D2Q A;  3SV1 A;  4DX9 0;  2D9W A;  4PQ0 A;  3DXE A;  3QWM A;  2NMB A;  2CY5 A;  1KZ7 A;  3BJI A;  1WGU A;  1EVH A;  2MFQ A;  2DX5 A;  1NU2 A;  2IYB A;  4A6F B;  3MDB C;  1UEF A;  3AJ4 A;  1V5U A;  1X05 A;  3PEG A;  2LUL A;  1DBH A;  2E2X A;  3F0W A;  3GYP A;  3HK0 A;  2Q13 A;  1V5P A;  5DIF B;  2VKI A;  1NI2 A;  4A5K A;  4GZU A;  1U5D A;  4HAX B;  3NSU A;  2LOX A;  2P0D A;  4K2O A;  2RNR B;  2D4Q A;  5JP4 A;  3PG7 A;  4MT7 A;  2LYD A;  1OQN A;  3CXB B;  1PMS A;  1WI1 A;  1Y19 B;  5LON B;  3SUZ A;  3QIJ A;  2P8V A;  2Y7B A;  2V76 A;  2FJL A;  5CLQ B;  5J3Y A;  3TFM A;  4MY6 A;  1U5F A;  4A6F A;  1MKE A;  2L2I A;  2D11 A;  1EGX A;  3MPX A;  3O96 A;  3CIK A;  2BCJ A;  4HAW B;  3DXD A;  1MIX A;  5KCV A;  2DX1 A;  1PLS A;  3A8Q A;  2DN6 A;  2DFK A;  5GOW B;  2HE7 A;  4YL8 A;  1DRO A;  4TYZ A;  3ULC A;  5KQ4 A;  2OQB A;  1RRP B;  1ZC3 B;  1UNR A;  2L1C A;  1UPQ A;  1XOD A;  5J3Q A;  1ZC4 B;  2D10 A;  5KQ1 A;  3HW2 B;  5C79 A;  3ODO A;  2J59 M;  1FGZ A;  1U27 A;  1XD4 A;  3TVV A;  2GCJ A;  1MIZ B;  2J0M A;  3ML4 A;  1FAO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...