4GN1A

Crystal structure of the ra and ph domains of lamellipodin
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
251
structure length
251
Chain Sequence
VKKLVIRVHMSDDSSKTMMVDERQTVRQVLDNLMDKSHCGYSLDWSLVETVSELQMERIFEDHENLVENLLNWTRDSQNKLIFMERIEKYALFKNPQNYLLGKKETAEMADRNKEVLLEECFCGSSVTVPEIEGVLWLKDDGKKSWKKRYFLLRASGIYYVPKGKAKVSRDLVCFLQLDHVNVYYGQDYRNKYKAPTDYCLVLKHPQIQKKSQYIKYLCCDDVRTLHQWVNGIRIAKYGKQLYMNYQEALK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Ras-associated and pleckstrin homology domains-containing pr
publication title Crystal structure of Lamellipodin implicates diverse functions in actin polymerization and Ras signaling.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 69
structure length 251
sequence length 251
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2012-08-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00169 PH PH domain
A PF00788 RA Ras association (RalGDS/AF-6) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 4gn1A02
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 4gn1A01
4F7ZA 2DN6A 4HCNB 3A9KA 2ZZPB 1U5DA 3H7PB 1BTNA 3M62B 1YJ1A 1C1YB 3VUYA 2KUPA 2JRIB 2J0JA 2EKEC 5J18A 3VOQA 1WXSA 1XR0B 4KZCA 1WFYA 2JP2A 4KHAA 3VFKA 2MKRA 1DDMA 3WALA 4C0AA 2L0TA 1ZC4B 2P0HA 1UNQA 2LVPA 1Z2MA 4JGHB 3VAWA 3QBVB 4HB4B 2D11A 2K8CA 2R0DA 1WX9A 2LRWA 2YSZA 4EFOA 2BWFA 3V60A 2KQ7A 3BY4B 4E3CA 2YLMA 1UH6A 1XX0A 2FCNA 2PJHA 4IW0A 4P7IA 2B3AA 3PS6A 3H1UA 2A4ZA 2JXXA 2KCJA 3ZW3A 5KHQA 4WWNA 2EJ8A 1LW3A 4HAWB 5GMVA 2Z0DB 2QKLA 3PSEB 3VTUA 2YS3A 4A6FA 2L00B 1P3RA 3O96A 2H7DA 2LGXA 1V9JA 1EO6A 2R2QA 2L1CA 3WYFB 3ML8A 2G3QB 2P8VA 2ADZA 4I6LB 4HB0B 5JHHA 4I6PA 3T8MA 4WJ7A 3TMPB 2ZCBA 3KUDB 2IFSA 3U8ZA 2RNRB 2MQJA 4DDID 1EF5A 2K00A 3DXEA 3VTWA 4A5KA 3PVUA 1G6JA 4W9CA 2L8JA 2LGYA 3AI5A 2DKPA 3U7DA 1DDWA 3DVGX 5L95C 5FI0A 1H8CA 1WGHA 2RLOA 1NTVA 5J2RA 4HLEA 3MHSD 2IO0B 4DX90 4K7UA 2ZEQA 2MBQA 1I2HA 5D3YA 4FHKA 3CSTA 3ODXA 3QWZB 4HWIB 2PE6B 5CHFA 4MGKE 3RYTA 1U5EA 1SGHA 5G55A 1UPRA 2DYMA 2M1MA 1TGZB 4D0NB 2ZVOA 4W9GA 1ZW7A 1FGYA 2VRRB 3APFA 4NJ7A 2ROZB 1RRBA 2MP2B 3TFMA 2HTHB 1FHWA 2FJLA 5J3TA 4HAUB 2JZ3B 2N9EB 4HHVA 4JL9A 3PG7A 4NSWA 1LXDA 2G45B 1D3ZA 1UNRA 3KRWA 4A3PA 4E74A 4ANXA 4WVFB 3VIAA 3AULA 2DYBA 3UQAA 4XX5A 2AL6A 1U5GA 1SIFA 1U2BA 2JPHA 4GN1A 5AEKB 1X11A 2G4SA 3GOEA 4HPLB 2D9XA 4HXDA 2PPHA 2DHJA 1QZEA 3A1QA 1P3QU 2KC2A 5BO4B 1K8RB 2XBBC 3G9WA 1EUVB 2DX5B 2CS4A 2GCLA 2MWNB 4TYZA 1X05A 4HJKA 4K7WA 3TVVA 3ZUNA 4ZRKA 2MBEA 3ZNHB 3TIXA 3ENEA 1NI2A 3ALBA 3DOWA 3A33B 4AJYB 1TBEA 1E5WA 4WQOB 4JQWC 2C9WB 1WF9A 3VXWA 3PEGA 4FULA 3PGEA 2WDTB 2IO3B 2LOXA 2DZKA 1W1DA 1UD7A 2RR9A 3OJ3A 3PHWB 3L54A 1L2NA 2RSGA 3EC8A 1KZGA 4GDKB 4MJSB 5D94A 3LJUX 3GYPA 3KVFB 1PLSA 3KUZA 1DBHA 4II2B 2JVCA 2RD0A 3K9OB 2YT0A 1Z5SB 2JZZA 4HPMB 3BINA 1FHOA 1FGZA 3ML4A 4KSKC 2D4QA 4AOFA 3R7RA 1WGGA 2Z0QA 1LM8B 1WJ4A 1WMHA 4E71A 4Z2NA 4X57B 1VCBA 2VRWB 3B08A 3ULCA 4PS3A 2L0FA 2D9ZA 3DDCB 4CHKA 2K25A 1FOEA 3SD5A 1IP9A 4GZUA 2AYOB 5EDSA 2NBWB 2CKHB 4ANVA 1UBQA 2DENB 2MBOA 4IG7B 3VHTC 3D8EA 2RSUA 3ZNGC 1R4MI 3NOBA 2K8HA 1EVHA 3PPAA 2J0MA 2KX3A 4W9EA 2KX0A 1V88A 2L05A 3GYOA 3R7QA 1U29A 5CHWA 2E2XA 1GJZA 3RCZA 2G4DB 3ODOA 2J7QB 4YONA 3VUXA 2ZVNA 4ZDVA 2LI5A 3SYXA 5D7GA 4EJNA 3DVGY 4DK5A 2GJYA 5DPRA 4HAVB 4XZ4A 5J17A 2NZ8B 4M8MA 1UZXB 1WGDA 2Y8GA 2LKOA 5DIFB 4KZ0A 2QHOA 2AWTA 3TO1A 4OVUA 4F7HA 3RUIB 3TCAA 3SU8X 4OVVA 2UYZB 2KWVB 5D3XA 2KNBA 2FCMA 3EFUA 1N3HA 4FADA 3A4RA 3A98B 2DX1A 2CY4A 2WYQA 4F8CB 5CTRC 4FN2A 2KVRA 3H7PA 3QAQA 4G11A 2GCJA 1E8ZA 1S3SG 2K6QA 2OTXA 2CY5A 1QQGA 1BWNA 1TZ1A 3QARA 4KDLB 4IC7B 2CR5A 3QK0A 2PZ1A 3D8FA 1WX7A 4XWXA 2MA9B 2JRHA 2ZNVB 4AP4C 4BKGA 4HAYB 4GMXB 3ODWA 3W1YA 3ZTCA 2DAJA 2NVUI 4KIKB 3KY9A 3AXCA 2WX0A 3KZ1A 2DAFA 2DZIA 3DBRI 1Q1OA 3FM8C 3P6AA 1U27A 2NPTB 1B55A 3QX1A 4HVBA 4DWFA 2KWCA 3MPXA 5DCNA 1MKEA 2GBRA 3AU4A 4Z2MB 4HAXB 4FBJB 3ECIA 4K81A 1WJMA 4CHJA 2YVCA 1KZ7A 2C60A 5HE1A 2DKQA 3A8PA 4NNJB 1WZ3A 4MEMA 4KHBB 2BPSA 4B6WA 3M3JA 2IY0B 1KLVA 5G2NA 1XD4A 1P98A 3NHEB 3DBHI 2EMTA 2KJHB 2COCA 1C3TA 4Y94A 1XKEA 5E6OA 5AZGA 3PLUA 3FSSA 3V61A 3TJPA 4ICUA 2VSZA 1M94A 1GC6A 2RGFA 1MK7B 1T0YA 4M8NA 2OQBA 2IO1B 3ZIMA 3HM3A 5KHOA 4K1RB 4HB2B 3ZLZA 4NPNA 1QC6A 3SDLC 1WI1A 2YT1A 5C23A 2IYBA 1WX8A 5JHGA 1E8YA 3KYCD 3CMMB 5JHBA 3R66C 1PFJA 2RUKB 2FUHB 4HATB 2NMBA 4CYEA 3BJIA 3NY5A 2D2QA 2KFKB 1E90A 2LXCA 1WM3A 2I5FA 3QA8A 1YD8U 4MT7A 1YQBA 2MP2A 2HTHA 3P7ZA 5D3VA 1VD2A 4GPTB 4WAAA 1J0WA 3M1IB 2LZ6A 2N0YA 5DH9B 3W1SA 1SHCA 4NQKE 2P0DA 3K9PB 2GBNA 3VTVA 1P6SA 2PE9A 2DZMA 2LYDA 1V5OA 1V81A 4G0NB 3UQBA 2FAZA 2K2JA 2CHWA 2CRFA 3CIKA 4FJVB 2DHKA 2GOWA 4B95A 3JSVB 4H8SA 3IHPC 1TJ6A 2DX5A 4URKA 1YIWA 2KXJA 4HAZB 2MRPA 3DPDA 2A5UA 2D07B 5C5BB 3VVWB 2L2IA 1TTNA 2EMSA 1ZKHA 1BT0A 3SHQA 1PQSA 1V5MA 1J0GA 4ANUA 1JRUA 5JH5C 2OJRA 4HCPB 3UZTA 3N7CA 3U30A 2L7RA 1OQNA 4FHJA 4RM8A 2BYVE 2KO3A 2WX1A 2LD9A 3NZUA 1RFAA 3Q3JA 2KD0A 4BBNF 4RMAA 2AEHA 1DROA 3RZWC 3QCAA 1W1GA 2RGNB 1IPGA 4GDKA 4MELA 3PVLA 3EECA 3PRMB 5J3QA 4MJSA 3A9JB 5D6JB 2D9WA 3F5RA 1XD3B 2MSED 3IVFA 2X18A 1WR6E 4MSMB 2LGDA 2GBMA 4WJNA 2KDIA 2IY1B 3A4SC 3QQ8B 3R3MA 4IM0A 4EZKA 2BKRB 4PNKA 4G3XB 2I5CA 2R2OA 3FEHA 2KJ6A 2IZVB 2PEAA 4CO7A 2RPQA 1ZM0A 4LDTB 5IAAC 4IWQA 5DI9B 2KTRB 3RCPA 2C7MB 5FR6A 2RVBB 4GOCA 2CU1A 4BFRA 1WGUA 4ANWA 5LOPB 2CHZA 2ZPYA 4MDKE 4ICVA 1WGQA 1Y5OA 4W9FA 1J8CA 4CHMA 3KH0A 3O65B 1V5PA 2W2XD 2O2VB 4NAWB 2P0FA 4IM3A 1MIXA 1Q5WB 2Z0EB 3H9DA 1FB8A 3VH3B 5HE2A 1WJ6A 1GG3A 3P2BA 4LJPB 5C79A 1EF1A 1F9JA 5LXHA 2UZRA 3V6CB 1I7AA 1Y8RC 3N30A 2DTCA 3ULBA 2REXA 1K5GB 3QIJA 5CLLB 4W9HA 3L16A 2G35A 4WJPA 2FIDA 3VQIA 3MTNB 5DHAB 2KHWB 2Q13A 3TW1A 1WH3A 2DYOA 3KSYA 1WXMA 2LG1A 2LRUA 4GDLB 1V5TA 4EEWA 2KDBA 3D32A 3V6EB 3PHXB 1WE7A 2W9NA 3RT3B 2JF5A 4IAPA 1ZSQA 1WGRA 3HQCA 4W9DA 3Q3FA 3PTFC 3NSUA 1M7RA 4DHZB 4JIOU 4FJZA 2WWZA 4WJOA 4BOSC 4RM9A 4BOZB 2KKCA 3ZO5B 2XQNM 2D10A 3W1SC 1WIAA 1I42A 4EKUA 3V62A 2NBVB 4WWPA 4MK0A 1NU2A 5CX3A 4A3OA 1FAOA 1ZGUB 4TKNA 1V2YA 2YRYA 3HIZA 1V6EA 1V80A 4IWPA 1HE8A 1H10A 4EZJA 4HK2A 3N32A 1V86A 4TUUA 3LJ3A 2D9VA 3L13A 3A8QA 3ZNID 3I3TB 3L0WB 2J59M 2L3ZA 4LCDE 5DPSA 3H6NA 1I35A 2FNJB 3JVZX 2FCSA 3WIMA 1Z87A 4MY6A 3WAPA 4IFSA 2N9XA 4KIKA 1P9DU 4KDIC 2GS0A 1MK9B 1UPQA 1Y19B 2BYFA 2O6VB 2ZCCA 3L10B 2NPTA 2ELBA 3D8DA 1WXVA 2NS5A 2MW5A 2W2WA 2KTFA 1CMXB 3DBLI 4IUMB 2DHZA 1WYWB 2R09A 1UBIA 3HW2B 2C5LC 1P0RA 2K2UA 3SO6A 4I6NB 1V5UA 1WJNA 1WZ0A 2KMCA 3PVWA 1OEYJ 4B6HA 3VDZA 2LVQA 3TL5A 3RD2A 1OTRB 4FA6A 5KQ1A 4F7GA 3T06A 2XK5B 1WE6A 2BYEA 2MDXA 3JW0X 1U4AA 3ZVRA 2MX2A 3PRPB 2MLBA 4K2OA 2KWUB 1E8WA 4GMVA 2HD5B 1IRSA 4DXAB 4L6EA 3KYDD 2FCQA 5JHAA 4IWOA 1GUAB 4W9JA 3X23A 4TV3A 2KLGA 3JYUA 2KLCA 3UGBB 4K7SA 4HB3B 5KQ4A 4KV2A 2IYDB 3OLMD 3V5WA 4ZYNA 3HM6X 2NBUA 4LDTD 2JT4B 3HK0A 5JLJB 3KRXA 2LWPA 3HHMA 1W1HA 3WAMA 2DHIA 4ZRIA 5IA7A 1GC7A 1P5TA 1PMSA 2DZJA 1TXDA 2K1FA 4MM3A 4PS8A 2ASQA 2V76A 2J0KA 2M14A 1ZVRA 2Y5BB 1MPHA 3DQVA 3IFWB 4LJOB 3A9KB 3DBSA 2MBHA 4DHZE 2C7HA 4GSWA 4KSLC 2KFKA 3N3KB 1XODA 1AWEA 2CHXA 4FLHA 2KC1A 4HDQA 3ZKJC 3PT2B 2LULA 2CODA 1GNUA 3QHTA 3T9LA 4BVUC 5LONB 4DBGA 4BBKA 3RZFA 1TQZA 1XT9B 1IYFA 2DA0A 2GBJA 2KQSA 2LOZA 2KK8A 1E7UA 3PRZA 2C7NB 2MBBB 2JUOA 2V1YA 2BF8B 1R4NI 2Y7BA 3ZRFA 2QKMA 2CAYA 2UWQA 4KVGB 4G50A 2KFJA 5CHVC 4KAXB 1J19A 4MSQB 3TBLD 3JSVA 3QC8B 2V4LA 2NCNA 1RJ2A 3QWMA 5C5BA 1OQYA 4F1SA 3ZDTA 4KHOA 3ZTDA 2XEWA 1KOTA 3KUCB 1KI1B 2KGXB 5D2MB 3ZRCA 4W9IA 2M8SA 4A6FB 3PV1A 5CLQB 2FIFA 1NTYA 3M63B 1ZC3B 4FJYA 4IM2A 4A6KA 3OANA 2I1KA 2ZNVC 4NY0A 1UEFA 2YS5A 4DHJB 2KZRA 1L7YA 2GBKA 2M0XA 1YX5B 5AZFA 5E6NA 3ML9A 3A9JA 4DBBA 1K5DB 2L76A 3LDZE 1X86A 1XCGA 3F0WA 1X1GA 2BWES 3SNHA 1V89A 2VKIA 1WG7A 4II3B 4IOYX 3X0WA 3ZVVA 1V61A 1BAKA 4DX8A 2O6VD 1AARA 3L08A 4NJ6A 2ZPNA 3CSFA 4XC2A 3DXDA 1Q0WB 2Y8FA 1ISNA 3PP2A 3SV1A 5DHFB 2KTRA 5LLIA 4AUQC 2W2XC 4DDGD 1RRPB 2BKFA 4B9KA 2DFKA 4WWOA 1WY8A 4GXBA 1FHXA 3UIOB 3DXCA 5C16A 1LB1A 1EGXA 1S1QB 2M17A 2N4FA 1MG8A 2K8BA 4K2PA 1WVHA 2O2VA 5JP4A 2K39A 4NAWA 3PSCA 2JY6A 3NZSA 3C0RB 3L17A 5AZHA 2Z59B 4K17A 4NQLB 3GZNI 3IG3A 4A6HA 5FI1A 4PYUA 1RLFA 4W9LA 2COAA 1V49A 4W9KA 1KM7A 4ASWC 2YF0A 2Z0OA 1OMWA 3A1QB 4PS7A 5DPTA 4M0WB 3NS8A 1WXAA 1BTKA 2KOXA 4BKSD 4EMOA 5C1ZA 1WJ1A 3M95A 4GDLA 5KCVA 2UVMA 3PLVA 2KDFB 2M4NA 2BGFA 3WANA 4MGIE 1RAXA 1OEYA 1X1FA 3MJWA 5HKHA 1WRDB 2LJ5A 4AJWA 2KJRA 4EOYA 4WJQA 2ELAA 3RULA 4WSFA 2N7EA 1Q67A 2ZJDA 2BCJA 4EZLA 1EAZA 3UF8A 3WAOA 5LXIB 2YS1A 2MWSB 2COFA 1UGMA 1KJTA 1DYNA 3AU5A 2NR2A 3B1LX 1NBFC 1UELA 3IBEA 2DYQA 5EFXA 3AJ4A 3VUWA 2N1VA 4F7UP 4JLCA 2DLWA 3KW5B 2LUEA 3MDBC 2AL3A 3WA0A 2UZSA 3CF6E 5D27A 3CXBB 3OJ4B 1UNPA 4MH0E 3APDA 3OAWA 2EC1A 2LASA 1DDVA 2H7EA 1OY2A 2M38A 1XQQA 5E6PA 1WMHB 1AQCA 1WI0A 4EUTA 2O6VA 2N7DA 1MAIA 5DPWA 2GMIC 4GIVA 1WM2A 5L83A 3DCGA 2N1WA 3APCA 5J3YA 4GU2A 4GB9A 5TR5A 4N9F4 4AWJA 2KANA 1U5FA 4MGYE 2ROVA 3B0AA 1X1MA 1LQBA 3PREA 2K6DB 1M7EA 4PYZA 4DHJD 3H7SA 3VH4B 1FXTB 3QJZA 5L81A 2D3GA 2JWZA 1YX6B 5D3WA 4J6IA 2XK5A 4HDOA 2DYNA 1SE9A 5HE0A 5HE3A 2MCNB 3SUZA 2LXAA 1WGYA 4TQ0A 3DVNV 2OOBB 3PZDA 5JZEB 4BBNC 1MIZB 2I1JA 1WR1A 2KDEB 1NDDA 2KMAA 1OGWA 4ZRJA 4GGQA 1P1AA 4A20A 2D9YA 4TQ1A 3ZNZB 3UINB 2N9PC 2HJ8A 4PQ0A 3ZDMC 2N23A 1WJUA 1E7VA 2KN5A 2IBIB 2MFQA 2LVOA 3S2AA 4YL8A 3EHVA 2IO2B 2Z0PA 3DVNU 1LFDA 2HE7A 4BKSA 1A5RA 1H4RA 5C6RA 1E8XA 4BKTA 2V3SA 3ONSA 3UIPB 5GOWB 4MGZE
chains in the Genus database with same CATH superfamily
4F7ZA 2DN6A 3W9CB 4HCNB 3A9KA 2ZZPB 1U5DA 3H7PB 1BTNA 3M62B 1WYGA 4RF1A 1YJ1A 3UI3A 1C1YB 3VUYA 4USAA 2KUPA 1JCKB 2JRIB 4ARIA 2J0JA 2EKEC 5J18A 3B2FA 3VOQA 1WXSA 3BK1A 3NW8A 1XR0B 2AQ2B 4KZCA 3MP9A 1WFYA 2JP2A 4KHAA 2XN9C 3VFKA 2MKRA 1DDMA 3WALA 2RDBC 4C0AA 2L0TA 4HJGE 1ZC4B 2P0HA 1UNQA 2LVPA 1Z2MA 1WSPA 4JGHB 3VAWA 3QBVB 4HB4B 1XCTL 2HTME 1RWSA 2D11A 1EU3A 2R0DA 2K8CA 2MJ3A 2OJWA 1WX9A 2LRWA 3N20C 2YSZA 4EFOA 2BT6A 2BWFA 1KTKA 1ZYIA 3V60A 2KQ7A 3BY4B 1PYWD 2QDFA 2K9XA 4E3CA 2YLMA 1C76A 1UH6A 1XX0A 3AEAB 2FCNA 2PJHA 4XE0A 4IW0A 1RYJA 4P7IA 2B3AA 1TZOA 1V1PA 3PS6A 3H1UA 2A4ZA 2JXXA 1FNWA 2KCJA 3ZW3A 2WXRA 5KHQA 4WH4A 4WWNA 4IKGA 2EJ8A 1IBXB 1LW3A 4QXAB 1I4QA 4HAWB 2GLSA 5GMVA 2Z0DB 4JE3B 4B0MA 2QKLA 3PSEB 3VTUA 2YS3A 4A6FA 2L00B 1P3RA 3O96A 1JQ4A 4XDCA 2H7DA 2LGXA 1V9JA 1VLBA 1EO6A 1F77A 2R2QA 2L1CA 3WYFB 3ML8A 2G3QB 3VRBB 2P8VA 2CJNA 4YSXB 2ADZA 4HPPA 4I6LB 4HB0B 5JHHA 4I6PA 1PFDA 4OSNA 3T8MA 4WJ7A 4ZYSA 2PMVA 3TMPB 4HKZE 1KLUD 2ZCBA 1VDVA 4P1CC 2IFSA 3U8ZA 3KUDB 2RNRB 2MQJA 4DDID 1EF5A 2K00A 1MPEA 5BMGA 4A8XC 3DXEA 3VTWA 4A5KA 3PVUA 1G6JA 4W9CA 1I4PA 2L8JA 2LGYA 3AI5A 2Z4DA 2PLPA 2DKPA 3U7DA 3SR6A 1DDWA 3DVGX 5L95C 5FI0A 1H8CA 5C3JB 1WGHA 2R61A 2RLOA 2JQRB 1NTVA 4RGMA 5J2RA 4HLEA 3NVYA 2NTSA 4ZRPA 3MHSD 2IO0B 4DX90 4K7UA 2JU6X 2K0PA 2ZEQA 1JWAD 2MBQA 1I2HA 5D3YA 3GE3C 3CSTA 4FHKA 3ODXA 1SJED 3QWZB 4HWIB 2PE6B 2W55A 2Z14A 1L4ZB 2W3SA 5CHFA 4MGKE 1R4MB 3RYTA 2IPKD 3NZ3A 1U5EA 4MACA 1SGHA 1HZ5A 4WURA 5G55A 2FJUB 1UPRA 2DYMA 2M1MA 1TY2A 5D3IB 1TGZB 1I4GA 1N5XA 4PK1A 1FCCC 4D0NB 2ZVOA 4W9GA 1ZW7A 1T0SC 3CIRB 1QQRA 1FGYA 2JZPA 2VRRB 3APFA 1CZPA 4NJ7A 2ROZB 1RRBA 4WIPA 2MP2B 2J53A 3GP7A 3AH7A 3TFMA 2HTHB 1FHWA 2FJLA 5IN7A 5H92C 5J3TA 3NWDA 4HAUB 1T77A 1WRIA 2JZ3B 1FPYA 1MHXA 2N9EB 4HHVA 4JL9A 3PG7A 2Z59A 4NSWA 1LXDA 2G45B 2QIEB 3Q69A 3U12A 5IOIA 1D3ZA 1UNRA 3KRWA 3DHHC 4A3PA 4E74A 4ANXA 4WVFB 3VIAA 2MHJA 1D5XC 2J42A 3AULA 2DYBA 1ET6A 3UQAA 4XX5A 2AL6A 4OZAA 2INNE 1U5GA 1SIFA 1U2BA 2JPHA 3ZJUA 4GN1A 5AEKB 4NAMA 1X11A 4B0EA 2G4SA 3GOEA 4ZHOA 4HPLB 2D9XA 4HXDA 2PPHA 3AEGB 2DHJA 1QZEA 3A1QA 1P3QU 3AE6B 2KC2A 5BO4B 4M0WA 1K8RB 3NWAA 3NG0A 2XBBC 2IGDA 1JALA 3G9WA 1EUVB 5BYRA 2DX5B 3FC4A 4JWSC 1Y56A 2GCLA 2MWNB 2CS4A 4TYZA 1X05A 4HJKA 5FK9C 4K7WA 3TVVA 5G5HA 3ZUNA 1J7AA 3DWMA 2I2YA 3HSAA 1NENB 2J4XA 4ZRKA 2MBEA 3ZNHB 2LGIA 3TIXA 3ENEA 1NI2A 4BZAA 3ALBA 3DOWA 1MJDA 1ESFA 3A33B 4AJYB 1TBEA 1E5WA 4WQOB 4JQWC 2C9WB 4WQMA 1WF9A 3VXWA 3PEGA 4BAXA 4FULA 3PGEA 5C2TB 2WDTB 1OQRA 2IO3B 2LOXA 3KQ4A 2DZKA 3SFDB 4ZOHC 2V9HA 2L83A 1W1DA 1UD7A 2RR9A 3OJ3A 3PHWB 3NVWA 3L54A 4GNKB 1L2NA 2BB5A 1E10A 4TSSA 2RSGA 1T0QC 1R7SA 3EC8A 3MC0B 2K22A 1KZGA 4GDKB 3T3NA 2WDVB 4MJSB 5BYQA 2IJ0A 5D94A 3LJUX 3GYPA 3KVFB 1SE2A 3Q6BA 1XLQA 1FO4A 1PLSA 3KUZA 3BK2A 1WXQA 1DBHA 4II2B 3DBRB 2JVCA 2RD0A 3K9OB 2YT0A 1Z5SB 3RNFC 2JZZA 4RFBA 1VZ8A 1SEBD 2WXPA 4HPMB 1TKGA 3BINA 3O13A 1FHOA 1FGZA 3ML4A 4KSKC 2D4QA 4AOFA 3R7RA 1ENFA 1XXGA 3P4QB 1L0YB 1WGGA 4LNFA 1L0XB 4JPSA 2Z0QA 1LM8B 2WDQB 1WJ4A 1WMHA 3Q3OC 4E71A 4YT0B 2FUG1 4Z2NA 1T0RC 4X57B 1ZUD2 2GB1A 5BMIA 4HROA 1TS4A 1VCBA 2VRWB 2LGSA 3B08A 3ULCA 2I38A 2M0AA 1XLOA 1BUIC 4PS3A 2L0FA 2D9ZA 1F52A 3DDCB 4CHKA 2K25A 1FOEA 4XWTA 3SD5A 2DNFA 3N1XC 1IP9A 4GZUA 2AYOB 5EDSA 1JROA 2NBWB 2CKHB 4ANVA 1UBQA 3RFZB 3IAM1 2DENB 4FXCA 2MBOA 4C80A 1LGRA 4IG7B 2WXJA 3MHZA 3VHTC 3D8EA 2RSUA 3DBHB 3RNBC 3ZNGC 1R4MI 3NOBA 2K8HA 4S17A 1SE4A 3RNEC 3NUHB 1EVHA 4HEA1 4A9AA 1P7FA 3PPAA 2J0MA 1E7PB 2KX3A 4W9EA 2KX0A 1DOIA 3Q8AA 1V88A 2L05A 3GYOA 2BS3B 3R7QA 1U29A 2QSDA 5CHWA 2E2XA 1GJZA 1K53A 1TS3A 4A90A 1QILA 3TEWA 3RCZA 2G4DB 3ODOA 1J7BA 2J7QB 3NS1A 4YONA 3VUXA 2ZVNA 4ZDVA 2QMTA 1GB1A 2LI5A 2K5PA 4UDUC 3SYXA 2AQ1B 4N6EB 2H89B 1NYQA 4XDDA 4ARCA 3IAS1 5D7GA 4EJNA 3DVGY 4DK5A 1QOFA 2GJYA 5DPRA 3U4EG 4HAVB 2BBCA 4ITKA 4XZ4A 5J17A 3C8YA 2NZ8B 3GS2A 4M8MA 1UZXB 3B2GA 1WGDA 4YSZB 2Y8GA 2LKOA 2V3PA 3NVZA 2QC8A 5DIFB 1CJEA 1YN3A 1YJIA 3AEBB 4KZ0A 2QHOA 2AWTA 3TO1A 4OVUA 4F7HA 3RUIB 3TCAA 3KWVA 3SU8X 4OVVA 2UYZB 2KWVB 3ZQ4A 5D3XA 1XF5L 2KNBA 1ZDXA 2FCMA 3EFUA 1N3HA 4FADA 3A4RA 3AV8A 3A98B 2LUMA 2DX1A 2CY4A 2WYQA 4F8CB 5CTRC 3DHGC 4MT5A 4FN2A 1FFVA 1FRRA 2KVRA 3BVMA 2L32A 3H7PA 3QAQA 4G11A 1EM7A 2GCJA 2LEKA 2KR0A 4HSIA 1E8ZA 1S3SG 2K6QA 2OTXA 1C78A 2CY5A 1QQGA 1BWNA 2WXLA 1TZ1A 4LNIA 1MVKA 3QARA 4KDLB 4IC7B 2KT7A 2CR5A 3QK0A 4MH8A 2PZ1A 5IKCM 3SEBA 1C4CA 3D8FA 1WX7A 4XWXA 2MA9B 2WHIA 2JRHA 2ZNVB 5HI1A 1HEZE 4AP4C 1QOGA 4BKGA 4HAYB 3P4PB 4GMXB 3ODWA 3W1YA 3ZTCA 3RPFC 2DAJA 2NVUI 3P42A 4KIKB 4XWWA 2G1EA 3KY9A 3AXCA 2WX0A 3KZ1A 2DAFA 2DZIA 3DBRI 1Q1OA 5FR3A 3FM8C 3P6AA 1U27A 2NPTB 1B55A 3E9SA 3QX1A 4HVBA 4DWFA 2RPVA 3NRZA 5BMHA 2KWCA 3MPXA 5DCNA 1WGKA 1MKEA 2GBRA 3AU4A 4KKJA 4Z2MB 1IBXA 4HAXB 4FBJB 3EA6A 3ECIA 4K81A 1FMAD 1I4XA 4ACFA 1WJMA 3H8HA 4CHJA 1YQ4B 2YVCA 1KZ7A 2C60A 5HE1A 2DKQA 3W5UB 1L6UA 1YOVB 4AQ7A 1MHHE 3A8PA 4NNJB 1VZ6A 1WZ3A 2OHFA 4MEMA 4KHBB 2BPSA 2LMCA 4C56C 4B6WA 2FE8A 3M3JA 2IY0B 3MFGA 2H88B 1KLVA 5G2NA 1XD4A 1P98A 1SBBB 3URYA 3NHEB 3DBHI 2EMTA 1Q10A 2KJHB 1VRAB 2EKIA 3R8BA 2COCA 1C3TA 1AN8A 4Y94A 1XKEA 5E6OA 5AZGA 2K49A 3PLUA 5IP4D 2KDMA 3FSSA 3V61A 3TJPA 3Q8EA 4ICUA 3AE9B 2VSZA 1UF0A 1M94A 3LYYA 1GC6A 1F1HA 2RGFA 1MK7B 1T0YA 4S0RA 2DBYA 1E6EB 2MH7A 3OWEB 4M8NA 2OQBA 2IO1B 1I4HA 3ZIMA 3HM3A 4YTNB 5KHOA 4K1RB 4KKIA 4HB2B 1HA5A 3ZLZA 2E3TA 4NPNA 1QC6A 2IGGA 3SDLC 4C7YA 2WXQA 1B9RA 2BS2B 3ABVB 1WI1A 2KIGA 2YT1A 5C23A 2E6XA 2IYBA 1WX8A 5JHGA 1E8YA 1ZP0B 1QKZA 4MM3B 3KYCD 1L0VB 3CMMB 2KAJA 5JHBA 2WQYB 3R66C 1PFJA 3AE3B 3AEFB 2RUKB 2FUHB 4HATB 2NMBA 4EE2A 4CYEA 3BJIA 3NY5A 4NZLB 2D2QA 2KFKB 1E90A 1D5MC 2LXCA 1WM3A 2I5FA 1D6EC 3WCQA 1NEKB 1PGXA 3RI7C 3QA8A 1YD8U 4MT7A 1YQBA 2MP2A 2HTHA 3P7ZA 5D3VA 4LNNA 1VD2A 4GPTB 4WAAA 2IDYA 1J0WA 3M1IB 2LZ6A 3FILB 3AE4B 1FEHA 2N0YA 1L6VA 5DH9B 1JWSD 3W1SA 1SHCA 4LLGM 4NQKE 2P0DA 3K9PB 4N58A 2GBNA 3VTVA 1F2RC 4P16A 1P6SA 2PE9A 1FNUA 3TSSA 3E56A 3ZJTA 2DZMA 2LYDA 1V5OA 1V81A 1EU4A 4G0NB 3UQBA 2FAZA 2AQ3B 2K2JA 2CHWA 2CRFA 3CIKA 4FJVB 3EGRA 2DHKA 2GOWA 1L4DB 3AM9A 4B95A 3JSVB 1F2RI 3NWFA 2WU2B 4H8SA 3IHPC 1TJ6A 2DX5A 4URKA 1YIWA 2KXJA 2INDC 2KWDA 4HAZB 2MRPA 1DOXA 3DPDA 1MFWA 1BMLC 2A5UA 2TSSA 2D07B 4K3BA 5C5BB 1NI3A 3VVWB 2KN4A 2L2IA 1TTNA 2EMSA 3Q3NC 1ZKHA 1BT0A 1EWCA 1AW7A 3SHQA 1C77A 1PQSA 1V5MA 1P7EA 2PTLA 1J0GA 4ANUA 2W82A 1JRUA 3BWUD 4REZA 5JH5C 2QEJC 2OJRA 3BZDB 4HCPB 2KQ4X 3UZTA 3N7CA 3U30A 1N61A 2OEDA 5I2MA 3N9YC 2L7RA 1OQNA 4FHJA 4RM8A 3TUOA 2BYVE 2KO3A 2WX1A 4CSQA 2Y5PA 2LD9A 3NZUA 1RFAA 3Q3JA 2KD0A 4BBNF 4DQOC 4RMAA 1JWUD 2AEHA 1DROA 3EUB2 1OQQA 4L2YA 3RZWC 3QCAA 1W1GA 2RGNB 1IPGA 1ZE3D 4GDKA 4MELA 3Q8BA 3PVLA 3EECA 2Z8LA 3PRMB 5J3QA 4MJSA 4A6QA 1YNTE 1T6BX 3A9JB 3HRDD 3R2IA 5D6JB 2D9WA 1C79A 3F5RA 1XD3B 1AYFA 2MSED 4LTUA 3IVFA 2X18A 1WR6E 4MSMB 2IGHA 5AUKA 2LGDA 2GBMA 4WJNA 1TKEA 3Q8CA 2LJIA 2KDIA 1K51A 2IY1B 3A4SC 5G5GA 3QQ8B 2BYTA 5I2SA 3R3MA 4JX1C 3U52E 4IM0A 1E0ZA 4EZKA 2BKRB 1T5XD 4PNKA 1L5PA 3DBLB 3RNCC 2DWQA 5D3DA 4G3XB 3AE5B 2I5CA 3PZ8A 2R2OA 2Y3AA 3FEHA 2KJ6A 2IZVB 5H8YE 1C4PA 2PEAA 4CO7A 1FM0D 5FKAC 1SXTA 2RPQA 4DIXA 1ZM0A 4LDTB 1T3QA 2VH1A 2MJEA 2X38A 4IWQA 5IAAC 1V8CA 5DI9B 2KTRB 4C4VB 3RCPA 2C7MB 5FR6A 2RVBB 4GOCA 2CU1A 4BFRA 1VJKA 2DLBA 1WGUA 4ANWA 3Q8FA 3B77A 5LOPB 2CHZA 1DGJA 4OT1A 3Q3MC 2ZPYA 1QLBB 1HZ6A 4MDKE 4ICVA 4YXDB 1WGQA 5JXVA 2VZKB 1TJEA 4WAFA 1Y5OA 4W9FA 1J8CA 4CHMA 3CWIA 3KH0A 3O65B 1V5PA 2W2XD 2O2VB 4NAWB 2P0FA 4RH6A 4IM3A 1MIXA 4NJCA 1Q5WB 2Z0EB 3H9DA 1FB8A 3VH3B 5HE2A 1XLNA 1WJ6A 1GG3A 3GB1A 3P2BA 1FD6A 1ACCA 4LJPB 5C79A 1C4AA 1EF1A 1F9JA 5LXHA 2UZRA 2W54A 2VH2A 4WWMA 3V6CB 1I7AA 3VR8B 4LNOA 1Y8RC 2GI9A 2ONQA 1MG4A 4C7ZA 2QILA 3N30A 1PGAA 2DTCA 3ULBA 2REXA 1K5GB 5TSSA 3TEYA 3QIJA 5CLLB 1XEEA 3I57A 4W9HA 1QT9A 3L16A 2G35A 4WJPA 3HVZA 4L23A 2FIDA 3VQIA 3MTNB 4QAYA 2KACA 5DHAB 2KHWB 2Q13A 3TW1A 2PVGC 2WXIA 1WH3A 2DYOA 2FBWB 3KSYA 1WXMA 2LG1A 2LRUA 4GDLB 3Q2AC 1MI0A 1V5TA 4EEWA 3MC8A 3IT4B 2D5GA 4YTMB 2KDBA 3D32A 3SFEB 2INPE 3V6EB 3PHXB 1WE7A 2W9NA 3RT3B 1KRHA 3RNAC 2JF5A 2YT2A 1ZSQA 4IAPA 1WGRA 3HQCA 4W9DA 4YTPB 2M56B 2INCC 3Q3FA 3PTFC 3NSUA 1M7RA 4DHZB 3P4RB 4JIOU 4FJZA 2WWZA 2QCZA 4WJOA 1WWTA 2SAKA 4RM9A 4BOSC 4BOZB 3AB5A 2KKCA 3ZO5B 2XQNM 2D10A 3W1SC 1WIAA 1I42A 4EKUA 3V62A 2NBVB 2LHEA 2D3BA 4WWPA 4MK0A 1NU2A 5CX3A 3AE1B 4A3OA 1SSNA 1FAOA 1ZGUB 4TKNA 1V2YA 2YRYA 3HIZA 2Y5CA 1V6EA 4QJ4B 1V80A 4IWPA 1HE8A 1H10A 4EZJA 4HK2A 3N32A 4L1RA 1R4NB 1GPXA 1V86A 4TUUA 1ZPSA 3LJ3A 3BVGA 2D9VA 3L13A 3A8QA 3ZNID 4HKQA 1XO3A 3I3TB 3L0WB 4DXGA 1FXAA 2J59M 1FRDA 1N60A 2L3ZA 5I4DA 4LCDE 5DPSA 1ZXHA 1N5WA 3HUIA 3H6NA 4GLSC 1I35A 2FNJB 3JVZX 2FCSA 4CQNA 4P6VF 2WGSA 3WIMA 1N63A 1Z87A 4MY6A 3WAPA 3P1MA 4IFSA 1KFYB 1PDXA 2N9XA 4KIKA 3I63C 1P9DU 4KDIC 2CJOA 1AWDA 3ZJVA 1ZDVA 2GS0A 1MK9B 1UPQA 2BVCA 1Y19B 2WXGA 2BYFA 4A55A 3L4PA 2O6VB 2ZCCA 2HDEA 3L10B 2NPTA 1GAQB 1TKYA 2ELBA 2RRFA 3D8DA 2B76B 1WXVA 1IUEA 2NS5A 2MW5A 2W2WA 2KTFA 2WDRB 1CMXB 3DBLI 4IUMB 2DHZA 1WYWB 2R09A 1UBIA 3HW2B 2C5LC 1P0RA 2K2UA 1N6ZA 3SO6A 4I6NB 1V5UA 1WJNA 1WZ0A 2KMCA 3PVWA 1OEYJ 3ZXVA 4B6HA 4YSYB 3VDZA 2NTTA 2LVQA 3TL5A 2ZW1A 2BQQA 3RD2A 1OTRB 4FA6A 5KQ1A 2X8XX 3AN1A 4F7GA 3OG5A 3T06A 2XK5B 1I4RA 1WE6A 4KHBA 1JRPA 4C00A 4K3CA 3FVCA 2BYEA 2MDXA 1TY0A 3JW0X 1U4AA 3ZVRA 2MX2A 3PRPB 1GOZA 2MLBA 3P4SB 4IDIA 4K2OA 2KWUB 1E8WA 4GMVA 2HD5B 1IRSA 4DXAB 4L6EA 3RN9C 3TEXA 3AEEB 3KYDD 2FCQA 1UGJA 5JHAA 4IWOA 1GUAB 4W9JA 1N62A 3X23A 4TV3A 4XGAB 4DXFA 2N9KA 2KLGA 3JYUA 5EE3A 2KLCA 3UGBB 4K7SA 4HB3B 5KQ4A 4KV2A 2ICIA 4R3DA 2IYDB 3OLMD 3V5WA 4ZYNA 3HM6X 2NBUA 3BIID 4LDTD 3KWLA 3BYTB 3DCXA 2JT4B 3FAHA 3HK0A 5JLJB 1ZXIA 5IRSA 3AEDB 4OVZA 3KRXA 2LWPA 3HHMA 1W1HA 3EFCA 3WAMA 2DHIA 4ZRIA 5IA7A 4JWUC 1GC7A 1MI1A 1P5TA 2AX5A 1PMSA 4P1BC 2DZJA 1TXDA 2K1FA 4MM3A 4PS8A 2ASQA 2VZKD 2V76A 2J0KA 2M14A 1ZVRA 2Y5BB 5EE0A 1MPHA 3DQVA 3IFWB 4LJOB 1F0ZA 3A9KB 3DBSA 1NYRA 2MBHA 3GZNB 4DHZE 3HIEA 2C7HA 4GSWA 3IXSA 4KSLC 2KFKA 1VZ7A 3N3KB 1XODA 1AWEA 4QJ5B 1IGCA 2CHXA 4FLHA 2KC1A 4HDQA 2PW9A 3ZKJC 3PT2B 4RF0A 2LULA 2CODA 2XNAC 1XLPA 4XYCA 5EE9A 1GNUA 3QHTA 1D4BA 3T9LA 4BVUC 5LONB 4DBGA 1K52A 3N1YC 1SJHD 1NVID 4BBKA 3RZFA 3RNGC 1RM6C 1TQZA 1XT9B 5AUIA 5T8IA 1V97A 1IYFA 2DA0A 2N7JA 2GBJA 3FILA 2KQSA 2LOZA 3ZXRA 2JYTA 2KK8A 1E7UA 3PRZA 1FXIA 2C7NB 3NVVA 2MBBB 3RMKC 2JUOA 2V1YA 2BF8B 1R4NI 2V3NA 2Y7BA 2KMMA 1SB3C 3ZRFA 2QKMA 2CAYA 2UWQA 4KVGB 4G50A 2KFJA 5CHVC 3A58A 4KAXB 1J19A 4MSQB 3TBLD 3JSVA 2HJ1A 2D3AA 3QC8B 2V4LA 4D2KA 4M01A 4US9A 2NCNA 1V1PB 1RJ2A 3QWMA 5C5BA 1OQYA 4F1SA 3ZDTA 2PVOD 4KHOA 1VR9A 3ZTDA 2XEWA 3NJTA 2BW2A 4LNKA 2PKOA 1KOTA 4HRSA 5MPOA 3KUCB 1KI1B 2WXNA 2KGXB 5D2MB 3ZRCA 4W9IA 2M8SA 4A6FB 3PV1A 1PGBA 5CLQB 2CU3A 3IT6B 2FIFA 1NTYA 3M63B 1ZC3B 1KH0A 4FJYA 3V3XA 4IM2A 4YWGG 2WXFA 4A6KA 3OANA 2I1KA 2ZNVC 3U7ZA 4NY0A 1UEFA 2YS5A 4DHJB 2KZRA 4AS1A 1L7YA 2GBKA 2M0XA 2NMQA 1YX5B 1K50A 5AZFA 5E6NA 2L52A 3ML9A 2Q5WD 1FIQA 3A9JA 4DBBA 1K5DB 2L76A 3LDZE 1X86A 1FNVA 2D3CA 1XCGA 2ZW0A 3F0WA 1X1GA 2WS3B 3MC9A 2BWES 1STEA 1HTOA 2W3RA 2ZKMX 3SNHA 1V89A 3C19A 2VKIA 1WG7A 3ZGZA 4II3B 4IOYX 1KF6B 3X0WA 3ZVVA 1V61A 2BTEA 3P63A 1BAKA 4DX8A 1V1OA 2O6VD 2R2YA 2RDGA 1AARA 3L08A 4NJ6A 5LNK1 2ON8A 3PO0A 2ZPNA 4OZBA 3CSFA 4XC2A 3DXDA 5BYSA 1Q0WB 2Y8FA 1ISNA 3ETRA 3PP2A 1D5ZC 3BVZA 3SV1A 3N1ZC 5DHFB 2KTRA 2JWUA 5LLIA 4C4VA 4AUQC 2W2XC 4DDGD 1SF0A 1RRPB 3VR9B 2BKFA 4B9KA 1CQVA 3AE8B 2L1AA 2DFKA 4WWOA 1WY8A 4L1BA 3U2SC 3MJ5A 3PZ7A 4RCOA 3GE8C 1ET9A 4GXBA 1FHXA 3UIOB 3DXCA 5C16A 1LB1A 1EGXA 1S1QB 1YMHE 2M17A 2N4FA 2QJLA 4GOUA 3DHIC 1MG8A 4M02A 2K8BA 4K2PA 1WVHA 2LHDA 2O2VA 5JP4A 2K39A 4NAWA 4OHJA 3PSCA 3LXFA 2JY6A 1C9FA 4N59A 3V05A 1ZOYB 3NZSA 4D6WA 3C0RB 1UWMA 3L17A 5AZHA 2WXOA 2Z59B 4K17A 4NQLB 2BB6A 4US8A 3GZNI 3IG3A 4A6HA 5FI1A 3AE7B 4PYUA 1SE3A 3ZYYX 2M19A 1RLFA 4W9LA 2COAA 3HVDA 1V49A 2MJDA 1KM7A 4W9KA 4ASWC 2YF0A 2Z0OA 3OHMB 2KUQA 2LFIA 1OMWA 3A1QB 4PS7A 4RNAA 5DPTA 4M0WB 3NS8A 1WXAA 1BTKA 2KOXA 1HXYD 4BKSD 4EMOA 2YEPF 5C1ZA 1WJ1A 2WXMA 3M95A 4GDLA 5KCVA 2UVMA 3PLVA 2KDFB 2M4NA 2BGFA 3WANA 4MGIE 2JSVX 1RAXA 1OEYA 1X1FA 3MJWA 2Z13A 5LG4B 2J52A 2KVZA 5HKHA 1WRDB 2LJ5A 4AJWA 5HFYA 2KJRA 4EOYA 2WXKA 4WJQA 4ZHPA 4H2AA 2V0GA 2ELAA 3RULA 1GB4A 4Q2JA 1YQ3B 3B9JA 4WSFA 5IO9A 2N0SB 1Q67A 2N7EA 1BXTA 2WLBA 1UWXA 2ZJDA 2BCJA 1KLGD 1TYGB 3R2TA 1J7CA 4EZLA 1EAZA 5EE1A 3UF8A 3W5VB 2BS4B 2RDHA 3WAOA 5LXIB 2YS1A 2NBVA 1TT5B 4ZRQA 3W2DA 2MWSB 1B1ZA 2COFA 2N9LA 3VRAB 2WP9B 1HQRD 1UGMA 1KJTA 1DYNA 3AU5A 3Q14C 2NR2A 3B1LX 2YEPB 4KGSA 1NBFC 1UELA 1QOBA 3IBEA 3I5JC 2DYQA 5EFXA 3AJ4A 2PIAA 2K8EA 3VUWA 2N1VA 5E6JA 4F7UP 2ACZB 4JLCA 2DLWA 4M00A 4RGOS 4RGNA 3KW5B 2LUEA 3MDBC 2AL3A 5M4YB 3WA0A 2UZSA 1UUPA 1JW9D 3CF6E 5D27A 3CXBB 3OJ4B 4KX6B 1UNPA 4MH0E 3APDA 1YN5A 3FKYA 3OAWA 2EC1A 2LASA 1DDVA 2H7EA 1OY2A 2M38A 2KIEA 1XQQA 2WNMA 5E6PA 1WMHB 4TMAB 1AQCA 1WI0A 4EUTA 4LK0M 1JMLA 2O6VA 3LB8C 2N7DA 1MAIA 2SEBD 5DPWA 2GMIC 1JWMD 4GIVA 1WM2A 5L83A 3DCGA 3BYYB 5GXGB 2N1WA 3APCA 5J3YA 4GU2A 4GB9A 1OFFA 5TR5A 4N9F4 4AWJA 2KANA 1U5FA 1EWYC 4IOIE 1FFUA 1A70A 3AE2B 4MGYE 2ROVA 3B0AA 2MEKA 3AECB 2WU5B 1FCLA 1X1MA 1I7HA 1LQBA 2GRIA 2K6DB 3PREA 1M7EA 4PYZA 4OW0A 4DHJD 3H7SA 3KLSX 3VH4B 4QJ3B 1FXTB 3QJZA 3J9CA 5L81A 2GUMA 2D3GA 2JWZA 2KYWA 3DWGC 2UU7A 1YX6B 5D3WA 4J6IA 2XK5A 4HDOA 4KGRA 2DYNA 1SE9A 2JX5A 5HE0A 5HE3A 2MCNB 3SUZA 2K3UA 2LXAA 1WGYA 4O1NA 5HHDG 4TQ0A 3I9V1 1QOAA 3DVNV 1XCQL 2OOBB 3PZDA 5JZEB 3TEZA 1JWBD 4BBNC 1UNSA 1MIZB 2I1JA 1WR1A 2KDEB 4RGTA 1NDDA 1CK1A 2KMAA 1OGWA 3AMZA 4ZRJA 4OZCA 4GGQA 1TIFA 2JYEA 1P1AA 4A20A 2D9YA 4PT5A 4TQ1A 3ZNZB 3UINB 2N9PC 2HJ8A 4KGTA 1SIJA 1YN4A 1E9MA 4PQ0A 3ZDMC 2N23A 1WJUA 1E7VA 2KN5A 2IBIB 2MFQA 2LVOA 3S2AA 4YL8A 2RMMA 3EHVA 2IO2B 2Z0PA 3DVNU 1LFDA 1PUTA 1YJJA 4J3OD 2HE7A 4BKSA 1A5RA 2G9HD 1ROEA 1H4RA 3T3OA 5C6RA 1DOYA 1RFKA 1E8XA 4BKTA 1TS5A 2V3SA 3ONSA 1LO5D 1QF6A 3UIPB 5GOWB 1IGDA 5HG2A 1DYQA 2WXHA 1M4VA 1HTQA 2JXTA 2EELA 1TS2A 2V4IB 4MGZE
chains in the Genus database with same CATH topology
4F7ZA 2DN6A 4HCNB 3A9KA 2ZZPB 1U5DA 3H7PB 1BTNA 3M62B 1YJ1A 1C1YB 3VUYA 2KUPA 2JRIB 2J0JA 2EKEC 5J18A 3VOQA 1WXSA 1XR0B 4KZCA 1WFYA 2JP2A 4KHAA 3VFKA 2MKRA 1DDMA 3WALA 4C0AA 2L0TA 1ZC4B 2P0HA 1UNQA 2LVPA 1Z2MA 4JGHB 3VAWA 3QBVB 4HB4B 2D11A 2K8CA 2R0DA 1WX9A 2LRWA 2YSZA 4EFOA 2BWFA 3V60A 2KQ7A 3BY4B 4E3CA 2YLMA 1UH6A 1XX0A 2FCNA 2PJHA 4IW0A 4P7IA 2B3AA 3PS6A 3H1UA 2A4ZA 2JXXA 2KCJA 3ZW3A 5KHQA 4WWNA 2EJ8A 1LW3A 4HAWB 5GMVA 2Z0DB 2QKLA 3PSEB 3VTUA 2YS3A 4A6FA 2L00B 1P3RA 3O96A 2H7DA 2LGXA 1V9JA 1EO6A 2R2QA 2L1CA 3WYFB 3ML8A 2G3QB 2P8VA 2ADZA 4I6LB 4HB0B 5JHHA 4I6PA 3T8MA 4WJ7A 3TMPB 2ZCBA 3KUDB 2IFSA 3U8ZA 2RNRB 2MQJA 4DDID 1EF5A 2K00A 3DXEA 3VTWA 4A5KA 3PVUA 1G6JA 4W9CA 2L8JA 2LGYA 3AI5A 2DKPA 3U7DA 1DDWA 3DVGX 5L95C 5FI0A 1H8CA 1WGHA 2RLOA 1NTVA 5J2RA 4HLEA 3MHSD 2IO0B 4DX90 4K7UA 2ZEQA 2MBQA 1I2HA 5D3YA 4FHKA 3CSTA 3ODXA 3QWZB 4HWIB 2PE6B 5CHFA 4MGKE 3RYTA 1U5EA 1SGHA 5G55A 1UPRA 2DYMA 2M1MA 1TGZB 4D0NB 2ZVOA 4W9GA 1ZW7A 1FGYA 2VRRB 3APFA 4NJ7A 2ROZB 1RRBA 2MP2B 3TFMA 2HTHB 1FHWA 2FJLA 5J3TA 4HAUB 2JZ3B 2N9EB 4HHVA 4JL9A 3PG7A 4NSWA 1LXDA 2G45B 1D3ZA 1UNRA 3KRWA 4A3PA 4E74A 4ANXA 4WVFB 3VIAA 3AULA 2DYBA 3UQAA 4XX5A 2AL6A 1U5GA 1SIFA 1U2BA 2JPHA 4GN1A 5AEKB 1X11A 2G4SA 3GOEA 4HPLB 2D9XA 4HXDA 2PPHA 2DHJA 1QZEA 3A1QA 1P3QU 2KC2A 5BO4B 1K8RB 2XBBC 3G9WA 1EUVB 2DX5B 2CS4A 2GCLA 2MWNB 4TYZA 1X05A 4HJKA 4K7WA 3TVVA 3ZUNA 4ZRKA 2MBEA 3ZNHB 3TIXA 3ENEA 1NI2A 3ALBA 3DOWA 3A33B 4AJYB 1TBEA 1E5WA 4WQOB 4JQWC 2C9WB 1WF9A 3VXWA 3PEGA 4FULA 3PGEA 2WDTB 2IO3B 2LOXA 2DZKA 1W1DA 1UD7A 2RR9A 3OJ3A 3PHWB 3L54A 1L2NA 2RSGA 3EC8A 1KZGA 4GDKB 4MJSB 5D94A 3LJUX 3GYPA 3KVFB 1PLSA 3KUZA 1DBHA 4II2B 2JVCA 2RD0A 3K9OB 2YT0A 1Z5SB 2JZZA 4HPMB 3BINA 1FHOA 1FGZA 3ML4A 4KSKC 2D4QA 4AOFA 3R7RA 1WGGA 2Z0QA 1LM8B 1WJ4A 1WMHA 4E71A 4Z2NA 4X57B 1VCBA 2VRWB 3B08A 3ULCA 4PS3A 2L0FA 2D9ZA 3DDCB 4CHKA 2K25A 1FOEA 3SD5A 1IP9A 4GZUA 2AYOB 5EDSA 2NBWB 2CKHB 4ANVA 1UBQA 2DENB 2MBOA 4IG7B 3VHTC 3D8EA 2RSUA 3ZNGC 1R4MI 3NOBA 2K8HA 1EVHA 3PPAA 2J0MA 2KX3A 4W9EA 2KX0A 1V88A 2L05A 3GYOA 3R7QA 1U29A 5CHWA 2E2XA 1GJZA 3RCZA 2G4DB 3ODOA 2J7QB 4YONA 3VUXA 2ZVNA 4ZDVA 2LI5A 3SYXA 5D7GA 4EJNA 3DVGY 4DK5A 2GJYA 5DPRA 4HAVB 4XZ4A 5J17A 2NZ8B 4M8MA 1UZXB 1WGDA 2Y8GA 2LKOA 5DIFB 4KZ0A 2QHOA 2AWTA 3TO1A 4OVUA 4F7HA 3RUIB 3TCAA 3SU8X 4OVVA 2UYZB 2KWVB 5D3XA 2KNBA 2FCMA 3EFUA 1N3HA 4FADA 3A4RA 3A98B 2DX1A 2CY4A 2WYQA 4F8CB 5CTRC 4FN2A 2KVRA 3H7PA 3QAQA 4G11A 2GCJA 1E8ZA 1S3SG 2K6QA 2OTXA 2CY5A 1QQGA 1BWNA 1TZ1A 3QARA 4KDLB 4IC7B 2CR5A 3QK0A 2PZ1A 3D8FA 1WX7A 4XWXA 2MA9B 2JRHA 2ZNVB 4AP4C 4BKGA 4HAYB 4GMXB 3ODWA 3W1YA 3ZTCA 2DAJA 2NVUI 4KIKB 3KY9A 3AXCA 2WX0A 3KZ1A 2DAFA 2DZIA 3DBRI 1Q1OA 3FM8C 3P6AA 1U27A 2NPTB 1B55A 3QX1A 4HVBA 4DWFA 2KWCA 3MPXA 5DCNA 1MKEA 2GBRA 3AU4A 4Z2MB 4HAXB 4FBJB 3ECIA 4K81A 1WJMA 4CHJA 2YVCA 1KZ7A 2C60A 5HE1A 2DKQA 3A8PA 4NNJB 1WZ3A 4MEMA 4KHBB 2BPSA 4B6WA 3M3JA 2IY0B 1KLVA 5G2NA 1XD4A 1P98A 3NHEB 3DBHI 2EMTA 2KJHB 2COCA 1C3TA 4Y94A 1XKEA 5E6OA 5AZGA 3PLUA 3FSSA 3V61A 3TJPA 4ICUA 2VSZA 1M94A 1GC6A 2RGFA 1MK7B 1T0YA 4M8NA 2OQBA 2IO1B 3ZIMA 3HM3A 5KHOA 4K1RB 4HB2B 3ZLZA 4NPNA 1QC6A 3SDLC 1WI1A 2YT1A 5C23A 2IYBA 1WX8A 5JHGA 1E8YA 3KYCD 3CMMB 5JHBA 3R66C 1PFJA 2RUKB 2FUHB 4HATB 2NMBA 4CYEA 3BJIA 3NY5A 2D2QA 2KFKB 1E90A 2LXCA 1WM3A 2I5FA 3QA8A 1YD8U 4MT7A 1YQBA 2MP2A 2HTHA 3P7ZA 5D3VA 1VD2A 4GPTB 4WAAA 1J0WA 3M1IB 2LZ6A 2N0YA 5DH9B 3W1SA 1SHCA 4NQKE 2P0DA 3K9PB 2GBNA 3VTVA 1P6SA 2PE9A 2DZMA 2LYDA 1V5OA 1V81A 4G0NB 3UQBA 2FAZA 2K2JA 2CHWA 2CRFA 3CIKA 4FJVB 2DHKA 2GOWA 4B95A 3JSVB 4H8SA 3IHPC 1TJ6A 2DX5A 4URKA 1YIWA 2KXJA 4HAZB 2MRPA 3DPDA 2A5UA 2D07B 5C5BB 3VVWB 2L2IA 1TTNA 2EMSA 1ZKHA 1BT0A 3SHQA 1PQSA 1V5MA 1J0GA 4ANUA 1JRUA 5JH5C 2OJRA 4HCPB 3UZTA 3N7CA 3U30A 2L7RA 1OQNA 4FHJA 4RM8A 2BYVE 2KO3A 2WX1A 2LD9A 3NZUA 1RFAA 3Q3JA 2KD0A 4BBNF 4RMAA 2AEHA 1DROA 3RZWC 3QCAA 1W1GA 2RGNB 1IPGA 4GDKA 4MELA 3PVLA 3EECA 3PRMB 5J3QA 4MJSA 3A9JB 5D6JB 2D9WA 3F5RA 1XD3B 2MSED 3IVFA 2X18A 1WR6E 4MSMB 2LGDA 2GBMA 4WJNA 2KDIA 2IY1B 3A4SC 3QQ8B 3R3MA 4IM0A 4EZKA 2BKRB 4PNKA 4G3XB 2I5CA 2R2OA 3FEHA 2KJ6A 2IZVB 2PEAA 4CO7A 2RPQA 1ZM0A 4LDTB 5IAAC 4IWQA 5DI9B 2KTRB 3RCPA 2C7MB 5FR6A 2RVBB 4GOCA 2CU1A 4BFRA 1WGUA 4ANWA 5LOPB 2CHZA 2ZPYA 4MDKE 4ICVA 1WGQA 1Y5OA 4W9FA 1J8CA 4CHMA 3KH0A 3O65B 1V5PA 2W2XD 2O2VB 4NAWB 2P0FA 4IM3A 1MIXA 1Q5WB 2Z0EB 3H9DA 1FB8A 3VH3B 5HE2A 1WJ6A 1GG3A 3P2BA 4LJPB 5C79A 1EF1A 1F9JA 5LXHA 2UZRA 3V6CB 1I7AA 1Y8RC 3N30A 2DTCA 3ULBA 2REXA 1K5GB 3QIJA 5CLLB 4W9HA 3L16A 2G35A 4WJPA 2FIDA 3VQIA 3MTNB 5DHAB 2KHWB 2Q13A 3TW1A 1WH3A 2DYOA 3KSYA 1WXMA 2LG1A 2LRUA 4GDLB 1V5TA 4EEWA 2KDBA 3D32A 3V6EB 3PHXB 1WE7A 2W9NA 3RT3B 2JF5A 4IAPA 1ZSQA 1WGRA 3HQCA 4W9DA 3Q3FA 3PTFC 3NSUA 1M7RA 4DHZB 4JIOU 4FJZA 2WWZA 4WJOA 4BOSC 4RM9A 4BOZB 2KKCA 3ZO5B 2XQNM 2D10A 3W1SC 1WIAA 1I42A 4EKUA 3V62A 2NBVB 4WWPA 4MK0A 1NU2A 5CX3A 4A3OA 1FAOA 1ZGUB 4TKNA 1V2YA 2YRYA 3HIZA 1V6EA 1V80A 4IWPA 1HE8A 1H10A 4EZJA 4HK2A 3N32A 1V86A 4TUUA 3LJ3A 2D9VA 3L13A 3A8QA 3ZNID 3I3TB 3L0WB 2J59M 2L3ZA 4LCDE 5DPSA 3H6NA 1I35A 2FNJB 3JVZX 2FCSA 3WIMA 1Z87A 4MY6A 3WAPA 4IFSA 2N9XA 4KIKA 1P9DU 4KDIC 2GS0A 1MK9B 1UPQA 1Y19B 2BYFA 2O6VB 2ZCCA 3L10B 2NPTA 2ELBA 3D8DA 1WXVA 2NS5A 2MW5A 2W2WA 2KTFA 1CMXB 3DBLI 4IUMB 2DHZA 1WYWB 2R09A 1UBIA 3HW2B 2C5LC 1P0RA 2K2UA 3SO6A 4I6NB 1V5UA 1WJNA 1WZ0A 2KMCA 3PVWA 1OEYJ 4B6HA 3VDZA 2LVQA 3TL5A 3RD2A 1OTRB 4FA6A 5KQ1A 4F7GA 3T06A 2XK5B 1WE6A 2BYEA 2MDXA 3JW0X 1U4AA 3ZVRA 2MX2A 3PRPB 2MLBA 4K2OA 2KWUB 1E8WA 4GMVA 2HD5B 1IRSA 4DXAB 4L6EA 3KYDD 2FCQA 5JHAA 4IWOA 1GUAB 4W9JA 3X23A 4TV3A 2KLGA 3JYUA 2KLCA 3UGBB 4K7SA 4HB3B 5KQ4A 4KV2A 2IYDB 3OLMD 3V5WA 4ZYNA 3HM6X 2NBUA 4LDTD 2JT4B 3HK0A 5JLJB 3KRXA 2LWPA 3HHMA 1W1HA 3WAMA 2DHIA 4ZRIA 5IA7A 1GC7A 1P5TA 1PMSA 2DZJA 1TXDA 2K1FA 4MM3A 4PS8A 2ASQA 2V76A 2J0KA 2M14A 1ZVRA 2Y5BB 1MPHA 3DQVA 3IFWB 4LJOB 3A9KB 3DBSA 2MBHA 4DHZE 2C7HA 4GSWA 4KSLC 2KFKA 3N3KB 1XODA 1AWEA 2CHXA 4FLHA 2KC1A 4HDQA 3ZKJC 3PT2B 2LULA 2CODA 1GNUA 3QHTA 3T9LA 4BVUC 5LONB 4DBGA 4BBKA 3RZFA 1TQZA 1XT9B 1IYFA 2DA0A 2GBJA 2KQSA 2LOZA 2KK8A 1E7UA 3PRZA 2C7NB 2MBBB 2JUOA 2V1YA 2BF8B 1R4NI 2Y7BA 3ZRFA 2QKMA 2CAYA 2UWQA 4KVGB 4G50A 2KFJA 5CHVC 4KAXB 1J19A 4MSQB 3TBLD 3JSVA 3QC8B 2V4LA 2NCNA 1RJ2A 3QWMA 5C5BA 1OQYA 4F1SA 3ZDTA 4KHOA 3ZTDA 2XEWA 1KOTA 3KUCB 1KI1B 2KGXB 5D2MB 3ZRCA 4W9IA 2M8SA 4A6FB 3PV1A 5CLQB 2FIFA 1NTYA 3M63B 1ZC3B 4FJYA 4IM2A 4A6KA 3OANA 2I1KA 2ZNVC 4NY0A 1UEFA 2YS5A 4DHJB 2KZRA 1L7YA 2GBKA 2M0XA 1YX5B 5AZFA 5E6NA 3ML9A 3A9JA 4DBBA 1K5DB 2L76A 3LDZE 1X86A 1XCGA 3F0WA 1X1GA 2BWES 3SNHA 1V89A 2VKIA 1WG7A 4II3B 4IOYX 3X0WA 3ZVVA 1V61A 1BAKA 4DX8A 2O6VD 1AARA 3L08A 4NJ6A 2ZPNA 3CSFA 4XC2A 3DXDA 1Q0WB 2Y8FA 1ISNA 3PP2A 3SV1A 5DHFB 2KTRA 5LLIA 4AUQC 2W2XC 4DDGD 1RRPB 2BKFA 4B9KA 2DFKA 4WWOA 1WY8A 4GXBA 1FHXA 3UIOB 3DXCA 5C16A 1LB1A 1EGXA 1S1QB 2M17A 2N4FA 1MG8A 2K8BA 4K2PA 1WVHA 2O2VA 5JP4A 2K39A 4NAWA 3PSCA 2JY6A 3NZSA 3C0RB 3L17A 5AZHA 2Z59B 4K17A 4NQLB 3GZNI 3IG3A 4A6HA 5FI1A 4PYUA 1RLFA 4W9LA 2COAA 1V49A 4W9KA 1KM7A 4ASWC 2YF0A 2Z0OA 1OMWA 3A1QB 4PS7A 5DPTA 4M0WB 3NS8A 1WXAA 1BTKA 2KOXA 4BKSD 4EMOA 5C1ZA 1WJ1A 3M95A 4GDLA 5KCVA 2UVMA 3PLVA 2KDFB 2M4NA 2BGFA 3WANA 4MGIE 1RAXA 1OEYA 1X1FA 3MJWA 5HKHA 1WRDB 2LJ5A 4AJWA 2KJRA 4EOYA 4WJQA 2ELAA 3RULA 4WSFA 2N7EA 1Q67A 2ZJDA 2BCJA 4EZLA 1EAZA 3UF8A 3WAOA 5LXIB 2YS1A 2MWSB 2COFA 1UGMA 1KJTA 1DYNA 3AU5A 2NR2A 3B1LX 1NBFC 1UELA 3IBEA 2DYQA 5EFXA 3AJ4A 3VUWA 2N1VA 4F7UP 4JLCA 2DLWA 3KW5B 2LUEA 3MDBC 2AL3A 3WA0A 2UZSA 3CF6E 5D27A 3CXBB 3OJ4B 1UNPA 4MH0E 3APDA 3OAWA 2EC1A 2LASA 1DDVA 2H7EA 1OY2A 2M38A 1XQQA 5E6PA 1WMHB 1AQCA 1WI0A 4EUTA 2O6VA 2N7DA 1MAIA 5DPWA 2GMIC 4GIVA 1WM2A 5L83A 3DCGA 2N1WA 3APCA 5J3YA 4GU2A 4GB9A 5TR5A 4N9F4 4AWJA 2KANA 1U5FA 4MGYE 2ROVA 3B0AA 1X1MA 1LQBA 3PREA 2K6DB 1M7EA 4PYZA 4DHJD 3H7SA 3VH4B 1FXTB 3QJZA 5L81A 2D3GA 2JWZA 1YX6B 5D3WA 4J6IA 2XK5A 4HDOA 2DYNA 1SE9A 5HE0A 5HE3A 2MCNB 3SUZA 2LXAA 1WGYA 4TQ0A 3DVNV 2OOBB 3PZDA 5JZEB 4BBNC 1MIZB 2I1JA 1WR1A 2KDEB 1NDDA 2KMAA 1OGWA 4ZRJA 4GGQA 1P1AA 4A20A 2D9YA 4TQ1A 3ZNZB 3UINB 2N9PC 2HJ8A 4PQ0A 3ZDMC 2N23A 1WJUA 1E7VA 2KN5A 2IBIB 2MFQA 2LVOA 3S2AA 4YL8A 3EHVA 2IO2B 2Z0PA 3DVNU 1LFDA 2HE7A 4BKSA 1A5RA 1H4RA 5C6RA 1E8XA 4BKTA 2V3SA 3ONSA 3UIPB 5GOWB 4MGZE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4F7Z A;  2DN6 A;  4HCN B;  3A9K A;  2ZZP B;  1U5D A;  3H7P B;  1BTN A;  3M62 B;  1YJ1 A;  1C1Y B;  3VUY A;  2KUP A;  2JRI B;  2J0J A;  2EKE C;  5J18 A;  3VOQ A;  1WXS A;  1XR0 B;  4KZC A;  1WFY A;  2JP2 A;  4KHA A;  3VFK A;  2MKR A;  1DDM A;  3WAL A;  4C0A A;  2L0T A;  1ZC4 B;  2P0H A;  1UNQ A;  2LVP A;  1Z2M A;  4JGH B;  3VAW A;  3QBV B;  4HB4 B;  2D11 A;  2K8C A;  2R0D A;  1WX9 A;  2LRW A;  2YSZ A;  4EFO A;  2BWF A;  3V60 A;  2KQ7 A;  3BY4 B;  4E3C A;  2YLM A;  1UH6 A;  1XX0 A;  2FCN A;  2PJH A;  4IW0 A;  4P7I A;  2B3A A;  3PS6 A;  3H1U A;  2A4Z A;  2JXX A;  2KCJ A;  3ZW3 A;  5KHQ A;  4WWN A;  2EJ8 A;  1LW3 A;  4HAW B;  5GMV A;  2Z0D B;  2QKL A;  3PSE B;  3VTU A;  2YS3 A;  4A6F A;  2L00 B;  1P3R A;  3O96 A;  2H7D A;  2LGX A;  1V9J A;  1EO6 A;  2R2Q A;  2L1C A;  3WYF B;  3ML8 A;  2G3Q B;  2P8V A;  2ADZ A;  4I6L B;  4HB0 B;  5JHH A;  4I6P A;  3T8M A;  4WJ7 A;  3TMP B;  2ZCB A;  3KUD B;  2IFS A;  3U8Z A;  2RNR B;  2MQJ A;  4DDI D;  1EF5 A;  2K00 A;  3DXE A;  3VTW A;  4A5K A;  3PVU A;  1G6J A;  4W9C A;  2L8J A;  2LGY A;  3AI5 A;  2DKP A;  3U7D A;  1DDW A;  3DVG X;  5L95 C;  5FI0 A;  1H8C A;  1WGH A;  2RLO A;  1NTV A;  5J2R A;  4HLE A;  3MHS D;  2IO0 B;  4DX9 0;  4K7U A;  2ZEQ A;  2MBQ A;  1I2H A;  5D3Y A;  4FHK A;  3CST A;  3ODX A;  3QWZ B;  4HWI B;  2PE6 B;  5CHF A;  4MGK E;  3RYT A;  1U5E A;  1SGH A;  5G55 A;  1UPR A;  2DYM A;  2M1M A;  1TGZ B;  4D0N B;  2ZVO A;  4W9G A;  1ZW7 A;  1FGY A;  2VRR B;  3APF A;  4NJ7 A;  2ROZ B;  1RRB A;  2MP2 B;  3TFM A;  2HTH B;  1FHW A;  2FJL A;  5J3T A;  4HAU B;  2JZ3 B;  2N9E B;  4HHV A;  4JL9 A;  3PG7 A;  4NSW A;  1LXD A;  2G45 B;  1D3Z A;  1UNR A;  3KRW A;  4A3P A;  4E74 A;  4ANX A;  4WVF B;  3VIA A;  3AUL A;  2DYB A;  3UQA A;  4XX5 A;  2AL6 A;  1U5G A;  1SIF A;  1U2B A;  2JPH A;  4GN1 A;  5AEK B;  1X11 A;  2G4S A;  3GOE A;  4HPL B;  2D9X A;  4HXD A;  2PPH A;  2DHJ A;  1QZE A;  3A1Q A;  1P3Q U;  2KC2 A;  5BO4 B;  1K8R B;  2XBB C;  3G9W A;  1EUV B;  2DX5 B;  2CS4 A;  2GCL A;  2MWN B;  4TYZ A;  1X05 A;  4HJK A;  4K7W A;  3TVV A;  3ZUN A;  4ZRK A;  2MBE A;  3ZNH B;  3TIX A;  3ENE A;  1NI2 A;  3ALB A;  3DOW A;  3A33 B;  4AJY B;  1TBE A;  1E5W A;  4WQO B;  4JQW C;  2C9W B;  1WF9 A;  3VXW A;  3PEG A;  4FUL A;  3PGE A;  2WDT B;  2IO3 B;  2LOX A;  2DZK A;  1W1D A;  1UD7 A;  2RR9 A;  3OJ3 A;  3PHW B;  3L54 A;  1L2N A;  2RSG A;  3EC8 A;  1KZG A;  4GDK B;  4MJS B;  5D94 A;  3LJU X;  3GYP A;  3KVF B;  1PLS A;  3KUZ A;  1DBH A;  4II2 B;  2JVC A;  2RD0 A;  3K9O B;  2YT0 A;  1Z5S B;  2JZZ A;  4HPM B;  3BIN A;  1FHO A;  1FGZ A;  3ML4 A;  4KSK C;  2D4Q A;  4AOF A;  3R7R A;  1WGG A;  2Z0Q A;  1LM8 B;  1WJ4 A;  1WMH A;  4E71 A;  4Z2N A;  4X57 B;  1VCB A;  2VRW B;  3B08 A;  3ULC A;  4PS3 A;  2L0F A;  2D9Z A;  3DDC B;  4CHK A;  2K25 A;  1FOE A;  3SD5 A;  1IP9 A;  4GZU A;  2AYO B;  5EDS A;  2NBW B;  2CKH B;  4ANV A;  1UBQ A;  2DEN B;  2MBO A;  4IG7 B;  3VHT C;  3D8E A;  2RSU A;  3ZNG C;  1R4M I;  3NOB A;  2K8H A;  1EVH A;  3PPA A;  2J0M A;  2KX3 A;  4W9E A;  2KX0 A;  1V88 A;  2L05 A;  3GYO A;  3R7Q A;  1U29 A;  5CHW A;  2E2X A;  1GJZ A;  3RCZ A;  2G4D B;  3ODO A;  2J7Q B;  4YON A;  3VUX A;  2ZVN A;  4ZDV A;  2LI5 A;  3SYX A;  5D7G A;  4EJN A;  3DVG Y;  4DK5 A;  2GJY A;  5DPR A;  4HAV B;  4XZ4 A;  5J17 A;  2NZ8 B;  4M8M A;  1UZX B;  1WGD A;  2Y8G A;  2LKO A;  5DIF B;  4KZ0 A;  2QHO A;  2AWT A;  3TO1 A;  4OVU A;  4F7H A;  3RUI B;  3TCA A;  3SU8 X;  4OVV A;  2UYZ B;  2KWV B;  5D3X A;  2KNB A;  2FCM A;  3EFU A;  1N3H A;  4FAD A;  3A4R A;  3A98 B;  2DX1 A;  2CY4 A;  2WYQ A;  4F8C B;  5CTR C;  4FN2 A;  2KVR A;  3H7P A;  3QAQ A;  4G11 A;  2GCJ A;  1E8Z A;  1S3S G;  2K6Q A;  2OTX A;  2CY5 A;  1QQG A;  1BWN A;  1TZ1 A;  3QAR A;  4KDL B;  4IC7 B;  2CR5 A;  3QK0 A;  2PZ1 A;  3D8F A;  1WX7 A;  4XWX A;  2MA9 B;  2JRH A;  2ZNV B;  4AP4 C;  4BKG A;  4HAY B;  4GMX B;  3ODW A;  3W1Y A;  3ZTC A;  2DAJ A;  2NVU I;  4KIK B;  3KY9 A;  3AXC A;  2WX0 A;  3KZ1 A;  2DAF A;  2DZI A;  3DBR I;  1Q1O A;  3FM8 C;  3P6A A;  1U27 A;  2NPT B;  1B55 A;  3QX1 A;  4HVB A;  4DWF A;  2KWC A;  3MPX A;  5DCN A;  1MKE A;  2GBR A;  3AU4 A;  4Z2M B;  4HAX B;  4FBJ B;  3ECI A;  4K81 A;  1WJM A;  4CHJ A;  2YVC A;  1KZ7 A;  2C60 A;  5HE1 A;  2DKQ A;  3A8P A;  4NNJ B;  1WZ3 A;  4MEM A;  4KHB B;  2BPS A;  4B6W A;  3M3J A;  2IY0 B;  1KLV A;  5G2N A;  1XD4 A;  1P98 A;  3NHE B;  3DBH I;  2EMT A;  2KJH B;  2COC A;  1C3T A;  4Y94 A;  1XKE A;  5E6O A;  5AZG A;  3PLU A;  3FSS A;  3V61 A;  3TJP A;  4ICU A;  2VSZ A;  1M94 A;  1GC6 A;  2RGF A;  1MK7 B;  1T0Y A;  4M8N A;  2OQB A;  2IO1 B;  3ZIM A;  3HM3 A;  5KHO A;  4K1R B;  4HB2 B;  3ZLZ A;  4NPN A;  1QC6 A;  3SDL C;  1WI1 A;  2YT1 A;  5C23 A;  2IYB A;  1WX8 A;  5JHG A;  1E8Y A;  3KYC D;  3CMM B;  5JHB A;  3R66 C;  1PFJ A;  2RUK B;  2FUH B;  4HAT B;  2NMB A;  4CYE A;  3BJI A;  3NY5 A;  2D2Q A;  2KFK B;  1E90 A;  2LXC A;  1WM3 A;  2I5F A;  3QA8 A;  1YD8 U;  4MT7 A;  1YQB A;  2MP2 A;  2HTH A;  3P7Z A;  5D3V A;  1VD2 A;  4GPT B;  4WAA A;  1J0W A;  3M1I B;  2LZ6 A;  2N0Y A;  5DH9 B;  3W1S A;  1SHC A;  4NQK E;  2P0D A;  3K9P B;  2GBN A;  3VTV A;  1P6S A;  2PE9 A;  2DZM A;  2LYD A;  1V5O A;  1V81 A;  4G0N B;  3UQB A;  2FAZ A;  2K2J A;  2CHW A;  2CRF A;  3CIK A;  4FJV B;  2DHK A;  2GOW A;  4B95 A;  3JSV B;  4H8S A;  3IHP C;  1TJ6 A;  2DX5 A;  4URK A;  1YIW A;  2KXJ A;  4HAZ B;  2MRP A;  3DPD A;  2A5U A;  2D07 B;  5C5B B;  3VVW B;  2L2I A;  1TTN A;  2EMS A;  1ZKH A;  1BT0 A;  3SHQ A;  1PQS A;  1V5M A;  1J0G A;  4ANU A;  1JRU A;  5JH5 C;  2OJR A;  4HCP B;  3UZT A;  3N7C A;  3U30 A;  2L7R A;  1OQN A;  4FHJ A;  4RM8 A;  2BYV E;  2KO3 A;  2WX1 A;  2LD9 A;  3NZU A;  1RFA A;  3Q3J A;  2KD0 A;  4BBN F;  4RMA A;  2AEH A;  1DRO A;  3RZW C;  3QCA A;  1W1G A;  2RGN B;  1IPG A;  4GDK A;  4MEL A;  3PVL A;  3EEC A;  3PRM B;  5J3Q A;  4MJS A;  3A9J B;  5D6J B;  2D9W A;  3F5R A;  1XD3 B;  2MSE D;  3IVF A;  2X18 A;  1WR6 E;  4MSM B;  2LGD A;  2GBM A;  4WJN A;  2KDI A;  2IY1 B;  3A4S C;  3QQ8 B;  3R3M A;  4IM0 A;  4EZK A;  2BKR B;  4PNK A;  4G3X B;  2I5C A;  2R2O A;  3FEH A;  2KJ6 A;  2IZV B;  2PEA A;  4CO7 A;  2RPQ A;  1ZM0 A;  4LDT B;  5IAA C;  4IWQ A;  5DI9 B;  2KTR B;  3RCP A;  2C7M B;  5FR6 A;  2RVB B;  4GOC A;  2CU1 A;  4BFR A;  1WGU A;  4ANW A;  5LOP B;  2CHZ A;  2ZPY A;  4MDK E;  4ICV A;  1WGQ A;  1Y5O A;  4W9F A;  1J8C A;  4CHM A;  3KH0 A;  3O65 B;  1V5P A;  2W2X D;  2O2V B;  4NAW B;  2P0F A;  4IM3 A;  1MIX A;  1Q5W B;  2Z0E B;  3H9D A;  1FB8 A;  3VH3 B;  5HE2 A;  1WJ6 A;  1GG3 A;  3P2B A;  4LJP B;  5C79 A;  1EF1 A;  1F9J A;  5LXH A;  2UZR A;  3V6C B;  1I7A A;  1Y8R C;  3N30 A;  2DTC A;  3ULB A;  2REX A;  1K5G B;  3QIJ A;  5CLL B;  4W9H A;  3L16 A;  2G35 A;  4WJP A;  2FID A;  3VQI A;  3MTN B;  5DHA B;  2KHW B;  2Q13 A;  3TW1 A;  1WH3 A;  2DYO A;  3KSY A;  1WXM A;  2LG1 A;  2LRU A;  4GDL B;  1V5T A;  4EEW A;  2KDB A;  3D32 A;  3V6E B;  3PHX B;  1WE7 A;  2W9N A;  3RT3 B;  2JF5 A;  4IAP A;  1ZSQ A;  1WGR A;  3HQC A;  4W9D A;  3Q3F A;  3PTF C;  3NSU A;  1M7R A;  4DHZ B;  4JIO U;  4FJZ A;  2WWZ A;  4WJO A;  4BOS C;  4RM9 A;  4BOZ B;  2KKC A;  3ZO5 B;  2XQN M;  2D10 A;  3W1S C;  1WIA A;  1I42 A;  4EKU A;  3V62 A;  2NBV B;  4WWP A;  4MK0 A;  1NU2 A;  5CX3 A;  4A3O A;  1FAO A;  1ZGU B;  4TKN A;  1V2Y A;  2YRY A;  3HIZ A;  1V6E A;  1V80 A;  4IWP A;  1HE8 A;  1H10 A;  4EZJ A;  4HK2 A;  3N32 A;  1V86 A;  4TUU A;  3LJ3 A;  2D9V A;  3L13 A;  3A8Q A;  3ZNI D;  3I3T B;  3L0W B;  2J59 M;  2L3Z A;  4LCD E;  5DPS A;  3H6N A;  1I35 A;  2FNJ B;  3JVZ X;  2FCS A;  3WIM A;  1Z87 A;  4MY6 A;  3WAP A;  4IFS A;  2N9X A;  4KIK A;  1P9D U;  4KDI C;  2GS0 A;  1MK9 B;  1UPQ A;  1Y19 B;  2BYF A;  2O6V B;  2ZCC A;  3L10 B;  2NPT A;  2ELB A;  3D8D A;  1WXV A;  2NS5 A;  2MW5 A;  2W2W A;  2KTF A;  1CMX B;  3DBL I;  4IUM B;  2DHZ A;  1WYW B;  2R09 A;  1UBI A;  3HW2 B;  2C5L C;  1P0R A;  2K2U A;  3SO6 A;  4I6N B;  1V5U A;  1WJN A;  1WZ0 A;  2KMC A;  3PVW A;  1OEY J;  4B6H A;  3VDZ A;  2LVQ A;  3TL5 A;  3RD2 A;  1OTR B;  4FA6 A;  5KQ1 A;  4F7G A;  3T06 A;  2XK5 B;  1WE6 A;  2BYE A;  2MDX A;  3JW0 X;  1U4A A;  3ZVR A;  2MX2 A;  3PRP B;  2MLB A;  4K2O A;  2KWU B;  1E8W A;  4GMV A;  2HD5 B;  1IRS A;  4DXA B;  4L6E A;  3KYD D;  2FCQ A;  5JHA A;  4IWO A;  1GUA B;  4W9J A;  3X23 A;  4TV3 A;  2KLG A;  3JYU A;  2KLC A;  3UGB B;  4K7S A;  4HB3 B;  5KQ4 A;  4KV2 A;  2IYD B;  3OLM D;  3V5W A;  4ZYN A;  3HM6 X;  2NBU A;  4LDT D;  2JT4 B;  3HK0 A;  5JLJ B;  3KRX A;  2LWP A;  3HHM A;  1W1H A;  3WAM A;  2DHI A;  4ZRI A;  5IA7 A;  1GC7 A;  1P5T A;  1PMS A;  2DZJ A;  1TXD A;  2K1F A;  4MM3 A;  4PS8 A;  2ASQ A;  2V76 A;  2J0K A;  2M14 A;  1ZVR A;  2Y5B B;  1MPH A;  3DQV A;  3IFW B;  4LJO B;  3A9K B;  3DBS A;  2MBH A;  4DHZ E;  2C7H A;  4GSW A;  4KSL C;  2KFK A;  3N3K B;  1XOD A;  1AWE A;  2CHX A;  4FLH A;  2KC1 A;  4HDQ A;  3ZKJ C;  3PT2 B;  2LUL A;  2COD A;  1GNU A;  3QHT A;  3T9L A;  4BVU C;  5LON B;  4DBG A;  4BBK A;  3RZF A;  1TQZ A;  1XT9 B;  1IYF A;  2DA0 A;  2GBJ A;  2KQS A;  2LOZ A;  2KK8 A;  1E7U A;  3PRZ A;  2C7N B;  2MBB B;  2JUO A;  2V1Y A;  2BF8 B;  1R4N I;  2Y7B A;  3ZRF A;  2QKM A;  2CAY A;  2UWQ A;  4KVG B;  4G50 A;  2KFJ A;  5CHV C;  4KAX B;  1J19 A;  4MSQ B;  3TBL D;  3JSV A;  3QC8 B;  2V4L A;  2NCN A;  1RJ2 A;  3QWM A;  5C5B A;  1OQY A;  4F1S A;  3ZDT A;  4KHO A;  3ZTD A;  2XEW A;  1KOT A;  3KUC B;  1KI1 B;  2KGX B;  5D2M B;  3ZRC A;  4W9I A;  2M8S A;  4A6F B;  3PV1 A;  5CLQ B;  2FIF A;  1NTY A;  3M63 B;  1ZC3 B;  4FJY A;  4IM2 A;  4A6K A;  3OAN A;  2I1K A;  2ZNV C;  4NY0 A;  1UEF A;  2YS5 A;  4DHJ B;  2KZR A;  1L7Y A;  2GBK A;  2M0X A;  1YX5 B;  5AZF A;  5E6N A;  3ML9 A;  3A9J A;  4DBB A;  1K5D B;  2L76 A;  3LDZ E;  1X86 A;  1XCG A;  3F0W A;  1X1G A;  2BWE S;  3SNH A;  1V89 A;  2VKI A;  1WG7 A;  4II3 B;  4IOY X;  3X0W A;  3ZVV A;  1V61 A;  1BAK A;  4DX8 A;  2O6V D;  1AAR A;  3L08 A;  4NJ6 A;  2ZPN A;  3CSF A;  4XC2 A;  3DXD A;  1Q0W B;  2Y8F A;  1ISN A;  3PP2 A;  3SV1 A;  5DHF B;  2KTR A;  5LLI A;  4AUQ C;  2W2X C;  4DDG D;  1RRP B;  2BKF A;  4B9K A;  2DFK A;  4WWO A;  1WY8 A;  4GXB A;  1FHX A;  3UIO B;  3DXC A;  5C16 A;  1LB1 A;  1EGX A;  1S1Q B;  2M17 A;  2N4F A;  1MG8 A;  2K8B A;  4K2P A;  1WVH A;  2O2V A;  5JP4 A;  2K39 A;  4NAW A;  3PSC A;  2JY6 A;  3NZS A;  3C0R B;  3L17 A;  5AZH A;  2Z59 B;  4K17 A;  4NQL B;  3GZN I;  3IG3 A;  4A6H A;  5FI1 A;  4PYU A;  1RLF A;  4W9L A;  2COA A;  1V49 A;  4W9K A;  1KM7 A;  4ASW C;  2YF0 A;  2Z0O A;  1OMW A;  3A1Q B;  4PS7 A;  5DPT A;  4M0W B;  3NS8 A;  1WXA A;  1BTK A;  2KOX A;  4BKS D;  4EMO A;  5C1Z A;  1WJ1 A;  3M95 A;  4GDL A;  5KCV A;  2UVM A;  3PLV A;  2KDF B;  2M4N A;  2BGF A;  3WAN A;  4MGI E;  1RAX A;  1OEY A;  1X1F A;  3MJW A;  5HKH A;  1WRD B;  2LJ5 A;  4AJW A;  2KJR A;  4EOY A;  4WJQ A;  2ELA A;  3RUL A;  4WSF A;  2N7E A;  1Q67 A;  2ZJD A;  2BCJ A;  4EZL A;  1EAZ A;  3UF8 A;  3WAO A;  5LXI B;  2YS1 A;  2MWS B;  2COF A;  1UGM A;  1KJT A;  1DYN A;  3AU5 A;  2NR2 A;  3B1L X;  1NBF C;  1UEL A;  3IBE A;  2DYQ A;  5EFX A;  3AJ4 A;  3VUW A;  2N1V A;  4F7U P;  4JLC A;  2DLW A;  3KW5 B;  2LUE A;  3MDB C;  2AL3 A;  3WA0 A;  2UZS A;  3CF6 E;  5D27 A;  3CXB B;  3OJ4 B;  1UNP A;  4MH0 E;  3APD A;  3OAW A;  2EC1 A;  2LAS A;  1DDV A;  2H7E A;  1OY2 A;  2M38 A;  1XQQ A;  5E6P A;  1WMH B;  1AQC A;  1WI0 A;  4EUT A;  2O6V A;  2N7D A;  1MAI A;  5DPW A;  2GMI C;  4GIV A;  1WM2 A;  5L83 A;  3DCG A;  2N1W A;  3APC A;  5J3Y A;  4GU2 A;  4GB9 A;  5TR5 A;  4N9F 4;  4AWJ A;  2KAN A;  1U5F A;  4MGY E;  2ROV A;  3B0A A;  1X1M A;  1LQB A;  3PRE A;  2K6D B;  1M7E A;  4PYZ A;  4DHJ D;  3H7S A;  3VH4 B;  1FXT B;  3QJZ A;  5L81 A;  2D3G A;  2JWZ A;  1YX6 B;  5D3W A;  4J6I A;  2XK5 A;  4HDO A;  2DYN A;  1SE9 A;  5HE0 A;  5HE3 A;  2MCN B;  3SUZ A;  2LXA A;  1WGY A;  4TQ0 A;  3DVN V;  2OOB B;  3PZD A;  5JZE B;  4BBN C;  1MIZ B;  2I1J A;  1WR1 A;  2KDE B;  1NDD A;  2KMA A;  1OGW A;  4ZRJ A;  4GGQ A;  1P1A A;  4A20 A;  2D9Y A;  4TQ1 A;  3ZNZ B;  3UIN B;  2N9P C;  2HJ8 A;  4PQ0 A;  3ZDM C;  2N23 A;  1WJU A;  1E7V A;  2KN5 A;  2IBI B;  2MFQ A;  2LVO A;  3S2A A;  4YL8 A;  3EHV A;  2IO2 B;  2Z0P A;  3DVN U;  1LFD A;  2HE7 A;  4BKS A;  1A5R A;  1H4R A;  5C6R A;  1E8X A;  4BKT A;  2V3S A;  3ONS A;  3UIP B;  5GOW B;  4MGZ E; 
#chains in the Genus database with same CATH topology
 4F7Z A;  2DN6 A;  3W9C B;  4HCN B;  3A9K A;  2ZZP B;  1U5D A;  3H7P B;  1BTN A;  3M62 B;  1WYG A;  4RF1 A;  1YJ1 A;  3UI3 A;  1C1Y B;  3VUY A;  4USA A;  2KUP A;  1JCK B;  2JRI B;  4ARI A;  2J0J A;  2EKE C;  5J18 A;  3B2F A;  3VOQ A;  1WXS A;  3BK1 A;  3NW8 A;  1XR0 B;  2AQ2 B;  4KZC A;  3MP9 A;  1WFY A;  2JP2 A;  4KHA A;  2XN9 C;  3VFK A;  2MKR A;  1DDM A;  3WAL A;  2RDB C;  4C0A A;  2L0T A;  4HJG E;  1ZC4 B;  2P0H A;  1UNQ A;  2LVP A;  1Z2M A;  1WSP A;  4JGH B;  3VAW A;  3QBV B;  4HB4 B;  1XCT L;  2HTM E;  1RWS A;  2D11 A;  1EU3 A;  2R0D A;  2K8C A;  2MJ3 A;  2OJW A;  1WX9 A;  2LRW A;  3N20 C;  2YSZ A;  4EFO A;  2BT6 A;  2BWF A;  1KTK A;  1ZYI A;  3V60 A;  2KQ7 A;  3BY4 B;  1PYW D;  2QDF A;  2K9X A;  4E3C A;  2YLM A;  1C76 A;  1UH6 A;  1XX0 A;  3AEA B;  2FCN A;  2PJH A;  4XE0 A;  4IW0 A;  1RYJ A;  4P7I A;  2B3A A;  1TZO A;  1V1P A;  3PS6 A;  3H1U A;  2A4Z A;  2JXX A;  1FNW A;  2KCJ A;  3ZW3 A;  2WXR A;  5KHQ A;  4WH4 A;  4WWN A;  4IKG A;  2EJ8 A;  1IBX B;  1LW3 A;  4QXA B;  1I4Q A;  4HAW B;  2GLS A;  5GMV A;  2Z0D B;  4JE3 B;  4B0M A;  2QKL A;  3PSE B;  3VTU A;  2YS3 A;  4A6F A;  2L00 B;  1P3R A;  3O96 A;  1JQ4 A;  4XDC A;  2H7D A;  2LGX A;  1V9J A;  1VLB A;  1EO6 A;  1F77 A;  2R2Q A;  2L1C A;  3WYF B;  3ML8 A;  2G3Q B;  3VRB B;  2P8V A;  2CJN A;  4YSX B;  2ADZ A;  4HPP A;  4I6L B;  4HB0 B;  5JHH A;  4I6P A;  1PFD A;  4OSN A;  3T8M A;  4WJ7 A;  4ZYS A;  2PMV A;  3TMP B;  4HKZ E;  1KLU D;  2ZCB A;  1VDV A;  4P1C C;  2IFS A;  3U8Z A;  3KUD B;  2RNR B;  2MQJ A;  4DDI D;  1EF5 A;  2K00 A;  1MPE A;  5BMG A;  4A8X C;  3DXE A;  3VTW A;  4A5K A;  3PVU A;  1G6J A;  4W9C A;  1I4P A;  2L8J A;  2LGY A;  3AI5 A;  2Z4D A;  2PLP A;  2DKP A;  3U7D A;  3SR6 A;  1DDW A;  3DVG X;  5L95 C;  5FI0 A;  1H8C A;  5C3J B;  1WGH A;  2R61 A;  2RLO A;  2JQR B;  1NTV A;  4RGM A;  5J2R A;  4HLE A;  3NVY A;  2NTS A;  4ZRP A;  3MHS D;  2IO0 B;  4DX9 0;  4K7U A;  2JU6 X;  2K0P A;  2ZEQ A;  1JWA D;  2MBQ A;  1I2H A;  5D3Y A;  3GE3 C;  3CST A;  4FHK A;  3ODX A;  1SJE D;  3QWZ B;  4HWI B;  2PE6 B;  2W55 A;  2Z14 A;  1L4Z B;  2W3S A;  5CHF A;  4MGK E;  1R4M B;  3RYT A;  2IPK D;  3NZ3 A;  1U5E A;  4MAC A;  1SGH A;  1HZ5 A;  4WUR A;  5G55 A;  2FJU B;  1UPR A;  2DYM A;  2M1M A;  1TY2 A;  5D3I B;  1TGZ B;  1I4G A;  1N5X A;  4PK1 A;  1FCC C;  4D0N B;  2ZVO A;  4W9G A;  1ZW7 A;  1T0S C;  3CIR B;  1QQR A;  1FGY A;  2JZP A;  2VRR B;  3APF A;  1CZP A;  4NJ7 A;  2ROZ B;  1RRB A;  4WIP A;  2MP2 B;  2J53 A;  3GP7 A;  3AH7 A;  3TFM A;  2HTH B;  1FHW A;  2FJL A;  5IN7 A;  5H92 C;  5J3T A;  3NWD A;  4HAU B;  1T77 A;  1WRI A;  2JZ3 B;  1FPY A;  1MHX A;  2N9E B;  4HHV A;  4JL9 A;  3PG7 A;  2Z59 A;  4NSW A;  1LXD A;  2G45 B;  2QIE B;  3Q69 A;  3U12 A;  5IOI A;  1D3Z A;  1UNR A;  3KRW A;  3DHH C;  4A3P A;  4E74 A;  4ANX A;  4WVF B;  3VIA A;  2MHJ A;  1D5X C;  2J42 A;  3AUL A;  2DYB A;  1ET6 A;  3UQA A;  4XX5 A;  2AL6 A;  4OZA A;  2INN E;  1U5G A;  1SIF A;  1U2B A;  2JPH A;  3ZJU A;  4GN1 A;  5AEK B;  4NAM A;  1X11 A;  4B0E A;  2G4S A;  3GOE A;  4ZHO A;  4HPL B;  2D9X A;  4HXD A;  2PPH A;  3AEG B;  2DHJ A;  1QZE A;  3A1Q A;  1P3Q U;  3AE6 B;  2KC2 A;  5BO4 B;  4M0W A;  1K8R B;  3NWA A;  3NG0 A;  2XBB C;  2IGD A;  1JAL A;  3G9W A;  1EUV B;  5BYR A;  2DX5 B;  3FC4 A;  4JWS C;  1Y56 A;  2GCL A;  2MWN B;  2CS4 A;  4TYZ A;  1X05 A;  4HJK A;  5FK9 C;  4K7W A;  3TVV A;  5G5H A;  3ZUN A;  1J7A A;  3DWM A;  2I2Y A;  3HSA A;  1NEN B;  2J4X A;  4ZRK A;  2MBE A;  3ZNH B;  2LGI A;  3TIX A;  3ENE A;  1NI2 A;  4BZA A;  3ALB A;  3DOW A;  1MJD A;  1ESF A;  3A33 B;  4AJY B;  1TBE A;  1E5W A;  4WQO B;  4JQW C;  2C9W B;  4WQM A;  1WF9 A;  3VXW A;  3PEG A;  4BAX A;  4FUL A;  3PGE A;  5C2T B;  2WDT B;  1OQR A;  2IO3 B;  2LOX A;  3KQ4 A;  2DZK A;  3SFD B;  4ZOH C;  2V9H A;  2L83 A;  1W1D A;  1UD7 A;  2RR9 A;  3OJ3 A;  3PHW B;  3NVW A;  3L54 A;  4GNK B;  1L2N A;  2BB5 A;  1E10 A;  4TSS A;  2RSG A;  1T0Q C;  1R7S A;  3EC8 A;  3MC0 B;  2K22 A;  1KZG A;  4GDK B;  3T3N A;  2WDV B;  4MJS B;  5BYQ A;  2IJ0 A;  5D94 A;  3LJU X;  3GYP A;  3KVF B;  1SE2 A;  3Q6B A;  1XLQ A;  1FO4 A;  1PLS A;  3KUZ A;  3BK2 A;  1WXQ A;  1DBH A;  4II2 B;  3DBR B;  2JVC A;  2RD0 A;  3K9O B;  2YT0 A;  1Z5S B;  3RNF C;  2JZZ A;  4RFB A;  1VZ8 A;  1SEB D;  2WXP A;  4HPM B;  1TKG A;  3BIN A;  3O13 A;  1FHO A;  1FGZ A;  3ML4 A;  4KSK C;  2D4Q A;  4AOF A;  3R7R A;  1ENF A;  1XXG A;  3P4Q B;  1L0Y B;  1WGG A;  4LNF A;  1L0X B;  4JPS A;  2Z0Q A;  1LM8 B;  2WDQ B;  1WJ4 A;  1WMH A;  3Q3O C;  4E71 A;  4YT0 B;  2FUG 1;  4Z2N A;  1T0R C;  4X57 B;  1ZUD 2;  2GB1 A;  5BMI A;  4HRO A;  1TS4 A;  1VCB A;  2VRW B;  2LGS A;  3B08 A;  3ULC A;  2I38 A;  2M0A A;  1XLO A;  1BUI C;  4PS3 A;  2L0F A;  2D9Z A;  1F52 A;  3DDC B;  4CHK A;  2K25 A;  1FOE A;  4XWT A;  3SD5 A;  2DNF A;  3N1X C;  1IP9 A;  4GZU A;  2AYO B;  5EDS A;  1JRO A;  2NBW B;  2CKH B;  4ANV A;  1UBQ A;  3RFZ B;  3IAM 1;  2DEN B;  4FXC A;  2MBO A;  4C80 A;  1LGR A;  4IG7 B;  2WXJ A;  3MHZ A;  3VHT C;  3D8E A;  2RSU A;  3DBH B;  3RNB C;  3ZNG C;  1R4M I;  3NOB A;  2K8H A;  4S17 A;  1SE4 A;  3RNE C;  3NUH B;  1EVH A;  4HEA 1;  4A9A A;  1P7F A;  3PPA A;  2J0M A;  1E7P B;  2KX3 A;  4W9E A;  2KX0 A;  1DOI A;  3Q8A A;  1V88 A;  2L05 A;  3GYO A;  2BS3 B;  3R7Q A;  1U29 A;  2QSD A;  5CHW A;  2E2X A;  1GJZ A;  1K53 A;  1TS3 A;  4A90 A;  1QIL A;  3TEW A;  3RCZ A;  2G4D B;  3ODO A;  1J7B A;  2J7Q B;  3NS1 A;  4YON A;  3VUX A;  2ZVN A;  4ZDV A;  2QMT A;  1GB1 A;  2LI5 A;  2K5P A;  4UDU C;  3SYX A;  2AQ1 B;  4N6E B;  2H89 B;  1NYQ A;  4XDD A;  4ARC A;  3IAS 1;  5D7G A;  4EJN A;  3DVG Y;  4DK5 A;  1QOF A;  2GJY A;  5DPR A;  3U4E G;  4HAV B;  2BBC A;  4ITK A;  4XZ4 A;  5J17 A;  3C8Y A;  2NZ8 B;  3GS2 A;  4M8M A;  1UZX B;  3B2G A;  1WGD A;  4YSZ B;  2Y8G A;  2LKO A;  2V3P A;  3NVZ A;  2QC8 A;  5DIF B;  1CJE A;  1YN3 A;  1YJI A;  3AEB B;  4KZ0 A;  2QHO A;  2AWT A;  3TO1 A;  4OVU A;  4F7H A;  3RUI B;  3TCA A;  3KWV A;  3SU8 X;  4OVV A;  2UYZ B;  2KWV B;  3ZQ4 A;  5D3X A;  1XF5 L;  2KNB A;  1ZDX A;  2FCM A;  3EFU A;  1N3H A;  4FAD A;  3A4R A;  3AV8 A;  3A98 B;  2LUM A;  2DX1 A;  2CY4 A;  2WYQ A;  4F8C B;  5CTR C;  3DHG C;  4MT5 A;  4FN2 A;  1FFV A;  1FRR A;  2KVR A;  3BVM A;  2L32 A;  3H7P A;  3QAQ A;  4G11 A;  1EM7 A;  2GCJ A;  2LEK A;  2KR0 A;  4HSI A;  1E8Z A;  1S3S G;  2K6Q A;  2OTX A;  1C78 A;  2CY5 A;  1QQG A;  1BWN A;  2WXL A;  1TZ1 A;  4LNI A;  1MVK A;  3QAR A;  4KDL B;  4IC7 B;  2KT7 A;  2CR5 A;  3QK0 A;  4MH8 A;  2PZ1 A;  5IKC M;  3SEB A;  1C4C A;  3D8F A;  1WX7 A;  4XWX A;  2MA9 B;  2WHI A;  2JRH A;  2ZNV B;  5HI1 A;  1HEZ E;  4AP4 C;  1QOG A;  4BKG A;  4HAY B;  3P4P B;  4GMX B;  3ODW A;  3W1Y A;  3ZTC A;  3RPF C;  2DAJ A;  2NVU I;  3P42 A;  4KIK B;  4XWW A;  2G1E A;  3KY9 A;  3AXC A;  2WX0 A;  3KZ1 A;  2DAF A;  2DZI A;  3DBR I;  1Q1O A;  5FR3 A;  3FM8 C;  3P6A A;  1U27 A;  2NPT B;  1B55 A;  3E9S A;  3QX1 A;  4HVB A;  4DWF A;  2RPV A;  3NRZ A;  5BMH A;  2KWC A;  3MPX A;  5DCN A;  1WGK A;  1MKE A;  2GBR A;  3AU4 A;  4KKJ A;  4Z2M B;  1IBX A;  4HAX B;  4FBJ B;  3EA6 A;  3ECI A;  4K81 A;  1FMA D;  1I4X A;  4ACF A;  1WJM A;  3H8H A;  4CHJ A;  1YQ4 B;  2YVC A;  1KZ7 A;  2C60 A;  5HE1 A;  2DKQ A;  3W5U B;  1L6U A;  1YOV B;  4AQ7 A;  1MHH E;  3A8P A;  4NNJ B;  1VZ6 A;  1WZ3 A;  2OHF A;  4MEM A;  4KHB B;  2BPS A;  2LMC A;  4C56 C;  4B6W A;  2FE8 A;  3M3J A;  2IY0 B;  3MFG A;  2H88 B;  1KLV A;  5G2N A;  1XD4 A;  1P98 A;  1SBB B;  3URY A;  3NHE B;  3DBH I;  2EMT A;  1Q10 A;  2KJH B;  1VRA B;  2EKI A;  3R8B A;  2COC A;  1C3T A;  1AN8 A;  4Y94 A;  1XKE A;  5E6O A;  5AZG A;  2K49 A;  3PLU A;  5IP4 D;  2KDM A;  3FSS A;  3V61 A;  3TJP A;  3Q8E A;  4ICU A;  3AE9 B;  2VSZ A;  1UF0 A;  1M94 A;  3LYY A;  1GC6 A;  1F1H A;  2RGF A;  1MK7 B;  1T0Y A;  4S0R A;  2DBY A;  1E6E B;  2MH7 A;  3OWE B;  4M8N A;  2OQB A;  2IO1 B;  1I4H A;  3ZIM A;  3HM3 A;  4YTN B;  5KHO A;  4K1R B;  4KKI A;  4HB2 B;  1HA5 A;  3ZLZ A;  2E3T A;  4NPN A;  1QC6 A;  2IGG A;  3SDL C;  4C7Y A;  2WXQ A;  1B9R A;  2BS2 B;  3ABV B;  1WI1 A;  2KIG A;  2YT1 A;  5C23 A;  2E6X A;  2IYB A;  1WX8 A;  5JHG A;  1E8Y A;  1ZP0 B;  1QKZ A;  4MM3 B;  3KYC D;  1L0V B;  3CMM B;  2KAJ A;  5JHB A;  2WQY B;  3R66 C;  1PFJ A;  3AE3 B;  3AEF B;  2RUK B;  2FUH B;  4HAT B;  2NMB A;  4EE2 A;  4CYE A;  3BJI A;  3NY5 A;  4NZL B;  2D2Q A;  2KFK B;  1E90 A;  1D5M C;  2LXC A;  1WM3 A;  2I5F A;  1D6E C;  3WCQ A;  1NEK B;  1PGX A;  3RI7 C;  3QA8 A;  1YD8 U;  4MT7 A;  1YQB A;  2MP2 A;  2HTH A;  3P7Z A;  5D3V A;  4LNN A;  1VD2 A;  4GPT B;  4WAA A;  2IDY A;  1J0W A;  3M1I B;  2LZ6 A;  3FIL B;  3AE4 B;  1FEH A;  2N0Y A;  1L6V A;  5DH9 B;  1JWS D;  3W1S A;  1SHC A;  4LLG M;  4NQK E;  2P0D A;  3K9P B;  4N58 A;  2GBN A;  3VTV A;  1F2R C;  4P16 A;  1P6S A;  2PE9 A;  1FNU A;  3TSS A;  3E56 A;  3ZJT A;  2DZM A;  2LYD A;  1V5O A;  1V81 A;  1EU4 A;  4G0N B;  3UQB A;  2FAZ A;  2AQ3 B;  2K2J A;  2CHW A;  2CRF A;  3CIK A;  4FJV B;  3EGR A;  2DHK A;  2GOW A;  1L4D B;  3AM9 A;  4B95 A;  3JSV B;  1F2R I;  3NWF A;  2WU2 B;  4H8S A;  3IHP C;  1TJ6 A;  2DX5 A;  4URK A;  1YIW A;  2KXJ A;  2IND C;  2KWD A;  4HAZ B;  2MRP A;  1DOX A;  3DPD A;  1MFW A;  1BML C;  2A5U A;  2TSS A;  2D07 B;  4K3B A;  5C5B B;  1NI3 A;  3VVW B;  2KN4 A;  2L2I A;  1TTN A;  2EMS A;  3Q3N C;  1ZKH A;  1BT0 A;  1EWC A;  1AW7 A;  3SHQ A;  1C77 A;  1PQS A;  1V5M A;  1P7E A;  2PTL A;  1J0G A;  4ANU A;  2W82 A;  1JRU A;  3BWU D;  4REZ A;  5JH5 C;  2QEJ C;  2OJR A;  3BZD B;  4HCP B;  2KQ4 X;  3UZT A;  3N7C A;  3U30 A;  1N61 A;  2OED A;  5I2M A;  3N9Y C;  2L7R A;  1OQN A;  4FHJ A;  4RM8 A;  3TUO A;  2BYV E;  2KO3 A;  2WX1 A;  4CSQ A;  2Y5P A;  2LD9 A;  3NZU A;  1RFA A;  3Q3J A;  2KD0 A;  4BBN F;  4DQO C;  4RMA A;  1JWU D;  2AEH A;  1DRO A;  3EUB 2;  1OQQ A;  4L2Y A;  3RZW C;  3QCA A;  1W1G A;  2RGN B;  1IPG A;  1ZE3 D;  4GDK A;  4MEL A;  3Q8B A;  3PVL A;  3EEC A;  2Z8L A;  3PRM B;  5J3Q A;  4MJS A;  4A6Q A;  1YNT E;  1T6B X;  3A9J B;  3HRD D;  3R2I A;  5D6J B;  2D9W A;  1C79 A;  3F5R A;  1XD3 B;  1AYF A;  2MSE D;  4LTU A;  3IVF A;  2X18 A;  1WR6 E;  4MSM B;  2IGH A;  5AUK A;  2LGD A;  2GBM A;  4WJN A;  1TKE A;  3Q8C A;  2LJI A;  2KDI A;  1K51 A;  2IY1 B;  3A4S C;  5G5G A;  3QQ8 B;  2BYT A;  5I2S A;  3R3M A;  4JX1 C;  3U52 E;  4IM0 A;  1E0Z A;  4EZK A;  2BKR B;  1T5X D;  4PNK A;  1L5P A;  3DBL B;  3RNC C;  2DWQ A;  5D3D A;  4G3X B;  3AE5 B;  2I5C A;  3PZ8 A;  2R2O A;  2Y3A A;  3FEH A;  2KJ6 A;  2IZV B;  5H8Y E;  1C4P A;  2PEA A;  4CO7 A;  1FM0 D;  5FKA C;  1SXT A;  2RPQ A;  4DIX A;  1ZM0 A;  4LDT B;  1T3Q A;  2VH1 A;  2MJE A;  2X38 A;  4IWQ A;  5IAA C;  1V8C A;  5DI9 B;  2KTR B;  4C4V B;  3RCP A;  2C7M B;  5FR6 A;  2RVB B;  4GOC A;  2CU1 A;  4BFR A;  1VJK A;  2DLB A;  1WGU A;  4ANW A;  3Q8F A;  3B77 A;  5LOP B;  2CHZ A;  1DGJ A;  4OT1 A;  3Q3M C;  2ZPY A;  1QLB B;  1HZ6 A;  4MDK E;  4ICV A;  4YXD B;  1WGQ A;  5JXV A;  2VZK B;  1TJE A;  4WAF A;  1Y5O A;  4W9F A;  1J8C A;  4CHM A;  3CWI A;  3KH0 A;  3O65 B;  1V5P A;  2W2X D;  2O2V B;  4NAW B;  2P0F A;  4RH6 A;  4IM3 A;  1MIX A;  4NJC A;  1Q5W B;  2Z0E B;  3H9D A;  1FB8 A;  3VH3 B;  5HE2 A;  1XLN A;  1WJ6 A;  1GG3 A;  3GB1 A;  3P2B A;  1FD6 A;  1ACC A;  4LJP B;  5C79 A;  1C4A A;  1EF1 A;  1F9J A;  5LXH A;  2UZR A;  2W54 A;  2VH2 A;  4WWM A;  3V6C B;  1I7A A;  3VR8 B;  4LNO A;  1Y8R C;  2GI9 A;  2ONQ A;  1MG4 A;  4C7Z A;  2QIL A;  3N30 A;  1PGA A;  2DTC A;  3ULB A;  2REX A;  1K5G B;  5TSS A;  3TEY A;  3QIJ A;  5CLL B;  1XEE A;  3I57 A;  4W9H A;  1QT9 A;  3L16 A;  2G35 A;  4WJP A;  3HVZ A;  4L23 A;  2FID A;  3VQI A;  3MTN B;  4QAY A;  2KAC A;  5DHA B;  2KHW B;  2Q13 A;  3TW1 A;  2PVG C;  2WXI A;  1WH3 A;  2DYO A;  2FBW B;  3KSY A;  1WXM A;  2LG1 A;  2LRU A;  4GDL B;  3Q2A C;  1MI0 A;  1V5T A;  4EEW A;  3MC8 A;  3IT4 B;  2D5G A;  4YTM B;  2KDB A;  3D32 A;  3SFE B;  2INP E;  3V6E B;  3PHX B;  1WE7 A;  2W9N A;  3RT3 B;  1KRH A;  3RNA C;  2JF5 A;  2YT2 A;  1ZSQ A;  4IAP A;  1WGR A;  3HQC A;  4W9D A;  4YTP B;  2M56 B;  2INC C;  3Q3F A;  3PTF C;  3NSU A;  1M7R A;  4DHZ B;  3P4R B;  4JIO U;  4FJZ A;  2WWZ A;  2QCZ A;  4WJO A;  1WWT A;  2SAK A;  4RM9 A;  4BOS C;  4BOZ B;  3AB5 A;  2KKC A;  3ZO5 B;  2XQN M;  2D10 A;  3W1S C;  1WIA A;  1I42 A;  4EKU A;  3V62 A;  2NBV B;  2LHE A;  2D3B A;  4WWP A;  4MK0 A;  1NU2 A;  5CX3 A;  3AE1 B;  4A3O A;  1SSN A;  1FAO A;  1ZGU B;  4TKN A;  1V2Y A;  2YRY A;  3HIZ A;  2Y5C A;  1V6E A;  4QJ4 B;  1V80 A;  4IWP A;  1HE8 A;  1H10 A;  4EZJ A;  4HK2 A;  3N32 A;  4L1R A;  1R4N B;  1GPX A;  1V86 A;  4TUU A;  1ZPS A;  3LJ3 A;  3BVG A;  2D9V A;  3L13 A;  3A8Q A;  3ZNI D;  4HKQ A;  1XO3 A;  3I3T B;  3L0W B;  4DXG A;  1FXA A;  2J59 M;  1FRD A;  1N60 A;  2L3Z A;  5I4D A;  4LCD E;  5DPS A;  1ZXH A;  1N5W A;  3HUI A;  3H6N A;  4GLS C;  1I35 A;  2FNJ B;  3JVZ X;  2FCS A;  4CQN A;  4P6V F;  2WGS A;  3WIM A;  1N63 A;  1Z87 A;  4MY6 A;  3WAP A;  3P1M A;  4IFS A;  1KFY B;  1PDX A;  2N9X A;  4KIK A;  3I63 C;  1P9D U;  4KDI C;  2CJO A;  1AWD A;  3ZJV A;  1ZDV A;  2GS0 A;  1MK9 B;  1UPQ A;  2BVC A;  1Y19 B;  2WXG A;  2BYF A;  4A55 A;  3L4P A;  2O6V B;  2ZCC A;  2HDE A;  3L10 B;  2NPT A;  1GAQ B;  1TKY A;  2ELB A;  2RRF A;  3D8D A;  2B76 B;  1WXV A;  1IUE A;  2NS5 A;  2MW5 A;  2W2W A;  2KTF A;  2WDR B;  1CMX B;  3DBL I;  4IUM B;  2DHZ A;  1WYW B;  2R09 A;  1UBI A;  3HW2 B;  2C5L C;  1P0R A;  2K2U A;  1N6Z A;  3SO6 A;  4I6N B;  1V5U A;  1WJN A;  1WZ0 A;  2KMC A;  3PVW A;  1OEY J;  3ZXV A;  4B6H A;  4YSY B;  3VDZ A;  2NTT A;  2LVQ A;  3TL5 A;  2ZW1 A;  2BQQ A;  3RD2 A;  1OTR B;  4FA6 A;  5KQ1 A;  2X8X X;  3AN1 A;  4F7G A;  3OG5 A;  3T06 A;  2XK5 B;  1I4R A;  1WE6 A;  4KHB A;  1JRP A;  4C00 A;  4K3C A;  3FVC A;  2BYE A;  2MDX A;  1TY0 A;  3JW0 X;  1U4A A;  3ZVR A;  2MX2 A;  3PRP B;  1GOZ A;  2MLB A;  3P4S B;  4IDI A;  4K2O A;  2KWU B;  1E8W A;  4GMV A;  2HD5 B;  1IRS A;  4DXA B;  4L6E A;  3RN9 C;  3TEX A;  3AEE B;  3KYD D;  2FCQ A;  1UGJ A;  5JHA A;  4IWO A;  1GUA B;  4W9J A;  1N62 A;  3X23 A;  4TV3 A;  4XGA B;  4DXF A;  2N9K A;  2KLG A;  3JYU A;  5EE3 A;  2KLC A;  3UGB B;  4K7S A;  4HB3 B;  5KQ4 A;  4KV2 A;  2ICI A;  4R3D A;  2IYD B;  3OLM D;  3V5W A;  4ZYN A;  3HM6 X;  2NBU A;  3BII D;  4LDT D;  3KWL A;  3BYT B;  3DCX A;  2JT4 B;  3FAH A;  3HK0 A;  5JLJ B;  1ZXI A;  5IRS A;  3AED B;  4OVZ A;  3KRX A;  2LWP A;  3HHM A;  1W1H A;  3EFC A;  3WAM A;  2DHI A;  4ZRI A;  5IA7 A;  4JWU C;  1GC7 A;  1MI1 A;  1P5T A;  2AX5 A;  1PMS A;  4P1B C;  2DZJ A;  1TXD A;  2K1F A;  4MM3 A;  4PS8 A;  2ASQ A;  2VZK D;  2V76 A;  2J0K A;  2M14 A;  1ZVR A;  2Y5B B;  5EE0 A;  1MPH A;  3DQV A;  3IFW B;  4LJO B;  1F0Z A;  3A9K B;  3DBS A;  1NYR A;  2MBH A;  3GZN B;  4DHZ E;  3HIE A;  2C7H A;  4GSW A;  3IXS A;  4KSL C;  2KFK A;  1VZ7 A;  3N3K B;  1XOD A;  1AWE A;  4QJ5 B;  1IGC A;  2CHX A;  4FLH A;  2KC1 A;  4HDQ A;  2PW9 A;  3ZKJ C;  3PT2 B;  4RF0 A;  2LUL A;  2COD A;  2XNA C;  1XLP A;  4XYC A;  5EE9 A;  1GNU A;  3QHT A;  1D4B A;  3T9L A;  4BVU C;  5LON B;  4DBG A;  1K52 A;  3N1Y C;  1SJH D;  1NVI D;  4BBK A;  3RZF A;  3RNG C;  1RM6 C;  1TQZ A;  1XT9 B;  5AUI A;  5T8I A;  1V97 A;  1IYF A;  2DA0 A;  2N7J A;  2GBJ A;  3FIL A;  2KQS A;  2LOZ A;  3ZXR A;  2JYT A;  2KK8 A;  1E7U A;  3PRZ A;  1FXI A;  2C7N B;  3NVV A;  2MBB B;  3RMK C;  2JUO A;  2V1Y A;  2BF8 B;  1R4N I;  2V3N A;  2Y7B A;  2KMM A;  1SB3 C;  3ZRF A;  2QKM A;  2CAY A;  2UWQ A;  4KVG B;  4G50 A;  2KFJ A;  5CHV C;  3A58 A;  4KAX B;  1J19 A;  4MSQ B;  3TBL D;  3JSV A;  2HJ1 A;  2D3A A;  3QC8 B;  2V4L A;  4D2K A;  4M01 A;  4US9 A;  2NCN A;  1V1P B;  1RJ2 A;  3QWM A;  5C5B A;  1OQY A;  4F1S A;  3ZDT A;  2PVO D;  4KHO A;  1VR9 A;  3ZTD A;  2XEW A;  3NJT A;  2BW2 A;  4LNK A;  2PKO A;  1KOT A;  4HRS A;  5MPO A;  3KUC B;  1KI1 B;  2WXN A;  2KGX B;  5D2M B;  3ZRC A;  4W9I A;  2M8S A;  4A6F B;  3PV1 A;  1PGB A;  5CLQ B;  2CU3 A;  3IT6 B;  2FIF A;  1NTY A;  3M63 B;  1ZC3 B;  1KH0 A;  4FJY A;  3V3X A;  4IM2 A;  4YWG G;  2WXF A;  4A6K A;  3OAN A;  2I1K A;  2ZNV C;  3U7Z A;  4NY0 A;  1UEF A;  2YS5 A;  4DHJ B;  2KZR A;  4AS1 A;  1L7Y A;  2GBK A;  2M0X A;  2NMQ A;  1YX5 B;  1K50 A;  5AZF A;  5E6N A;  2L52 A;  3ML9 A;  2Q5W D;  1FIQ A;  3A9J A;  4DBB A;  1K5D B;  2L76 A;  3LDZ E;  1X86 A;  1FNV A;  2D3C A;  1XCG A;  2ZW0 A;  3F0W A;  1X1G A;  2WS3 B;  3MC9 A;  2BWE S;  1STE A;  1HTO A;  2W3R A;  2ZKM X;  3SNH A;  1V89 A;  3C19 A;  2VKI A;  1WG7 A;  3ZGZ A;  4II3 B;  4IOY X;  1KF6 B;  3X0W A;  3ZVV A;  1V61 A;  2BTE A;  3P63 A;  1BAK A;  4DX8 A;  1V1O A;  2O6V D;  2R2Y A;  2RDG A;  1AAR A;  3L08 A;  4NJ6 A;  5LNK 1;  2ON8 A;  3PO0 A;  2ZPN A;  4OZB A;  3CSF A;  4XC2 A;  3DXD A;  5BYS A;  1Q0W B;  2Y8F A;  1ISN A;  3ETR A;  3PP2 A;  1D5Z C;  3BVZ A;  3SV1 A;  3N1Z C;  5DHF B;  2KTR A;  2JWU A;  5LLI A;  4C4V A;  4AUQ C;  2W2X C;  4DDG D;  1SF0 A;  1RRP B;  3VR9 B;  2BKF A;  4B9K A;  1CQV A;  3AE8 B;  2L1A A;  2DFK A;  4WWO A;  1WY8 A;  4L1B A;  3U2S C;  3MJ5 A;  3PZ7 A;  4RCO A;  3GE8 C;  1ET9 A;  4GXB A;  1FHX A;  3UIO B;  3DXC A;  5C16 A;  1LB1 A;  1EGX A;  1S1Q B;  1YMH E;  2M17 A;  2N4F A;  2QJL A;  4GOU A;  3DHI C;  1MG8 A;  4M02 A;  2K8B A;  4K2P A;  1WVH A;  2LHD A;  2O2V A;  5JP4 A;  2K39 A;  4NAW A;  4OHJ A;  3PSC A;  3LXF A;  2JY6 A;  1C9F A;  4N59 A;  3V05 A;  1ZOY B;  3NZS A;  4D6W A;  3C0R B;  1UWM A;  3L17 A;  5AZH A;  2WXO A;  2Z59 B;  4K17 A;  4NQL B;  2BB6 A;  4US8 A;  3GZN I;  3IG3 A;  4A6H A;  5FI1 A;  3AE7 B;  4PYU A;  1SE3 A;  3ZYY X;  2M19 A;  1RLF A;  4W9L A;  2COA A;  3HVD A;  1V49 A;  2MJD A;  1KM7 A;  4W9K A;  4ASW C;  2YF0 A;  2Z0O A;  3OHM B;  2KUQ A;  2LFI A;  1OMW A;  3A1Q B;  4PS7 A;  4RNA A;  5DPT A;  4M0W B;  3NS8 A;  1WXA A;  1BTK A;  2KOX A;  1HXY D;  4BKS D;  4EMO A;  2YEP F;  5C1Z A;  1WJ1 A;  2WXM A;  3M95 A;  4GDL A;  5KCV A;  2UVM A;  3PLV A;  2KDF B;  2M4N A;  2BGF A;  3WAN A;  4MGI E;  2JSV X;  1RAX A;  1OEY A;  1X1F A;  3MJW A;  2Z13 A;  5LG4 B;  2J52 A;  2KVZ A;  5HKH A;  1WRD B;  2LJ5 A;  4AJW A;  5HFY A;  2KJR A;  4EOY A;  2WXK A;  4WJQ A;  4ZHP A;  4H2A A;  2V0G A;  2ELA A;  3RUL A;  1GB4 A;  4Q2J A;  1YQ3 B;  3B9J A;  4WSF A;  5IO9 A;  2N0S B;  1Q67 A;  2N7E A;  1BXT A;  2WLB A;  1UWX A;  2ZJD A;  2BCJ A;  1KLG D;  1TYG B;  3R2T A;  1J7C A;  4EZL A;  1EAZ A;  5EE1 A;  3UF8 A;  3W5V B;  2BS4 B;  2RDH A;  3WAO A;  5LXI B;  2YS1 A;  2NBV A;  1TT5 B;  4ZRQ A;  3W2D A;  2MWS B;  1B1Z A;  2COF A;  2N9L A;  3VRA B;  2WP9 B;  1HQR D;  1UGM A;  1KJT A;  1DYN A;  3AU5 A;  3Q14 C;  2NR2 A;  3B1L X;  2YEP B;  4KGS A;  1NBF C;  1UEL A;  1QOB A;  3IBE A;  3I5J C;  2DYQ A;  5EFX A;  3AJ4 A;  2PIA A;  2K8E A;  3VUW A;  2N1V A;  5E6J A;  4F7U P;  2ACZ B;  4JLC A;  2DLW A;  4M00 A;  4RGO S;  4RGN A;  3KW5 B;  2LUE A;  3MDB C;  2AL3 A;  5M4Y B;  3WA0 A;  2UZS A;  1UUP A;  1JW9 D;  3CF6 E;  5D27 A;  3CXB B;  3OJ4 B;  4KX6 B;  1UNP A;  4MH0 E;  3APD A;  1YN5 A;  3FKY A;  3OAW A;  2EC1 A;  2LAS A;  1DDV A;  2H7E A;  1OY2 A;  2M38 A;  2KIE A;  1XQQ A;  2WNM A;  5E6P A;  1WMH B;  4TMA B;  1AQC A;  1WI0 A;  4EUT A;  4LK0 M;  1JML A;  2O6V A;  3LB8 C;  2N7D A;  1MAI A;  2SEB D;  5DPW A;  2GMI C;  1JWM D;  4GIV A;  1WM2 A;  5L83 A;  3DCG A;  3BYY B;  5GXG B;  2N1W A;  3APC A;  5J3Y A;  4GU2 A;  4GB9 A;  1OFF A;  5TR5 A;  4N9F 4;  4AWJ A;  2KAN A;  1U5F A;  1EWY C;  4IOI E;  1FFU A;  1A70 A;  3AE2 B;  4MGY E;  2ROV A;  3B0A A;  2MEK A;  3AEC B;  2WU5 B;  1FCL A;  1X1M A;  1I7H A;  1LQB A;  2GRI A;  2K6D B;  3PRE A;  1M7E A;  4PYZ A;  4OW0 A;  4DHJ D;  3H7S A;  3KLS X;  3VH4 B;  4QJ3 B;  1FXT B;  3QJZ A;  3J9C A;  5L81 A;  2GUM A;  2D3G A;  2JWZ A;  2KYW A;  3DWG C;  2UU7 A;  1YX6 B;  5D3W A;  4J6I A;  2XK5 A;  4HDO A;  4KGR A;  2DYN A;  1SE9 A;  2JX5 A;  5HE0 A;  5HE3 A;  2MCN B;  3SUZ A;  2K3U A;  2LXA A;  1WGY A;  4O1N A;  5HHD G;  4TQ0 A;  3I9V 1;  1QOA A;  3DVN V;  1XCQ L;  2OOB B;  3PZD A;  5JZE B;  3TEZ A;  1JWB D;  4BBN C;  1UNS A;  1MIZ B;  2I1J A;  1WR1 A;  2KDE B;  4RGT A;  1NDD A;  1CK1 A;  2KMA A;  1OGW A;  3AMZ A;  4ZRJ A;  4OZC A;  4GGQ A;  1TIF A;  2JYE A;  1P1A A;  4A20 A;  2D9Y A;  4PT5 A;  4TQ1 A;  3ZNZ B;  3UIN B;  2N9P C;  2HJ8 A;  4KGT A;  1SIJ A;  1YN4 A;  1E9M A;  4PQ0 A;  3ZDM C;  2N23 A;  1WJU A;  1E7V A;  2KN5 A;  2IBI B;  2MFQ A;  2LVO A;  3S2A A;  4YL8 A;  2RMM A;  3EHV A;  2IO2 B;  2Z0P A;  3DVN U;  1LFD A;  1PUT A;  1YJJ A;  4J3O D;  2HE7 A;  4BKS A;  1A5R A;  2G9H D;  1ROE A;  1H4R A;  3T3O A;  5C6R A;  1DOY A;  1RFK A;  1E8X A;  4BKT A;  1TS5 A;  2V3S A;  3ONS A;  1LO5 D;  1QF6 A;  3UIP B;  5GOW B;  1IGD A;  5HG2 A;  1DYQ A;  2WXH A;  1M4V A;  1HTQ A;  2JXT A;  2EEL A;  1TS2 A;  2V4I B;  4MGZ E; 
#chains in the Genus database with same CATH homology
 4F7Z A;  2DN6 A;  4HCN B;  3A9K A;  2ZZP B;  1U5D A;  3H7P B;  1BTN A;  3M62 B;  1YJ1 A;  1C1Y B;  3VUY A;  2KUP A;  2JRI B;  2J0J A;  2EKE C;  5J18 A;  3VOQ A;  1WXS A;  1XR0 B;  4KZC A;  1WFY A;  2JP2 A;  4KHA A;  3VFK A;  2MKR A;  1DDM A;  3WAL A;  4C0A A;  2L0T A;  1ZC4 B;  2P0H A;  1UNQ A;  2LVP A;  1Z2M A;  4JGH B;  3VAW A;  3QBV B;  4HB4 B;  2D11 A;  2K8C A;  2R0D A;  1WX9 A;  2LRW A;  2YSZ A;  4EFO A;  2BWF A;  3V60 A;  2KQ7 A;  3BY4 B;  4E3C A;  2YLM A;  1UH6 A;  1XX0 A;  2FCN A;  2PJH A;  4IW0 A;  4P7I A;  2B3A A;  3PS6 A;  3H1U A;  2A4Z A;  2JXX A;  2KCJ A;  3ZW3 A;  5KHQ A;  4WWN A;  2EJ8 A;  1LW3 A;  4HAW B;  5GMV A;  2Z0D B;  2QKL A;  3PSE B;  3VTU A;  2YS3 A;  4A6F A;  2L00 B;  1P3R A;  3O96 A;  2H7D A;  2LGX A;  1V9J A;  1EO6 A;  2R2Q A;  2L1C A;  3WYF B;  3ML8 A;  2G3Q B;  2P8V A;  2ADZ A;  4I6L B;  4HB0 B;  5JHH A;  4I6P A;  3T8M A;  4WJ7 A;  3TMP B;  2ZCB A;  3KUD B;  2IFS A;  3U8Z A;  2RNR B;  2MQJ A;  4DDI D;  1EF5 A;  2K00 A;  3DXE A;  3VTW A;  4A5K A;  3PVU A;  1G6J A;  4W9C A;  2L8J A;  2LGY A;  3AI5 A;  2DKP A;  3U7D A;  1DDW A;  3DVG X;  5L95 C;  5FI0 A;  1H8C A;  1WGH A;  2RLO A;  1NTV A;  5J2R A;  4HLE A;  3MHS D;  2IO0 B;  4DX9 0;  4K7U A;  2ZEQ A;  2MBQ A;  1I2H A;  5D3Y A;  4FHK A;  3CST A;  3ODX A;  3QWZ B;  4HWI B;  2PE6 B;  5CHF A;  4MGK E;  3RYT A;  1U5E A;  1SGH A;  5G55 A;  1UPR A;  2DYM A;  2M1M A;  1TGZ B;  4D0N B;  2ZVO A;  4W9G A;  1ZW7 A;  1FGY A;  2VRR B;  3APF A;  4NJ7 A;  2ROZ B;  1RRB A;  2MP2 B;  3TFM A;  2HTH B;  1FHW A;  2FJL A;  5J3T A;  4HAU B;  2JZ3 B;  2N9E B;  4HHV A;  4JL9 A;  3PG7 A;  4NSW A;  1LXD A;  2G45 B;  1D3Z A;  1UNR A;  3KRW A;  4A3P A;  4E74 A;  4ANX A;  4WVF B;  3VIA A;  3AUL A;  2DYB A;  3UQA A;  4XX5 A;  2AL6 A;  1U5G A;  1SIF A;  1U2B A;  2JPH A;  4GN1 A;  5AEK B;  1X11 A;  2G4S A;  3GOE A;  4HPL B;  2D9X A;  4HXD A;  2PPH A;  2DHJ A;  1QZE A;  3A1Q A;  1P3Q U;  2KC2 A;  5BO4 B;  1K8R B;  2XBB C;  3G9W A;  1EUV B;  2DX5 B;  2CS4 A;  2GCL A;  2MWN B;  4TYZ A;  1X05 A;  4HJK A;  4K7W A;  3TVV A;  3ZUN A;  4ZRK A;  2MBE A;  3ZNH B;  3TIX A;  3ENE A;  1NI2 A;  3ALB A;  3DOW A;  3A33 B;  4AJY B;  1TBE A;  1E5W A;  4WQO B;  4JQW C;  2C9W B;  1WF9 A;  3VXW A;  3PEG A;  4FUL A;  3PGE A;  2WDT B;  2IO3 B;  2LOX A;  2DZK A;  1W1D A;  1UD7 A;  2RR9 A;  3OJ3 A;  3PHW B;  3L54 A;  1L2N A;  2RSG A;  3EC8 A;  1KZG A;  4GDK B;  4MJS B;  5D94 A;  3LJU X;  3GYP A;  3KVF B;  1PLS A;  3KUZ A;  1DBH A;  4II2 B;  2JVC A;  2RD0 A;  3K9O B;  2YT0 A;  1Z5S B;  2JZZ A;  4HPM B;  3BIN A;  1FHO A;  1FGZ A;  3ML4 A;  4KSK C;  2D4Q A;  4AOF A;  3R7R A;  1WGG A;  2Z0Q A;  1LM8 B;  1WJ4 A;  1WMH A;  4E71 A;  4Z2N A;  4X57 B;  1VCB A;  2VRW B;  3B08 A;  3ULC A;  4PS3 A;  2L0F A;  2D9Z A;  3DDC B;  4CHK A;  2K25 A;  1FOE A;  3SD5 A;  1IP9 A;  4GZU A;  2AYO B;  5EDS A;  2NBW B;  2CKH B;  4ANV A;  1UBQ A;  2DEN B;  2MBO A;  4IG7 B;  3VHT C;  3D8E A;  2RSU A;  3ZNG C;  1R4M I;  3NOB A;  2K8H A;  1EVH A;  3PPA A;  2J0M A;  2KX3 A;  4W9E A;  2KX0 A;  1V88 A;  2L05 A;  3GYO A;  3R7Q A;  1U29 A;  5CHW A;  2E2X A;  1GJZ A;  3RCZ A;  2G4D B;  3ODO A;  2J7Q B;  4YON A;  3VUX A;  2ZVN A;  4ZDV A;  2LI5 A;  3SYX A;  5D7G A;  4EJN A;  3DVG Y;  4DK5 A;  2GJY A;  5DPR A;  4HAV B;  4XZ4 A;  5J17 A;  2NZ8 B;  4M8M A;  1UZX B;  1WGD A;  2Y8G A;  2LKO A;  5DIF B;  4KZ0 A;  2QHO A;  2AWT A;  3TO1 A;  4OVU A;  4F7H A;  3RUI B;  3TCA A;  3SU8 X;  4OVV A;  2UYZ B;  2KWV B;  5D3X A;  2KNB A;  2FCM A;  3EFU A;  1N3H A;  4FAD A;  3A4R A;  3A98 B;  2DX1 A;  2CY4 A;  2WYQ A;  4F8C B;  5CTR C;  4FN2 A;  2KVR A;  3H7P A;  3QAQ A;  4G11 A;  2GCJ A;  1E8Z A;  1S3S G;  2K6Q A;  2OTX A;  2CY5 A;  1QQG A;  1BWN A;  1TZ1 A;  3QAR A;  4KDL B;  4IC7 B;  2CR5 A;  3QK0 A;  2PZ1 A;  3D8F A;  1WX7 A;  4XWX A;  2MA9 B;  2JRH A;  2ZNV B;  4AP4 C;  4BKG A;  4HAY B;  4GMX B;  3ODW A;  3W1Y A;  3ZTC A;  2DAJ A;  2NVU I;  4KIK B;  3KY9 A;  3AXC A;  2WX0 A;  3KZ1 A;  2DAF A;  2DZI A;  3DBR I;  1Q1O A;  3FM8 C;  3P6A A;  1U27 A;  2NPT B;  1B55 A;  3QX1 A;  4HVB A;  4DWF A;  2KWC A;  3MPX A;  5DCN A;  1MKE A;  2GBR A;  3AU4 A;  4Z2M B;  4HAX B;  4FBJ B;  3ECI A;  4K81 A;  1WJM A;  4CHJ A;  2YVC A;  1KZ7 A;  2C60 A;  5HE1 A;  2DKQ A;  3A8P A;  4NNJ B;  1WZ3 A;  4MEM A;  4KHB B;  2BPS A;  4B6W A;  3M3J A;  2IY0 B;  1KLV A;  5G2N A;  1XD4 A;  1P98 A;  3NHE B;  3DBH I;  2EMT A;  2KJH B;  2COC A;  1C3T A;  4Y94 A;  1XKE A;  5E6O A;  5AZG A;  3PLU A;  3FSS A;  3V61 A;  3TJP A;  4ICU A;  2VSZ A;  1M94 A;  1GC6 A;  2RGF A;  1MK7 B;  1T0Y A;  4M8N A;  2OQB A;  2IO1 B;  3ZIM A;  3HM3 A;  5KHO A;  4K1R B;  4HB2 B;  3ZLZ A;  4NPN A;  1QC6 A;  3SDL C;  1WI1 A;  2YT1 A;  5C23 A;  2IYB A;  1WX8 A;  5JHG A;  1E8Y A;  3KYC D;  3CMM B;  5JHB A;  3R66 C;  1PFJ A;  2RUK B;  2FUH B;  4HAT B;  2NMB A;  4CYE A;  3BJI A;  3NY5 A;  2D2Q A;  2KFK B;  1E90 A;  2LXC A;  1WM3 A;  2I5F A;  3QA8 A;  1YD8 U;  4MT7 A;  1YQB A;  2MP2 A;  2HTH A;  3P7Z A;  5D3V A;  1VD2 A;  4GPT B;  4WAA A;  1J0W A;  3M1I B;  2LZ6 A;  2N0Y A;  5DH9 B;  3W1S A;  1SHC A;  4NQK E;  2P0D A;  3K9P B;  2GBN A;  3VTV A;  1P6S A;  2PE9 A;  2DZM A;  2LYD A;  1V5O A;  1V81 A;  4G0N B;  3UQB A;  2FAZ A;  2K2J A;  2CHW A;  2CRF A;  3CIK A;  4FJV B;  2DHK A;  2GOW A;  4B95 A;  3JSV B;  4H8S A;  3IHP C;  1TJ6 A;  2DX5 A;  4URK A;  1YIW A;  2KXJ A;  4HAZ B;  2MRP A;  3DPD A;  2A5U A;  2D07 B;  5C5B B;  3VVW B;  2L2I A;  1TTN A;  2EMS A;  1ZKH A;  1BT0 A;  3SHQ A;  1PQS A;  1V5M A;  1J0G A;  4ANU A;  1JRU A;  5JH5 C;  2OJR A;  4HCP B;  3UZT A;  3N7C A;  3U30 A;  2L7R A;  1OQN A;  4FHJ A;  4RM8 A;  2BYV E;  2KO3 A;  2WX1 A;  2LD9 A;  3NZU A;  1RFA A;  3Q3J A;  2KD0 A;  4BBN F;  4RMA A;  2AEH A;  1DRO A;  3RZW C;  3QCA A;  1W1G A;  2RGN B;  1IPG A;  4GDK A;  4MEL A;  3PVL A;  3EEC A;  3PRM B;  5J3Q A;  4MJS A;  3A9J B;  5D6J B;  2D9W A;  3F5R A;  1XD3 B;  2MSE D;  3IVF A;  2X18 A;  1WR6 E;  4MSM B;  2LGD A;  2GBM A;  4WJN A;  2KDI A;  2IY1 B;  3A4S C;  3QQ8 B;  3R3M A;  4IM0 A;  4EZK A;  2BKR B;  4PNK A;  4G3X B;  2I5C A;  2R2O A;  3FEH A;  2KJ6 A;  2IZV B;  2PEA A;  4CO7 A;  2RPQ A;  1ZM0 A;  4LDT B;  5IAA C;  4IWQ A;  5DI9 B;  2KTR B;  3RCP A;  2C7M B;  5FR6 A;  2RVB B;  4GOC A;  2CU1 A;  4BFR A;  1WGU A;  4ANW A;  5LOP B;  2CHZ A;  2ZPY A;  4MDK E;  4ICV A;  1WGQ A;  1Y5O A;  4W9F A;  1J8C A;  4CHM A;  3KH0 A;  3O65 B;  1V5P A;  2W2X D;  2O2V B;  4NAW B;  2P0F A;  4IM3 A;  1MIX A;  1Q5W B;  2Z0E B;  3H9D A;  1FB8 A;  3VH3 B;  5HE2 A;  1WJ6 A;  1GG3 A;  3P2B A;  4LJP B;  5C79 A;  1EF1 A;  1F9J A;  5LXH A;  2UZR A;  3V6C B;  1I7A A;  1Y8R C;  3N30 A;  2DTC A;  3ULB A;  2REX A;  1K5G B;  3QIJ A;  5CLL B;  4W9H A;  3L16 A;  2G35 A;  4WJP A;  2FID A;  3VQI A;  3MTN B;  5DHA B;  2KHW B;  2Q13 A;  3TW1 A;  1WH3 A;  2DYO A;  3KSY A;  1WXM A;  2LG1 A;  2LRU A;  4GDL B;  1V5T A;  4EEW A;  2KDB A;  3D32 A;  3V6E B;  3PHX B;  1WE7 A;  2W9N A;  3RT3 B;  2JF5 A;  4IAP A;  1ZSQ A;  1WGR A;  3HQC A;  4W9D A;  3Q3F A;  3PTF C;  3NSU A;  1M7R A;  4DHZ B;  4JIO U;  4FJZ A;  2WWZ A;  4WJO A;  4BOS C;  4RM9 A;  4BOZ B;  2KKC A;  3ZO5 B;  2XQN M;  2D10 A;  3W1S C;  1WIA A;  1I42 A;  4EKU A;  3V62 A;  2NBV B;  4WWP A;  4MK0 A;  1NU2 A;  5CX3 A;  4A3O A;  1FAO A;  1ZGU B;  4TKN A;  1V2Y A;  2YRY A;  3HIZ A;  1V6E A;  1V80 A;  4IWP A;  1HE8 A;  1H10 A;  4EZJ A;  4HK2 A;  3N32 A;  1V86 A;  4TUU A;  3LJ3 A;  2D9V A;  3L13 A;  3A8Q A;  3ZNI D;  3I3T B;  3L0W B;  2J59 M;  2L3Z A;  4LCD E;  5DPS A;  3H6N A;  1I35 A;  2FNJ B;  3JVZ X;  2FCS A;  3WIM A;  1Z87 A;  4MY6 A;  3WAP A;  4IFS A;  2N9X A;  4KIK A;  1P9D U;  4KDI C;  2GS0 A;  1MK9 B;  1UPQ A;  1Y19 B;  2BYF A;  2O6V B;  2ZCC A;  3L10 B;  2NPT A;  2ELB A;  3D8D A;  1WXV A;  2NS5 A;  2MW5 A;  2W2W A;  2KTF A;  1CMX B;  3DBL I;  4IUM B;  2DHZ A;  1WYW B;  2R09 A;  1UBI A;  3HW2 B;  2C5L C;  1P0R A;  2K2U A;  3SO6 A;  4I6N B;  1V5U A;  1WJN A;  1WZ0 A;  2KMC A;  3PVW A;  1OEY J;  4B6H A;  3VDZ A;  2LVQ A;  3TL5 A;  3RD2 A;  1OTR B;  4FA6 A;  5KQ1 A;  4F7G A;  3T06 A;  2XK5 B;  1WE6 A;  2BYE A;  2MDX A;  3JW0 X;  1U4A A;  3ZVR A;  2MX2 A;  3PRP B;  2MLB A;  4K2O A;  2KWU B;  1E8W A;  4GMV A;  2HD5 B;  1IRS A;  4DXA B;  4L6E A;  3KYD D;  2FCQ A;  5JHA A;  4IWO A;  1GUA B;  4W9J A;  3X23 A;  4TV3 A;  2KLG A;  3JYU A;  2KLC A;  3UGB B;  4K7S A;  4HB3 B;  5KQ4 A;  4KV2 A;  2IYD B;  3OLM D;  3V5W A;  4ZYN A;  3HM6 X;  2NBU A;  4LDT D;  2JT4 B;  3HK0 A;  5JLJ B;  3KRX A;  2LWP A;  3HHM A;  1W1H A;  3WAM A;  2DHI A;  4ZRI A;  5IA7 A;  1GC7 A;  1P5T A;  1PMS A;  2DZJ A;  1TXD A;  2K1F A;  4MM3 A;  4PS8 A;  2ASQ A;  2V76 A;  2J0K A;  2M14 A;  1ZVR A;  2Y5B B;  1MPH A;  3DQV A;  3IFW B;  4LJO B;  3A9K B;  3DBS A;  2MBH A;  4DHZ E;  2C7H A;  4GSW A;  4KSL C;  2KFK A;  3N3K B;  1XOD A;  1AWE A;  2CHX A;  4FLH A;  2KC1 A;  4HDQ A;  3ZKJ C;  3PT2 B;  2LUL A;  2COD A;  1GNU A;  3QHT A;  3T9L A;  4BVU C;  5LON B;  4DBG A;  4BBK A;  3RZF A;  1TQZ A;  1XT9 B;  1IYF A;  2DA0 A;  2GBJ A;  2KQS A;  2LOZ A;  2KK8 A;  1E7U A;  3PRZ A;  2C7N B;  2MBB B;  2JUO A;  2V1Y A;  2BF8 B;  1R4N I;  2Y7B A;  3ZRF A;  2QKM A;  2CAY A;  2UWQ A;  4KVG B;  4G50 A;  2KFJ A;  5CHV C;  4KAX B;  1J19 A;  4MSQ B;  3TBL D;  3JSV A;  3QC8 B;  2V4L A;  2NCN A;  1RJ2 A;  3QWM A;  5C5B A;  1OQY A;  4F1S A;  3ZDT A;  4KHO A;  3ZTD A;  2XEW A;  1KOT A;  3KUC B;  1KI1 B;  2KGX B;  5D2M B;  3ZRC A;  4W9I A;  2M8S A;  4A6F B;  3PV1 A;  5CLQ B;  2FIF A;  1NTY A;  3M63 B;  1ZC3 B;  4FJY A;  4IM2 A;  4A6K A;  3OAN A;  2I1K A;  2ZNV C;  4NY0 A;  1UEF A;  2YS5 A;  4DHJ B;  2KZR A;  1L7Y A;  2GBK A;  2M0X A;  1YX5 B;  5AZF A;  5E6N A;  3ML9 A;  3A9J A;  4DBB A;  1K5D B;  2L76 A;  3LDZ E;  1X86 A;  1XCG A;  3F0W A;  1X1G A;  2BWE S;  3SNH A;  1V89 A;  2VKI A;  1WG7 A;  4II3 B;  4IOY X;  3X0W A;  3ZVV A;  1V61 A;  1BAK A;  4DX8 A;  2O6V D;  1AAR A;  3L08 A;  4NJ6 A;  2ZPN A;  3CSF A;  4XC2 A;  3DXD A;  1Q0W B;  2Y8F A;  1ISN A;  3PP2 A;  3SV1 A;  5DHF B;  2KTR A;  5LLI A;  4AUQ C;  2W2X C;  4DDG D;  1RRP B;  2BKF A;  4B9K A;  2DFK A;  4WWO A;  1WY8 A;  4GXB A;  1FHX A;  3UIO B;  3DXC A;  5C16 A;  1LB1 A;  1EGX A;  1S1Q B;  2M17 A;  2N4F A;  1MG8 A;  2K8B A;  4K2P A;  1WVH A;  2O2V A;  5JP4 A;  2K39 A;  4NAW A;  3PSC A;  2JY6 A;  3NZS A;  3C0R B;  3L17 A;  5AZH A;  2Z59 B;  4K17 A;  4NQL B;  3GZN I;  3IG3 A;  4A6H A;  5FI1 A;  4PYU A;  1RLF A;  4W9L A;  2COA A;  1V49 A;  4W9K A;  1KM7 A;  4ASW C;  2YF0 A;  2Z0O A;  1OMW A;  3A1Q B;  4PS7 A;  5DPT A;  4M0W B;  3NS8 A;  1WXA A;  1BTK A;  2KOX A;  4BKS D;  4EMO A;  5C1Z A;  1WJ1 A;  3M95 A;  4GDL A;  5KCV A;  2UVM A;  3PLV A;  2KDF B;  2M4N A;  2BGF A;  3WAN A;  4MGI E;  1RAX A;  1OEY A;  1X1F A;  3MJW A;  5HKH A;  1WRD B;  2LJ5 A;  4AJW A;  2KJR A;  4EOY A;  4WJQ A;  2ELA A;  3RUL A;  4WSF A;  2N7E A;  1Q67 A;  2ZJD A;  2BCJ A;  4EZL A;  1EAZ A;  3UF8 A;  3WAO A;  5LXI B;  2YS1 A;  2MWS B;  2COF A;  1UGM A;  1KJT A;  1DYN A;  3AU5 A;  2NR2 A;  3B1L X;  1NBF C;  1UEL A;  3IBE A;  2DYQ A;  5EFX A;  3AJ4 A;  3VUW A;  2N1V A;  4F7U P;  4JLC A;  2DLW A;  3KW5 B;  2LUE A;  3MDB C;  2AL3 A;  3WA0 A;  2UZS A;  3CF6 E;  5D27 A;  3CXB B;  3OJ4 B;  1UNP A;  4MH0 E;  3APD A;  3OAW A;  2EC1 A;  2LAS A;  1DDV A;  2H7E A;  1OY2 A;  2M38 A;  1XQQ A;  5E6P A;  1WMH B;  1AQC A;  1WI0 A;  4EUT A;  2O6V A;  2N7D A;  1MAI A;  5DPW A;  2GMI C;  4GIV A;  1WM2 A;  5L83 A;  3DCG A;  2N1W A;  3APC A;  5J3Y A;  4GU2 A;  4GB9 A;  5TR5 A;  4N9F 4;  4AWJ A;  2KAN A;  1U5F A;  4MGY E;  2ROV A;  3B0A A;  1X1M A;  1LQB A;  3PRE A;  2K6D B;  1M7E A;  4PYZ A;  4DHJ D;  3H7S A;  3VH4 B;  1FXT B;  3QJZ A;  5L81 A;  2D3G A;  2JWZ A;  1YX6 B;  5D3W A;  4J6I A;  2XK5 A;  4HDO A;  2DYN A;  1SE9 A;  5HE0 A;  5HE3 A;  2MCN B;  3SUZ A;  2LXA A;  1WGY A;  4TQ0 A;  3DVN V;  2OOB B;  3PZD A;  5JZE B;  4BBN C;  1MIZ B;  2I1J A;  1WR1 A;  2KDE B;  1NDD A;  2KMA A;  1OGW A;  4ZRJ A;  4GGQ A;  1P1A A;  4A20 A;  2D9Y A;  4TQ1 A;  3ZNZ B;  3UIN B;  2N9P C;  2HJ8 A;  4PQ0 A;  3ZDM C;  2N23 A;  1WJU A;  1E7V A;  2KN5 A;  2IBI B;  2MFQ A;  2LVO A;  3S2A A;  4YL8 A;  3EHV A;  2IO2 B;  2Z0P A;  3DVN U;  1LFD A;  2HE7 A;  4BKS A;  1A5R A;  1H4R A;  5C6R A;  1E8X A;  4BKT A;  2V3S A;  3ONS A;  3UIP B;  5GOW B;  4MGZ E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...