4GN1A

Crystal structure of the ra and ph domains of lamellipodin
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
251
structure length
251
Chain Sequence
VKKLVIRVHMSDDSSKTMMVDERQTVRQVLDNLMDKSHCGYSLDWSLVETVSELQMERIFEDHENLVENLLNWTRDSQNKLIFMERIEKYALFKNPQNYLLGKKETAEMADRNKEVLLEECFCGSSVTVPEIEGVLWLKDDGKKSWKKRYFLLRASGIYYVPKGKAKVSRDLVCFLQLDHVNVYYGQDYRNKYKAPTDYCLVLKHPQIQKKSQYIKYLCCDDVRTLHQWVNGIRIAKYGKQLYMNYQEALK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of Lamellipodin implicates diverse functions in actin polymerization and Ras signaling.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords Ras-associated and pleckstrin homology domains-containing pr
total genus 69
structure length 251
sequence length 251
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2012-08-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00169 PH PH domain
A PF00788 RA Ras association (RalGDS/AF-6) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 4gn1A02
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 4gn1A01
2V1YA 1N3HA 3DBLI 1LW3A 3CXBB 3WIMA 3UZTA 2X18A 1WFYA 5KHOA 4GU2A 2CHWA 2LVQA 3QHTA 1ZGUB 4WJNA 2UWQA 2V76A 4WJOA 3PRZA 3DCGA 4FADA 5JHGA 2KWCA 3EHVA 3NSUA 2YF0A 1WJ6A 2RUKB 2YVCA 2KFJA 4HDOA 1P98A 1UELA 2LRUA 4K7UA 3APCA 2ADZA 1FAOA 3ODWA 1XR0B 2RGFA 3NS8A 2KTRA 2JP2A 1L2NA 2KC1A 1LFDA 3D32A 2NZ8B 1V6EA 3SD5A 4GXBA 4K2OA 3L0WB 1IRSA 3CSFA 4HWIB 4JIOU 3M62B 5FR6A 1B55A 1XD3B 2KHWB 2DHJA 4W9CA 4URKA 3HK0A 1KZ7A 1HE8A 4WJ7A 1ZW7A 2N7EA 2FAZA 3SUZA 2C7NB 1J19A 1V5UA 3P7ZA 2KX0A 3DDCB 3T06A 1E8WA 2LD9A 1V9JA 2XK5A 2KGXB 1RLFA 3PVLA 3VQIA 1M7EA 4DX90 4TUUA 2ASQA 5CHFA 4BKSD 3QA8A 1I42A 3OJ4B 2R0DA 3LDZE 1UH6A 1WJ1A 2KUPA 2QHOA 2JUOA 3PPAA 2DZJA 3FM8C 5DI9B 2KO3A 2IY0B 4NQKE 3N32A 3QCAA 3ZLZA 3RT3B 4HPLB 4GGQA 5C5BA 1YQBA 2BWES 2MWNB 2JZZA 2MP2A 2GBJA 2LGXA 4MSMB 4MGYE 4W9DA 3A1QB 4TV3A 2UZSA 2DX5A 2NBUA 3DVGY 3N30A 3PLUA 4E3CA 2QKMA 2PJHA 3V62A 4KVGB 2LULA 3U7DA 4DHJB 2ZEQA 5D94A 4DK5A 2BYFA 1AARA 2ELBA 2E2XA 2W2WA 1V49A 2CKHB 2NPTB 1CMXB 4HDQA 3WAPA 3VTVA 2RD0A 4HB0B 4XWXA 4ZRJA 1C1YB 3DPDA 1X1GA 1PLSA 5J3QA 4II3B 2L1CA 3ZDTA 2D9ZA 4E71A 3BJIA 3QC8B 2DHIA 2ZNVB 2KTFA 3F5RA 1H10A 2XQNM 4FJZA 2H7DA 3ZNHB 1R4MI 3SO6A 2GBRA 2KANA 2WX1A 1ZM0A 1NDDA 4AJWA 4BBNC 1Y8RC 2PZ1A 1UNRA 1XX0A 4NNJB 2I1KA 4HAZB 1OGWA 2MBEA 3TL5A 3ML4A 2KOXA 1GC6A 1ZSQA 3PP2A 5KHQA 4Z2MB 2KMAA 1WX8A 1L7YA 3CIKA 1WE7A 2KX3A 5C16A 2K8HA 2KXJA 3VUXA 2D9VA 4KSKC 3WAMA 4EFOA 2LGYA 2MLBA 2O6VD 3FEHA 2M1MA 4MY6A 5FI0A 3KYCD 5L83A 1WJMA 1K5DB 1V80A 2G35A 2L00B 3L13A 3QX1A 4ANXA 1V5PA 3BINA 5D3WA 3G9WA 4M0WB 4MGZE 5D2MB 2N9XA 2DFKA 3NZUA 1TXDA 3UIPB 2WWZA 3TO1A 3A9JB 5TR5A 4HVBA 2PEAA 1XODA 3PTFC 4XC2A 1DDVA 4HATB 2MQJA 2L0FA 2IO3B 2G4SA 2EMTA 4EKUA 3L08A 3QAQA 5C1ZA 1Q67A 3B0AA 3DVNU 4IUMB 3ZRFA 2JVCA 4Z2NA 5AEKB 1X11A 3R66C 2DYMA 5J17A 1UEFA 4MSQB 4IM0A 4PYUA 5JHAA 5DPWA 3CSTA 4ANVA 2FCQA 4FA6A 4PS8A 2COAA 5CLQB 5L81A 3M3JA 4K1RB 4WWPA 3PG7A 3ONSA 2MRPA 3SNHA 3ECIA 2KJHB 2G4DB 2IZVB 3JVZX 4MEMA 4A6KA 2J0MA 1RFAA 2O6VA 1WJNA 1TJ6A 1FXTB 4IM3A 4M8NA 3UF8A 3VFKA 1OEYA 3QJZA 4MM3A 4FHKA 1Y5OA 1XKEA 3LJUX 3OAWA 3QWZB 4DDGD 2FUHB 1WIAA 2W9NA 1E7UA 4ANUA 3ULBA 4PS7A 3IVFA 4BVUC 3O96A 1WMHA 2GBNA 1MKEA 2L0TA 2ROZB 1TGZB 2KLCA 2ZJDA 1ISNA 1JRUA 4E74A 2CR5A 2Z0OA 1NU2A 3ML9A 3U30A 4Y94A 2RNRB 4JLCA 2LRWA 3ML8A 2IYDB 3UQAA 1S3SG 2PE9A 3MTNB 1BWNA 2Q13A 4WWNA 3ZW3A 4HB3B 2KWVB 1UGMA 2KMCA 4B95A 5G2NA 1U27A 2N9EB 2ZCBA 1BTNA 2GCLA 5J3TA 3EFUA 4MGKE 2DENB 3DBRI 5CX3A 2KTRB 1AWEA 5AZGA 1OEYJ 1SGHA 3W1SC 2DYOA 3IBEA 4ICUA 4NQLB 3ZKJC 4DWFA 3QQ8B 3KUDB 2G3QB 2LJ5A 1DDWA 1DYNA 2COFA 1OTRB 3TBLD 1AQCA 3PRPB 3X0WA 1V5TA 5C5BB 3S2AA 4KZCA 3JSVA 2WYQA 3ODOA 2W2XD 4XZ4A 1E8XA 2KDFB 3ODXA 2VRRB 4IAPA 3LJ3A 2D07B 4X57B 2NS5A 5AZHA 5J18A 2HJ8A 4II2B 3V60A 4AUQC 1VCBA 2C7MB 4GDLB 4B9KA 1U5FA 5JP4A 5D7GA 3AJ4A 1V2YA 2ZZPB 2K8CA 4AOFA 1EGXA 1RAXA 2NVUI 4GMXB 4EZLA 4B6HA 4MJSA 1Q0WB 3TW1A 4K81A 4KHOA 2BKRB 1Z5SB 2CODA 1GUAB 2XK5B 1FHWA 1EF1A 2I5CA 3F0WA 2KKCA 2XEWA 3A4SC 3V61A 2MA9B 1TTNA 3VAWA 2HD5B 2XBBC 3A9KB 5CHWA 4F1SA 3PHXB 2C5LC 2NPTA 1EUVB 4NY0A 4BBNF 4F7ZA 2O2VA 1WGUA 4LJOB 2KQSA 2Z0EB 2RVBB 2DHZA 4WJPA 2KC2A 2DN6A 4IWOA 2P0FA 2EKEC 5DH9B 4KIKB 5DPRA 3N7CA 3M1IB 2ZVNA 3ZTDA 1OQYA 3PRMB 4HK2A 4I6LB 2G45B 2CHXA 2FCNA 3KVFB 4HCNB 1EVHA 4ZRKA 1LQBA 1ZC3B 1OQNA 2DX1A 1OY2A 1T0YA 4GN1A 2Y8FA 4W9LA 3A8PA 1WR1A 4NSWA 1FB8A 1XQQA 1KLVA 2DTCA 3H9DA 1MIXA 2IO0B 4NJ7A 2RSGA 5HE0A 1GC7A 2UZRA 2BYEA 3H7SA 3JYUA 2K2UA 1WYWB 1NI2A 3NHEB 1GNUA 4K2PA 2NBVB 3SHQA 4EOYA 1ZKHA 1E90A 3H6NA 2HTHB 1WY8A 3RD2A 5L95C 3PEGA 4A6FA 4NAWB 4BOZB 5E6PA 4MGIE 2LXAA 3ZUNA 1YJ1A 2YS5A 4WQOB 5AZFA 3DVGX 4BKTA 2VRWB 4PYZA 2BF8B 3HW2B 4BKSA 2KDIA 1W1GA 5HE3A 3KUZA 3ZVVA 2DA0A 2JPHA 1WGQA 4GB9A 5LOPB 2EC1A 1MK7B 1WI1A 3OLMD 4HCPB 1V88A 1W1HA 5G55A 3ZO5B 5LXHA 3TFMA 1TBEA 3QIJA 2R2OA 3A9JA 5DIFB 2BGFA 3C0RB 3ZRCA 1Z87A 2W2XC 1FGZA 2MKRA 1LM8B 4HAVB 1V5MA 2MBQA 2YLMA 3PT2B 4FJVB 5GMVA 2P0HA 1BAKA 2R2QA 1WM2A 1X86A 2YS1A 4KIKA 2M8SA 1WF9A 1IP9A 3NZSA 4ZYNA 4ZRIA 2M14A 2DZIA 2JRIB 4LCDE 2K6DB 1WMHB 4ZDVA 1I2HA 1K5GB 1RJ2A 2MW5A 5C23A 1P0RA 1YIWA 3A9KA 3V6EB 1WM3A 3DOWA 2DKPA 2IBIB 5D27A 5DHAB 2J7QB 4IWPA 1A5RA 1E8ZA 2MX2A 2L76A 2DAFA 2JY6A 3D8FA 4I6PA 4WWOA 4LDTD 4LDTB 3QBVB 1X05A 4L6EA 1QZEA 1WJ4A 5HE1A 1WZ3A 5J2RA 2DLWA 4GDKB 3O65B 3ZIMA 4IW0A 2K00A 2COCA 4C0AA 2ELAA 3W1SA 2KCJA 1E7VA 5JHBA 2D9WA 2K2JA 5CHVC 3A4RA 3RZWC 3TMPB 3BY4B 1KOTA 4K7WA 4OVUA 4WVFB 1WR6E 2BPSA 1J8CA 2D2QA 2UYZB 5CLLB 1WGRA 1PMSA 2DYQA 2C60A 4W9KA 3OJ3A 2M38A 2AEHA 2A4ZA 4BKGA 3L16A 2ROVA 2KFKB 3V6CB 4AJYB 1P3RA 2K6QA 3JSVB 3T9LA 1GJZA 1XD4A 3A1QA 4RM8A 3DXCA 4HAWB 2FCMA 4LJPB 3WALA 4CHMA 1U5EA 3RULA 2Z59B 2OQBA 3VUWA 3ZTCA 1ZVRA 4JQWC 1TQZA 4IOYX 1SE9A 2A5UA 2CS4A 2Y5BB 3AXCA 4G0NB 1QC6A 1WVHA 4YONA 2NR2A 1J0WA 2Z0DB 3L54A 4JL9A 2L7RA 3PGEA 4IM2A 3DXEA 1WXMA 1U5DA 2KDBA 2ZPYA 3HIZA 4W9FA 5E6NA 3ZDMC 4GOCA 2KQ7A 2N23A 1MIZB 2NMBA 4EZKA 1WGDA 1WX9A 3Q3JA 5LLIA 3SDLC 3KUCB 1C3TA 2I1JA 2GMIC 2VKIA 4ASWC 1V81A 2MBOA 2MFQA 3DQVA 3PSEB 2DAJA 4G50A 2FCSA 2KWUB 2Y7BA 4GDKA 4J6IA 4RM9A 5E6OA 4EZJA 3KW5B 4KAXB 2LI5A 2LKOA 5FI1A 3MHSD 1G6JA 4P7IA 4HB2B 1UD7A 2FIFA 4WSFA 3VHTC 3KRXA 4GMVA 2LZ6A 4DBGA 3RCZA 3KRWA 4FJYA 3DVNV 2LOZA 2HE7A 1Q1OA 2LG1A 4FBJB 2Y8GA 1PFJA 1RRPB 3QK0A 2B3AA 2GBKA 2AWTA 3AU5A 1U2BA 3KSYA 4RMAA 4DHZB 2P0DA 4HAUB 1KI1B 3AU4A 3KY9A 1X1FA 4A6HA 3WA0A 4FLHA 4HLEA 2ZVOA 4HJKA 2C9WB 1WRDB 5DPSA 1WXSA 1DBHA 1UNPA 2LASA 4OVVA 2BCJA 2EMSA 4GPTB 4HHVA 2ZNVC 3KZ1A 3AULA 1WH3A 3Q3FA 2V4LA 1W1DA 1J0GA 1V61A 3DBHI 3FSSA 3R7QA 1Z2MA 2D9XA 2QKLA 1H8CA 1UZXB 3HHMA 4A3OA 4F7UP 3M63B 1WXAA 4KHAA 4A6FB 2BKFA 4F7GA 2J59M 2CHZA 2H7EA 4NPNA 3PS6A 1XCGA 2LGDA 4ICVA 2N4FA 2RGNB 5D3YA 2DYBA 4CHJA 5EDSA 3APDA 3AI5A 2VSZA 3KH0A 1D3ZA 1U29A 3OANA 4D0NB 1EF5A 1Y19B 1YX5B 4HPMB 3RZFA 3VH3B 2ZCCA 4CHKA 4MK0A 1WGGA 4I6NB 4M8MA 3TIXA 3W1YA 4A3PA 5D3XA 2D10A 2IY1B 3IHPC 2FIDA 2Z0QA 3TVVA 2L2IA 2GBMA 4FN2A 4EUTA 4DXAB 1DROA 1SIFA 4KDLB 3DXDA 4AWJA 2DX5B 2M0XA 1IYFA 4A5KA 1S1QB 3ZNGC 5JLJB 2LVPA 4W9EA 2FJLA 3RCPA 2AL6A 1RRBA 2KJ6A 4KZ0A 2MCNB 3TJPA 3VVWB 3ZNZB 4A20A 2CAYA 4YL8A 3IFWB 1WG7A 2DZMA 3I3TB 1YD8U 4DX8A 3X23A 2OTXA 3UIOB 4IC7B 4BOSC 1NTYA 1WGHA 2R09A 2GOWA 2OOBB 3IG3A 2Z0PA 5CTRC 3K9PB 2DKQA 5GOWB 4G11A 4H8SA 5EFXA 3VH4B 2BWFA 5DPTA 2KLGA 4KV2A 2MSED 1WGYA 2CY5A 4MH0E 3H7PB 4CO7A 4GZUA 2M4NA 2IYBA 3PZDA 2MBHA 2IFSA 3MDBC 2MWSB 2RSUA 1SHCA 1U4AA 1WX7A 2D3GA 4TQ1A 1EO6A 3ZNID 4GDLA 5HKHA 3VOQA 4KSLC 1ZC4B 2N9PC 3PSCA 1WI0A 1U5GA 1V89A 1WZ0A 2FNJB 2YT1A 2DHKA 1WJUA 2D11A 2YRYA 3GOEA 5IA7A 2L3ZA 4W9HA 2CRFA 5BO4B 2K1FA 2KD0A 3A33B 4HXDA 5C79A 4MELA 3A8QA 3VTUA 4IWQA 4FHJA 1MG8A 2YS3A 1F9JA 2J0KA 3UGBB 2AYOB 4TKNA 3L17A 4W9IA 1P6SA 1IPGA 2MBBB 2RR9A 3VUYA 4IG7B 2D4QA 3EC8A 2WX0A 1MK9B 3QWMA 4MT7A 1P3QU 2JRHA 2K25A 2K39A 2N1VA 5KQ4A 2JXXA 2L8JA 2LVOA 2PPHA 3APFA 3P6AA 1R4NI 2REXA 3PV1A 1MAIA 1K8RB 2BYVE 2ZPNA 1OMWA 1X1MA 3D8EA 4K7SA 4NJ6A 2CU1A 1E8YA 4G3XB 1M94A 5D3VA 3DBSA 1VD2A 1BT0A 1YX6B 3M95A 3SYXA 2YSZA 3PHWB 3VXWA 4K17A 3H7PA 3JW0X 1I35A 4BBKA 3L10B 5HE2A 2UVMA 3A98B 2DZKA 4FULA 3B08A 4CYEA 2AL3A 2JT4B 3R3MA 1NTVA 3SV1A 3NOBA 4XX5A 5JZEB 2WDTB 4WAAA 4PS3A 4JGHB 1DDMA 1XT9B 2O6VB 4NAWA 4TQ0A 2DYNA 3VIAA 2HTHA 2OJRA 3PVWA 2MP2B 2N1WA 3PREA 3SU8X 3UQBA 1P9DU 1WE6A 3HQCA 5LONB 3K9OB 5JHHA 3MJWA 3QARA 3GYOA 1H4RA 4KHBB 3ULCA 3EECA 4GIVA 1LB1A 2V3SA 1V5OA 2IO1B 4EMOA 2L05A 3V5WA 1Q5WB 1FHXA 2NBWB 2LWPA 2JZ3B 1MPHA 1FGYA 4EJNA 5C6RA 1WXVA 2K8BA 1KJTA 2JWZA 4W9GA 3CF6E 3ENEA 3ZVRA 5D6JB 2EJ8A 3ALBA 4IFSA 2M17A 4DHZE 2GCJA 2RLOA 1P5TA 2GS0A 5J3YA 3RYTA 2LOXA 1UNQA 4HAYB 3NY5A 4MDKE 3H1UA 4DBBA 3PVUA 3VDZA 4EEWA 2KN5A 2I5FA 3TCAA 4F7HA 2C7HA 5DCNA 2YT0A 3VTWA 1UBIA 3RUIB 4TYZA 4F8CB 2P8VA 2J0JA 4DHJD 1NBFC 3GYPA 1TZ1A 3WYFB 1GG3A 4DDID 2JF5A 3U8ZA 5LXIB 1UPRA 4BFRA 2KNBA 1UBQA 1V86A 2LXCA 1I7AA 2N7DA 3HM6X 2NCNA 4MJSB 4PNKA 1KM7A 1E5WA 2MDXA 2GJYA 2KDEB 1PQSA 2CY4A 1KZGA 2LYDA 5DHFB 2KK8A 4N9F4 3PLVA 4ANWA 5KQ1A 2LUEA 3T8MA 3WAOA 3GZNI 3KYDD 4AP4C 2N0YA 3N3KB 4HB4B 1FHOA 1QQGA 5IAAC 3HM3A 3MPXA 2O2VB 2PE6B 4HAXB 4W9JA 1UPQA 3B1LX 1LXDA 1EAZA 2KJRA 3CMMB 3R7RA 1M7RA 4KDIC 3UINB 1BTKA 2D9YA 2KFKA 2KZRA 2RPQA 3WANA 4PQ0A 4B6WA 2KVRA 2IO2B 1FOEA 5KCVA 4WJQA 3D8DA 1P1AA 4GSWA 5JH5C 3P2BA
chains in the Genus database with same CATH superfamily
2V1YA 1LW3A 3CXBB 3UZTA 4K3BA 2AQ2B 3MP9A 4RF0A 2LJIA 4ARIA 1ZGUB 2V76A 4FADA 4DQOC 4RGNA 1WJ6A 2YVCA 3RFZB 3ODWA 1L2NA 3D32A 5EE0A 3SD5A 1QILA 1FMAD 3M62B 5FR6A 3NRZA 1ZYIA 4W9CA 1XLNA 5HG2A 2N7EA 2KX0A 2C7NB 4NAMA 3SFDB 1IBXB 2CJOA 4YSZB 1WJ1A 1VZ8A 2WU2B 3BK1A 3RT3B 2J42A 4LNOA 2ONQA 4KGSA 5C5BA 2MWNB 2JZZA 1F2RI 2MP2A 4MGYE 2LGXA 2PVGC 3DVGY 2J4XA 4L1BA 3V62A 1OFFA 4KGRA 3U7DA 2ELBA 2E2XA 5TSSA 2CKHB 3DPDA 1X1GA 2L1CA 3ZDTA 2D9ZA 4E71A 1TZOA 1H10A 3DHHC 2WX1A 2E6XA 2N0SB 4BBNC 2PZ1A 1T0RC 2N9KA 4HAZB 1ZSQA 1TS2A 3C8YA 3PP2A 1WE7A 2W3RA 3NZ3A 3VUXA 3TEYA 4MH8A 4MY6A 3VR9B 5IO9A 1V80A 2L00B 3BINA 5D3WA 4MGZE 5M4YB 2QJLA 3UIPB 2WWZA 3TO1A 3A9JB 3PTFC 4XC2A 2L0FA 1FIQA 2IO3B 2G4SA 4EKUA 3KWVA 1ZDVA 3B0AA 3DVNU 3ZRFA 4Z2NA 5BMHA 5J17A 5DPWA 1F0ZA 2COAA 5L81A 2LHDA 2MRPA 5BMGA 2IZVB 4A6KA 2FBWB 1RFAA 2O6VA 5FK9C 4OZAA 3QJZA 2FUHB 2W9NA 3A58A 1MKEA 2ROZB 2KLCA 1OQQA 1ISNA 2KYWA 4XDDA 5EE1A 3OHMB 3RN9C 2PE9A 4WWNA 4HB3B 3VR8B 5FR3A 3IT4B 1XLPA 2N9EB 5J3TA 2DENB 3BZDB 3DBRI 3IBEA 4ICUA 1AQCA 3PRPB 2WS3B 1V5TA 3W2DA 5C5BB 3S2AA 5EE9A 1E8XA 1QQRA 5AZHA 2D07B 5J18A 2NS5A 4XWTA 4II2B 3V60A 4GDLB 1U5FA 1KF6B 1LGRA 1AN8A 2NBVA 2K8CA 1RAXA 4GMXB 1I7HA 4B6HA 1L4DB 2GUMA 1Q0WB 2BS2B 1L5PA 3N1ZC 2BKRB 2M19A 3A4SC 2XEWA 2MA9B 2NPTA 1C4CA 1WGUA 1HTQA 2WXHA 4WJPA 2DN6A 2P0FA 4OT1A 5DPRA 3N7CA 2ZVNA 1JROA 2JYTA 1OQYA 4HK2A 4CQNA 2KMMA 2QCZA 3N20C 1FXIA 1EWYC 1OY2A 1T0YA 4W9LA 4HPPA 3AE9B 1C76A 4NJ7A 5HE0A 1GC7A 1DOYA 2BYEA 3H7SA 3JYUA 2K2UA 1WYWB 2WHIA 3NG0A 3SHQA 3H6NA 2HTHB 1WY8A 4NAWB 2GLSA 3ZUNA 1IBXA 4WQOB 3DVGX 4BKTA 2D3AA 2PW9A 3KUZA 3DBLB 1IGCA 5LOPB 2EC1A 1D6EC 1TBEA 1TY2A 4PK1A 1Z87A 1FGZA 1LM8B 1WXQA 3PT2B 5IA7A 2P0HA 1X86A 3HSAA 2H89B 2M14A 2JRIB 1RJ2A 1P0RA 1YIWA 2KN4A 3RI7C 3RNFC 1A5RA 1E8ZA 1L0XB 1E0ZA 4O1NA 4ITKA 2DAFA 2ICIA 4LDTD 4LDTB 1HQRD 3U52E 1QOAA 3O65B 4IW0A 3ZIMA 1K52A 1FPYA 2KCJA 2D9WA 3RZWC 1BXTA 1J8CA 1N5WA 3OG5A 3L16A 2M0AA 1UWXA 2KFKB 4NJCA 1GJZA 3A1QA 1FNWA 2FCMA 3WALA 4CHMA 4ZRQA 5AUKA 1WVHA 3L54A 1WXMA 1GPXA 5E6NA 2KQ7A 2N23A 1YN4A 2IDYA 1SJED 5LLIA 3SDLC 2KDMA 4GDKA 3PSEB 2KWUB 1V1PB 3MHSD 4HB2B 3RCZA 3DVNV 2INNE 3AU5A 3KSYA 1T77A 4L1RA 4HAUB 4FLHA 2ZVOA 2C9WB 5DPSA 1UNPA 4GNKB 2ZNVC 1WH3A 5BYQA 3E56A 2H88B 2PVOD 1UZXB 4F7UP 4A6FB 4ICVA 2N4FA 2DYBA 4CHJA 2VZKD 3BYYB 3APDA 4D0NB 1Y19B 3VH3B 2B76B 2ZCCA 4CHKA 4C7ZA 2IY1B 2W54A 2FIDA 2Q5WD 2Z0QA 3IHPC 2L2IA 4CSQA 1LO5D 4US8A 1SIFA 4KDLB 3DXDA 5MPOA 2M0XA 5JLJB 1MJDA 1CZPA 4W9EA 2KJ6A 2AL6A 1RRBA 3ZNZB 1JWAD 4RGOS 4YL8A 1WG7A 1DOIA 3UIOB 4BOSC 4IC7B 1T5XD 1J7CA 3K9PB 1ZPSA 5EFXA 3VH4B 2BWFA 5DPTA 1WGYA 4CO7A 1PFDA 2YEPF 2MWSB 2MBHA 1SHCA 1WX7A 4TQ1A 4S0RA 2FE8A 4KSLC 2N9PC 3DHIC 1WI0A 2YT1A 1WJUA 2K1FA 4HXDA 5C79A 3T3NA 3VTUA 4FHJA 1MG8A 1P7FA 4W9IA 3BYTB 2MBBB 4IG7B 2D4QA 3QWMA 1E10A 2K39A 2REXA 2BYVE 1K8RB 2KWDA 2KACA 3NVWA 5I2SA 1M94A 5D3VA 3DBSA 1VD2A 1JALA 2YSZA 1PDXA 4K17A 1F52A 3JW0X 1I35A 4BBKA 3FVCA 5HE2A 2UVMA 4FULA 1L0YB 2JT4B 1NTVA 3SV1A 3AE2B 4KKJA 4PS3A 1VLBA 1A70A 2IJ0A 4XE0A 2HTHA 2MP2B 3GS2A 1WE6A 2L83A 3GP7A 3QARA 5JHHA 4KHBB 1H4RA 1XO3A 3C19A 4N6EB 1LB1A 2IO1B 3B2FA 1WXVA 3HVDA 5D6JB 4DHZE 3TUOA 2RLOA 5J3YA 2LOXA 1UNQA 4HAYB 4MDKE 2BQQA 2I5FA 3TCAA 3VTWA 1NENB 3RUIB 4TYZA 1T0QC 4H2AA 3AB5A 3WYFB 3ZJUA 4HKZE 1GG3A 2J53A 3U8ZA 1UPRA 1UBQA 2LXCA 2NCNA 1KM7A 2MDXA 2CY4A 4GOUA 1KZGA 3GB1A 2LYDA 5DHFB 4N9F4 3PLVA 2LUEA 3T8MA 3MC8A 3AH7A 3WAOA 4AP4C 2N0YA 1QQGA 2K22A 2I2YA 2QDFA 3HM3A 2O2VB 4LTUA 4WIPA 1R7SA 4W9JA 3UINB 4F8CB 2KJRA 1M7RA 4KDIC 2KFKA 3N1YC 2IO2B 5KCVA 2QC8A 3R8BA 3DBLI 2CHWA 1YMHE 2LVQA 2SAKA 3QHTA 4WJOA 3DCGA 5JHGA 2KWCA 3EHVA 5H8YE 1C4AA 2QMTA 1UELA 4K7UA 3APCA 1XR0B 2KC1A 2NZ8B 1I4RA 4YSYB 4GXBA 3CSFA 4HWIB 3DBHB 5E6JA 2MEKA 2DHJA 1HE8A 4XZ4A 3ZLZA 3TEZA 2FAZA 3RMKC 1E8WA 4OZCA 1M7EA 4TUUA 1V1OA 4BKSD 1V97A 3QA8A 3OJ4B 3LDZE 2QHOA 3PPAA 1I42A 3NVYA 5DI9B 2IY0B 2GB1A 3UI3A 4HPLB 5LNK1 1SF0A 4GGQA 1B9RA 1XXGA 2N9LA 3I57A 4TV3A 3VRBB 2W55A 4C80A 2OHFA 4KHBA 4DHJB 4C7YA 3PHXB 2W2WA 3WAPA 1CMXB 4HB0B 4XWXA 4ZRJA 4YT0B 4M01A 5BMIA 1P7EA 3QC8B 2ZNVB 3ZNHB 5AUIA 3W5VB 1NDDA 2PMVA 2INDC 5C2TB 1Y8RC 2QILA 1FD6A 5KHQA 3CIRB 1L7YA 2KXJA 5C16A 1YJJA 2MLBA 1SIJA 2GI9A 1HA5A 3P63A 3KYCD 3L13A 3QX1A 4M0WB 2N9XA 2DFKA 1TXDA 4HVBA 3R2IA 4C4VA 1E7PB 4HATB 2EMTA 3L08A 4QJ3B 2L1AA 1X11A 1UEFA 5JHAA 4PS8A 2BYTA 5C3JB 3PG7A 3ONSA 4WH4A 3SNHA 4MEMA 3JVZX 2WLBA 2J0MA 4M8NA 1RYJA 2LHEA 1JWMD 4FHKA 3IAS1 1XKEA 3OAWA 3QWZB 1KLUD 2WDVB 4PS7A 4RH6A 3O96A 4ZHPA 1XLQA 3PZ7A 3U4EG 4C56C 5HFYA 1NU2A 3U30A 2LRWA 3ML8A 2IYDB 3HIEA 1BWNA 3AEDB 2KWVB 1UGMA 4B95A 5G2NA 2WGSA 2VZKB 2DBYA 2ZCBA 1K51A 1AWEA 1JMLA 1SGHA 1OEYJ 4NQLB 4DWFA 1C79A 2YT2A 2COFA 1IUEA 3X0WA 3Q6BA 4JWSC 2KDFB 1DYQA 3LJ3A 2GRIA 2HJ8A 1VCBA 1RWSA 3AJ4A 1EGXA 2XNAC 4EZLA 4AS1A 1T3QA 3TW1A 2MJ3A 4K81A 1N5XA 1FHWA 2I5CA 1FRDA 1TTNA 3VAWA 2XBBC 4F1SA 1JWSD 2C5LC 4YTNB 1EUVB 2PIAA 1MI0A 2KQSA 4XDCA 2RVBB 2DHZA 3RNCC 1XEEA 2EKEC 3ZTDA 3T3OA 3M1IB 4IOIE 1DOXA 2FCNA 5EE3A 1ZC3B 4GN1A 1WR1A 2HDEA 2DTCA 3H9DA 2UZRA 1RM6C 1JCKB 1C77A 1ZKHA 1E90A 1TS5A 1KLGD 3URYA 3PEGA 4A6FA 4HLEA 5L95C 2WQYB 2YS5A 5AZFA 4PYZA 4BKSA 2KDIA 5HE3A 2DA0A 3Q14C 4HCPB 3OLMD 1V88A 4QJ5B 3A9JA 3C0RB 3EA6A 2MBQA 3Q8FA 5GMVA 3MHZA 1WM2A 2IGDA 4KIKA 1ENFA 2M8SA 3ZGZA 1WF9A 4LCDE 2K6DB 1FNVA 4N58A 3ABVB 3DOWA 3P42A 5D27A 2J7QB 4BAXA 2L76A 4KGTA 1FO4A 4I6PA 4L6EA 1WJ4A 1WZ3A 2WNMA 4MT5A 2Z4DA 4GDKB 2ELAA 5G5GA 5JHBA 3TMPB 2FUG1 3BY4B 4K7WA 2BPSA 2UYZB 5CLLB 1PMSA 4BKGA 4W9KA 2AEHA 4TMAB 1GB4A 1P3RA 3JSVB 5D3IB 3AEEB 3ZTCA 1HEZE 4G0NB 3AXCA 1UGJA 4YONA 2Z0DB 4JL9A 2L7RA 3PGEA 4IM2A 4HSIA 2ZPYA 3KLSX 1FFVA 4GOCA 1MIZB 2NMBA 1WGDA 1WX9A 3OWEB 2I1JA 1B1ZA 1V81A 2MBOA 2MFQA 3DQVA 3EFCA 4J6IA 4EZJA 4A90A 1G6JA 1UD7A 2NMQA 1KOTA 3KRXA 4DBGA 3KQ4A 1TS4A 3I5JC 4FBJB 3QK0A 2AWTA 1R4NB 2P0DA 1KI1B 3AU4A 4ZRPA 4HJKA 1DBHA 4OVVA 2BCJA 2EMSA 1MHXA 2JYEA 1J0GA 4OSNA 1H8CA 3FSSA 1Z2MA 3FKYA 2CHZA 2BKFA 2J59M 2H7EA 1YQ3B 2LGDA 2WXFA 2JSVX 4YTMB 2W3SA 2M56B 1D3ZA 5BYRA 3KH0A 3OANA 3RZFA 1YX5B 4HPMB 4I6NB 5D3XA 4YSXB 4HKQA 2GBMA 4AWJA 1IYFA 2DX5B 3LB8C 3ZNGC 2LVPA 2FJLA 2MCNB 3VVWB 4A20A 5IRSA 2CAYA 2VH2A 2DZMA 4P1BC 1ZP0B 2BTEA 2OTXA 5T8IA 4R3DA 1NTYA 1WGHA 2R09A 3IG3A 2DKQA 4HJGE 2CY5A 4MH0E 1ZUD2 3PZDA 1D5ZC 3MDBC 2PKOA 2RSUA 2D3GA 1FNUA 3ZNID 3NWAA 3VOQA 2D5GA 1D4BA 1U5GA 2D11A 4W9HA 3NWDA 2KD0A 2I38A 3A33B 2NTTA 3A8QA 2V9HA 2YS3A 3EC8A 4QXAB 2JRHA 2K25A 5KQ4A 2JXXA 3APFA 3PV1A 1TKEA 3EUB2 1YX6B 2KR0A 2ACZB 3L10B 4DIXA 2BW2A 1NVID 3B08A 1YQ4B 1EM7A 2AL3A 3R3MA 1I4PA 3NOBA 1Q10A 2WDTB 2LMCA 1DDMA 4JGHB 2DYNA 3VIAA 2AX5A 2OJRA 1P9DU 3MJWA 3GYOA 2V3SA 1F2RC 2KT7A 2L05A 1FHXA 1MPHA 2K8BA 1KJTA 4YTPB 1QF6A 4W9GA 3N9YC 3ENEA 2EJ8A 3BVZA 4IFSA 2M17A 3RYTA 3NY5A 4FXCA 3VDZA 4LLGM 2KN5A 4M0WA 2P8VA 2J0JA 1NBFC 3GYPA 1NI3A 3AN1A 5D3DA 1TJEA 2JF5A 1SB3C 2KNBA 4RFBA 2N7DA 3MFGA 4C00A 1YNTE 4LNKA 2CU3A 3AE6B 4HB4B 3NUHB 1FHOA 2Z14A 5IAAC 1QOGA 4HAXB 3CMMB 4XGAB 2BT6A 4B6WA 2RPQA 2G1EA 3D8DA 1P1AA 3B9JA 3P2BA 2WXMA 1N3HA 3WIMA 1TYGB 5KHOA 1N60A 4WJNA 2K0PA 3NSUA 2YF0A 2RUKB 4HDOA 2Y5PA 1P98A 2LRUA 5H92C 2ADZA 2JP2A 1SBBB 4RF1A 1V6EA 4K2OA 3E9SA 3L0WB 1IRSA 1B55A 4URKA 4OZBA 4WJ7A 3MJ5A 1V5UA 3P7ZA 2LD9A 1V9JA 2XK5A 2KGXB 1RLFA 3PVLA 2JZPA 4DX90 2ASQA 5CHFA 3W9CB 2R0DA 1UH6A 2KUPA 2QEJC 1SSNA 4NQKE 2DZJA 3FM8C 2KO3A 4J3OD 3N32A 3QCAA 3I63C 2GBJA 5IP4D 2NBUA 3PLUA 4PT5A 2LULA 3EGRA 2ZEQA 4REZA 5D94A 1AARA 1V49A 3N1XC 2RD0A 1SEBD 1FCCC 3BWUD 4II3B 2DHIA 2KTFA 3F5RA 5I4DA 4DXFA 2H7DA 2KANA 2GBRA 2JX5A 2VH1A 1MVKA 2D3BA 4NNJB 1XX0A 2JXTA 1OGWA 2JQRB 3TL5A 2KOXA 1GC6A 1WX8A 3CIKA 2D9VA 4KSKC 3WAMA 4EFOA 2LGYA 2O6VD 2INPE 2K49A 2M1MA 5L83A 2ZW1A 1K5DB 2WDRB 3G9WA 2DNFA 3NZUA 3PO0A 4YXDB 1XODA 1GAQB 1DDVA 3MC0B 3QAQA 1Q67A 2JVCA 2AQ1B 2LEKA 5AEKB 2DYMA 4MSQB 2IGGA 3ZQ4A 4PYUA 3CSTA 2FCQA 5CLQB 4WWPA 3NVVA 1EU4A 3AE5B 4ARCA 2KJHB 3VFKA 3AEBB 3UF8A 1OEYA 4MM3A 1JW9D 1JWBD 3ZXVA 1E7UA 4ANUA 3ULBA 3IVFA 3AEFB 1C9FA 2TSSA 2CR5A 2Z0OA 1FXAA 3ML9A 2RNRB 1T6BX 4ZYSA 1S3SG 2Q13A 2KMCA 1BTNA 1TT5B 3EFUA 5CX3A 2KTRB 2ZW0A 3W1SC 3ZKJC 2DYOA 3Q8EA 3QQ8B 3AE8B 3O13A 1ROEA 2LJ5A 1DDWA 2L52A 1XCTL 1VRAB 3JSVA 2K9XA 2W2XD 3ODXA 2G9HD 2Z59A 4X57B 1XCQL 4B9KA 5JP4A 5D7GA 1FFUA 1V2YA 2DWQA 2NVUI 1MFWA 4MJSA 3AEAB 4KHOA 2XK5B 3BK2A 1Z5SB 1GUAB 1EF1A 3FILB 2HD5B 2Z0EB 2KC2A 5DH9B 4KIKB 3IAM1 1OQRA 3ZJTA 2CHXA 1EVHA 4ZRKA 1LQBA 2DX1A 2Y8FA 3DWMA 4NSWA 1FB8A 1N6ZA 1XQQA 2PLPA 2WXJA 1KLVA 2IO0B 3NHEB 1GNUA 4K2PA 4EOYA 1HZ5A 5E6PA 2LXAA 1YJIA 1W1GA 2BB6A 1WGQA 2AQ3B 1WI1A 4KX6B 5G55A 4P16A 2KIEA 1W1HA 3ZO5B 5LXHA 1C78A 5DIFB 4LK0M 2W2XC 2MKRA 1V5MA 4HAVB 2YLMA 1BAKA 3Q3OC 2BB5A 3MC9A 3NZSA 4MACA 4ZYNA 2DZIA 3HVZA 1WMHB 4IKGA 1K5GB 3GZNB 5C23A 2WXQA 1UF0A 1WM3A 2DKPA 3RNBC 1KTKA 2JY6A 4NZLB 3D8FA 4JPSA 2ON8A 3QBVB 5J2RA 2COCA 4C0AA 3AE7B 3A4RA 1STEA 2KQ4X 4OVUA 1AWDA 2D2QA 2M38A 2A4ZA 2ROVA 1FEHA 3V6CB 3T9LA 4MM3B 1R4MB 4HAWB 1SE4A 3BVGA 4LJPB 2Z59B 3VUWA 4HROA 4JQWC 4JWUC 4IOYX 1SE9A 1QC6A 1DGJA 1J0WA 1KRHA 1U5DA 2KDBA 2MJEA 3ZDMC 3Q3JA 4LNIA 2K3UA 2LGIA 1MHHE 4F7ZA 4RM9A 4WWMA 5E6OA 1QT9A 3KW5B 2LKOA 5FI1A 3VHTC 1CJEA 2LZ6A 3FAHA 4FJYA 3Q3NC 2LOZA 3DCXA 2HE7A 1IGDA 2LG1A 2Y8GA 1PFJA 3Q69A 2GBKA 2MHJA 4RMAA 4RGMA 4A6HA 2JU6X 2WXRA 1WRDB 4GPTB 4HHVA 2V4LA 1W1DA 1CK1A 1V61A 4OVZA 2D9XA 2QKLA 1PYWD 4A3OA 1WXAA 4KHAA 4NPNA 4F7GA 5GXGB 1I4HA 1XCGA 2RGNB 5D3YA 3HUIA 5EDSA 2JWUA 1TY0A 1U29A 1EF5A 1V1PA 2WXKA 4MK0A 1WGGA 4M8MA 3WCQA 2D10A 1PGXA 2KVZA 4DXAB 1DROA 3LXFA 4A5KA 5BYSA 4KZ0A 3TJPA 3BVMA 3IFWB 3P4SB 4DX8A 3X23A 2OOBB 2Z0PA 5CTRC 5GOWB 3P4PB 4G11A 4H8SA 2RMMA 2KLGA 4KV2A 2MSED 4HEA1 1UNSA 3V05A 2IYBA 5HKHA 2W82A 4GDLA 1ZC4B 1WZ0A 1V89A 2FNJB 3GOEA 2L3ZA 4GLSC 4C4VB 1VZ6A 2V3NA 1ACCA 2MJDA 1F9JA 2J0KA 1YN5A 1P6SA 1IPGA 2RR9A 3VUYA 3AV8A 1MK9B 1UUPA 2HJ1A 4MT7A 1P3QU 2WXLA 1BUIC 3P6AA 4HRSA 3FC4A 2ZPNA 1PUTA 1E8YA 4G3XB 4ZDVA 3PHWB 3M95A 3SYXA 3H7PA 3R2TA 4EE2A 2KIGA 2KUQA 4CYEA 4TQ0A 1XT9B 2O6VB 4NAWA 2BS3B 3UQBA 3PVWA 2N1WA 3PREA 1XF5L 4WURA 1I4GA 3HQCA 5LONB 1E6EB 4GIVA 1V5OA 3LYYA 3V5WA 1Q5WB 2NBWB 2LWPA 4LNFA 1FGYA 4EJNA 5C6RA 2JWZA 3CF6E 3ZVRA 1MPEA 2KAJA 3ALBA 3DHGC 2GCJA 2GS0A 3P4RB 1ET6A 4DBBA 3PVUA 1PGBA 4L2YA 4DHJD 1GB1A 4DDID 4BFRA 1V86A 4PNKA 2KDEB 1PQSA 4US9A 1ZOYB 4D2KA 3P4QB 2KK8A 4S17A 3AE4B 3KYDD 1JQ4A 3MPXA 1UPQA 3B1LX 1LXDA 1EAZA 2XN9C 3R7RA 1KFYB 2E3TA 2KZRA 4PQ0A 1FOEA 4WJQA 1N61A 4GSWA 1MG4A 2Z13A 2X18A 1WFYA 4GU2A 3AE1B 3I9V1 2UWQA 3PRZA 2K5PA 4IDIA 2KFJA 2D3CA 1ESFA 2LUMA 1PGAA 4QAYA 1FAOA 2QSDA 2RGFA 3NS8A 2KTRA 5IOIA 1LFDA 2Y3AA 4A8XC 5G5HA 4JIOU 1XD3B 2WP9B 2KHWB 4TSSA 3HK0A 1KZ7A 1ZW7A 2ZJDA 3SEBA 3DDCB 3SUZA 4ACFA 1J19A 3T06A 3PZ8A 3VQIA 1WYGA 1N62A 1SE2A 2JUOA 4RGTA 1YQBA 2BWES 4WAFA 2RDBC 4MSMB 1N63A 4W9DA 3A1QB 2UZSA 2DX5A 3N30A 2K8EA 4E3CA 2QKMA 2PJHA 4JE3B 4KVGB 4DK5A 2WU5B 3U2SC 2BYFA 2NPTB 4HDQA 3VTVA 1D5MC 1C1YB 1PLSA 5J3QA 3BJIA 2BVCA 2XQNM 4FJZA 1R4MI 3SO6A 1TKYA 1ZM0A 1UNRA 2I1KA 2SEBD 2MBEA 3ML4A 4Z2MB 2KMAA 2KX3A 5IKCM 3KWLA 2K8HA 3FEHA 5FI0A 3Q8AA 1WJMA 2G35A 4ANXA 1V5PA 1I4XA 5D2MB 5TR5A 2V3PA 2PEAA 1C4PA 1L0VB 2MQJA 1KH0A 5HI1A 1ZDXA 2R61A 5C1ZA 3U12A 4IUMB 2QIEB 3R66C 1ET9A 4IM0A 1TIFA 4B0EA 1NYRA 4FA6A 1RFKA 3M3JA 4K1RB 3ZVVA 3ECIA 1AW7A 2G4DB 4RCOA 4W9FA 2V0GA 4L23A 1V8CA 1TJ6A 1FXTB 1WJNA 4IM3A 3Q3MC 1Y5OA 3LJUX 4BZAA 4DDGD 3RNGC 2PTLA 4KKIA 1WIAA 4XWWA 3TSSA 4BVUC 1TS3A 3BIID 1WMHA 2GBNA 2L0TA 3W5UB 1TGZB 1JRUA 1ZE3D 4E74A 1L6UA 4Y94A 4JLCA 3GE8C 1CQVA 3UQAA 3MTNB 3ZW3A 2FJUB 1GOZA 1U27A 4YWGG 1WRIA 2GCLA 2BBCA 4MGKE 5AZGA 1YN3A 1VDVA 1WSPA 3KUDB 3GE3C 2G3QB 1DYNA 1OTRB 2BS4B 3TBLD 4KZCA 2WYQA 3ODOA 4LNNA 2VRRB 4IAPA 1FRRA 3SR6A 4AUQC 2C7MB 1MI1A 1F77A 4WQMA 4ZOHC 2ZZPB 4AOFA 2CODA 4P6VF 1QKZA 3F0WA 2KKCA 3V61A 3Q8CA 4M00A 3A9KB 5CHWA 4NY0A 4BBNF 4K3CA 2O2VA 4LJOB 4IWOA 1J7AA 3J9CA 3PRMB 3Q8BA 4I6LB 2G45B 3KVFB 4HCNB 3TEWA 2EELA 1OQNA 1FCLA 1AYFA 3A8PA 1MIXA 2RSGA 1NI2A 2NBVB 3RD2A 4P1CC 4BOZB 4MGIE 1C3TA 1YJ1A 2VRWB 2BF8B 1JRPA 3HW2B 2ZKMX 1QOFA 2JPHA 4GB9A 1JWUD 1K50A 1MK7B 1I4QA 3TFMA 2R2OA 3QIJA 2BGFA 3ZRCA 4FJVB 4UDUC 2R2QA 2YS1A 5I2MA 1L6VA 4ZRIA 2RRFA 1I2HA 2IGHA 2MW5A 3A9KA 4Q2JA 3V6EB 1NYQA 5DHAB 2IBIB 5LG4B 4IWPA 4USAA 1ZXIA 2MX2A 2OJWA 4DXGA 4WWOA 1X05A 1QZEA 5HE1A 2DLWA 2IPKD 2WXGA 2K00A 3W1SA 1L4ZB 1E7VA 2K2JA 5CHVC 1YOVB 4WVFB 1K53A 1WR6E 2R2YA 1WGRA 2DYQA 2C60A 3OJ3A 1J7BA 3U7ZA 4ZHOA 4AJYB 3NWFA 2K6QA 1XD4A 4RM8A 2WXOA 3DXCA 2EKIA 2NTSA 3DBRB 1U5EA 2X38A 3RULA 2OQBA 2INCC 1ZVRA 1TQZA 2MH7A 2A5UA 2CS4A 2Y5BB 2NR2A 3DXEA 3HIZA 1SE3A 3RPFC 4EZKA 3KUCB 3P1MA 2GMIC 3CWIA 2VKIA 1D5XC 4ASWC 4G50A 2DAJA 2FCSA 2YEPB 2Y7BA 4M02A 4KAXB 2LI5A 4P7IA 2FIFA 4WSFA 1XLOA 4GMVA 3KRWA 4QJ4B 3SFEB 1Q1OA 3ZYYX 1RRPB 2B3AA 1VR9A 1U2BA 4DHZB 3KY9A 1X1FA 3ZJVA 3WA0A 4A9AA 2WXPA 1WXSA 2LASA 1HZ6A 3KZ1A 3AULA 3Q3FA 3DBHI 3R7QA 4RNAA 3HHMA 3ETRA 3IXSA 3M63B 2J52A 2HTME 2WXIA 3PS6A 4N59A 1QLBB 2N7JA 1SXTA 3AI5A 2VSZA 3AECB 3TIXA 3VRAB 3W1YA 4A3PA 3B2GA 2RPVA 3TVVA 4EUTA 4FN2A 1E9MA 1S1QB 4B0MA 3RCPA 2LGSA 3Q2AC 3I3TB 1YD8U 1ZXHA 2GOWA 2Z8LA 4ANVA 3H7PB 4GZUA 2M4NA 2IFSA 1U4AA 5IN7A 1EO6A 2RDHA 2L32A 1FM0D 3PSCA 2DHKA 2YRYA 3HRDD 2CRFA 1QOBA 5BO4B 3B77A 2X8XX 1EWCA 1HTOA 4MELA 4XYCA 1EU3A 4IWQA 1NEKB 2UU7A 3UGBB 2RDGA 2AYOB 4TKNA 2OEDA 3NJTA 4OHJA 3L17A 2WX0A 3AMZA 2WDQB 2N1VA 3IT6B 2L8JA 2LVOA 2PPHA 2V4IB 1R4NI 3V3XA 1MAIA 1OMWA 1X1MA 3D8EA 4K7SA 4NJ6A 2CU1A 4A6QA 4AJWA 1BT0A 3VXWA 2DLBA 4A55A 3DWGC 2LFIA 2Y5CA 3A98B 2DZKA 1VJKA 1WWTA 4XX5A 5JZEB 4WAAA 1F1HA 5JXVA 3TEXA 5FKAC 3NVZA 3SU8X 3AEGB 2CJNA 3K9OB 1UWMA 3ULCA 3EECA 4EMOA 3AM9A 2JZ3B 1SJHD 1Y56A 3RNAC 1BMLC 1T0SC 1P5TA 1VZ7A 3L4PA 4EEWA 3H1UA 4F7HA 2C7HA 1TKGA 5DCNA 2YT0A 1IP9A 1UBIA 1TZ1A 3H8HA 3NS1A 5LXIB 3HM6X 1I7AA 4MJSB 2WXNA 1E5WA 2GJYA 4ANWA 5KQ1A 4JX1C 3FILA 3GZNI 3N3KB 3NW8A 1WGKA 2PE6B 5HHDG 1M4VA 3WANA 3AE3B 4D6WA 1BTKA 2D9YA 4AQ7A 3RNEC 2KVRA 5JH5C 3ZXRA 4OW0A 1HXYD
chains in the Genus database with same CATH topology
2V1YA 1N3HA 3DBLI 1LW3A 3CXBB 3WIMA 3UZTA 2X18A 1WFYA 5KHOA 4GU2A 2CHWA 2LVQA 3QHTA 1ZGUB 4WJNA 2UWQA 2V76A 4WJOA 3PRZA 3DCGA 4FADA 5JHGA 2KWCA 3EHVA 3NSUA 2YF0A 1WJ6A 2RUKB 2YVCA 2KFJA 4HDOA 1P98A 1UELA 2LRUA 4K7UA 3APCA 2ADZA 1FAOA 3ODWA 1XR0B 2RGFA 3NS8A 2KTRA 2JP2A 1L2NA 2KC1A 1LFDA 3D32A 2NZ8B 1V6EA 3SD5A 4GXBA 4K2OA 3L0WB 1IRSA 3CSFA 4HWIB 4JIOU 3M62B 5FR6A 1B55A 1XD3B 2KHWB 2DHJA 4W9CA 4URKA 3HK0A 1KZ7A 1HE8A 4WJ7A 1ZW7A 2N7EA 2FAZA 3SUZA 2C7NB 1J19A 1V5UA 3P7ZA 2KX0A 3DDCB 3T06A 1E8WA 2LD9A 1V9JA 2XK5A 2KGXB 1RLFA 3PVLA 3VQIA 1M7EA 4DX90 4TUUA 2ASQA 5CHFA 4BKSD 3QA8A 1I42A 3OJ4B 2R0DA 3LDZE 1UH6A 1WJ1A 2KUPA 2QHOA 2JUOA 3PPAA 2DZJA 3FM8C 5DI9B 2KO3A 2IY0B 4NQKE 3N32A 3QCAA 3ZLZA 3RT3B 4HPLB 4GGQA 5C5BA 1YQBA 2BWES 2MWNB 2JZZA 2MP2A 2GBJA 2LGXA 4MSMB 4MGYE 4W9DA 3A1QB 4TV3A 2UZSA 2DX5A 2NBUA 3DVGY 3N30A 3PLUA 4E3CA 2QKMA 2PJHA 3V62A 4KVGB 2LULA 3U7DA 4DHJB 2ZEQA 5D94A 4DK5A 2BYFA 1AARA 2ELBA 2E2XA 2W2WA 1V49A 2CKHB 2NPTB 1CMXB 4HDQA 3WAPA 3VTVA 2RD0A 4HB0B 4XWXA 4ZRJA 1C1YB 3DPDA 1X1GA 1PLSA 5J3QA 4II3B 2L1CA 3ZDTA 2D9ZA 4E71A 3BJIA 3QC8B 2DHIA 2ZNVB 2KTFA 3F5RA 1H10A 2XQNM 4FJZA 2H7DA 3ZNHB 1R4MI 3SO6A 2GBRA 2KANA 2WX1A 1ZM0A 1NDDA 4AJWA 4BBNC 1Y8RC 2PZ1A 1UNRA 1XX0A 4NNJB 2I1KA 4HAZB 1OGWA 2MBEA 3TL5A 3ML4A 2KOXA 1GC6A 1ZSQA 3PP2A 5KHQA 4Z2MB 2KMAA 1WX8A 1L7YA 3CIKA 1WE7A 2KX3A 5C16A 2K8HA 2KXJA 3VUXA 2D9VA 4KSKC 3WAMA 4EFOA 2LGYA 2MLBA 2O6VD 3FEHA 2M1MA 4MY6A 5FI0A 3KYCD 5L83A 1WJMA 1K5DB 1V80A 2G35A 2L00B 3L13A 3QX1A 4ANXA 1V5PA 3BINA 5D3WA 3G9WA 4M0WB 4MGZE 5D2MB 2N9XA 2DFKA 3NZUA 1TXDA 3UIPB 2WWZA 3TO1A 3A9JB 5TR5A 4HVBA 2PEAA 1XODA 3PTFC 4XC2A 1DDVA 4HATB 2MQJA 2L0FA 2IO3B 2G4SA 2EMTA 4EKUA 3L08A 3QAQA 5C1ZA 1Q67A 3B0AA 3DVNU 4IUMB 3ZRFA 2JVCA 4Z2NA 5AEKB 1X11A 3R66C 2DYMA 5J17A 1UEFA 4MSQB 4IM0A 4PYUA 5JHAA 5DPWA 3CSTA 4ANVA 2FCQA 4FA6A 4PS8A 2COAA 5CLQB 5L81A 3M3JA 4K1RB 4WWPA 3PG7A 3ONSA 2MRPA 3SNHA 3ECIA 2KJHB 2G4DB 2IZVB 3JVZX 4MEMA 4A6KA 2J0MA 1RFAA 2O6VA 1WJNA 1TJ6A 1FXTB 4IM3A 4M8NA 3UF8A 3VFKA 1OEYA 3QJZA 4MM3A 4FHKA 1Y5OA 1XKEA 3LJUX 3OAWA 3QWZB 4DDGD 2FUHB 1WIAA 2W9NA 1E7UA 4ANUA 3ULBA 4PS7A 3IVFA 4BVUC 3O96A 1WMHA 2GBNA 1MKEA 2L0TA 2ROZB 1TGZB 2KLCA 2ZJDA 1ISNA 1JRUA 4E74A 2CR5A 2Z0OA 1NU2A 3ML9A 3U30A 4Y94A 2RNRB 4JLCA 2LRWA 3ML8A 2IYDB 3UQAA 1S3SG 2PE9A 3MTNB 1BWNA 2Q13A 4WWNA 3ZW3A 4HB3B 2KWVB 1UGMA 2KMCA 4B95A 5G2NA 1U27A 2N9EB 2ZCBA 1BTNA 2GCLA 5J3TA 3EFUA 4MGKE 2DENB 3DBRI 5CX3A 2KTRB 1AWEA 5AZGA 1OEYJ 1SGHA 3W1SC 2DYOA 3IBEA 4ICUA 4NQLB 3ZKJC 4DWFA 3QQ8B 3KUDB 2G3QB 2LJ5A 1DDWA 1DYNA 2COFA 1OTRB 3TBLD 1AQCA 3PRPB 3X0WA 1V5TA 5C5BB 3S2AA 4KZCA 3JSVA 2WYQA 3ODOA 2W2XD 4XZ4A 1E8XA 2KDFB 3ODXA 2VRRB 4IAPA 3LJ3A 2D07B 4X57B 2NS5A 5AZHA 5J18A 2HJ8A 4II2B 3V60A 4AUQC 1VCBA 2C7MB 4GDLB 4B9KA 1U5FA 5JP4A 5D7GA 3AJ4A 1V2YA 2ZZPB 2K8CA 4AOFA 1EGXA 1RAXA 2NVUI 4GMXB 4EZLA 4B6HA 4MJSA 1Q0WB 3TW1A 4K81A 4KHOA 2BKRB 1Z5SB 2CODA 1GUAB 2XK5B 1FHWA 1EF1A 2I5CA 3F0WA 2KKCA 2XEWA 3A4SC 3V61A 2MA9B 1TTNA 3VAWA 2HD5B 2XBBC 3A9KB 5CHWA 4F1SA 3PHXB 2C5LC 2NPTA 1EUVB 4NY0A 4BBNF 4F7ZA 2O2VA 1WGUA 4LJOB 2KQSA 2Z0EB 2RVBB 2DHZA 4WJPA 2KC2A 2DN6A 4IWOA 2P0FA 2EKEC 5DH9B 4KIKB 5DPRA 3N7CA 3M1IB 2ZVNA 3ZTDA 1OQYA 3PRMB 4HK2A 4I6LB 2G45B 2CHXA 2FCNA 3KVFB 4HCNB 1EVHA 4ZRKA 1LQBA 1ZC3B 1OQNA 2DX1A 1OY2A 1T0YA 4GN1A 2Y8FA 4W9LA 3A8PA 1WR1A 4NSWA 1FB8A 1XQQA 1KLVA 2DTCA 3H9DA 1MIXA 2IO0B 4NJ7A 2RSGA 5HE0A 1GC7A 2UZRA 2BYEA 3H7SA 3JYUA 2K2UA 1WYWB 1NI2A 3NHEB 1GNUA 4K2PA 2NBVB 3SHQA 4EOYA 1ZKHA 1E90A 3H6NA 2HTHB 1WY8A 3RD2A 5L95C 3PEGA 4A6FA 4NAWB 4BOZB 5E6PA 4MGIE 2LXAA 3ZUNA 1YJ1A 2YS5A 4WQOB 5AZFA 3DVGX 4BKTA 2VRWB 4PYZA 2BF8B 3HW2B 4BKSA 2KDIA 1W1GA 5HE3A 3KUZA 3ZVVA 2DA0A 2JPHA 1WGQA 4GB9A 5LOPB 2EC1A 1MK7B 1WI1A 3OLMD 4HCPB 1V88A 1W1HA 5G55A 3ZO5B 5LXHA 3TFMA 1TBEA 3QIJA 2R2OA 3A9JA 5DIFB 2BGFA 3C0RB 3ZRCA 1Z87A 2W2XC 1FGZA 2MKRA 1LM8B 4HAVB 1V5MA 2MBQA 2YLMA 3PT2B 4FJVB 5GMVA 2P0HA 1BAKA 2R2QA 1WM2A 1X86A 2YS1A 4KIKA 2M8SA 1WF9A 1IP9A 3NZSA 4ZYNA 4ZRIA 2M14A 2DZIA 2JRIB 4LCDE 2K6DB 1WMHB 4ZDVA 1I2HA 1K5GB 1RJ2A 2MW5A 5C23A 1P0RA 1YIWA 3A9KA 3V6EB 1WM3A 3DOWA 2DKPA 2IBIB 5D27A 5DHAB 2J7QB 4IWPA 1A5RA 1E8ZA 2MX2A 2L76A 2DAFA 2JY6A 3D8FA 4I6PA 4WWOA 4LDTD 4LDTB 3QBVB 1X05A 4L6EA 1QZEA 1WJ4A 5HE1A 1WZ3A 5J2RA 2DLWA 4GDKB 3O65B 3ZIMA 4IW0A 2K00A 2COCA 4C0AA 2ELAA 3W1SA 2KCJA 1E7VA 5JHBA 2D9WA 2K2JA 5CHVC 3A4RA 3RZWC 3TMPB 3BY4B 1KOTA 4K7WA 4OVUA 4WVFB 1WR6E 2BPSA 1J8CA 2D2QA 2UYZB 5CLLB 1WGRA 1PMSA 2DYQA 2C60A 4W9KA 3OJ3A 2M38A 2AEHA 2A4ZA 4BKGA 3L16A 2ROVA 2KFKB 3V6CB 4AJYB 1P3RA 2K6QA 3JSVB 3T9LA 1GJZA 1XD4A 3A1QA 4RM8A 3DXCA 4HAWB 2FCMA 4LJPB 3WALA 4CHMA 1U5EA 3RULA 2Z59B 2OQBA 3VUWA 3ZTCA 1ZVRA 4JQWC 1TQZA 4IOYX 1SE9A 2A5UA 2CS4A 2Y5BB 3AXCA 4G0NB 1QC6A 1WVHA 4YONA 2NR2A 1J0WA 2Z0DB 3L54A 4JL9A 2L7RA 3PGEA 4IM2A 3DXEA 1WXMA 1U5DA 2KDBA 2ZPYA 3HIZA 4W9FA 5E6NA 3ZDMC 4GOCA 2KQ7A 2N23A 1MIZB 2NMBA 4EZKA 1WGDA 1WX9A 3Q3JA 5LLIA 3SDLC 3KUCB 1C3TA 2I1JA 2GMIC 2VKIA 4ASWC 1V81A 2MBOA 2MFQA 3DQVA 3PSEB 2DAJA 4G50A 2FCSA 2KWUB 2Y7BA 4GDKA 4J6IA 4RM9A 5E6OA 4EZJA 3KW5B 4KAXB 2LI5A 2LKOA 5FI1A 3MHSD 1G6JA 4P7IA 4HB2B 1UD7A 2FIFA 4WSFA 3VHTC 3KRXA 4GMVA 2LZ6A 4DBGA 3RCZA 3KRWA 4FJYA 3DVNV 2LOZA 2HE7A 1Q1OA 2LG1A 4FBJB 2Y8GA 1PFJA 1RRPB 3QK0A 2B3AA 2GBKA 2AWTA 3AU5A 1U2BA 3KSYA 4RMAA 4DHZB 2P0DA 4HAUB 1KI1B 3AU4A 3KY9A 1X1FA 4A6HA 3WA0A 4FLHA 4HLEA 2ZVOA 4HJKA 2C9WB 1WRDB 5DPSA 1WXSA 1DBHA 1UNPA 2LASA 4OVVA 2BCJA 2EMSA 4GPTB 4HHVA 2ZNVC 3KZ1A 3AULA 1WH3A 3Q3FA 2V4LA 1W1DA 1J0GA 1V61A 3DBHI 3FSSA 3R7QA 1Z2MA 2D9XA 2QKLA 1H8CA 1UZXB 3HHMA 4A3OA 4F7UP 3M63B 1WXAA 4KHAA 4A6FB 2BKFA 4F7GA 2J59M 2CHZA 2H7EA 4NPNA 3PS6A 1XCGA 2LGDA 4ICVA 2N4FA 2RGNB 5D3YA 2DYBA 4CHJA 5EDSA 3APDA 3AI5A 2VSZA 3KH0A 1D3ZA 1U29A 3OANA 4D0NB 1EF5A 1Y19B 1YX5B 4HPMB 3RZFA 3VH3B 2ZCCA 4CHKA 4MK0A 1WGGA 4I6NB 4M8MA 3TIXA 3W1YA 4A3PA 5D3XA 2D10A 2IY1B 3IHPC 2FIDA 2Z0QA 3TVVA 2L2IA 2GBMA 4FN2A 4EUTA 4DXAB 1DROA 1SIFA 4KDLB 3DXDA 4AWJA 2DX5B 2M0XA 1IYFA 4A5KA 1S1QB 3ZNGC 5JLJB 2LVPA 4W9EA 2FJLA 3RCPA 2AL6A 1RRBA 2KJ6A 4KZ0A 2MCNB 3TJPA 3VVWB 3ZNZB 4A20A 2CAYA 4YL8A 3IFWB 1WG7A 2DZMA 3I3TB 1YD8U 4DX8A 3X23A 2OTXA 3UIOB 4IC7B 4BOSC 1NTYA 1WGHA 2R09A 2GOWA 2OOBB 3IG3A 2Z0PA 5CTRC 3K9PB 2DKQA 5GOWB 4G11A 4H8SA 5EFXA 3VH4B 2BWFA 5DPTA 2KLGA 4KV2A 2MSED 1WGYA 2CY5A 4MH0E 3H7PB 4CO7A 4GZUA 2M4NA 2IYBA 3PZDA 2MBHA 2IFSA 3MDBC 2MWSB 2RSUA 1SHCA 1U4AA 1WX7A 2D3GA 4TQ1A 1EO6A 3ZNID 4GDLA 5HKHA 3VOQA 4KSLC 1ZC4B 2N9PC 3PSCA 1WI0A 1U5GA 1V89A 1WZ0A 2FNJB 2YT1A 2DHKA 1WJUA 2D11A 2YRYA 3GOEA 5IA7A 2L3ZA 4W9HA 2CRFA 5BO4B 2K1FA 2KD0A 3A33B 4HXDA 5C79A 4MELA 3A8QA 3VTUA 4IWQA 4FHJA 1MG8A 2YS3A 1F9JA 2J0KA 3UGBB 2AYOB 4TKNA 3L17A 4W9IA 1P6SA 1IPGA 2MBBB 2RR9A 3VUYA 4IG7B 2D4QA 3EC8A 2WX0A 1MK9B 3QWMA 4MT7A 1P3QU 2JRHA 2K25A 2K39A 2N1VA 5KQ4A 2JXXA 2L8JA 2LVOA 2PPHA 3APFA 3P6AA 1R4NI 2REXA 3PV1A 1MAIA 1K8RB 2BYVE 2ZPNA 1OMWA 1X1MA 3D8EA 4K7SA 4NJ6A 2CU1A 1E8YA 4G3XB 1M94A 5D3VA 3DBSA 1VD2A 1BT0A 1YX6B 3M95A 3SYXA 2YSZA 3PHWB 3VXWA 4K17A 3H7PA 3JW0X 1I35A 4BBKA 3L10B 5HE2A 2UVMA 3A98B 2DZKA 4FULA 3B08A 4CYEA 2AL3A 2JT4B 3R3MA 1NTVA 3SV1A 3NOBA 4XX5A 5JZEB 2WDTB 4WAAA 4PS3A 4JGHB 1DDMA 1XT9B 2O6VB 4NAWA 4TQ0A 2DYNA 3VIAA 2HTHA 2OJRA 3PVWA 2MP2B 2N1WA 3PREA 3SU8X 3UQBA 1P9DU 1WE6A 3HQCA 5LONB 3K9OB 5JHHA 3MJWA 3QARA 3GYOA 1H4RA 4KHBB 3ULCA 3EECA 4GIVA 1LB1A 2V3SA 1V5OA 2IO1B 4EMOA 2L05A 3V5WA 1Q5WB 1FHXA 2NBWB 2LWPA 2JZ3B 1MPHA 1FGYA 4EJNA 5C6RA 1WXVA 2K8BA 1KJTA 2JWZA 4W9GA 3CF6E 3ENEA 3ZVRA 5D6JB 2EJ8A 3ALBA 4IFSA 2M17A 4DHZE 2GCJA 2RLOA 1P5TA 2GS0A 5J3YA 3RYTA 2LOXA 1UNQA 4HAYB 3NY5A 4MDKE 3H1UA 4DBBA 3PVUA 3VDZA 4EEWA 2KN5A 2I5FA 3TCAA 4F7HA 2C7HA 5DCNA 2YT0A 3VTWA 1UBIA 3RUIB 4TYZA 4F8CB 2P8VA 2J0JA 4DHJD 1NBFC 3GYPA 1TZ1A 3WYFB 1GG3A 4DDID 2JF5A 3U8ZA 5LXIB 1UPRA 4BFRA 2KNBA 1UBQA 1V86A 2LXCA 1I7AA 2N7DA 3HM6X 2NCNA 4MJSB 4PNKA 1KM7A 1E5WA 2MDXA 2GJYA 2KDEB 1PQSA 2CY4A 1KZGA 2LYDA 5DHFB 2KK8A 4N9F4 3PLVA 4ANWA 5KQ1A 2LUEA 3T8MA 3WAOA 3GZNI 3KYDD 4AP4C 2N0YA 3N3KB 4HB4B 1FHOA 1QQGA 5IAAC 3HM3A 3MPXA 2O2VB 2PE6B 4HAXB 4W9JA 1UPQA 3B1LX 1LXDA 1EAZA 2KJRA 3CMMB 3R7RA 1M7RA 4KDIC 3UINB 1BTKA 2D9YA 2KFKA 2KZRA 2RPQA 3WANA 4PQ0A 4B6WA 2KVRA 2IO2B 1FOEA 5KCVA 4WJQA 3D8DA 1P1AA 4GSWA 5JH5C 3P2BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2V1Y A;  1N3H A;  3DBL I;  1LW3 A;  3CXB B;  3WIM A;  3UZT A;  2X18 A;  1WFY A;  5KHO A;  4GU2 A;  2CHW A;  2LVQ A;  3QHT A;  1ZGU B;  4WJN A;  2UWQ A;  2V76 A;  4WJO A;  3PRZ A;  3DCG A;  4FAD A;  5JHG A;  2KWC A;  3EHV A;  3NSU A;  2YF0 A;  1WJ6 A;  2RUK B;  2YVC A;  2KFJ A;  4HDO A;  1P98 A;  1UEL A;  2LRU A;  4K7U A;  3APC A;  2ADZ A;  1FAO A;  3ODW A;  1XR0 B;  2RGF A;  3NS8 A;  2KTR A;  2JP2 A;  1L2N A;  2KC1 A;  1LFD A;  3D32 A;  2NZ8 B;  1V6E A;  3SD5 A;  4GXB A;  4K2O A;  3L0W B;  1IRS A;  3CSF A;  4HWI B;  4JIO U;  3M62 B;  5FR6 A;  1B55 A;  1XD3 B;  2KHW B;  2DHJ A;  4W9C A;  4URK A;  3HK0 A;  1KZ7 A;  1HE8 A;  4WJ7 A;  1ZW7 A;  2N7E A;  2FAZ A;  3SUZ A;  2C7N B;  1J19 A;  1V5U A;  3P7Z A;  2KX0 A;  3DDC B;  3T06 A;  1E8W A;  2LD9 A;  1V9J A;  2XK5 A;  2KGX B;  1RLF A;  3PVL A;  3VQI A;  1M7E A;  4DX9 0;  4TUU A;  2ASQ A;  5CHF A;  4BKS D;  3QA8 A;  1I42 A;  3OJ4 B;  2R0D A;  3LDZ E;  1UH6 A;  1WJ1 A;  2KUP A;  2QHO A;  2JUO A;  3PPA A;  2DZJ A;  3FM8 C;  5DI9 B;  2KO3 A;  2IY0 B;  4NQK E;  3N32 A;  3QCA A;  3ZLZ A;  3RT3 B;  4HPL B;  4GGQ A;  5C5B A;  1YQB A;  2BWE S;  2MWN B;  2JZZ A;  2MP2 A;  2GBJ A;  2LGX A;  4MSM B;  4MGY E;  4W9D A;  3A1Q B;  4TV3 A;  2UZS A;  2DX5 A;  2NBU A;  3DVG Y;  3N30 A;  3PLU A;  4E3C A;  2QKM A;  2PJH A;  3V62 A;  4KVG B;  2LUL A;  3U7D A;  4DHJ B;  2ZEQ A;  5D94 A;  4DK5 A;  2BYF A;  1AAR A;  2ELB A;  2E2X A;  2W2W A;  1V49 A;  2CKH B;  2NPT B;  1CMX B;  4HDQ A;  3WAP A;  3VTV A;  2RD0 A;  4HB0 B;  4XWX A;  4ZRJ A;  1C1Y B;  3DPD A;  1X1G A;  1PLS A;  5J3Q A;  4II3 B;  2L1C A;  3ZDT A;  2D9Z A;  4E71 A;  3BJI A;  3QC8 B;  2DHI A;  2ZNV B;  2KTF A;  3F5R A;  1H10 A;  2XQN M;  4FJZ A;  2H7D A;  3ZNH B;  1R4M I;  3SO6 A;  2GBR A;  2KAN A;  2WX1 A;  1ZM0 A;  1NDD A;  4AJW A;  4BBN C;  1Y8R C;  2PZ1 A;  1UNR A;  1XX0 A;  4NNJ B;  2I1K A;  4HAZ B;  1OGW A;  2MBE A;  3TL5 A;  3ML4 A;  2KOX A;  1GC6 A;  1ZSQ A;  3PP2 A;  5KHQ A;  4Z2M B;  2KMA A;  1WX8 A;  1L7Y A;  3CIK A;  1WE7 A;  2KX3 A;  5C16 A;  2K8H A;  2KXJ A;  3VUX A;  2D9V A;  4KSK C;  3WAM A;  4EFO A;  2LGY A;  2MLB A;  2O6V D;  3FEH A;  2M1M A;  4MY6 A;  5FI0 A;  3KYC D;  5L83 A;  1WJM A;  1K5D B;  1V80 A;  2G35 A;  2L00 B;  3L13 A;  3QX1 A;  4ANX A;  1V5P A;  3BIN A;  5D3W A;  3G9W A;  4M0W B;  4MGZ E;  5D2M B;  2N9X A;  2DFK A;  3NZU A;  1TXD A;  3UIP B;  2WWZ A;  3TO1 A;  3A9J B;  5TR5 A;  4HVB A;  2PEA A;  1XOD A;  3PTF C;  4XC2 A;  1DDV A;  4HAT B;  2MQJ A;  2L0F A;  2IO3 B;  2G4S A;  2EMT A;  4EKU A;  3L08 A;  3QAQ A;  5C1Z A;  1Q67 A;  3B0A A;  3DVN U;  4IUM B;  3ZRF A;  2JVC A;  4Z2N A;  5AEK B;  1X11 A;  3R66 C;  2DYM A;  5J17 A;  1UEF A;  4MSQ B;  4IM0 A;  4PYU A;  5JHA A;  5DPW A;  3CST A;  4ANV A;  2FCQ A;  4FA6 A;  4PS8 A;  2COA A;  5CLQ B;  5L81 A;  3M3J A;  4K1R B;  4WWP A;  3PG7 A;  3ONS A;  2MRP A;  3SNH A;  3ECI A;  2KJH B;  2G4D B;  2IZV B;  3JVZ X;  4MEM A;  4A6K A;  2J0M A;  1RFA A;  2O6V A;  1WJN A;  1TJ6 A;  1FXT B;  4IM3 A;  4M8N A;  3UF8 A;  3VFK A;  1OEY A;  3QJZ A;  4MM3 A;  4FHK A;  1Y5O A;  1XKE A;  3LJU X;  3OAW A;  3QWZ B;  4DDG D;  2FUH B;  1WIA A;  2W9N A;  1E7U A;  4ANU A;  3ULB A;  4PS7 A;  3IVF A;  4BVU C;  3O96 A;  1WMH A;  2GBN A;  1MKE A;  2L0T A;  2ROZ B;  1TGZ B;  2KLC A;  2ZJD A;  1ISN A;  1JRU A;  4E74 A;  2CR5 A;  2Z0O A;  1NU2 A;  3ML9 A;  3U30 A;  4Y94 A;  2RNR B;  4JLC A;  2LRW A;  3ML8 A;  2IYD B;  3UQA A;  1S3S G;  2PE9 A;  3MTN B;  1BWN A;  2Q13 A;  4WWN A;  3ZW3 A;  4HB3 B;  2KWV B;  1UGM A;  2KMC A;  4B95 A;  5G2N A;  1U27 A;  2N9E B;  2ZCB A;  1BTN A;  2GCL A;  5J3T A;  3EFU A;  4MGK E;  2DEN B;  3DBR I;  5CX3 A;  2KTR B;  1AWE A;  5AZG A;  1OEY J;  1SGH A;  3W1S C;  2DYO A;  3IBE A;  4ICU A;  4NQL B;  3ZKJ C;  4DWF A;  3QQ8 B;  3KUD B;  2G3Q B;  2LJ5 A;  1DDW A;  1DYN A;  2COF A;  1OTR B;  3TBL D;  1AQC A;  3PRP B;  3X0W A;  1V5T A;  5C5B B;  3S2A A;  4KZC A;  3JSV A;  2WYQ A;  3ODO A;  2W2X D;  4XZ4 A;  1E8X A;  2KDF B;  3ODX A;  2VRR B;  4IAP A;  3LJ3 A;  2D07 B;  4X57 B;  2NS5 A;  5AZH A;  5J18 A;  2HJ8 A;  4II2 B;  3V60 A;  4AUQ C;  1VCB A;  2C7M B;  4GDL B;  4B9K A;  1U5F A;  5JP4 A;  5D7G A;  3AJ4 A;  1V2Y A;  2ZZP B;  2K8C A;  4AOF A;  1EGX A;  1RAX A;  2NVU I;  4GMX B;  4EZL A;  4B6H A;  4MJS A;  1Q0W B;  3TW1 A;  4K81 A;  4KHO A;  2BKR B;  1Z5S B;  2COD A;  1GUA B;  2XK5 B;  1FHW A;  1EF1 A;  2I5C A;  3F0W A;  2KKC A;  2XEW A;  3A4S C;  3V61 A;  2MA9 B;  1TTN A;  3VAW A;  2HD5 B;  2XBB C;  3A9K B;  5CHW A;  4F1S A;  3PHX B;  2C5L C;  2NPT A;  1EUV B;  4NY0 A;  4BBN F;  4F7Z A;  2O2V A;  1WGU A;  4LJO B;  2KQS A;  2Z0E B;  2RVB B;  2DHZ A;  4WJP A;  2KC2 A;  2DN6 A;  4IWO A;  2P0F A;  2EKE C;  5DH9 B;  4KIK B;  5DPR A;  3N7C A;  3M1I B;  2ZVN A;  3ZTD A;  1OQY A;  3PRM B;  4HK2 A;  4I6L B;  2G45 B;  2CHX A;  2FCN A;  3KVF B;  4HCN B;  1EVH A;  4ZRK A;  1LQB A;  1ZC3 B;  1OQN A;  2DX1 A;  1OY2 A;  1T0Y A;  4GN1 A;  2Y8F A;  4W9L A;  3A8P A;  1WR1 A;  4NSW A;  1FB8 A;  1XQQ A;  1KLV A;  2DTC A;  3H9D A;  1MIX A;  2IO0 B;  4NJ7 A;  2RSG A;  5HE0 A;  1GC7 A;  2UZR A;  2BYE A;  3H7S A;  3JYU A;  2K2U A;  1WYW B;  1NI2 A;  3NHE B;  1GNU A;  4K2P A;  2NBV B;  3SHQ A;  4EOY A;  1ZKH A;  1E90 A;  3H6N A;  2HTH B;  1WY8 A;  3RD2 A;  5L95 C;  3PEG A;  4A6F A;  4NAW B;  4BOZ B;  5E6P A;  4MGI E;  2LXA A;  3ZUN A;  1YJ1 A;  2YS5 A;  4WQO B;  5AZF A;  3DVG X;  4BKT A;  2VRW B;  4PYZ A;  2BF8 B;  3HW2 B;  4BKS A;  2KDI A;  1W1G A;  5HE3 A;  3KUZ A;  3ZVV A;  2DA0 A;  2JPH A;  1WGQ A;  4GB9 A;  5LOP B;  2EC1 A;  1MK7 B;  1WI1 A;  3OLM D;  4HCP B;  1V88 A;  1W1H A;  5G55 A;  3ZO5 B;  5LXH A;  3TFM A;  1TBE A;  3QIJ A;  2R2O A;  3A9J A;  5DIF B;  2BGF A;  3C0R B;  3ZRC A;  1Z87 A;  2W2X C;  1FGZ A;  2MKR A;  1LM8 B;  4HAV B;  1V5M A;  2MBQ A;  2YLM A;  3PT2 B;  4FJV B;  5GMV A;  2P0H A;  1BAK A;  2R2Q A;  1WM2 A;  1X86 A;  2YS1 A;  4KIK A;  2M8S A;  1WF9 A;  1IP9 A;  3NZS A;  4ZYN A;  4ZRI A;  2M14 A;  2DZI A;  2JRI B;  4LCD E;  2K6D B;  1WMH B;  4ZDV A;  1I2H A;  1K5G B;  1RJ2 A;  2MW5 A;  5C23 A;  1P0R A;  1YIW A;  3A9K A;  3V6E B;  1WM3 A;  3DOW A;  2DKP A;  2IBI B;  5D27 A;  5DHA B;  2J7Q B;  4IWP A;  1A5R A;  1E8Z A;  2MX2 A;  2L76 A;  2DAF A;  2JY6 A;  3D8F A;  4I6P A;  4WWO A;  4LDT D;  4LDT B;  3QBV B;  1X05 A;  4L6E A;  1QZE A;  1WJ4 A;  5HE1 A;  1WZ3 A;  5J2R A;  2DLW A;  4GDK B;  3O65 B;  3ZIM A;  4IW0 A;  2K00 A;  2COC A;  4C0A A;  2ELA A;  3W1S A;  2KCJ A;  1E7V A;  5JHB A;  2D9W A;  2K2J A;  5CHV C;  3A4R A;  3RZW C;  3TMP B;  3BY4 B;  1KOT A;  4K7W A;  4OVU A;  4WVF B;  1WR6 E;  2BPS A;  1J8C A;  2D2Q A;  2UYZ B;  5CLL B;  1WGR A;  1PMS A;  2DYQ A;  2C60 A;  4W9K A;  3OJ3 A;  2M38 A;  2AEH A;  2A4Z A;  4BKG A;  3L16 A;  2ROV A;  2KFK B;  3V6C B;  4AJY B;  1P3R A;  2K6Q A;  3JSV B;  3T9L A;  1GJZ A;  1XD4 A;  3A1Q A;  4RM8 A;  3DXC A;  4HAW B;  2FCM A;  4LJP B;  3WAL A;  4CHM A;  1U5E A;  3RUL A;  2Z59 B;  2OQB A;  3VUW A;  3ZTC A;  1ZVR A;  4JQW C;  1TQZ A;  4IOY X;  1SE9 A;  2A5U A;  2CS4 A;  2Y5B B;  3AXC A;  4G0N B;  1QC6 A;  1WVH A;  4YON A;  2NR2 A;  1J0W A;  2Z0D B;  3L54 A;  4JL9 A;  2L7R A;  3PGE A;  4IM2 A;  3DXE A;  1WXM A;  1U5D A;  2KDB A;  2ZPY A;  3HIZ A;  4W9F A;  5E6N A;  3ZDM C;  4GOC A;  2KQ7 A;  2N23 A;  1MIZ B;  2NMB A;  4EZK A;  1WGD A;  1WX9 A;  3Q3J A;  5LLI A;  3SDL C;  3KUC B;  1C3T A;  2I1J A;  2GMI C;  2VKI A;  4ASW C;  1V81 A;  2MBO A;  2MFQ A;  3DQV A;  3PSE B;  2DAJ A;  4G50 A;  2FCS A;  2KWU B;  2Y7B A;  4GDK A;  4J6I A;  4RM9 A;  5E6O A;  4EZJ A;  3KW5 B;  4KAX B;  2LI5 A;  2LKO A;  5FI1 A;  3MHS D;  1G6J A;  4P7I A;  4HB2 B;  1UD7 A;  2FIF A;  4WSF A;  3VHT C;  3KRX A;  4GMV A;  2LZ6 A;  4DBG A;  3RCZ A;  3KRW A;  4FJY A;  3DVN V;  2LOZ A;  2HE7 A;  1Q1O A;  2LG1 A;  4FBJ B;  2Y8G A;  1PFJ A;  1RRP B;  3QK0 A;  2B3A A;  2GBK A;  2AWT A;  3AU5 A;  1U2B A;  3KSY A;  4RMA A;  4DHZ B;  2P0D A;  4HAU B;  1KI1 B;  3AU4 A;  3KY9 A;  1X1F A;  4A6H A;  3WA0 A;  4FLH A;  4HLE A;  2ZVO A;  4HJK A;  2C9W B;  1WRD B;  5DPS A;  1WXS A;  1DBH A;  1UNP A;  2LAS A;  4OVV A;  2BCJ A;  2EMS A;  4GPT B;  4HHV A;  2ZNV C;  3KZ1 A;  3AUL A;  1WH3 A;  3Q3F A;  2V4L A;  1W1D A;  1J0G A;  1V61 A;  3DBH I;  3FSS A;  3R7Q A;  1Z2M A;  2D9X A;  2QKL A;  1H8C A;  1UZX B;  3HHM A;  4A3O A;  4F7U P;  3M63 B;  1WXA A;  4KHA A;  4A6F B;  2BKF A;  4F7G A;  2J59 M;  2CHZ A;  2H7E A;  4NPN A;  3PS6 A;  1XCG A;  2LGD A;  4ICV A;  2N4F A;  2RGN B;  5D3Y A;  2DYB A;  4CHJ A;  5EDS A;  3APD A;  3AI5 A;  2VSZ A;  3KH0 A;  1D3Z A;  1U29 A;  3OAN A;  4D0N B;  1EF5 A;  1Y19 B;  1YX5 B;  4HPM B;  3RZF A;  3VH3 B;  2ZCC A;  4CHK A;  4MK0 A;  1WGG A;  4I6N B;  4M8M A;  3TIX A;  3W1Y A;  4A3P A;  5D3X A;  2D10 A;  2IY1 B;  3IHP C;  2FID A;  2Z0Q A;  3TVV A;  2L2I A;  2GBM A;  4FN2 A;  4EUT A;  4DXA B;  1DRO A;  1SIF A;  4KDL B;  3DXD A;  4AWJ A;  2DX5 B;  2M0X A;  1IYF A;  4A5K A;  1S1Q B;  3ZNG C;  5JLJ B;  2LVP A;  4W9E A;  2FJL A;  3RCP A;  2AL6 A;  1RRB A;  2KJ6 A;  4KZ0 A;  2MCN B;  3TJP A;  3VVW B;  3ZNZ B;  4A20 A;  2CAY A;  4YL8 A;  3IFW B;  1WG7 A;  2DZM A;  3I3T B;  1YD8 U;  4DX8 A;  3X23 A;  2OTX A;  3UIO B;  4IC7 B;  4BOS C;  1NTY A;  1WGH A;  2R09 A;  2GOW A;  2OOB B;  3IG3 A;  2Z0P A;  5CTR C;  3K9P B;  2DKQ A;  5GOW B;  4G11 A;  4H8S A;  5EFX A;  3VH4 B;  2BWF A;  5DPT A;  2KLG A;  4KV2 A;  2MSE D;  1WGY A;  2CY5 A;  4MH0 E;  3H7P B;  4CO7 A;  4GZU A;  2M4N A;  2IYB A;  3PZD A;  2MBH A;  2IFS A;  3MDB C;  2MWS B;  2RSU A;  1SHC A;  1U4A A;  1WX7 A;  2D3G A;  4TQ1 A;  1EO6 A;  3ZNI D;  4GDL A;  5HKH A;  3VOQ A;  4KSL C;  1ZC4 B;  2N9P C;  3PSC A;  1WI0 A;  1U5G A;  1V89 A;  1WZ0 A;  2FNJ B;  2YT1 A;  2DHK A;  1WJU A;  2D11 A;  2YRY A;  3GOE A;  5IA7 A;  2L3Z A;  4W9H A;  2CRF A;  5BO4 B;  2K1F A;  2KD0 A;  3A33 B;  4HXD A;  5C79 A;  4MEL A;  3A8Q A;  3VTU A;  4IWQ A;  4FHJ A;  1MG8 A;  2YS3 A;  1F9J A;  2J0K A;  3UGB B;  2AYO B;  4TKN A;  3L17 A;  4W9I A;  1P6S A;  1IPG A;  2MBB B;  2RR9 A;  3VUY A;  4IG7 B;  2D4Q A;  3EC8 A;  2WX0 A;  1MK9 B;  3QWM A;  4MT7 A;  1P3Q U;  2JRH A;  2K25 A;  2K39 A;  2N1V A;  5KQ4 A;  2JXX A;  2L8J A;  2LVO A;  2PPH A;  3APF A;  3P6A A;  1R4N I;  2REX A;  3PV1 A;  1MAI A;  1K8R B;  2BYV E;  2ZPN A;  1OMW A;  1X1M A;  3D8E A;  4K7S A;  4NJ6 A;  2CU1 A;  1E8Y A;  4G3X B;  1M94 A;  5D3V A;  3DBS A;  1VD2 A;  1BT0 A;  1YX6 B;  3M95 A;  3SYX A;  2YSZ A;  3PHW B;  3VXW A;  4K17 A;  3H7P A;  3JW0 X;  1I35 A;  4BBK A;  3L10 B;  5HE2 A;  2UVM A;  3A98 B;  2DZK A;  4FUL A;  3B08 A;  4CYE A;  2AL3 A;  2JT4 B;  3R3M A;  1NTV A;  3SV1 A;  3NOB A;  4XX5 A;  5JZE B;  2WDT B;  4WAA A;  4PS3 A;  4JGH B;  1DDM A;  1XT9 B;  2O6V B;  4NAW A;  4TQ0 A;  2DYN A;  3VIA A;  2HTH A;  2OJR A;  3PVW A;  2MP2 B;  2N1W A;  3PRE A;  3SU8 X;  3UQB A;  1P9D U;  1WE6 A;  3HQC A;  5LON B;  3K9O B;  5JHH A;  3MJW A;  3QAR A;  3GYO A;  1H4R A;  4KHB B;  3ULC A;  3EEC A;  4GIV A;  1LB1 A;  2V3S A;  1V5O A;  2IO1 B;  4EMO A;  2L05 A;  3V5W A;  1Q5W B;  1FHX A;  2NBW B;  2LWP A;  2JZ3 B;  1MPH A;  1FGY A;  4EJN A;  5C6R A;  1WXV A;  2K8B A;  1KJT A;  2JWZ A;  4W9G A;  3CF6 E;  3ENE A;  3ZVR A;  5D6J B;  2EJ8 A;  3ALB A;  4IFS A;  2M17 A;  4DHZ E;  2GCJ A;  2RLO A;  1P5T A;  2GS0 A;  5J3Y A;  3RYT A;  2LOX A;  1UNQ A;  4HAY B;  3NY5 A;  4MDK E;  3H1U A;  4DBB A;  3PVU A;  3VDZ A;  4EEW A;  2KN5 A;  2I5F A;  3TCA A;  4F7H A;  2C7H A;  5DCN A;  2YT0 A;  3VTW A;  1UBI A;  3RUI B;  4TYZ A;  4F8C B;  2P8V A;  2J0J A;  4DHJ D;  1NBF C;  3GYP A;  1TZ1 A;  3WYF B;  1GG3 A;  4DDI D;  2JF5 A;  3U8Z A;  5LXI B;  1UPR A;  4BFR A;  2KNB A;  1UBQ A;  1V86 A;  2LXC A;  1I7A A;  2N7D A;  3HM6 X;  2NCN A;  4MJS B;  4PNK A;  1KM7 A;  1E5W A;  2MDX A;  2GJY A;  2KDE B;  1PQS A;  2CY4 A;  1KZG A;  2LYD A;  5DHF B;  2KK8 A;  4N9F 4;  3PLV A;  4ANW A;  5KQ1 A;  2LUE A;  3T8M A;  3WAO A;  3GZN I;  3KYD D;  4AP4 C;  2N0Y A;  3N3K B;  4HB4 B;  1FHO A;  1QQG A;  5IAA C;  3HM3 A;  3MPX A;  2O2V B;  2PE6 B;  4HAX B;  4W9J A;  1UPQ A;  3B1L X;  1LXD A;  1EAZ A;  2KJR A;  3CMM B;  3R7R A;  1M7R A;  4KDI C;  3UIN B;  1BTK A;  2D9Y A;  2KFK A;  2KZR A;  2RPQ A;  3WAN A;  4PQ0 A;  4B6W A;  2KVR A;  2IO2 B;  1FOE A;  5KCV A;  4WJQ A;  3D8D A;  1P1A A;  4GSW A;  5JH5 C;  3P2B A; 
#chains in the Genus database with same CATH topology
 2V1Y A;  1LW3 A;  3CXB B;  3UZT A;  4K3B A;  2AQ2 B;  3MP9 A;  4RF0 A;  2LJI A;  4ARI A;  1ZGU B;  2V76 A;  4FAD A;  4DQO C;  4RGN A;  1WJ6 A;  2YVC A;  3RFZ B;  3ODW A;  1L2N A;  3D32 A;  5EE0 A;  3SD5 A;  1QIL A;  1FMA D;  3M62 B;  5FR6 A;  3NRZ A;  1ZYI A;  4W9C A;  1XLN A;  5HG2 A;  2N7E A;  2KX0 A;  2C7N B;  4NAM A;  3SFD B;  1IBX B;  2CJO A;  4YSZ B;  1WJ1 A;  1VZ8 A;  2WU2 B;  3BK1 A;  3RT3 B;  2J42 A;  4LNO A;  2ONQ A;  4KGS A;  5C5B A;  2MWN B;  2JZZ A;  1F2R I;  2MP2 A;  4MGY E;  2LGX A;  2PVG C;  3DVG Y;  2J4X A;  4L1B A;  3V62 A;  1OFF A;  4KGR A;  3U7D A;  2ELB A;  2E2X A;  5TSS A;  2CKH B;  3DPD A;  1X1G A;  2L1C A;  3ZDT A;  2D9Z A;  4E71 A;  1TZO A;  1H10 A;  3DHH C;  2WX1 A;  2E6X A;  2N0S B;  4BBN C;  2PZ1 A;  1T0R C;  2N9K A;  4HAZ B;  1ZSQ A;  1TS2 A;  3C8Y A;  3PP2 A;  1WE7 A;  2W3R A;  3NZ3 A;  3VUX A;  3TEY A;  4MH8 A;  4MY6 A;  3VR9 B;  5IO9 A;  1V80 A;  2L00 B;  3BIN A;  5D3W A;  4MGZ E;  5M4Y B;  2QJL A;  3UIP B;  2WWZ A;  3TO1 A;  3A9J B;  3PTF C;  4XC2 A;  2L0F A;  1FIQ A;  2IO3 B;  2G4S A;  4EKU A;  3KWV A;  1ZDV A;  3B0A A;  3DVN U;  3ZRF A;  4Z2N A;  5BMH A;  5J17 A;  5DPW A;  1F0Z A;  2COA A;  5L81 A;  2LHD A;  2MRP A;  5BMG A;  2IZV B;  4A6K A;  2FBW B;  1RFA A;  2O6V A;  5FK9 C;  4OZA A;  3QJZ A;  2FUH B;  2W9N A;  3A58 A;  1MKE A;  2ROZ B;  2KLC A;  1OQQ A;  1ISN A;  2KYW A;  4XDD A;  5EE1 A;  3OHM B;  3RN9 C;  2PE9 A;  4WWN A;  4HB3 B;  3VR8 B;  5FR3 A;  3IT4 B;  1XLP A;  2N9E B;  5J3T A;  2DEN B;  3BZD B;  3DBR I;  3IBE A;  4ICU A;  1AQC A;  3PRP B;  2WS3 B;  1V5T A;  3W2D A;  5C5B B;  3S2A A;  5EE9 A;  1E8X A;  1QQR A;  5AZH A;  2D07 B;  5J18 A;  2NS5 A;  4XWT A;  4II2 B;  3V60 A;  4GDL B;  1U5F A;  1KF6 B;  1LGR A;  1AN8 A;  2NBV A;  2K8C A;  1RAX A;  4GMX B;  1I7H A;  4B6H A;  1L4D B;  2GUM A;  1Q0W B;  2BS2 B;  1L5P A;  3N1Z C;  2BKR B;  2M19 A;  3A4S C;  2XEW A;  2MA9 B;  2NPT A;  1C4C A;  1WGU A;  1HTQ A;  2WXH A;  4WJP A;  2DN6 A;  2P0F A;  4OT1 A;  5DPR A;  3N7C A;  2ZVN A;  1JRO A;  2JYT A;  1OQY A;  4HK2 A;  4CQN A;  2KMM A;  2QCZ A;  3N20 C;  1FXI A;  1EWY C;  1OY2 A;  1T0Y A;  4W9L A;  4HPP A;  3AE9 B;  1C76 A;  4NJ7 A;  5HE0 A;  1GC7 A;  1DOY A;  2BYE A;  3H7S A;  3JYU A;  2K2U A;  1WYW B;  2WHI A;  3NG0 A;  3SHQ A;  3H6N A;  2HTH B;  1WY8 A;  4NAW B;  2GLS A;  3ZUN A;  1IBX A;  4WQO B;  3DVG X;  4BKT A;  2D3A A;  2PW9 A;  3KUZ A;  3DBL B;  1IGC A;  5LOP B;  2EC1 A;  1D6E C;  1TBE A;  1TY2 A;  4PK1 A;  1Z87 A;  1FGZ A;  1LM8 B;  1WXQ A;  3PT2 B;  5IA7 A;  2P0H A;  1X86 A;  3HSA A;  2H89 B;  2M14 A;  2JRI B;  1RJ2 A;  1P0R A;  1YIW A;  2KN4 A;  3RI7 C;  3RNF C;  1A5R A;  1E8Z A;  1L0X B;  1E0Z A;  4O1N A;  4ITK A;  2DAF A;  2ICI A;  4LDT D;  4LDT B;  1HQR D;  3U52 E;  1QOA A;  3O65 B;  4IW0 A;  3ZIM A;  1K52 A;  1FPY A;  2KCJ A;  2D9W A;  3RZW C;  1BXT A;  1J8C A;  1N5W A;  3OG5 A;  3L16 A;  2M0A A;  1UWX A;  2KFK B;  4NJC A;  1GJZ A;  3A1Q A;  1FNW A;  2FCM A;  3WAL A;  4CHM A;  4ZRQ A;  5AUK A;  1WVH A;  3L54 A;  1WXM A;  1GPX A;  5E6N A;  2KQ7 A;  2N23 A;  1YN4 A;  2IDY A;  1SJE D;  5LLI A;  3SDL C;  2KDM A;  4GDK A;  3PSE B;  2KWU B;  1V1P B;  3MHS D;  4HB2 B;  3RCZ A;  3DVN V;  2INN E;  3AU5 A;  3KSY A;  1T77 A;  4L1R A;  4HAU B;  4FLH A;  2ZVO A;  2C9W B;  5DPS A;  1UNP A;  4GNK B;  2ZNV C;  1WH3 A;  5BYQ A;  3E56 A;  2H88 B;  2PVO D;  1UZX B;  4F7U P;  4A6F B;  4ICV A;  2N4F A;  2DYB A;  4CHJ A;  2VZK D;  3BYY B;  3APD A;  4D0N B;  1Y19 B;  3VH3 B;  2B76 B;  2ZCC A;  4CHK A;  4C7Z A;  2IY1 B;  2W54 A;  2FID A;  2Q5W D;  2Z0Q A;  3IHP C;  2L2I A;  4CSQ A;  1LO5 D;  4US8 A;  1SIF A;  4KDL B;  3DXD A;  5MPO A;  2M0X A;  5JLJ B;  1MJD A;  1CZP A;  4W9E A;  2KJ6 A;  2AL6 A;  1RRB A;  3ZNZ B;  1JWA D;  4RGO S;  4YL8 A;  1WG7 A;  1DOI A;  3UIO B;  4BOS C;  4IC7 B;  1T5X D;  1J7C A;  3K9P B;  1ZPS A;  5EFX A;  3VH4 B;  2BWF A;  5DPT A;  1WGY A;  4CO7 A;  1PFD A;  2YEP F;  2MWS B;  2MBH A;  1SHC A;  1WX7 A;  4TQ1 A;  4S0R A;  2FE8 A;  4KSL C;  2N9P C;  3DHI C;  1WI0 A;  2YT1 A;  1WJU A;  2K1F A;  4HXD A;  5C79 A;  3T3N A;  3VTU A;  4FHJ A;  1MG8 A;  1P7F A;  4W9I A;  3BYT B;  2MBB B;  4IG7 B;  2D4Q A;  3QWM A;  1E10 A;  2K39 A;  2REX A;  2BYV E;  1K8R B;  2KWD A;  2KAC A;  3NVW A;  5I2S A;  1M94 A;  5D3V A;  3DBS A;  1VD2 A;  1JAL A;  2YSZ A;  1PDX A;  4K17 A;  1F52 A;  3JW0 X;  1I35 A;  4BBK A;  3FVC A;  5HE2 A;  2UVM A;  4FUL A;  1L0Y B;  2JT4 B;  1NTV A;  3SV1 A;  3AE2 B;  4KKJ A;  4PS3 A;  1VLB A;  1A70 A;  2IJ0 A;  4XE0 A;  2HTH A;  2MP2 B;  3GS2 A;  1WE6 A;  2L83 A;  3GP7 A;  3QAR A;  5JHH A;  4KHB B;  1H4R A;  1XO3 A;  3C19 A;  4N6E B;  1LB1 A;  2IO1 B;  3B2F A;  1WXV A;  3HVD A;  5D6J B;  4DHZ E;  3TUO A;  2RLO A;  5J3Y A;  2LOX A;  1UNQ A;  4HAY B;  4MDK E;  2BQQ A;  2I5F A;  3TCA A;  3VTW A;  1NEN B;  3RUI B;  4TYZ A;  1T0Q C;  4H2A A;  3AB5 A;  3WYF B;  3ZJU A;  4HKZ E;  1GG3 A;  2J53 A;  3U8Z A;  1UPR A;  1UBQ A;  2LXC A;  2NCN A;  1KM7 A;  2MDX A;  2CY4 A;  4GOU A;  1KZG A;  3GB1 A;  2LYD A;  5DHF B;  4N9F 4;  3PLV A;  2LUE A;  3T8M A;  3MC8 A;  3AH7 A;  3WAO A;  4AP4 C;  2N0Y A;  1QQG A;  2K22 A;  2I2Y A;  2QDF A;  3HM3 A;  2O2V B;  4LTU A;  4WIP A;  1R7S A;  4W9J A;  3UIN B;  4F8C B;  2KJR A;  1M7R A;  4KDI C;  2KFK A;  3N1Y C;  2IO2 B;  5KCV A;  2QC8 A;  3R8B A;  3DBL I;  2CHW A;  1YMH E;  2LVQ A;  2SAK A;  3QHT A;  4WJO A;  3DCG A;  5JHG A;  2KWC A;  3EHV A;  5H8Y E;  1C4A A;  2QMT A;  1UEL A;  4K7U A;  3APC A;  1XR0 B;  2KC1 A;  2NZ8 B;  1I4R A;  4YSY B;  4GXB A;  3CSF A;  4HWI B;  3DBH B;  5E6J A;  2MEK A;  2DHJ A;  1HE8 A;  4XZ4 A;  3ZLZ A;  3TEZ A;  2FAZ A;  3RMK C;  1E8W A;  4OZC A;  1M7E A;  4TUU A;  1V1O A;  4BKS D;  1V97 A;  3QA8 A;  3OJ4 B;  3LDZ E;  2QHO A;  3PPA A;  1I42 A;  3NVY A;  5DI9 B;  2IY0 B;  2GB1 A;  3UI3 A;  4HPL B;  5LNK 1;  1SF0 A;  4GGQ A;  1B9R A;  1XXG A;  2N9L A;  3I57 A;  4TV3 A;  3VRB B;  2W55 A;  4C80 A;  2OHF A;  4KHB A;  4DHJ B;  4C7Y A;  3PHX B;  2W2W A;  3WAP A;  1CMX B;  4HB0 B;  4XWX A;  4ZRJ A;  4YT0 B;  4M01 A;  5BMI A;  1P7E A;  3QC8 B;  2ZNV B;  3ZNH B;  5AUI A;  3W5V B;  1NDD A;  2PMV A;  2IND C;  5C2T B;  1Y8R C;  2QIL A;  1FD6 A;  5KHQ A;  3CIR B;  1L7Y A;  2KXJ A;  5C16 A;  1YJJ A;  2MLB A;  1SIJ A;  2GI9 A;  1HA5 A;  3P63 A;  3KYC D;  3L13 A;  3QX1 A;  4M0W B;  2N9X A;  2DFK A;  1TXD A;  4HVB A;  3R2I A;  4C4V A;  1E7P B;  4HAT B;  2EMT A;  3L08 A;  4QJ3 B;  2L1A A;  1X11 A;  1UEF A;  5JHA A;  4PS8 A;  2BYT A;  5C3J B;  3PG7 A;  3ONS A;  4WH4 A;  3SNH A;  4MEM A;  3JVZ X;  2WLB A;  2J0M A;  4M8N A;  1RYJ A;  2LHE A;  1JWM D;  4FHK A;  3IAS 1;  1XKE A;  3OAW A;  3QWZ B;  1KLU D;  2WDV B;  4PS7 A;  4RH6 A;  3O96 A;  4ZHP A;  1XLQ A;  3PZ7 A;  3U4E G;  4C56 C;  5HFY A;  1NU2 A;  3U30 A;  2LRW A;  3ML8 A;  2IYD B;  3HIE A;  1BWN A;  3AED B;  2KWV B;  1UGM A;  4B95 A;  5G2N A;  2WGS A;  2VZK B;  2DBY A;  2ZCB A;  1K51 A;  1AWE A;  1JML A;  1SGH A;  1OEY J;  4NQL B;  4DWF A;  1C79 A;  2YT2 A;  2COF A;  1IUE A;  3X0W A;  3Q6B A;  4JWS C;  2KDF B;  1DYQ A;  3LJ3 A;  2GRI A;  2HJ8 A;  1VCB A;  1RWS A;  3AJ4 A;  1EGX A;  2XNA C;  4EZL A;  4AS1 A;  1T3Q A;  3TW1 A;  2MJ3 A;  4K81 A;  1N5X A;  1FHW A;  2I5C A;  1FRD A;  1TTN A;  3VAW A;  2XBB C;  4F1S A;  1JWS D;  2C5L C;  4YTN B;  1EUV B;  2PIA A;  1MI0 A;  2KQS A;  4XDC A;  2RVB B;  2DHZ A;  3RNC C;  1XEE A;  2EKE C;  3ZTD A;  3T3O A;  3M1I B;  4IOI E;  1DOX A;  2FCN A;  5EE3 A;  1ZC3 B;  4GN1 A;  1WR1 A;  2HDE A;  2DTC A;  3H9D A;  2UZR A;  1RM6 C;  1JCK B;  1C77 A;  1ZKH A;  1E90 A;  1TS5 A;  1KLG D;  3URY A;  3PEG A;  4A6F A;  4HLE A;  5L95 C;  2WQY B;  2YS5 A;  5AZF A;  4PYZ A;  4BKS A;  2KDI A;  5HE3 A;  2DA0 A;  3Q14 C;  4HCP B;  3OLM D;  1V88 A;  4QJ5 B;  3A9J A;  3C0R B;  3EA6 A;  2MBQ A;  3Q8F A;  5GMV A;  3MHZ A;  1WM2 A;  2IGD A;  4KIK A;  1ENF A;  2M8S A;  3ZGZ A;  1WF9 A;  4LCD E;  2K6D B;  1FNV A;  4N58 A;  3ABV B;  3DOW A;  3P42 A;  5D27 A;  2J7Q B;  4BAX A;  2L76 A;  4KGT A;  1FO4 A;  4I6P A;  4L6E A;  1WJ4 A;  1WZ3 A;  2WNM A;  4MT5 A;  2Z4D A;  4GDK B;  2ELA A;  5G5G A;  5JHB A;  3TMP B;  2FUG 1;  3BY4 B;  4K7W A;  2BPS A;  2UYZ B;  5CLL B;  1PMS A;  4BKG A;  4W9K A;  2AEH A;  4TMA B;  1GB4 A;  1P3R A;  3JSV B;  5D3I B;  3AEE B;  3ZTC A;  1HEZ E;  4G0N B;  3AXC A;  1UGJ A;  4YON A;  2Z0D B;  4JL9 A;  2L7R A;  3PGE A;  4IM2 A;  4HSI A;  2ZPY A;  3KLS X;  1FFV A;  4GOC A;  1MIZ B;  2NMB A;  1WGD A;  1WX9 A;  3OWE B;  2I1J A;  1B1Z A;  1V81 A;  2MBO A;  2MFQ A;  3DQV A;  3EFC A;  4J6I A;  4EZJ A;  4A90 A;  1G6J A;  1UD7 A;  2NMQ A;  1KOT A;  3KRX A;  4DBG A;  3KQ4 A;  1TS4 A;  3I5J C;  4FBJ B;  3QK0 A;  2AWT A;  1R4N B;  2P0D A;  1KI1 B;  3AU4 A;  4ZRP A;  4HJK A;  1DBH A;  4OVV A;  2BCJ A;  2EMS A;  1MHX A;  2JYE A;  1J0G A;  4OSN A;  1H8C A;  3FSS A;  1Z2M A;  3FKY A;  2CHZ A;  2BKF A;  2J59 M;  2H7E A;  1YQ3 B;  2LGD A;  2WXF A;  2JSV X;  4YTM B;  2W3S A;  2M56 B;  1D3Z A;  5BYR A;  3KH0 A;  3OAN A;  3RZF A;  1YX5 B;  4HPM B;  4I6N B;  5D3X A;  4YSX B;  4HKQ A;  2GBM A;  4AWJ A;  1IYF A;  2DX5 B;  3LB8 C;  3ZNG C;  2LVP A;  2FJL A;  2MCN B;  3VVW B;  4A20 A;  5IRS A;  2CAY A;  2VH2 A;  2DZM A;  4P1B C;  1ZP0 B;  2BTE A;  2OTX A;  5T8I A;  4R3D A;  1NTY A;  1WGH A;  2R09 A;  3IG3 A;  2DKQ A;  4HJG E;  2CY5 A;  4MH0 E;  1ZUD 2;  3PZD A;  1D5Z C;  3MDB C;  2PKO A;  2RSU A;  2D3G A;  1FNU A;  3ZNI D;  3NWA A;  3VOQ A;  2D5G A;  1D4B A;  1U5G A;  2D11 A;  4W9H A;  3NWD A;  2KD0 A;  2I38 A;  3A33 B;  2NTT A;  3A8Q A;  2V9H A;  2YS3 A;  3EC8 A;  4QXA B;  2JRH A;  2K25 A;  5KQ4 A;  2JXX A;  3APF A;  3PV1 A;  1TKE A;  3EUB 2;  1YX6 B;  2KR0 A;  2ACZ B;  3L10 B;  4DIX A;  2BW2 A;  1NVI D;  3B08 A;  1YQ4 B;  1EM7 A;  2AL3 A;  3R3M A;  1I4P A;  3NOB A;  1Q10 A;  2WDT B;  2LMC A;  1DDM A;  4JGH B;  2DYN A;  3VIA A;  2AX5 A;  2OJR A;  1P9D U;  3MJW A;  3GYO A;  2V3S A;  1F2R C;  2KT7 A;  2L05 A;  1FHX A;  1MPH A;  2K8B A;  1KJT A;  4YTP B;  1QF6 A;  4W9G A;  3N9Y C;  3ENE A;  2EJ8 A;  3BVZ A;  4IFS A;  2M17 A;  3RYT A;  3NY5 A;  4FXC A;  3VDZ A;  4LLG M;  2KN5 A;  4M0W A;  2P8V A;  2J0J A;  1NBF C;  3GYP A;  1NI3 A;  3AN1 A;  5D3D A;  1TJE A;  2JF5 A;  1SB3 C;  2KNB A;  4RFB A;  2N7D A;  3MFG A;  4C00 A;  1YNT E;  4LNK A;  2CU3 A;  3AE6 B;  4HB4 B;  3NUH B;  1FHO A;  2Z14 A;  5IAA C;  1QOG A;  4HAX B;  3CMM B;  4XGA B;  2BT6 A;  4B6W A;  2RPQ A;  2G1E A;  3D8D A;  1P1A A;  3B9J A;  3P2B A;  2WXM A;  1N3H A;  3WIM A;  1TYG B;  5KHO A;  1N60 A;  4WJN A;  2K0P A;  3NSU A;  2YF0 A;  2RUK B;  4HDO A;  2Y5P A;  1P98 A;  2LRU A;  5H92 C;  2ADZ A;  2JP2 A;  1SBB B;  4RF1 A;  1V6E A;  4K2O A;  3E9S A;  3L0W B;  1IRS A;  1B55 A;  4URK A;  4OZB A;  4WJ7 A;  3MJ5 A;  1V5U A;  3P7Z A;  2LD9 A;  1V9J A;  2XK5 A;  2KGX B;  1RLF A;  3PVL A;  2JZP A;  4DX9 0;  2ASQ A;  5CHF A;  3W9C B;  2R0D A;  1UH6 A;  2KUP A;  2QEJ C;  1SSN A;  4NQK E;  2DZJ A;  3FM8 C;  2KO3 A;  4J3O D;  3N32 A;  3QCA A;  3I63 C;  2GBJ A;  5IP4 D;  2NBU A;  3PLU A;  4PT5 A;  2LUL A;  3EGR A;  2ZEQ A;  4REZ A;  5D94 A;  1AAR A;  1V49 A;  3N1X C;  2RD0 A;  1SEB D;  1FCC C;  3BWU D;  4II3 B;  2DHI A;  2KTF A;  3F5R A;  5I4D A;  4DXF A;  2H7D A;  2KAN A;  2GBR A;  2JX5 A;  2VH1 A;  1MVK A;  2D3B A;  4NNJ B;  1XX0 A;  2JXT A;  1OGW A;  2JQR B;  3TL5 A;  2KOX A;  1GC6 A;  1WX8 A;  3CIK A;  2D9V A;  4KSK C;  3WAM A;  4EFO A;  2LGY A;  2O6V D;  2INP E;  2K49 A;  2M1M A;  5L83 A;  2ZW1 A;  1K5D B;  2WDR B;  3G9W A;  2DNF A;  3NZU A;  3PO0 A;  4YXD B;  1XOD A;  1GAQ B;  1DDV A;  3MC0 B;  3QAQ A;  1Q67 A;  2JVC A;  2AQ1 B;  2LEK A;  5AEK B;  2DYM A;  4MSQ B;  2IGG A;  3ZQ4 A;  4PYU A;  3CST A;  2FCQ A;  5CLQ B;  4WWP A;  3NVV A;  1EU4 A;  3AE5 B;  4ARC A;  2KJH B;  3VFK A;  3AEB B;  3UF8 A;  1OEY A;  4MM3 A;  1JW9 D;  1JWB D;  3ZXV A;  1E7U A;  4ANU A;  3ULB A;  3IVF A;  3AEF B;  1C9F A;  2TSS A;  2CR5 A;  2Z0O A;  1FXA A;  3ML9 A;  2RNR B;  1T6B X;  4ZYS A;  1S3S G;  2Q13 A;  2KMC A;  1BTN A;  1TT5 B;  3EFU A;  5CX3 A;  2KTR B;  2ZW0 A;  3W1S C;  3ZKJ C;  2DYO A;  3Q8E A;  3QQ8 B;  3AE8 B;  3O13 A;  1ROE A;  2LJ5 A;  1DDW A;  2L52 A;  1XCT L;  1VRA B;  3JSV A;  2K9X A;  2W2X D;  3ODX A;  2G9H D;  2Z59 A;  4X57 B;  1XCQ L;  4B9K A;  5JP4 A;  5D7G A;  1FFU A;  1V2Y A;  2DWQ A;  2NVU I;  1MFW A;  4MJS A;  3AEA B;  4KHO A;  2XK5 B;  3BK2 A;  1Z5S B;  1GUA B;  1EF1 A;  3FIL B;  2HD5 B;  2Z0E B;  2KC2 A;  5DH9 B;  4KIK B;  3IAM 1;  1OQR A;  3ZJT A;  2CHX A;  1EVH A;  4ZRK A;  1LQB A;  2DX1 A;  2Y8F A;  3DWM A;  4NSW A;  1FB8 A;  1N6Z A;  1XQQ A;  2PLP A;  2WXJ A;  1KLV A;  2IO0 B;  3NHE B;  1GNU A;  4K2P A;  4EOY A;  1HZ5 A;  5E6P A;  2LXA A;  1YJI A;  1W1G A;  2BB6 A;  1WGQ A;  2AQ3 B;  1WI1 A;  4KX6 B;  5G55 A;  4P16 A;  2KIE A;  1W1H A;  3ZO5 B;  5LXH A;  1C78 A;  5DIF B;  4LK0 M;  2W2X C;  2MKR A;  1V5M A;  4HAV B;  2YLM A;  1BAK A;  3Q3O C;  2BB5 A;  3MC9 A;  3NZS A;  4MAC A;  4ZYN A;  2DZI A;  3HVZ A;  1WMH B;  4IKG A;  1K5G B;  3GZN B;  5C23 A;  2WXQ A;  1UF0 A;  1WM3 A;  2DKP A;  3RNB C;  1KTK A;  2JY6 A;  4NZL B;  3D8F A;  4JPS A;  2ON8 A;  3QBV B;  5J2R A;  2COC A;  4C0A A;  3AE7 B;  3A4R A;  1STE A;  2KQ4 X;  4OVU A;  1AWD A;  2D2Q A;  2M38 A;  2A4Z A;  2ROV A;  1FEH A;  3V6C B;  3T9L A;  4MM3 B;  1R4M B;  4HAW B;  1SE4 A;  3BVG A;  4LJP B;  2Z59 B;  3VUW A;  4HRO A;  4JQW C;  4JWU C;  4IOY X;  1SE9 A;  1QC6 A;  1DGJ A;  1J0W A;  1KRH A;  1U5D A;  2KDB A;  2MJE A;  3ZDM C;  3Q3J A;  4LNI A;  2K3U A;  2LGI A;  1MHH E;  4F7Z A;  4RM9 A;  4WWM A;  5E6O A;  1QT9 A;  3KW5 B;  2LKO A;  5FI1 A;  3VHT C;  1CJE A;  2LZ6 A;  3FAH A;  4FJY A;  3Q3N C;  2LOZ A;  3DCX A;  2HE7 A;  1IGD A;  2LG1 A;  2Y8G A;  1PFJ A;  3Q69 A;  2GBK A;  2MHJ A;  4RMA A;  4RGM A;  4A6H A;  2JU6 X;  2WXR A;  1WRD B;  4GPT B;  4HHV A;  2V4L A;  1W1D A;  1CK1 A;  1V61 A;  4OVZ A;  2D9X A;  2QKL A;  1PYW D;  4A3O A;  1WXA A;  4KHA A;  4NPN A;  4F7G A;  5GXG B;  1I4H A;  1XCG A;  2RGN B;  5D3Y A;  3HUI A;  5EDS A;  2JWU A;  1TY0 A;  1U29 A;  1EF5 A;  1V1P A;  2WXK A;  4MK0 A;  1WGG A;  4M8M A;  3WCQ A;  2D10 A;  1PGX A;  2KVZ A;  4DXA B;  1DRO A;  3LXF A;  4A5K A;  5BYS A;  4KZ0 A;  3TJP A;  3BVM A;  3IFW B;  3P4S B;  4DX8 A;  3X23 A;  2OOB B;  2Z0P A;  5CTR C;  5GOW B;  3P4P B;  4G11 A;  4H8S A;  2RMM A;  2KLG A;  4KV2 A;  2MSE D;  4HEA 1;  1UNS A;  3V05 A;  2IYB A;  5HKH A;  2W82 A;  4GDL A;  1ZC4 B;  1WZ0 A;  1V89 A;  2FNJ B;  3GOE A;  2L3Z A;  4GLS C;  4C4V B;  1VZ6 A;  2V3N A;  1ACC A;  2MJD A;  1F9J A;  2J0K A;  1YN5 A;  1P6S A;  1IPG A;  2RR9 A;  3VUY A;  3AV8 A;  1MK9 B;  1UUP A;  2HJ1 A;  4MT7 A;  1P3Q U;  2WXL A;  1BUI C;  3P6A A;  4HRS A;  3FC4 A;  2ZPN A;  1PUT A;  1E8Y A;  4G3X B;  4ZDV A;  3PHW B;  3M95 A;  3SYX A;  3H7P A;  3R2T A;  4EE2 A;  2KIG A;  2KUQ A;  4CYE A;  4TQ0 A;  1XT9 B;  2O6V B;  4NAW A;  2BS3 B;  3UQB A;  3PVW A;  2N1W A;  3PRE A;  1XF5 L;  4WUR A;  1I4G A;  3HQC A;  5LON B;  1E6E B;  4GIV A;  1V5O A;  3LYY A;  3V5W A;  1Q5W B;  2NBW B;  2LWP A;  4LNF A;  1FGY A;  4EJN A;  5C6R A;  2JWZ A;  3CF6 E;  3ZVR A;  1MPE A;  2KAJ A;  3ALB A;  3DHG C;  2GCJ A;  2GS0 A;  3P4R B;  1ET6 A;  4DBB A;  3PVU A;  1PGB A;  4L2Y A;  4DHJ D;  1GB1 A;  4DDI D;  4BFR A;  1V86 A;  4PNK A;  2KDE B;  1PQS A;  4US9 A;  1ZOY B;  4D2K A;  3P4Q B;  2KK8 A;  4S17 A;  3AE4 B;  3KYD D;  1JQ4 A;  3MPX A;  1UPQ A;  3B1L X;  1LXD A;  1EAZ A;  2XN9 C;  3R7R A;  1KFY B;  2E3T A;  2KZR A;  4PQ0 A;  1FOE A;  4WJQ A;  1N61 A;  4GSW A;  1MG4 A;  2Z13 A;  2X18 A;  1WFY A;  4GU2 A;  3AE1 B;  3I9V 1;  2UWQ A;  3PRZ A;  2K5P A;  4IDI A;  2KFJ A;  2D3C A;  1ESF A;  2LUM A;  1PGA A;  4QAY A;  1FAO A;  2QSD A;  2RGF A;  3NS8 A;  2KTR A;  5IOI A;  1LFD A;  2Y3A A;  4A8X C;  5G5H A;  4JIO U;  1XD3 B;  2WP9 B;  2KHW B;  4TSS A;  3HK0 A;  1KZ7 A;  1ZW7 A;  2ZJD A;  3SEB A;  3DDC B;  3SUZ A;  4ACF A;  1J19 A;  3T06 A;  3PZ8 A;  3VQI A;  1WYG A;  1N62 A;  1SE2 A;  2JUO A;  4RGT A;  1YQB A;  2BWE S;  4WAF A;  2RDB C;  4MSM B;  1N63 A;  4W9D A;  3A1Q B;  2UZS A;  2DX5 A;  3N30 A;  2K8E A;  4E3C A;  2QKM A;  2PJH A;  4JE3 B;  4KVG B;  4DK5 A;  2WU5 B;  3U2S C;  2BYF A;  2NPT B;  4HDQ A;  3VTV A;  1D5M C;  1C1Y B;  1PLS A;  5J3Q A;  3BJI A;  2BVC A;  2XQN M;  4FJZ A;  1R4M I;  3SO6 A;  1TKY A;  1ZM0 A;  1UNR A;  2I1K A;  2SEB D;  2MBE A;  3ML4 A;  4Z2M B;  2KMA A;  2KX3 A;  5IKC M;  3KWL A;  2K8H A;  3FEH A;  5FI0 A;  3Q8A A;  1WJM A;  2G35 A;  4ANX A;  1V5P A;  1I4X A;  5D2M B;  5TR5 A;  2V3P A;  2PEA A;  1C4P A;  1L0V B;  2MQJ A;  1KH0 A;  5HI1 A;  1ZDX A;  2R61 A;  5C1Z A;  3U12 A;  4IUM B;  2QIE B;  3R66 C;  1ET9 A;  4IM0 A;  1TIF A;  4B0E A;  1NYR A;  4FA6 A;  1RFK A;  3M3J A;  4K1R B;  3ZVV A;  3ECI A;  1AW7 A;  2G4D B;  4RCO A;  4W9F A;  2V0G A;  4L23 A;  1V8C A;  1TJ6 A;  1FXT B;  1WJN A;  4IM3 A;  3Q3M C;  1Y5O A;  3LJU X;  4BZA A;  4DDG D;  3RNG C;  2PTL A;  4KKI A;  1WIA A;  4XWW A;  3TSS A;  4BVU C;  1TS3 A;  3BII D;  1WMH A;  2GBN A;  2L0T A;  3W5U B;  1TGZ B;  1JRU A;  1ZE3 D;  4E74 A;  1L6U A;  4Y94 A;  4JLC A;  3GE8 C;  1CQV A;  3UQA A;  3MTN B;  3ZW3 A;  2FJU B;  1GOZ A;  1U27 A;  4YWG G;  1WRI A;  2GCL A;  2BBC A;  4MGK E;  5AZG A;  1YN3 A;  1VDV A;  1WSP A;  3KUD B;  3GE3 C;  2G3Q B;  1DYN A;  1OTR B;  2BS4 B;  3TBL D;  4KZC A;  2WYQ A;  3ODO A;  4LNN A;  2VRR B;  4IAP A;  1FRR A;  3SR6 A;  4AUQ C;  2C7M B;  1MI1 A;  1F77 A;  4WQM A;  4ZOH C;  2ZZP B;  4AOF A;  2COD A;  4P6V F;  1QKZ A;  3F0W A;  2KKC A;  3V61 A;  3Q8C A;  4M00 A;  3A9K B;  5CHW A;  4NY0 A;  4BBN F;  4K3C A;  2O2V A;  4LJO B;  4IWO A;  1J7A A;  3J9C A;  3PRM B;  3Q8B A;  4I6L B;  2G45 B;  3KVF B;  4HCN B;  3TEW A;  2EEL A;  1OQN A;  1FCL A;  1AYF A;  3A8P A;  1MIX A;  2RSG A;  1NI2 A;  2NBV B;  3RD2 A;  4P1C C;  4BOZ B;  4MGI E;  1C3T A;  1YJ1 A;  2VRW B;  2BF8 B;  1JRP A;  3HW2 B;  2ZKM X;  1QOF A;  2JPH A;  4GB9 A;  1JWU D;  1K50 A;  1MK7 B;  1I4Q A;  3TFM A;  2R2O A;  3QIJ A;  2BGF A;  3ZRC A;  4FJV B;  4UDU C;  2R2Q A;  2YS1 A;  5I2M A;  1L6V A;  4ZRI A;  2RRF A;  1I2H A;  2IGH A;  2MW5 A;  3A9K A;  4Q2J A;  3V6E B;  1NYQ A;  5DHA B;  2IBI B;  5LG4 B;  4IWP A;  4USA A;  1ZXI A;  2MX2 A;  2OJW A;  4DXG A;  4WWO A;  1X05 A;  1QZE A;  5HE1 A;  2DLW A;  2IPK D;  2WXG A;  2K00 A;  3W1S A;  1L4Z B;  1E7V A;  2K2J A;  5CHV C;  1YOV B;  4WVF B;  1K53 A;  1WR6 E;  2R2Y A;  1WGR A;  2DYQ A;  2C60 A;  3OJ3 A;  1J7B A;  3U7Z A;  4ZHO A;  4AJY B;  3NWF A;  2K6Q A;  1XD4 A;  4RM8 A;  2WXO A;  3DXC A;  2EKI A;  2NTS A;  3DBR B;  1U5E A;  2X38 A;  3RUL A;  2OQB A;  2INC C;  1ZVR A;  1TQZ A;  2MH7 A;  2A5U A;  2CS4 A;  2Y5B B;  2NR2 A;  3DXE A;  3HIZ A;  1SE3 A;  3RPF C;  4EZK A;  3KUC B;  3P1M A;  2GMI C;  3CWI A;  2VKI A;  1D5X C;  4ASW C;  4G50 A;  2DAJ A;  2FCS A;  2YEP B;  2Y7B A;  4M02 A;  4KAX B;  2LI5 A;  4P7I A;  2FIF A;  4WSF A;  1XLO A;  4GMV A;  3KRW A;  4QJ4 B;  3SFE B;  1Q1O A;  3ZYY X;  1RRP B;  2B3A A;  1VR9 A;  1U2B A;  4DHZ B;  3KY9 A;  1X1F A;  3ZJV A;  3WA0 A;  4A9A A;  2WXP A;  1WXS A;  2LAS A;  1HZ6 A;  3KZ1 A;  3AUL A;  3Q3F A;  3DBH I;  3R7Q A;  4RNA A;  3HHM A;  3ETR A;  3IXS A;  3M63 B;  2J52 A;  2HTM E;  2WXI A;  3PS6 A;  4N59 A;  1QLB B;  2N7J A;  1SXT A;  3AI5 A;  2VSZ A;  3AEC B;  3TIX A;  3VRA B;  3W1Y A;  4A3P A;  3B2G A;  2RPV A;  3TVV A;  4EUT A;  4FN2 A;  1E9M A;  1S1Q B;  4B0M A;  3RCP A;  2LGS A;  3Q2A C;  3I3T B;  1YD8 U;  1ZXH A;  2GOW A;  2Z8L A;  4ANV A;  3H7P B;  4GZU A;  2M4N A;  2IFS A;  1U4A A;  5IN7 A;  1EO6 A;  2RDH A;  2L32 A;  1FM0 D;  3PSC A;  2DHK A;  2YRY A;  3HRD D;  2CRF A;  1QOB A;  5BO4 B;  3B77 A;  2X8X X;  1EWC A;  1HTO A;  4MEL A;  4XYC A;  1EU3 A;  4IWQ A;  1NEK B;  2UU7 A;  3UGB B;  2RDG A;  2AYO B;  4TKN A;  2OED A;  3NJT A;  4OHJ A;  3L17 A;  2WX0 A;  3AMZ A;  2WDQ B;  2N1V A;  3IT6 B;  2L8J A;  2LVO A;  2PPH A;  2V4I B;  1R4N I;  3V3X A;  1MAI A;  1OMW A;  1X1M A;  3D8E A;  4K7S A;  4NJ6 A;  2CU1 A;  4A6Q A;  4AJW A;  1BT0 A;  3VXW A;  2DLB A;  4A55 A;  3DWG C;  2LFI A;  2Y5C A;  3A98 B;  2DZK A;  1VJK A;  1WWT A;  4XX5 A;  5JZE B;  4WAA A;  1F1H A;  5JXV A;  3TEX A;  5FKA C;  3NVZ A;  3SU8 X;  3AEG B;  2CJN A;  3K9O B;  1UWM A;  3ULC A;  3EEC A;  4EMO A;  3AM9 A;  2JZ3 B;  1SJH D;  1Y56 A;  3RNA C;  1BML C;  1T0S C;  1P5T A;  1VZ7 A;  3L4P A;  4EEW A;  3H1U A;  4F7H A;  2C7H A;  1TKG A;  5DCN A;  2YT0 A;  1IP9 A;  1UBI A;  1TZ1 A;  3H8H A;  3NS1 A;  5LXI B;  3HM6 X;  1I7A A;  4MJS B;  2WXN A;  1E5W A;  2GJY A;  4ANW A;  5KQ1 A;  4JX1 C;  3FIL A;  3GZN I;  3N3K B;  3NW8 A;  1WGK A;  2PE6 B;  5HHD G;  1M4V A;  3WAN A;  3AE3 B;  4D6W A;  1BTK A;  2D9Y A;  4AQ7 A;  3RNE C;  2KVR A;  5JH5 C;  3ZXR A;  4OW0 A;  1HXY D; 
#chains in the Genus database with same CATH homology
 2V1Y A;  1N3H A;  3DBL I;  1LW3 A;  3CXB B;  3WIM A;  3UZT A;  2X18 A;  1WFY A;  5KHO A;  4GU2 A;  2CHW A;  2LVQ A;  3QHT A;  1ZGU B;  4WJN A;  2UWQ A;  2V76 A;  4WJO A;  3PRZ A;  3DCG A;  4FAD A;  5JHG A;  2KWC A;  3EHV A;  3NSU A;  2YF0 A;  1WJ6 A;  2RUK B;  2YVC A;  2KFJ A;  4HDO A;  1P98 A;  1UEL A;  2LRU A;  4K7U A;  3APC A;  2ADZ A;  1FAO A;  3ODW A;  1XR0 B;  2RGF A;  3NS8 A;  2KTR A;  2JP2 A;  1L2N A;  2KC1 A;  1LFD A;  3D32 A;  2NZ8 B;  1V6E A;  3SD5 A;  4GXB A;  4K2O A;  3L0W B;  1IRS A;  3CSF A;  4HWI B;  4JIO U;  3M62 B;  5FR6 A;  1B55 A;  1XD3 B;  2KHW B;  2DHJ A;  4W9C A;  4URK A;  3HK0 A;  1KZ7 A;  1HE8 A;  4WJ7 A;  1ZW7 A;  2N7E A;  2FAZ A;  3SUZ A;  2C7N B;  1J19 A;  1V5U A;  3P7Z A;  2KX0 A;  3DDC B;  3T06 A;  1E8W A;  2LD9 A;  1V9J A;  2XK5 A;  2KGX B;  1RLF A;  3PVL A;  3VQI A;  1M7E A;  4DX9 0;  4TUU A;  2ASQ A;  5CHF A;  4BKS D;  3QA8 A;  1I42 A;  3OJ4 B;  2R0D A;  3LDZ E;  1UH6 A;  1WJ1 A;  2KUP A;  2QHO A;  2JUO A;  3PPA A;  2DZJ A;  3FM8 C;  5DI9 B;  2KO3 A;  2IY0 B;  4NQK E;  3N32 A;  3QCA A;  3ZLZ A;  3RT3 B;  4HPL B;  4GGQ A;  5C5B A;  1YQB A;  2BWE S;  2MWN B;  2JZZ A;  2MP2 A;  2GBJ A;  2LGX A;  4MSM B;  4MGY E;  4W9D A;  3A1Q B;  4TV3 A;  2UZS A;  2DX5 A;  2NBU A;  3DVG Y;  3N30 A;  3PLU A;  4E3C A;  2QKM A;  2PJH A;  3V62 A;  4KVG B;  2LUL A;  3U7D A;  4DHJ B;  2ZEQ A;  5D94 A;  4DK5 A;  2BYF A;  1AAR A;  2ELB A;  2E2X A;  2W2W A;  1V49 A;  2CKH B;  2NPT B;  1CMX B;  4HDQ A;  3WAP A;  3VTV A;  2RD0 A;  4HB0 B;  4XWX A;  4ZRJ A;  1C1Y B;  3DPD A;  1X1G A;  1PLS A;  5J3Q A;  4II3 B;  2L1C A;  3ZDT A;  2D9Z A;  4E71 A;  3BJI A;  3QC8 B;  2DHI A;  2ZNV B;  2KTF A;  3F5R A;  1H10 A;  2XQN M;  4FJZ A;  2H7D A;  3ZNH B;  1R4M I;  3SO6 A;  2GBR A;  2KAN A;  2WX1 A;  1ZM0 A;  1NDD A;  4AJW A;  4BBN C;  1Y8R C;  2PZ1 A;  1UNR A;  1XX0 A;  4NNJ B;  2I1K A;  4HAZ B;  1OGW A;  2MBE A;  3TL5 A;  3ML4 A;  2KOX A;  1GC6 A;  1ZSQ A;  3PP2 A;  5KHQ A;  4Z2M B;  2KMA A;  1WX8 A;  1L7Y A;  3CIK A;  1WE7 A;  2KX3 A;  5C16 A;  2K8H A;  2KXJ A;  3VUX A;  2D9V A;  4KSK C;  3WAM A;  4EFO A;  2LGY A;  2MLB A;  2O6V D;  3FEH A;  2M1M A;  4MY6 A;  5FI0 A;  3KYC D;  5L83 A;  1WJM A;  1K5D B;  1V80 A;  2G35 A;  2L00 B;  3L13 A;  3QX1 A;  4ANX A;  1V5P A;  3BIN A;  5D3W A;  3G9W A;  4M0W B;  4MGZ E;  5D2M B;  2N9X A;  2DFK A;  3NZU A;  1TXD A;  3UIP B;  2WWZ A;  3TO1 A;  3A9J B;  5TR5 A;  4HVB A;  2PEA A;  1XOD A;  3PTF C;  4XC2 A;  1DDV A;  4HAT B;  2MQJ A;  2L0F A;  2IO3 B;  2G4S A;  2EMT A;  4EKU A;  3L08 A;  3QAQ A;  5C1Z A;  1Q67 A;  3B0A A;  3DVN U;  4IUM B;  3ZRF A;  2JVC A;  4Z2N A;  5AEK B;  1X11 A;  3R66 C;  2DYM A;  5J17 A;  1UEF A;  4MSQ B;  4IM0 A;  4PYU A;  5JHA A;  5DPW A;  3CST A;  4ANV A;  2FCQ A;  4FA6 A;  4PS8 A;  2COA A;  5CLQ B;  5L81 A;  3M3J A;  4K1R B;  4WWP A;  3PG7 A;  3ONS A;  2MRP A;  3SNH A;  3ECI A;  2KJH B;  2G4D B;  2IZV B;  3JVZ X;  4MEM A;  4A6K A;  2J0M A;  1RFA A;  2O6V A;  1WJN A;  1TJ6 A;  1FXT B;  4IM3 A;  4M8N A;  3UF8 A;  3VFK A;  1OEY A;  3QJZ A;  4MM3 A;  4FHK A;  1Y5O A;  1XKE A;  3LJU X;  3OAW A;  3QWZ B;  4DDG D;  2FUH B;  1WIA A;  2W9N A;  1E7U A;  4ANU A;  3ULB A;  4PS7 A;  3IVF A;  4BVU C;  3O96 A;  1WMH A;  2GBN A;  1MKE A;  2L0T A;  2ROZ B;  1TGZ B;  2KLC A;  2ZJD A;  1ISN A;  1JRU A;  4E74 A;  2CR5 A;  2Z0O A;  1NU2 A;  3ML9 A;  3U30 A;  4Y94 A;  2RNR B;  4JLC A;  2LRW A;  3ML8 A;  2IYD B;  3UQA A;  1S3S G;  2PE9 A;  3MTN B;  1BWN A;  2Q13 A;  4WWN A;  3ZW3 A;  4HB3 B;  2KWV B;  1UGM A;  2KMC A;  4B95 A;  5G2N A;  1U27 A;  2N9E B;  2ZCB A;  1BTN A;  2GCL A;  5J3T A;  3EFU A;  4MGK E;  2DEN B;  3DBR I;  5CX3 A;  2KTR B;  1AWE A;  5AZG A;  1OEY J;  1SGH A;  3W1S C;  2DYO A;  3IBE A;  4ICU A;  4NQL B;  3ZKJ C;  4DWF A;  3QQ8 B;  3KUD B;  2G3Q B;  2LJ5 A;  1DDW A;  1DYN A;  2COF A;  1OTR B;  3TBL D;  1AQC A;  3PRP B;  3X0W A;  1V5T A;  5C5B B;  3S2A A;  4KZC A;  3JSV A;  2WYQ A;  3ODO A;  2W2X D;  4XZ4 A;  1E8X A;  2KDF B;  3ODX A;  2VRR B;  4IAP A;  3LJ3 A;  2D07 B;  4X57 B;  2NS5 A;  5AZH A;  5J18 A;  2HJ8 A;  4II2 B;  3V60 A;  4AUQ C;  1VCB A;  2C7M B;  4GDL B;  4B9K A;  1U5F A;  5JP4 A;  5D7G A;  3AJ4 A;  1V2Y A;  2ZZP B;  2K8C A;  4AOF A;  1EGX A;  1RAX A;  2NVU I;  4GMX B;  4EZL A;  4B6H A;  4MJS A;  1Q0W B;  3TW1 A;  4K81 A;  4KHO A;  2BKR B;  1Z5S B;  2COD A;  1GUA B;  2XK5 B;  1FHW A;  1EF1 A;  2I5C A;  3F0W A;  2KKC A;  2XEW A;  3A4S C;  3V61 A;  2MA9 B;  1TTN A;  3VAW A;  2HD5 B;  2XBB C;  3A9K B;  5CHW A;  4F1S A;  3PHX B;  2C5L C;  2NPT A;  1EUV B;  4NY0 A;  4BBN F;  4F7Z A;  2O2V A;  1WGU A;  4LJO B;  2KQS A;  2Z0E B;  2RVB B;  2DHZ A;  4WJP A;  2KC2 A;  2DN6 A;  4IWO A;  2P0F A;  2EKE C;  5DH9 B;  4KIK B;  5DPR A;  3N7C A;  3M1I B;  2ZVN A;  3ZTD A;  1OQY A;  3PRM B;  4HK2 A;  4I6L B;  2G45 B;  2CHX A;  2FCN A;  3KVF B;  4HCN B;  1EVH A;  4ZRK A;  1LQB A;  1ZC3 B;  1OQN A;  2DX1 A;  1OY2 A;  1T0Y A;  4GN1 A;  2Y8F A;  4W9L A;  3A8P A;  1WR1 A;  4NSW A;  1FB8 A;  1XQQ A;  1KLV A;  2DTC A;  3H9D A;  1MIX A;  2IO0 B;  4NJ7 A;  2RSG A;  5HE0 A;  1GC7 A;  2UZR A;  2BYE A;  3H7S A;  3JYU A;  2K2U A;  1WYW B;  1NI2 A;  3NHE B;  1GNU A;  4K2P A;  2NBV B;  3SHQ A;  4EOY A;  1ZKH A;  1E90 A;  3H6N A;  2HTH B;  1WY8 A;  3RD2 A;  5L95 C;  3PEG A;  4A6F A;  4NAW B;  4BOZ B;  5E6P A;  4MGI E;  2LXA A;  3ZUN A;  1YJ1 A;  2YS5 A;  4WQO B;  5AZF A;  3DVG X;  4BKT A;  2VRW B;  4PYZ A;  2BF8 B;  3HW2 B;  4BKS A;  2KDI A;  1W1G A;  5HE3 A;  3KUZ A;  3ZVV A;  2DA0 A;  2JPH A;  1WGQ A;  4GB9 A;  5LOP B;  2EC1 A;  1MK7 B;  1WI1 A;  3OLM D;  4HCP B;  1V88 A;  1W1H A;  5G55 A;  3ZO5 B;  5LXH A;  3TFM A;  1TBE A;  3QIJ A;  2R2O A;  3A9J A;  5DIF B;  2BGF A;  3C0R B;  3ZRC A;  1Z87 A;  2W2X C;  1FGZ A;  2MKR A;  1LM8 B;  4HAV B;  1V5M A;  2MBQ A;  2YLM A;  3PT2 B;  4FJV B;  5GMV A;  2P0H A;  1BAK A;  2R2Q A;  1WM2 A;  1X86 A;  2YS1 A;  4KIK A;  2M8S A;  1WF9 A;  1IP9 A;  3NZS A;  4ZYN A;  4ZRI A;  2M14 A;  2DZI A;  2JRI B;  4LCD E;  2K6D B;  1WMH B;  4ZDV A;  1I2H A;  1K5G B;  1RJ2 A;  2MW5 A;  5C23 A;  1P0R A;  1YIW A;  3A9K A;  3V6E B;  1WM3 A;  3DOW A;  2DKP A;  2IBI B;  5D27 A;  5DHA B;  2J7Q B;  4IWP A;  1A5R A;  1E8Z A;  2MX2 A;  2L76 A;  2DAF A;  2JY6 A;  3D8F A;  4I6P A;  4WWO A;  4LDT D;  4LDT B;  3QBV B;  1X05 A;  4L6E A;  1QZE A;  1WJ4 A;  5HE1 A;  1WZ3 A;  5J2R A;  2DLW A;  4GDK B;  3O65 B;  3ZIM A;  4IW0 A;  2K00 A;  2COC A;  4C0A A;  2ELA A;  3W1S A;  2KCJ A;  1E7V A;  5JHB A;  2D9W A;  2K2J A;  5CHV C;  3A4R A;  3RZW C;  3TMP B;  3BY4 B;  1KOT A;  4K7W A;  4OVU A;  4WVF B;  1WR6 E;  2BPS A;  1J8C A;  2D2Q A;  2UYZ B;  5CLL B;  1WGR A;  1PMS A;  2DYQ A;  2C60 A;  4W9K A;  3OJ3 A;  2M38 A;  2AEH A;  2A4Z A;  4BKG A;  3L16 A;  2ROV A;  2KFK B;  3V6C B;  4AJY B;  1P3R A;  2K6Q A;  3JSV B;  3T9L A;  1GJZ A;  1XD4 A;  3A1Q A;  4RM8 A;  3DXC A;  4HAW B;  2FCM A;  4LJP B;  3WAL A;  4CHM A;  1U5E A;  3RUL A;  2Z59 B;  2OQB A;  3VUW A;  3ZTC A;  1ZVR A;  4JQW C;  1TQZ A;  4IOY X;  1SE9 A;  2A5U A;  2CS4 A;  2Y5B B;  3AXC A;  4G0N B;  1QC6 A;  1WVH A;  4YON A;  2NR2 A;  1J0W A;  2Z0D B;  3L54 A;  4JL9 A;  2L7R A;  3PGE A;  4IM2 A;  3DXE A;  1WXM A;  1U5D A;  2KDB A;  2ZPY A;  3HIZ A;  4W9F A;  5E6N A;  3ZDM C;  4GOC A;  2KQ7 A;  2N23 A;  1MIZ B;  2NMB A;  4EZK A;  1WGD A;  1WX9 A;  3Q3J A;  5LLI A;  3SDL C;  3KUC B;  1C3T A;  2I1J A;  2GMI C;  2VKI A;  4ASW C;  1V81 A;  2MBO A;  2MFQ A;  3DQV A;  3PSE B;  2DAJ A;  4G50 A;  2FCS A;  2KWU B;  2Y7B A;  4GDK A;  4J6I A;  4RM9 A;  5E6O A;  4EZJ A;  3KW5 B;  4KAX B;  2LI5 A;  2LKO A;  5FI1 A;  3MHS D;  1G6J A;  4P7I A;  4HB2 B;  1UD7 A;  2FIF A;  4WSF A;  3VHT C;  3KRX A;  4GMV A;  2LZ6 A;  4DBG A;  3RCZ A;  3KRW A;  4FJY A;  3DVN V;  2LOZ A;  2HE7 A;  1Q1O A;  2LG1 A;  4FBJ B;  2Y8G A;  1PFJ A;  1RRP B;  3QK0 A;  2B3A A;  2GBK A;  2AWT A;  3AU5 A;  1U2B A;  3KSY A;  4RMA A;  4DHZ B;  2P0D A;  4HAU B;  1KI1 B;  3AU4 A;  3KY9 A;  1X1F A;  4A6H A;  3WA0 A;  4FLH A;  4HLE A;  2ZVO A;  4HJK A;  2C9W B;  1WRD B;  5DPS A;  1WXS A;  1DBH A;  1UNP A;  2LAS A;  4OVV A;  2BCJ A;  2EMS A;  4GPT B;  4HHV A;  2ZNV C;  3KZ1 A;  3AUL A;  1WH3 A;  3Q3F A;  2V4L A;  1W1D A;  1J0G A;  1V61 A;  3DBH I;  3FSS A;  3R7Q A;  1Z2M A;  2D9X A;  2QKL A;  1H8C A;  1UZX B;  3HHM A;  4A3O A;  4F7U P;  3M63 B;  1WXA A;  4KHA A;  4A6F B;  2BKF A;  4F7G A;  2J59 M;  2CHZ A;  2H7E A;  4NPN A;  3PS6 A;  1XCG A;  2LGD A;  4ICV A;  2N4F A;  2RGN B;  5D3Y A;  2DYB A;  4CHJ A;  5EDS A;  3APD A;  3AI5 A;  2VSZ A;  3KH0 A;  1D3Z A;  1U29 A;  3OAN A;  4D0N B;  1EF5 A;  1Y19 B;  1YX5 B;  4HPM B;  3RZF A;  3VH3 B;  2ZCC A;  4CHK A;  4MK0 A;  1WGG A;  4I6N B;  4M8M A;  3TIX A;  3W1Y A;  4A3P A;  5D3X A;  2D10 A;  2IY1 B;  3IHP C;  2FID A;  2Z0Q A;  3TVV A;  2L2I A;  2GBM A;  4FN2 A;  4EUT A;  4DXA B;  1DRO A;  1SIF A;  4KDL B;  3DXD A;  4AWJ A;  2DX5 B;  2M0X A;  1IYF A;  4A5K A;  1S1Q B;  3ZNG C;  5JLJ B;  2LVP A;  4W9E A;  2FJL A;  3RCP A;  2AL6 A;  1RRB A;  2KJ6 A;  4KZ0 A;  2MCN B;  3TJP A;  3VVW B;  3ZNZ B;  4A20 A;  2CAY A;  4YL8 A;  3IFW B;  1WG7 A;  2DZM A;  3I3T B;  1YD8 U;  4DX8 A;  3X23 A;  2OTX A;  3UIO B;  4IC7 B;  4BOS C;  1NTY A;  1WGH A;  2R09 A;  2GOW A;  2OOB B;  3IG3 A;  2Z0P A;  5CTR C;  3K9P B;  2DKQ A;  5GOW B;  4G11 A;  4H8S A;  5EFX A;  3VH4 B;  2BWF A;  5DPT A;  2KLG A;  4KV2 A;  2MSE D;  1WGY A;  2CY5 A;  4MH0 E;  3H7P B;  4CO7 A;  4GZU A;  2M4N A;  2IYB A;  3PZD A;  2MBH A;  2IFS A;  3MDB C;  2MWS B;  2RSU A;  1SHC A;  1U4A A;  1WX7 A;  2D3G A;  4TQ1 A;  1EO6 A;  3ZNI D;  4GDL A;  5HKH A;  3VOQ A;  4KSL C;  1ZC4 B;  2N9P C;  3PSC A;  1WI0 A;  1U5G A;  1V89 A;  1WZ0 A;  2FNJ B;  2YT1 A;  2DHK A;  1WJU A;  2D11 A;  2YRY A;  3GOE A;  5IA7 A;  2L3Z A;  4W9H A;  2CRF A;  5BO4 B;  2K1F A;  2KD0 A;  3A33 B;  4HXD A;  5C79 A;  4MEL A;  3A8Q A;  3VTU A;  4IWQ A;  4FHJ A;  1MG8 A;  2YS3 A;  1F9J A;  2J0K A;  3UGB B;  2AYO B;  4TKN A;  3L17 A;  4W9I A;  1P6S A;  1IPG A;  2MBB B;  2RR9 A;  3VUY A;  4IG7 B;  2D4Q A;  3EC8 A;  2WX0 A;  1MK9 B;  3QWM A;  4MT7 A;  1P3Q U;  2JRH A;  2K25 A;  2K39 A;  2N1V A;  5KQ4 A;  2JXX A;  2L8J A;  2LVO A;  2PPH A;  3APF A;  3P6A A;  1R4N I;  2REX A;  3PV1 A;  1MAI A;  1K8R B;  2BYV E;  2ZPN A;  1OMW A;  1X1M A;  3D8E A;  4K7S A;  4NJ6 A;  2CU1 A;  1E8Y A;  4G3X B;  1M94 A;  5D3V A;  3DBS A;  1VD2 A;  1BT0 A;  1YX6 B;  3M95 A;  3SYX A;  2YSZ A;  3PHW B;  3VXW A;  4K17 A;  3H7P A;  3JW0 X;  1I35 A;  4BBK A;  3L10 B;  5HE2 A;  2UVM A;  3A98 B;  2DZK A;  4FUL A;  3B08 A;  4CYE A;  2AL3 A;  2JT4 B;  3R3M A;  1NTV A;  3SV1 A;  3NOB A;  4XX5 A;  5JZE B;  2WDT B;  4WAA A;  4PS3 A;  4JGH B;  1DDM A;  1XT9 B;  2O6V B;  4NAW A;  4TQ0 A;  2DYN A;  3VIA A;  2HTH A;  2OJR A;  3PVW A;  2MP2 B;  2N1W A;  3PRE A;  3SU8 X;  3UQB A;  1P9D U;  1WE6 A;  3HQC A;  5LON B;  3K9O B;  5JHH A;  3MJW A;  3QAR A;  3GYO A;  1H4R A;  4KHB B;  3ULC A;  3EEC A;  4GIV A;  1LB1 A;  2V3S A;  1V5O A;  2IO1 B;  4EMO A;  2L05 A;  3V5W A;  1Q5W B;  1FHX A;  2NBW B;  2LWP A;  2JZ3 B;  1MPH A;  1FGY A;  4EJN A;  5C6R A;  1WXV A;  2K8B A;  1KJT A;  2JWZ A;  4W9G A;  3CF6 E;  3ENE A;  3ZVR A;  5D6J B;  2EJ8 A;  3ALB A;  4IFS A;  2M17 A;  4DHZ E;  2GCJ A;  2RLO A;  1P5T A;  2GS0 A;  5J3Y A;  3RYT A;  2LOX A;  1UNQ A;  4HAY B;  3NY5 A;  4MDK E;  3H1U A;  4DBB A;  3PVU A;  3VDZ A;  4EEW A;  2KN5 A;  2I5F A;  3TCA A;  4F7H A;  2C7H A;  5DCN A;  2YT0 A;  3VTW A;  1UBI A;  3RUI B;  4TYZ A;  4F8C B;  2P8V A;  2J0J A;  4DHJ D;  1NBF C;  3GYP A;  1TZ1 A;  3WYF B;  1GG3 A;  4DDI D;  2JF5 A;  3U8Z A;  5LXI B;  1UPR A;  4BFR A;  2KNB A;  1UBQ A;  1V86 A;  2LXC A;  1I7A A;  2N7D A;  3HM6 X;  2NCN A;  4MJS B;  4PNK A;  1KM7 A;  1E5W A;  2MDX A;  2GJY A;  2KDE B;  1PQS A;  2CY4 A;  1KZG A;  2LYD A;  5DHF B;  2KK8 A;  4N9F 4;  3PLV A;  4ANW A;  5KQ1 A;  2LUE A;  3T8M A;  3WAO A;  3GZN I;  3KYD D;  4AP4 C;  2N0Y A;  3N3K B;  4HB4 B;  1FHO A;  1QQG A;  5IAA C;  3HM3 A;  3MPX A;  2O2V B;  2PE6 B;  4HAX B;  4W9J A;  1UPQ A;  3B1L X;  1LXD A;  1EAZ A;  2KJR A;  3CMM B;  3R7R A;  1M7R A;  4KDI C;  3UIN B;  1BTK A;  2D9Y A;  2KFK A;  2KZR A;  2RPQ A;  3WAN A;  4PQ0 A;  4B6W A;  2KVR A;  2IO2 B;  1FOE A;  5KCV A;  4WJQ A;  3D8D A;  1P1A A;  4GSW A;  5JH5 C;  3P2B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...