4GN1A

Crystal structure of the ra and ph domains of lamellipodin
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
251
structure length
251
Chain Sequence
VKKLVIRVHMSDDSSKTMMVDERQTVRQVLDNLMDKSHCGYSLDWSLVETVSELQMERIFEDHENLVENLLNWTRDSQNKLIFMERIEKYALFKNPQNYLLGKKETAEMADRNKEVLLEECFCGSSVTVPEIEGVLWLKDDGKKSWKKRYFLLRASGIYYVPKGKAKVSRDLVCFLQLDHVNVYYGQDYRNKYKAPTDYCLVLKHPQIQKKSQYIKYLCCDDVRTLHQWVNGIRIAKYGKQLYMNYQEALK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of Lamellipodin implicates diverse functions in actin polymerization and Ras signaling.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords Ras-associated and pleckstrin homology domains-containing pr
total genus 69
structure length 251
sequence length 251
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2012-08-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00169 PH PH domain
A PF00788 RA Ras association (RalGDS/AF-6) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 4gn1A02
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 4gn1A01
4KHOA 4MSMB 1WJNA 2XBBC 3VIAA 2FCQA 3JVZX 4WJPA 4KIKB 4M8NA 3ZNID 4JQWC 1R4NI 2MWNB 3DBSA 2P0FA 5CX3A 5FR6A 2K39A 3UINB 1C3TA 2KUPA 2CRFA 2IZVB 5KHOA 4ASWC 4BBNC 1M7RA 1U5FA 4GGQA 2K2JA 1J0GA 4NJ7A 1WM2A 1OEYJ 1GJZA 1MK7B 4GB9A 3NS8A 4OVUA 3ODWA 3TW1A 1P1AA 3QIJA 1U5EA 3CSFA 4HJKA 4A3OA 1WYWB 3APDA 4FHKA 2N7DA 4W9HA 3A9KB 2WX0A 4A20A 3PHWB 2KDIA 1P3QU 3P6AA 3ZTDA 1TJ6A 2AYOB 3ULCA 3FSSA 4KAXB 2MP2A 2PE6B 4MGZE 3B1LX 1P3RA 2Z59B 4W9DA 1TXDA 3MTNB 2ZNVC 3VH3B 2FAZA 2M14A 3QWMA 1WZ3A 3QX1A 1QC6A 2ROVA 2IO0B 1TBEA 3TIXA 1J8CA 2KDEB 2LRWA 4E74A 3V6EB 4HAUB 1FGYA 3HW2B 1SGHA 4Z2NA 1V9JA 2KTRB 3UZTA 2MRPA 2UWQA 3DVGX 2MBBB 3DVGY 4GOCA 4IWPA 4J6IA 5L95C 3DBHI 4HCPB 1IPGA 2KQ7A 4PS3A 5FI1A 1WM3A 3DXDA 2DYBA 2MLBA 3MDBC 1XX0A 1QQGA 3M1IB 2KKCA 2NBUA 3RD2A 3W1YA 4JGHB 1NTYA 2OQBA 1LFDA 3T8MA 2KDFB 2PPHA 1Y5OA 2FNJB 2RGFA 5IAAC 3TJPA 2D2QA 1KI1B 4DHZE 2RUKB 2MX2A 4BBNF 2JUOA 5KQ1A 1U5GA 2MQJA 4XZ4A 1EVHA 2KFJA 2ZJDA 2JXXA 2NVUI 1U29A 1U2BA 2DYQA 2DZKA 4K1RB 2Z0QA 1WF9A 2C9WB 2G4DB 1TTNA 2R2OA 4M0WB 1FAOA 2D3GA 3H7PA 4PYUA 3KYDD 3TCAA 3V62A 2RSUA 1UBIA 1JRUA 1WXMA 2MW5A 3A4RA 3VQIA 3WAOA 1I42A 4BVUC 3VUWA 3MPXA 2N1VA 4KV2A 3DXCA 4HDOA 4F7HA 5E6PA 4GDLB 3RT3B 1UNPA 3GZNI 4I6LB 2C7MB 1N3HA 4WVFB 3PTFC 4URKA 4TYZA 2L8JA 2QHOA 1K5GB 3KRXA 2VKIA 1ZSQA 3ML9A 3VUXA 5HKHA 2CY5A 4IFSA 3Q3FA 1UEFA 2XEWA 2ZZPB 3RULA 2KLGA 4A6FB 3VDZA 1XQQA 2N9XA 4NAWB 2L1CA 1BAKA 2NPTA 1I7AA 2YS5A 2RSGA 2A5UA 3VTWA 1X05A 5DHFB 4Z2MB 4HPLB 4A6KA 1M94A 3KUCB 1CMXB 2LVOA 2DAFA 2IYDB 4G50A 1WMHA 3SDLC 3ZTCA 2BYFA 2BCJA 3TL5A 4RMAA 2KFKA 3CSTA 4BKTA 2GBNA 3RUIB 5IA7A 3H6NA 3WAPA 2UZRA 3ZIMA 3BINA 2ZCBA 3ODXA 3PZDA 2M17A 3KYCD 3ODOA 3M3JA 3ML4A 2KDBA 3UIPB 2V3SA 2WDTB 1P98A 1GG3A 3HHMA 5D6JB 2LGDA 2CODA 3C0RB 2LULA 4GDKA 4DDID 1MK9B 2D10A 5C5BB 2COFA 2ZVOA 1WZ0A 3HM3A 4WJNA 2ELBA 1GC6A 4DX90 4IG7B 2LASA 5C23A 2PJHA 4K7SA 1WG7A 1OGWA 2GBKA 2MBOA 3H1UA 2D9ZA 2Y8FA 2YT1A 2QKMA 2JP2A 1UZXB 3FM8C 1FOEA 3KUZA 3L17A 3OJ3A 4LJOB 3V5WA 2V4LA 3SO6A 2BKFA 2Q13A 1XKEA 3SV1A 1LQBA 3KVFB 3IFWB 3ZNZB 4BOZB 4HCNB 4HAXB 2J59M 2N9PC 1EUVB 2I5CA 1E90A 1WX9A 2I1JA 1WGRA 3EECA 3IHPC 2W2XD 3MHSD 4AJWA 4HAWB 4GDKB 1ZC4B 4F1SA 2COAA 5D3YA 1HE8A 2K6QA 1UPQA 4HB0B 2LVQA 2I1KA 4KSKC 4XX5A 4W9KA 3A8PA 2Y7BA 3A98B 4GDLA 1AARA 3L13A 1KZGA 2EMSA 3PRMB 2BF8B 3UQAA 3KW5B 3RYTA 1KM7A 1S3SG 2MA9B 2R09A 4GN1A 4B6HA 2M38A 3WALA 1DDVA 5DPWA 4WWOA 2EC1A 4HAVB 3L10B 1XCGA 1XODA 4MY6A 1WJ6A 3HK0A 4MM3A 3ZKJC 1WMHB 3VOQA 3TBLD 4ZRKA 2NMBA 1WRDB 3LJ3A 2NCNA 5G55A 3AJ4A 3DDCB 5DIFB 4DBGA 1MAIA 2KJ6A 4KHAA 1LM8B 1WI0A 4X57B 4EJNA 1MG8A 2LOXA 3W1SC 2Z0OA 2CAYA 4WSFA 2BWFA 3A9KA 3H7SA 5TR5A 3QAQA 2DFKA 2KVRA 4MGKE 5LOPB 2N0YA 2LGXA 1YJ1A 2DKPA 2P0DA 4WJ7A 5D27A 4F7GA 1RFAA 4BFRA 2BWES 1ZC3B 3HM6X 1KJTA 1V5OA 2LVPA 2LI5A 2W2WA 4MDKE 3OJ4B 4DK5A 4IWOA 5DPTA 3VHTC 2BGFA 3UIOB 2R0DA 3NSUA 2K25A 5C16A 2WYQA 4W9GA 3UF8A 4ZDVA 4GSWA 4LJPB 3GOEA 3L0WB 3ZUNA 5J17A 2NBWB 2YSZA 2DHJA 1WR1A 3DVNV 1V5TA 3P7ZA 3QARA 4FJYA 3U7DA 2MKRA 1GC7A 4K17A 4Y94A 5D3VA 5DH9B 1MIZB 2DYNA 1WJ1A 1WJ4A 1YX5B 2KXJA 4TQ1A 5DPSA 4MGIE 4P7IA 5D94A 2D9XA 4F8CB 4FJVB 1D3ZA 2V76A 3D8DA 2ZPYA 4IOYX 3PGEA 2L0FA 1U4AA 4K7UA 2ADZA 1FHWA 2D07B 3KZ1A 2RD0A 3ONSA 4ANVA 2NZ8B 4GPTB 2L3ZA 2L0TA 2N7EA 3PG7A 3K9OB 3NY5A 2AL6A 4EFOA 2G35A 1WGUA 3D8FA 5EFXA 1ZKHA 1GNUA 2ZVNA 3QWZB 4W9JA 1U27A 4ZYNA 4BKGA 4FBJB 4MH0E 1H8CA 3N3KB 2KMCA 3SYXA 4EZJA 2MP2B 2KC1A 1A5RA 3T9LA 2MSED 3RCZA 3QA8A 1E7UA 1S1QB 3BY4B 2NBVB 3IG3A 3U8ZA 2HE7A 2HJ8A 3M63B 4BOSC 1OQYA 4FHJA 4BKSA 2PEAA 1H10A 1YX6B 4I6PA 4GXBA 5CHWA 2BYEA 2G45B 4AJYB 2K6DB 3QJZA 2LZ6A 2KLCA 2JVCA 2GBRA 4TUUA 4WWPA 2M8SA 1X11A 4ZRJA 2RPQA 4B9KA 5HE2A 1EF5A 1WX8A 1UPRA 1WX7A 4HB3B 1V89A 1UNQA 4A6FA 2J7QB 2KZRA 4CHMA 1WJUA 5AEKB 2KN5A 3M62B 3X0WA 1OQNA 3UQBA 3ML8A 3ALBA 3PHXB 1NU2A 2HTHB 1TGZB 4W9LA 1LB1A 1E7VA 1Y8RC 3VH4B 2KX0A 1ZVRA 2DAJA 2O6VB 3L08A 2YLMA 2KO3A 2Z0DB 3R66C 5D2MB 5AZFA 3ZW3A 5L83A 2MDXA 2OJRA 1B55A 2AWTA 2KFKB 4ANXA 4EZKA 5LXIB 1J19A 4BBKA 2NR2A 1X86A 4IM3A 4MSQB 3ZRCA 5D3XA 3LJUX 2CU1A 2EJ8A 3PREA 3TFMA 1BTNA 3PVWA 5HE3A 4CYEA 4M8MA 2YS3A 4ZRIA 1WXVA 2DN6A 3CXBB 5HE0A 3AU5A 2DZMA 2J0MA 1RAXA 2IY0B 1T0YA 2EMTA 3WA0A 1Z5SB 3PPAA 4GU2A 4IW0A 2LG1A 2GS0A 3VFKA 3SUZA 2FCSA 3DBLI 3H9DA 3ZLZA 4AWJA 2LKOA 2CHXA 1W1HA 2G3QB 3Q3JA 5G2NA 1DDMA 4W9FA 1Q0WB 1KZ7A 5GOWB 2D9VA 1EAZA 2VRRB 2IO1B 1V49A 4FLHA 4PYZA 3ULBA 1UH6A 5JHGA 4GMVA 5FI0A 4ANWA 2KNBA 1BT0A 4DHJD 1V88A 3JSVB 4YL8A 2IO3B 1V61A 2NS5A 2KMAA 3S2AA 2M0XA 1FB8A 5KCVA 1WR6E 3X23A 2FIFA 3F0WA 2RLOA 1QZEA 2BYVE 2LRUA 1WI1A 4II3B 4IM0A 5JH5C 1E8YA 4MK0A 3N32A 2VSZA 4EOYA 4DDGD 1WFYA 5LXHA 5AZHA 4KHBB 4WAAA 1YD8U 2DX1A 4DWFA 3JW0X 2GJYA 2KWCA 2UYZB 5JZEB 1NTVA 4W9IA 3P2BA 1VD2A 5J2RA 3N30A 3NHEB 4KSLC 4MJSA 4TV3A 1YIWA 4PS8A 2M1MA 3KUDB 5J3QA 2FUHB 3TO1A 2N4FA 1X1MA 1J0WA 4DBBA 1UD7A 2JF5A 2C7NB 2K1FA 4WWNA 3UGBB 3V60A 4CHKA 2VRWB 1DROA 2YF0A 1UELA 1WGHA 1MIXA 5LLIA 2ELAA 1K8RB 2K8BA 2DLWA 3PEGA 2MBHA 3A4SC 3ECIA 3SD5A 1L2NA 1PFJA 1WJMA 2C5LC 3GYOA 2B3AA 5E6NA 2IFSA 3A1QB 4K7WA 1V81A 4A6HA 2KK8A 1ZM0A 4RM8A 3JYUA 1K5DB 4JL9A 4NJ6A 1P5TA 3AU4A 1W1GA 3G9WA 1X1FA 2LUEA 3EHVA 3M95A 4ICUA 4ICVA 3SNHA 3PVUA 1GUAB 3ZRFA 4CHJA 1UGMA 3FEHA 2KCJA 2Y8GA 3WAMA 2KTFA 1EO6A 3IVFA 2DA0A 3CIKA 3KY9A 3PV1A 3KRWA 3VTUA 4NY0A 1SHCA 1E5WA 1X1GA 2JY6A 4GMXB 2C60A 4BKSD 4E71A 1XT9B 5J3YA 2WWZA 2KHWB 2UVMA 1UNRA 2DHKA 4EMOA 3K9PB 2XQNM 4W9CA 4HB2B 4HXDA 3A9JA 5JP4A 2PE9A 4E3CA 4KZCA 1V5PA 1FGZA 3ZDTA 2D11A 5CLLB 1DBHA 4XWXA 2MWSB 3JSVA 1V6EA 3OAWA 4IUMB 2IBIB 4FN2A 4IM2A 4IWQA 3VAWA 1M7EA 2GOWA 3AXCA 1E8XA 2GBMA 2JRIB 2N9EB 4A3PA 5JHBA 3WANA 1SE9A 2XK5B 1U5DA 2RGNB 4KIKA 4HAYB 3SHQA 2JZZA 2V1YA 3D32A 5GMVA 2Z0EB 1IP9A 2ZCCA 1Z2MA 2WX1A 4KDLB 4NQLB 5CTRC 2JZ3B 1PQSA 4K2OA 5JHHA 1WE6A 2N1WA 1KOTA 2MBQA 1DDWA 2UZSA 5C1ZA 3PRPB 1V5UA 4G0NB 2W2XC 3QCAA 1YQBA 3QBVB 4MELA 3WIMA 3TVVA 1NDDA 3DOWA 4WJQA 2Y5BB 1W1DA 1WXSA 2OOBB 4IC7B 2L05A 1V86A 3B0AA 5DHAB 1XR0B 2N23A 2L76A 5D7GA 1XD4A 4TKNA 1C1YB 2XK5A 3LDZE 3ZVRA 2BPSA 2DYMA 2KOXA 3R7QA 3QC8B 2JRHA 4DX8A 2YT0A 3EFUA 3NZUA 1WXAA 3QK0A 4AP4C 5D3WA 1NBFC 1DYNA 2KWVB 5CHVC 2KGXB 3RZWC 2HTHA 3ZVVA 1PMSA 3VTVA 2D9YA 1E8ZA 5DI9B 2IYBA 3T06A 3ZNGC 4WJOA 3R7RA 1ZGUB 3VUYA 1OY2A 4DHJB 3HQCA 2COCA 2IO2B 2O6VA 4LCDE 3RZFA 4HLEA 2KX3A 2JPHA 2DENB 3IBEA 1Y19B 4HDQA 1PLSA 5C6RA 2YS1A 1OMWA 1IRSA 4PQ0A 4DXAB 5CHFA 2KWUB 3OLMD 4F7ZA 1V2YA 4GIVA 5J3TA 4NNJB 4EEWA 2ZPNA 3WYFB 1TQZA 4OVVA 1IYFA 2DHZA 4NSWA 5LONB 1Q5WB 2O2VA 4PS7A 3VVWB 2MCNB 1FHXA 2DZJA 2AL3A 2G4SA 4W9EA 1I35A 3R3MA 1ZW7A 4LDTD 2Z0PA 4EKUA 1P9DU 3H7PB 3I3TB 4HWIB 2CY4A 3ZO5B 3RCPA 1FHOA 3U30A 2PZ1A 2K8HA 1AQCA 3V6CB 4HHVA 2KC2A 2BKRB 1V80A 2KTRA 2KANA 3DPDA 4KZ0A 2LYDA 4DHZB 1RJ2A 1WGQA 3GYPA 2HD5B 3W1SA 4PNKA 5J18A 3MJWA 1E8WA 2ROZB 2FIDA 4WQOB 4C0AA 5DCNA 4CO7A 3BJIA 5EDSA 4B6WA 1R4MI 1SIFA 3DBRI 1RRBA 3EC8A 1UBQA 1WGDA 3PT2B 3QQ8B 4LDTB 4KVGB 4JIOU 4MJSB 5DPRA 2CR5A 3PLUA 4KDIC 2K2UA 4MT7A 4NAWA 4D0NB 2KD0A 1ISNA 2K8CA 1BWNA 2H7EA 2L00B 3TMPB 3L54A 3APFA 2LXAA 2J0KA 2LOZA 4B95A 1MPHA 1VCBA 3NZSA 2C7HA 4NQKE 1Z87A 3QHTA 3KH0A 3ZDMC 4MEMA 4YONA 2RVBB 4HATB 1V5MA 4HVBA 4HPMB 4RM9A 1EGXA 3A33B 1RRPB 4G3XB 4II2B 2GMIC 3DVNU 2L2IA 4K2PA 1BTKA 4N9F4 2JWZA 4HAZB 4FADA 4MGYE 2R2QA 2O2VB 1WE7A 2D9WA 2DX5A 4FA6A 3ZNHB 2OTXA 3OANA 2ASQA 2NPTB 3DCGA 2DKQA 1NI2A 3PSEB 4EZLA 2KQSA 5KHQA 3B08A 1WIAA 4JLCA 2GCJA 2GCLA 2P0HA 1OTRB 2CKHB 5JHAA 2CHWA 2LWPA 2EKEC 2K00A 2W9NA 2D4QA 3DXEA 3APCA 4K81A 4AUQC 1F9JA 2IY1B 1AWEA 2REXA 3NOBA 3PS6A 2MBEA 2MFQA 3CF6E 4A5KA 1Q67A 1WGGA 2P8VA 2LJ5A 2YRYA 1L7YA 1RLFA 3DQVA 3KSYA 4H8SA 1WY8A 3L16A 2ZNVB 5AZGA 2A4ZA 1P6SA 2DX5B 3PSCA 3A1QA 4NPNA 3V61A 3F5RA 2DZIA 4EUTA 4HB4B 3N7CA 5CLQB 1WGYA 2GBJA 2M4NA 4G11A 2H7DA 4L6EA 2E2XA 1FXTB 5C5BA 2RNRB 3A8QA 4I6NB 2QKLA 2L7RA 5C79A 1OEYA 5L81A 2YVCA 2O6VD 4IAPA 1MKEA 1G6JA 4FJZA 2CS4A 2CHZA 3D8EA 3O96A 4GZUA 5JLJB 3PRZA 3PP2A 5KQ4A 3AI5A 2FCNA 2KJRA 2I5FA 2DHIA 3O65B 2AEHA 2LD9A 2J0JA 3ENEA 2JT4B 5HE1A 4F7UP 1Q1OA 1WH3A 2LXCA 2DTCA 4ANUA 2FCMA 1I2HA 3SU8X 1XD3B 3VXWA 1H4RA 3A9JB 2FJLA 2KJHB 1EF1A 1P0RA 1LXDA 2ZEQA 2X18A 3AULA 3HIZA 3PLVA 4TQ0A 1KLVA 4FULA 1LW3A 2LGYA 5E6OA 4AOFA 5BO4B 3CMMB 4HK2A 2RR9A 4XC2A 1TZ1A 3PVLA 2DYOA 1WVHA
chains in the Genus database with same CATH superfamily
4MSMB 1WJNA 2FCQA 4WJPA 2QIEB 4M8NA 4JQWC 1R4NI 2MWNB 1C3TA 2KUPA 2IZVB 4BBNC 1J0GA 1U5FA 2K2JA 2INNE 1T6BX 2BT6A 3J9CA 2L1AA 3NS8A 3ODWA 3TW1A 1P1AA 3QIJA 1XCTL 2NTTA 1RFKA 2WX0A 2KDIA 1TJ6A 1ZDVA 3FSSA 2Z59B 2H89B 2ZNVC 1TZOA 2IGDA 2QMTA 1J8CA 2IO0B 1TBEA 3ZJVA 4ACFA 2V9HA 3Q8FA 1V9JA 1FGYA 2ZJDA 4WWMA 2KTRB 3V6EB 3DVGX 1UGJA 2QC8A 2MLBA 2BTEA 1ACCA 3RD2A 2OQBA 1TY2A 2PPHA 2ZKMX 5IAAC 2MX2A 2JUOA 1V8CA 2K0PA 1UNSA 5IO9A 2NVUI 1U2BA 2DYQA 2Z0QA 2C9WB 4M0WB 2D3GA 3KYDD 3TCAA 3V62A 1UBIA 1YN4A 3VUWA 4KV2A 3DXCA 3BVZA 4GDLB 1N6ZA 3GP7A 3GZNB 4I6LB 1N3HA 3PTFC 4URKA 1ZSQA 1BMLC 3VUXA 4IFSA 4NAWB 3RNAC 3W2DA 2RSGA 4HPLB 1PFDA 1EU4A 3KUCB 1CMXB 4G50A 2BYFA 4P6VF 4RMAA 5IA7A 4CSQA 2UZRA 2MH7A 3KYCD 4NAMA 4KGRA 2I38A 3ODOA 1WYGA 3ML4A 4D2KA 5HFYA 2WDTB 2KDMA 3C0RB 1MK9B 5E6OA 1WZ0A 2ELBA 1GC6A 4IG7B 1ZXIA 1WG7A 2AQ1B 2VH1A 3H1UA 3TEZA 3L17A 1UZXB 2V4LA 3SO6A 2WS3B 2Q13A 1TKYA 3SV1A 1I4PA 1LQBA 3AE2B 3MHSD 2I1JA 1ZC4B 2K6QA 3A8PA 3C19A 3A98B 1AARA 5GXGB 2EMSA 2BF8B 4TSSA 4GN1A 3I5JC 3WALA 2PMVA 4WWOA 3L10B 1WJ6A 4MM3A 1IUEA 3VOQA 2RMMA 2NMBA 1WRDB 5G55A 3EGRA 4X57B 1PGAA 1MG8A 2CAYA 1GB4A 3H7SA 4MGKE 2WDVB 4WJ7A 3AE7B 5AUKA 1ZC3B 1V5OA 2LVPA 2WXOA 3R2IA 2W2WA 1ET9A 1XCQL 1I4XA 2WQYB 1BXTA 1E0ZA 3UIOB 2K25A 4W9GA 2CJNA 4LJPB 4XDDA 1TJEA 1WR1A 1V5TA 3DVNV 3QARA 3TEWA 2KJ6A 5D3VA 1NI3A 5DH9B 1MIZB 2DYNA 2D9XA 3GS2A 4A90A 3D8DA 3Q3NC 2WP9B 1FMAD 4QAYA 3PG7A 4EFOA 3D8FA 3AM9A 5EFXA 1ZKHA 2ZVNA 4FBJB 1IGCA 3SYXA 2J42A 1A5RA 2MSED 1WRIA 3IAM1 5FK9C 3P1MA 1OQYA 1C4CA 4I6PA 4GXBA 5G5HA 2BYEA 4HEA1 3I9V1 3SFDB 4L2YA 2K49A 4ZRJA 4B9KA 5HE2A 3AB5A 1MVKA 1WX7A 2KZRA 1C9FA 1XEEA 1WJUA 1XF5L 2K9XA 1OQNA 3PHXB 4RNAA 2DAJA 3L08A 5AZFA 3R66C 2WNMA 4LLGM 1K53A 4ANXA 2GLSA 2UU7A 1VZ6A 2CU1A 2YT2A 3TFMA 1K51A 1WXVA 2WXHA 3I63C 2J0MA 2CU3A 3IAS1 4IW0A 2GS0A 3H9DA 4AWJA 3U4EG 5G2NA 2W54A 1KZ7A 1EAZA 4KX6B 4PYZA 3ULBA 1UH6A 5JHGA 5FI0A 2KNBA 4NZLB 1V88A 2IGHA 2M0XA 2SEBD 3X23A 1I7HA 3F0WA 1QZEA 3LYYA 5HG2A 4W9IA 4PS8A 2N4FA 1YJJA 3AEDB 1J0WA 4DBBA 2K1FA 4WWNA 4CHKA 1DROA 1MIXA 3A4SC 1KH0A 4NJCA 1PFJA 2E3TA 1F77A 3HVZA 2KK8A 1ZM0A 3N1YC 3AU4A 1E6EB 4P1BC 3EHVA 1F2RC 3ZRFA 4CHJA 1UGMA 2Y8GA 3WAMA 4C56C 3PV1A 2KR0A 4NY0A 1X1GA 4BKSD 1XT9B 2WWZA 2KHWB 2B76B 2DHKA 4HB2B 4HXDA 3A9JA 5E6JA 4N58A 1L6UA 1A70A 3R7RA 3JSVA 2BQQA 3UQBA 4XWXA 3EA6A 2ACZB 2QDFA 4IM2A 4IWQA 1FFVA 1PGXA 1M7EA 2LUMA 3AXCA 4BAXA 1ET6A 4JPSA 2XK5B 1U5DA 4HAYB 1IP9A 1ROEA 3KLSX 5CTRC 1WE6A 1B9RA 1DDWA 3RNEC 4G0NB 1HZ6A 4RGMA 1RM6C 2KQ4X 1W1DA 4KGTA 2M19A 1VDVA 4TKNA 1C1YB 2XK5A 3LDZE 3R7QA 4O1NA 2JRHA 3EFUA 1WXAA 3N1XC 1JCKB 2HTHA 1WSPA 2D9YA 5DI9B 2N0SB 2KX3A 1I4RA 1Y19B 4HDQA 1FFUA 2YS1A 5CHFA 4F7ZA 1V2YA 4GIVA 5J3TA 4NNJB 2ZPNA 3WYFB 1QF6A 1TQZA 4LNIA 2ZW1A 1IYFA 2DHZA 2KWDA 2LGIA 4PS7A 2O2VA 3VVWB 1ZP0B 4W9EA 3R3MA 3HSAA 1EM7A 1P9DU 4HWIB 2CY4A 4US8A 2PZ1A 2K8HA 2GUMA 5C3JB 2BKRB 2KANA 2LYDA 4DHZB 1RJ2A 2HD5B 3IT4B 2JQRB 5LG4B 3RNFC 4CO7A 4B6WA 1R4MI 3PT2B 2NTSA 3EUB2 3PLUA 1PDXA 2K8CA 2H7EA 4JWUC 4B95A 3ZQ4A 1VCBA 4OZCA 4XYCA 2FUG1 3QHTA 3NRZA 3AEBB 2Y3AA 4N9F4 2WU5B 4HAZB 2R2QA 2WXFA 2D9WA 2DX5A 5KHQA 4EZLA 1WIAA 2P0HA 2GCLA 1OTRB 2RDGA 1MG4A 3B2GA 3NWFA 2D4QA 4K81A 3NWAA 2IY1B 1F9JA 1AWEA 2IGGA 3ZLZA 4PK1A 4ZHPA 2P8VA 1T0QC 1GAQB 4H8SA 2DX5B 4HB4B 3N7CA 2M4NA 4L6EA 2E2XA 1FXTB 2QEJC 1ZE3D 3GE3C 2L7RA 2O6VD 2CS4A 3D8EA 1SE2A 4WH4A 4GLSC 4JWSC 2KJRA 2DHIA 3O65B 2J0JA 5HI1A 3ENEA 5HE1A 4ARIA 4F7UP 1Q1OA 1WH3A 2BS3B 2DTCA 4GNKB 1I2HA 1H4RA 2KJHB 3P4SB 3RMKC 1EF1A 2X18A 3HIZA 3AMZA 1VZ7A 4FULA 5T8IA 4AOFA 2W3SA 1NVID 2DYOA 3AEGB 2RRFA 3JVZX 2XBBC 4KIKB 5CX3A 1KLGD 2BVCA 4GGQA 2J4XA 2MEKA 1U5EA 2MJDA 1WYWB 1JWSD 3Q8CA 3FILB 2N7DA 3A9KB 3N20C 4LTUA 3PHWB 1F52A 3P6AA 4XWTA 5BYSA 3ULCA 4MGZE 4W9DA 4AQ7A 3MTNB 1HTOA 2FAZA 1WZ3A 1SEBD 3QX1A 1QC6A 2ROVA 2V3PA 1SXTA 1N5XA 2UWQA 2YEPF 3TEYA 3DBHI 3TUOA 5FI1A 1WM3A 3DXDA 2DYBA 3MDBC 1ZUD2 1XX0A 1QQGA 2NBUA 1FO4A 2WXNA 2EKIA 1Y5OA 1KI1B 2RUKB 1HEZE 3NVZA 2PKOA 1L6VA 2ZW0A 2MQJA 4XZ4A 1U29A 4K1RB 1WF9A 4PYUA 4LNOA 2BB6A 2RSUA 1E7PB 2N9KA 2QSDA 2WU2B 1DOIA 1HTQA 2WXJA 1R4NB 4BVUC 3NJTA 5E6PA 3RT3B 4ARCA 3GZNI 4WVFB 2L8JA 1NYRA 3KRXA 5EE0A 3ML9A 4K3CA 2CY5A 3RULA 4A6FB 3GB1A 3VDZA 3DBRB 1I7AA 2YS5A 3Q3MC 3VTWA 4US9A 1M94A 4QJ4B 2IYDB 4MM3B 2ONQA 2BCJA 2KFKA 3RUIB 3BINA 2ZCBA 1UWMA 2KDBA 4AS1A 2ICIA 1FXIA 3HHMA 5D6JB 2LGDA 2CODA 4B0EA 4GDKA 2D10A 2ZVOA 5C23A 1FNWA 1R7SA 1QKZA 2X8XX 4N6EB 2RDHA 2I2YA 2Y8FA 2YT1A 2QKMA 1JRPA 1VRAB 3DWGC 3ZNZB 3N1ZC 2N9PC 1E90A 1WGRA 4AJWA 1DOYA 4GDKB 4F1SA 2COAA 2W82A 1HA5A 4HB0B 3DCXA 4KSKC 2Y7BA 3L13A 3KW5B 1V1OA 1XLQA 5DPWA 1DDVA 4HAVB 1XODA 3NUHB 3ZKJC 3TBLD 4ZRKA 3LJ3A 3OWEB 4RGOS 2KVZA 3AJ4A 3DDCB 1MI0A 1MAIA 4J3OD 3AE5B 2LOXA 3BVGA 2Z0OA 4WSFA 1RYJA 2E6XA 4IOIE 5TR5A 3QAQA 3ZYYX 2KVRA 5LOPB 2LGXA 4F7GA 3HM6X 5FR3A 1QQRA 1E10A 4GSWA 3GOEA 3L0WB 3KWLA 5J17A 2YSZA 2LJIA 3P7ZA 2QJLA 2WXIA 3AI5A 1GC7A 4Y94A 3W1YA 5DPSA 2KXJA 1WJ1A 4DXGA 4F8CB 4YXDB 4P7IA 4FJVB 2JSVX 3RNBC 1KLUD 4IOYX 1QOFA 4K7UA 2ADZA 1FHWA 4ANVA 2NZ8B 4GPTB 2N7EA 1N60A 2AL6A 3QWZB 3BIID 4MH0E 2FBWB 2WDQB 2KMCA 2KC1A 3RCZA 1E7UA 1JMLA 1NENB 3U8ZA 2HJ8A 1SF0A 4FHJA 2PEAA 3AH7A 1YX6B 2MHJA 2G45B 4AJYB 4WWPA 2JVCA 2GBRA 2J53A 4C4VB 2RPQA 1WX8A 1UNQA 4CHMA 1D6EC 1J7AA 2WXGA 3ZJUA 2KN4A 1AWDA 1TGZB 2SAKA 1EWCA 4W9LA 1ZVRA 2O6VB 2KO3A 3ZW3A 2OJRA 4LK0M 2AWTA 2KFKB 3NVVA 1J19A 5I2SA 2NR2A 3V05A 1YMHE 3LJUX 2EJ8A 1BTNA 3MJ5A 4CYEA 4ZRIA 2DN6A 1SE3A 2IY0B 2EMTA 1Z5SB 4L1RA 1L0VB 5BMHA 3Q3JA 1W1HA 4HKZE 1EWYC 1DDMA 1Q0WB 2VZKD 4MT5A 5GOWB 2IO1B 4XE0A 1MHHE 4C00A 3L4PA 4ANWA 1FB8A 1C4PA 2FIFA 5JH5C 2RLOA 2LRUA 4II3B 1GB1A 1WI1A 4IM0A 1E8YA 4IDIA 4DDGD 4KHBB 4WAAA 1QLBB 1T77A 2UYZB 1NTVA 5J2RA 3N30A 4KSLC 4MJSA 4TV3A 1TIFA 3KUDB 4M01A 2JF5A 2VRWB 1YN3A 1UELA 3AV8A 1CZPA 2ELAA 2K8BA 3TEXA 2MBHA 3PEGA 1WJMA 2C5LC 2K22A 3GYOA 1I4HA 2HTME 1Q10A 4K7WA 1V81A 4A6HA 3JYUA 1D5ZC 4L1BA 1P5TA 3DWMA 2FJUB 3G9WA 2LUEA 3CIRB 3SNHA 1GUAB 5I2MA 2LHEA 3CIKA 2KIEA 4E71A 4GMXB 3AE9B 5J3YA 2UVMA 4EMOA 3K9PB 4M0WA 3Q14C 4KZCA 1V5PA 3ZDTA 2D11A 3OAWA 1V6EA 4FN2A 5IN7A 2GBMA 1C76A 2JRIB 2BW2A 4A3PA 1MPEA 1JWMD 1XO3A 4KIKA 3SHQA 2JZZA 3D32A 5GMVA 2ZCCA 4NQLB 2N1WA 1KOTA 2MBQA 3PRPB 3BZDB 3QCAA 4MELA 1YQBA 1ESFA 3TVVA 2PIAA 3DOWA 4WJQA 4IC7B 2L05A 3B0AA 1XR0B 2L76A 1XD4A 2K5PA 3ZVRA 2BPSA 2KOXA 5EE9A 4C4VA 4WAFA 4DX8A 2YT0A 3QK0A 3FVCA 5D3WA 1NBFC 4QXAB 1DYNA 1SBBB 5CHVC 4LNKA 4RGNA 3ZVVA 1PMSA 4EE2A 3T06A 3ZNGC 1FRDA 1PGBA 2O6VA 4LCDE 1FM0D 2JPHA 2EELA 3IBEA 1OQRA 3Q2AC 1IRSA 2VH2A 3OHMB 2KWUB 3OLMD 4DXFA 2AQ2B 4KKJA 4P16A 3ABVB 2MCNB 3U7ZA 2AL3A 3O13A 2KIGA 2Z0PA 3H7PB 4XWWA 3I3TB 3ZO5B 1AQCA 1VZ8A 2KC2A 1NYQA 3W1SA 2ROZB 4WQOB 5DCNA 5EDSA 2W3RA 1JWUD 3DBRI 3QQ8B 4LDTB 1WGDA 4MJSB 5DPRA 1IBXA 4JIOU 3NZ3A 2CR5A 4MH8A 2K2UA 2L00B 3APFA 2J0KA 1VLBA 4ZHOA 1N5WA 1T0RC 2C7HA 5TSSA 1Z87A 2JYTA 3AE4B 2X38A 2HDEA 4HPMB 4L23A 1HXYD 3A33B 4II2B 3RNGC 1LGRA 2L2IA 2QCZA 3HRDD 3WCQA 2JWZA 4MGYE 4BZAA 3NS1A 5HHDG 3ZNHB 4P1CC 2INCC 3OANA 3PSEB 2GCJA 2CHWA 1WGKA 1NEKB 2K00A 2W9NA 4H2AA 3DXEA 4WURA 3APCA 2D5GA 1IGDA 3HIEA 3PS6A 4DHJD 3CF6E 3R8BA 2YRYA 2DNFA 5AZGA 3KSYA 2KUQA 1P6SA 3A1QA 3V61A 4NPNA 3F5RA 2DZIA 2Y5CA 3FILA 4EUTA 4G11A 3Q8BA 4BOZB 4OT1A 5C5BA 5L81A 3MC0B 3DBHB 2Z4DA 5JXVA 3PRZA 1FCLA 5KQ4A 2I5FA 2WXRA 3NVWA 4YT0B 1KLVA 3AULA 3A58A 3PLVA 4TQ0A 1LW3A 2LGYA 4OVZA 4HRSA 1TZ1A 3C8YA 1WVHA 3VIAA 1YJIA 4HPPA 3ZNID 3UINB 3DBSA 3MHZA 2K39A 4ASWC 2JYEA 4Q2JA 1WM2A 1OEYJ 1GJZA 1MK7B 1T0SC 4GB9A 1MJDA 4HJKA 4JE3B 3APDA 4W9HA 4A20A 4KAXB 1P3RA 4C7ZA 2M14A 3QWMA 3TIXA 2KDEB 2LRWA 3RFZB 2NBVA 4HAUB 3HW2B 4Z2NA 4GOCA 3DVGY 4J6IA 4IWPA 3U12A 5L95C 4HCPB 3M1IB 3ETRA 2KKCA 1NTYA 3T8MA 2KDFB 3EFCA 4QJ3B 2FNJB 3P4PB 3TJPA 4BBNF 2JU6X 3AEEB 1U5GA 1EVHA 2KFJA 2JXXA 2DZKA 3SEBA 1TTNA 2R2OA 1FAOA 3H7PA 5BMGA 1JRUA 3MPXA 4HDOA 1XLPA 1K5GB 2D3CA 2VKIA 1L0YB 3Q3FA 1I4QA 1UEFA 2AX5A 2ZZPB 2KLGA 2VZKB 1XQQA 2N9XA 4N59A 4ZRQA 2L1CA 1BAKA 1N61A 2A5UA 1X05A 4Z2MB 2KYWA 2RDBC 2GRIA 1F1HA 4DIXA 2DAFA 3SDLC 3ZTCA 1V97A 2G9HD 3Q8EA 1SB3C 3CSTA 4BKTA 1YN5A 1QT9A 3BVMA 1JROA 3ZIMA 3ODXA 3PZDA 2M17A 2XNAC 3M3JA 1L4ZB 2JWUA 3UIPB 1KFYB 4DDID 4KKIA 3AE6B 5C5BB 4XDCA 5BYRA 4DX90 4OW0A 2LASA 2MBOA 3VUYA 1K52A 3KUZA 3OJ3A 1FOEA 3BWUD 4LJOB 3V5WA 1C77A 1F0ZA 3IFWB 4HAXB 2J59M 1EUVB 2I5CA 1WX9A 2W2XD 2BB5A 5D3YA 1HE8A 1UPQA 2WXQA 4C80A 2I1KA 4GDLA 3GE8C 1KZGA 3RYTA 1S3SG 2R09A 2M38A 3MC9A 4YTMB 4MY6A 2M56B 3HK0A 1WMHB 2WXPA 2GB1A 2N7JA 4KHAA 1TYGB 2JZPA 4HSIA 3A9KA 3B9JA 2DFKA 2DKPA 4BFRA 2BWES 4HJGE 2LI5A 4MDKE 2DLBA 2KT7A 4DK5A 1DGJA 4IWOA 5DPTA 3NSUA 5C16A 4ZDVA 1XLNA 2WHIA 3ZUNA 2DHJA 3I57A 1EU3A 3U7DA 5EE3A 4TQ1A 3T3NA 1D3ZA 4MGIE 5D94A 2JXTA 2ZPYA 2FE8A 3PGEA 2L0FA 3ONSA 3TSSA 3KZ1A 2L0TA 3NY5A 1WGUA 4W9JA 4BKGA 4ZYNA 1FPYA 3N3KB 4EZJA 2MP2B 2AQ3B 1S1QB 2NBVB 3AN1A 2K6DB 2IJ0A 2KLCA 1FD6A 2BS4B 1EF5A 4HB3B 5AEKB 4A6FA 4XGAB 3MP9A 3X0WA 3ALBA 1NU2A 4A6QA 4MACA 1E7VA 1Y8RC 3RNCC 2PVGC 2KX0A 3P4QB 3VH4B 5D2MB 2YLMA 4OHJA 5H92C 1UF0A 1L5PA 3KQ4A 4QJ5B 5D3XA 3PREA 3PVWA 4M8MA 4NJ7A 3E56A 2DZMA 3IG3A 5KHOA 5HE0A 2CJOA 1P7EA 3PPAA 1T0YA 3VFKA 4GU2A 2LG1A 3SUZA 2D3BA 2K3UA 5IOIA 2LKOA 1ZXHA 2G3QB 4FLHA 4RCOA 4A8XC 1MI1A 5H8YE 3JSVB 2KMAA 3DBLB 3S2AA 2IDYA 5KCVA 1WR6E 1ZYIA 1WXQA 3IT6B 1CQVA 1V1PA 5AZHA 2DX1A 5JZEB 3JW0X 2GJYA 2KWCA 3P2BA 1VD2A 3NHEB 1I4GA 2Z59A 3TO1A 1X1MA 2G1EA 2C7NB 3V60A 3BK1A 1WGHA 5LLIA 2DLWA 3SD5A 3ECIA 3P42A 1SJED 3A1QB 3PZ7A 4RM8A 4RH6A 3M95A 4ICVA 3PVUA 4YSXB 5IP4D 2KCJA 1EO6A 2DA0A 2WGSA 3KRWA 2OJWA 1SHCA 1E5WA 2C60A 2OHFA 4W9CA 2XQNM 1TKEA 5JP4A 5LXHA 5CLLB 3VAWA 4JX1C 5G5GA 2GOWA 1CK1A 1E8XA 1GPXA 5JHBA 2Z8LA 3WANA 1SE9A 2JX5A 2RGNB 1FNVA 1Z2MA 1JALA 1PQSA 4K2OA 5JHHA 4KGSA 2W2XC 3WIMA 2Y5BB 1WXSA 3LB8C 3AE8B 4CQNA 2N23A 1YNTE 2DYMA 1K50A 2J52A 3RI7C 3ZXRA 2KGXB 2DBYA 4R3DA 1XXGA 2IYBA 4WJOA 1ZGUB 2BYTA 2R2YA 1OY2A 3E9SA 2IO2B 1HZ5A 1UWXA 5C6RA 4EEWA 2KAJA 1UUPA 4OVVA 4NSWA 2KMMA 1FHXA 2G4SA 1I35A 1TT5B 1MHXA 4LDTD 3RCPA 3U30A 3V6CB 4HHVA 4KZ0A 3Q3OC 2KTRA 3DPDA 3MC8A 3GYPA 1E8WA 2FIDA 4C0AA 3BJIA 1MFWA 1SIFA 2LMCA 3EC8A 1UBQA 3IXSA 4UDUC 1BWNA 3PZ8A 3TMPB 3VR8B 2LOZA 1MPHA 4NQKE 1JW9D 4MEMA 2RVBB 2KACA 4HATB 5EE1A 4RM9A 1AYFA 3BYTB 1EGXA 1RRPB 3DVNU 4K2PA 1V1PB 4RFBA 4RF0A 1WE7A 2INDC 1WWTA 2NPTB 1ENFA 4YTPB 1PUTA 5JHAA 2LWPA 4S17A 4AUQC 3NOBA 4LNNA 2MBEA 4A5KA 3H6NA 3SU8X 4E74A 3DQVA 1RLFA 1WY8A 3L16A 2ZNVB 2A4ZA 3PSCA 3T9LA 5CLQB 2GBJA 2RNRB 4GOUA 5C79A 2YVCA 2Z13A 4IAPA 3O96A 5JLJB 3PP2A 2FCNA 1M4VA 2L52A 2LD9A 2JT4B 1OQQA 4ANUA 2FCMA 1N63A 1C79A 2FJLA 2NMQA 3W9CB 1P0RA 1LXDA 2ZEQA 3Q69A 3CMMB 4HK2A 2RR9A 4XC2A 3PVLA 2WXLA 4AP4C 3B77A 4KHOA 1D5XC 2LGSA 2P0FA 5FR6A 1FXAA 4ZRPA 2CRFA 2MJEA 1M7RA 4DQOC 4C7YA 1QOGA 4OVUA 3CWIA 3AE3B 3CSFA 4A3OA 3Q6BA 4FHKA 1TS4A 3N9YC 1P3QU 3ZTDA 2AYOB 2MP2A 1N62A 2PE6B 3B1LX 1TXDA 3T3OA 3VH3B 3LXFA 1SGHA 2MRPA 3L54A 3UF8A 3UZTA 1AN8A 2MBBB 1IPGA 2KQ7A 1BUIC 3NW8A 4PS3A 2L83A 4JGHB 1LFDA 3H8HA 2RGFA 2LEKA 2D2QA 2R61A 5C2TB 4DHZE 5KQ1A 1JWBD 3SFEB 2G4DB 4USAA 3FKYA 1TS3A 1WXMA 2MW5A 3A4RA 3RN9C 2WXMA 3VQIA 3WAOA 1I42A 3AEAB 2N1VA 4F7HA 4IKGA 1UNPA 2C7MB 4WQMA 2QHOA 4TYZA 1ZPSA 4A55A 5HKHA 2D3AA 2XEWA 2NPTA 2Y5PA 5BMIA 5IKCM 5DHFB 4WIPA 2RPVA 4A6KA 2LVOA 5FKAC 1WMHA 1T3QA 1ZOYB 3TL5A 1FIQA 2V3NA 2GBNA 2BBCA 1D4BA 3WAPA 1STEA 3OG5A 3ZXVA 3HUIA 4ZYSA 2V3SA 1P98A 1GG3A 2PVOD 3FAHA 1VR9A 2LULA 1TS5A 2COFA 3HM3A 4WJNA 2PW9A 2PJHA 4K7SA 3SR6A 1OGWA 2GBKA 1VJKA 2D9ZA 3RPFC 2JP2A 3FM8C 2BKFA 1AW7A 1TY0A 1XKEA 3KVFB 4HCNB 3EECA 3IHPC 4HAWB 2HJ1A 5D3IB 3U52E 4XX5A 2LVQA 4W9KA 3PRMB 3UQAA 1HQRD 1KM7A 2MA9B 4B6HA 1JWAD 2EC1A 1XCGA 2NCNA 5DIFB 4DBGA 4B0MA 3W1SC 1LM8B 1WI0A 4EJNA 5M4YB 1KF6B 1B1ZA 1PYWD 1FCCC 2BWFA 2N0YA 1YJ1A 2P0DA 5D27A 1RFAA 1KJTA 4M02A 3OJ4B 3BK2A 4S0RA 3VHTC 2K8EA 1IBXB 2BGFA 2R0DA 2WYQA 4OZAA 1KTKA 2M0AA 2NBWB 4FJYA 4RF1A 2V0GA 3NVYA 1KRHA 2MKRA 4K17A 2H88B 2W55A 1YX5B 1WJ4A 4YSYB 2V76A 3P4RB 1U4AA 2RD0A 2D07B 3URYA 2L3ZA 3K9OB 2G35A 1GNUA 1U27A 1H8CA 1P7FA 3AECB 3QA8A 3BY4B 1TS2A 1LO5D 2HE7A 3M63B 4BOSC 4BKSA 2Z14A 1H10A 5CHWA 3QJZA 2WLBA 2LZ6A 4TUUA 3V3XA 2M8SA 1X11A 4D6WA 1UPRA 1V89A 2J7QB 2DWQA 2KN5A 3M62B 3ML8A 4REZA 2HTHB 2LHDA 1LB1A 4HROA 1DYQA 2Z0DB 3W5UB 5L83A 2MDXA 1B55A 4LNFA 4EZKA 5LXIB 1J7CA 4BBKA 4RGTA 4IM3A 1X86A 4ZOHC 4MSQB 3ZRCA 5HE3A 2YS3A 3CXBB 3AU5A 1RAXA 2Q5WD 3WA0A 2FCSA 3DBLI 2CHXA 4W9FA 1FRRA 2D9VA 2VRRB 1YQ4B 1GOZA 1V49A 3Q8AA 2TSSA 4YTNB 4GMVA 1XLOA 1BT0A 3NWDA 4YL8A 2IO3B 1V61A 2NS5A 2YEPB 2BYVE 3N32A 4MK0A 2VSZA 4EOYA 1WFYA 5I4DA 1YD8U 4DWFA 1YIWA 2M1MA 5J3QA 2FUHB 1UD7A 3UGBB 5AUIA 4TMAB 2YF0A 1K8RB 1L2NA 2MJ3A 1JQ4A 3ZGZA 3NG0A 2B3AA 5E6NA 2IFSA 1K5DB 4JL9A 4NJ6A 1W1GA 1X1FA 4ICUA 2XN9C 3MFGA 2PLPA 3FEHA 2KTFA 3IVFA 5D3DA 3KY9A 2PTLA 5LNK1 4FXCA 1F2RI 3VTUA 2JY6A 1TKGA 3UI3A 1UNRA 2PE9A 1R4MB 4E3CA 1FGZA 2MWSB 1DBHA 3AE1B 4IUMB 2IBIB 2N9EB 2V4IB 1QOBA 4KHBA 1L4DB 2V1YA 3HVDA 2Z0EB 2WX1A 4KDLB 2JZ3B 3FC4A 2UZSA 5C1ZA 1V5UA 3QBVB 3DHGC 1OFFA 1NDDA 1SSNA 1SJHD 2OOBB 1Y56A 1V86A 3ZJTA 5DHAB 4M00A 2WXKA 1FEHA 5D7GA 1SE4A 3DHHC 3QC8B 2ON8A 3AEFB 3NZUA 1J7BA 2KWVB 3RZWC 3VTVA 1E8ZA 3U2SC 1C4AA 3VRBB 4DHJB 3HQCA 2COCA 3RZFA 4HLEA 4PT5A 2WDRB 2OEDA 2DENB 3R2TA 1PLSA 1OMWA 3DHIC 4PQ0A 4DXAB 1DOXA 3PO0A 5LONB 1Q5WB 2DZJA 4OZBA 1ZW7A 5MPOA 4EKUA 2LFIA 1FHOA 1V80A 5J18A 1WGQA 4PNKA 3MJWA 3W5VB 3B2FA 1RRBA 4KVGB 4A9AA 5IRSA 4KDIC 4MT7A 4NAWA 4D0NB 1QILA 2KD0A 1ISNA 1L0XB 2LXAA 4OSNA 3NZSA 2IPKD 3KH0A 3ZDMC 4YONA 1V5MA 5BYQA 4HVBA 1SIJA 4G3XB 2GMIC 3P63A 1BTKA 1FNUA 4YSZB 4FADA 1CJEA 2INPE 2O2VB 4FA6A 2OTXA 2GI9A 2ASQA 3DCGA 2DKQA 1NI2A 4YWGG 2KQSA 3B08A 4K3BA 4JLCA 2CKHB 2EKEC 1ZDXA 2BS2B 2REXA 2L32A 1C78A 2MFQA 1T5XD 2LJ5A 1Q67A 1WGGA 1D5MC 1L7YA 1RWSA 3VRAB 3VR9B 2QILA 1WGYA 2H7DA 4I6NB 4HKQA 3A8QA 2QKLA 1OEYA 1E9MA 1QOAA 1YOVB 1MKEA 1G6JA 4FJZA 2CHZA 4GZUA 1YQ3B 4ITKA 3BYYB 2N9LA 2AEHA 2LXCA 1XD3B 3VXWA 3A9JB 3KWVA 5BO4B
chains in the Genus database with same CATH topology
4KHOA 4MSMB 1WJNA 2XBBC 3VIAA 2FCQA 3JVZX 4WJPA 4KIKB 4M8NA 3ZNID 4JQWC 1R4NI 2MWNB 3DBSA 2P0FA 5CX3A 5FR6A 2K39A 3UINB 1C3TA 2KUPA 2CRFA 2IZVB 5KHOA 4ASWC 4BBNC 1M7RA 1U5FA 4GGQA 2K2JA 1J0GA 4NJ7A 1WM2A 1OEYJ 1GJZA 1MK7B 4GB9A 3NS8A 4OVUA 3ODWA 3TW1A 1P1AA 3QIJA 1U5EA 3CSFA 4HJKA 4A3OA 1WYWB 3APDA 4FHKA 2N7DA 4W9HA 3A9KB 2WX0A 4A20A 3PHWB 2KDIA 1P3QU 3P6AA 3ZTDA 1TJ6A 2AYOB 3ULCA 3FSSA 4KAXB 2MP2A 2PE6B 4MGZE 3B1LX 1P3RA 2Z59B 4W9DA 1TXDA 3MTNB 2ZNVC 3VH3B 2FAZA 2M14A 3QWMA 1WZ3A 3QX1A 1QC6A 2ROVA 2IO0B 1TBEA 3TIXA 1J8CA 2KDEB 2LRWA 4E74A 3V6EB 4HAUB 1FGYA 3HW2B 1SGHA 4Z2NA 1V9JA 2KTRB 3UZTA 2MRPA 2UWQA 3DVGX 2MBBB 3DVGY 4GOCA 4IWPA 4J6IA 5L95C 3DBHI 4HCPB 1IPGA 2KQ7A 4PS3A 5FI1A 1WM3A 3DXDA 2DYBA 2MLBA 3MDBC 1XX0A 1QQGA 3M1IB 2KKCA 2NBUA 3RD2A 3W1YA 4JGHB 1NTYA 2OQBA 1LFDA 3T8MA 2KDFB 2PPHA 1Y5OA 2FNJB 2RGFA 5IAAC 3TJPA 2D2QA 1KI1B 4DHZE 2RUKB 2MX2A 4BBNF 2JUOA 5KQ1A 1U5GA 2MQJA 4XZ4A 1EVHA 2KFJA 2ZJDA 2JXXA 2NVUI 1U29A 1U2BA 2DYQA 2DZKA 4K1RB 2Z0QA 1WF9A 2C9WB 2G4DB 1TTNA 2R2OA 4M0WB 1FAOA 2D3GA 3H7PA 4PYUA 3KYDD 3TCAA 3V62A 2RSUA 1UBIA 1JRUA 1WXMA 2MW5A 3A4RA 3VQIA 3WAOA 1I42A 4BVUC 3VUWA 3MPXA 2N1VA 4KV2A 3DXCA 4HDOA 4F7HA 5E6PA 4GDLB 3RT3B 1UNPA 3GZNI 4I6LB 2C7MB 1N3HA 4WVFB 3PTFC 4URKA 4TYZA 2L8JA 2QHOA 1K5GB 3KRXA 2VKIA 1ZSQA 3ML9A 3VUXA 5HKHA 2CY5A 4IFSA 3Q3FA 1UEFA 2XEWA 2ZZPB 3RULA 2KLGA 4A6FB 3VDZA 1XQQA 2N9XA 4NAWB 2L1CA 1BAKA 2NPTA 1I7AA 2YS5A 2RSGA 2A5UA 3VTWA 1X05A 5DHFB 4Z2MB 4HPLB 4A6KA 1M94A 3KUCB 1CMXB 2LVOA 2DAFA 2IYDB 4G50A 1WMHA 3SDLC 3ZTCA 2BYFA 2BCJA 3TL5A 4RMAA 2KFKA 3CSTA 4BKTA 2GBNA 3RUIB 5IA7A 3H6NA 3WAPA 2UZRA 3ZIMA 3BINA 2ZCBA 3ODXA 3PZDA 2M17A 3KYCD 3ODOA 3M3JA 3ML4A 2KDBA 3UIPB 2V3SA 2WDTB 1P98A 1GG3A 3HHMA 5D6JB 2LGDA 2CODA 3C0RB 2LULA 4GDKA 4DDID 1MK9B 2D10A 5C5BB 2COFA 2ZVOA 1WZ0A 3HM3A 4WJNA 2ELBA 1GC6A 4DX90 4IG7B 2LASA 5C23A 2PJHA 4K7SA 1WG7A 1OGWA 2GBKA 2MBOA 3H1UA 2D9ZA 2Y8FA 2YT1A 2QKMA 2JP2A 1UZXB 3FM8C 1FOEA 3KUZA 3L17A 3OJ3A 4LJOB 3V5WA 2V4LA 3SO6A 2BKFA 2Q13A 1XKEA 3SV1A 1LQBA 3KVFB 3IFWB 3ZNZB 4BOZB 4HCNB 4HAXB 2J59M 2N9PC 1EUVB 2I5CA 1E90A 1WX9A 2I1JA 1WGRA 3EECA 3IHPC 2W2XD 3MHSD 4AJWA 4HAWB 4GDKB 1ZC4B 4F1SA 2COAA 5D3YA 1HE8A 2K6QA 1UPQA 4HB0B 2LVQA 2I1KA 4KSKC 4XX5A 4W9KA 3A8PA 2Y7BA 3A98B 4GDLA 1AARA 3L13A 1KZGA 2EMSA 3PRMB 2BF8B 3UQAA 3KW5B 3RYTA 1KM7A 1S3SG 2MA9B 2R09A 4GN1A 4B6HA 2M38A 3WALA 1DDVA 5DPWA 4WWOA 2EC1A 4HAVB 3L10B 1XCGA 1XODA 4MY6A 1WJ6A 3HK0A 4MM3A 3ZKJC 1WMHB 3VOQA 3TBLD 4ZRKA 2NMBA 1WRDB 3LJ3A 2NCNA 5G55A 3AJ4A 3DDCB 5DIFB 4DBGA 1MAIA 2KJ6A 4KHAA 1LM8B 1WI0A 4X57B 4EJNA 1MG8A 2LOXA 3W1SC 2Z0OA 2CAYA 4WSFA 2BWFA 3A9KA 3H7SA 5TR5A 3QAQA 2DFKA 2KVRA 4MGKE 5LOPB 2N0YA 2LGXA 1YJ1A 2DKPA 2P0DA 4WJ7A 5D27A 4F7GA 1RFAA 4BFRA 2BWES 1ZC3B 3HM6X 1KJTA 1V5OA 2LVPA 2LI5A 2W2WA 4MDKE 3OJ4B 4DK5A 4IWOA 5DPTA 3VHTC 2BGFA 3UIOB 2R0DA 3NSUA 2K25A 5C16A 2WYQA 4W9GA 3UF8A 4ZDVA 4GSWA 4LJPB 3GOEA 3L0WB 3ZUNA 5J17A 2NBWB 2YSZA 2DHJA 1WR1A 3DVNV 1V5TA 3P7ZA 3QARA 4FJYA 3U7DA 2MKRA 1GC7A 4K17A 4Y94A 5D3VA 5DH9B 1MIZB 2DYNA 1WJ1A 1WJ4A 1YX5B 2KXJA 4TQ1A 5DPSA 4MGIE 4P7IA 5D94A 2D9XA 4F8CB 4FJVB 1D3ZA 2V76A 3D8DA 2ZPYA 4IOYX 3PGEA 2L0FA 1U4AA 4K7UA 2ADZA 1FHWA 2D07B 3KZ1A 2RD0A 3ONSA 4ANVA 2NZ8B 4GPTB 2L3ZA 2L0TA 2N7EA 3PG7A 3K9OB 3NY5A 2AL6A 4EFOA 2G35A 1WGUA 3D8FA 5EFXA 1ZKHA 1GNUA 2ZVNA 3QWZB 4W9JA 1U27A 4ZYNA 4BKGA 4FBJB 4MH0E 1H8CA 3N3KB 2KMCA 3SYXA 4EZJA 2MP2B 2KC1A 1A5RA 3T9LA 2MSED 3RCZA 3QA8A 1E7UA 1S1QB 3BY4B 2NBVB 3IG3A 3U8ZA 2HE7A 2HJ8A 3M63B 4BOSC 1OQYA 4FHJA 4BKSA 2PEAA 1H10A 1YX6B 4I6PA 4GXBA 5CHWA 2BYEA 2G45B 4AJYB 2K6DB 3QJZA 2LZ6A 2KLCA 2JVCA 2GBRA 4TUUA 4WWPA 2M8SA 1X11A 4ZRJA 2RPQA 4B9KA 5HE2A 1EF5A 1WX8A 1UPRA 1WX7A 4HB3B 1V89A 1UNQA 4A6FA 2J7QB 2KZRA 4CHMA 1WJUA 5AEKB 2KN5A 3M62B 3X0WA 1OQNA 3UQBA 3ML8A 3ALBA 3PHXB 1NU2A 2HTHB 1TGZB 4W9LA 1LB1A 1E7VA 1Y8RC 3VH4B 2KX0A 1ZVRA 2DAJA 2O6VB 3L08A 2YLMA 2KO3A 2Z0DB 3R66C 5D2MB 5AZFA 3ZW3A 5L83A 2MDXA 2OJRA 1B55A 2AWTA 2KFKB 4ANXA 4EZKA 5LXIB 1J19A 4BBKA 2NR2A 1X86A 4IM3A 4MSQB 3ZRCA 5D3XA 3LJUX 2CU1A 2EJ8A 3PREA 3TFMA 1BTNA 3PVWA 5HE3A 4CYEA 4M8MA 2YS3A 4ZRIA 1WXVA 2DN6A 3CXBB 5HE0A 3AU5A 2DZMA 2J0MA 1RAXA 2IY0B 1T0YA 2EMTA 3WA0A 1Z5SB 3PPAA 4GU2A 4IW0A 2LG1A 2GS0A 3VFKA 3SUZA 2FCSA 3DBLI 3H9DA 3ZLZA 4AWJA 2LKOA 2CHXA 1W1HA 2G3QB 3Q3JA 5G2NA 1DDMA 4W9FA 1Q0WB 1KZ7A 5GOWB 2D9VA 1EAZA 2VRRB 2IO1B 1V49A 4FLHA 4PYZA 3ULBA 1UH6A 5JHGA 4GMVA 5FI0A 4ANWA 2KNBA 1BT0A 4DHJD 1V88A 3JSVB 4YL8A 2IO3B 1V61A 2NS5A 2KMAA 3S2AA 2M0XA 1FB8A 5KCVA 1WR6E 3X23A 2FIFA 3F0WA 2RLOA 1QZEA 2BYVE 2LRUA 1WI1A 4II3B 4IM0A 5JH5C 1E8YA 4MK0A 3N32A 2VSZA 4EOYA 4DDGD 1WFYA 5LXHA 5AZHA 4KHBB 4WAAA 1YD8U 2DX1A 4DWFA 3JW0X 2GJYA 2KWCA 2UYZB 5JZEB 1NTVA 4W9IA 3P2BA 1VD2A 5J2RA 3N30A 3NHEB 4KSLC 4MJSA 4TV3A 1YIWA 4PS8A 2M1MA 3KUDB 5J3QA 2FUHB 3TO1A 2N4FA 1X1MA 1J0WA 4DBBA 1UD7A 2JF5A 2C7NB 2K1FA 4WWNA 3UGBB 3V60A 4CHKA 2VRWB 1DROA 2YF0A 1UELA 1WGHA 1MIXA 5LLIA 2ELAA 1K8RB 2K8BA 2DLWA 3PEGA 2MBHA 3A4SC 3ECIA 3SD5A 1L2NA 1PFJA 1WJMA 2C5LC 3GYOA 2B3AA 5E6NA 2IFSA 3A1QB 4K7WA 1V81A 4A6HA 2KK8A 1ZM0A 4RM8A 3JYUA 1K5DB 4JL9A 4NJ6A 1P5TA 3AU4A 1W1GA 3G9WA 1X1FA 2LUEA 3EHVA 3M95A 4ICUA 4ICVA 3SNHA 3PVUA 1GUAB 3ZRFA 4CHJA 1UGMA 3FEHA 2KCJA 2Y8GA 3WAMA 2KTFA 1EO6A 3IVFA 2DA0A 3CIKA 3KY9A 3PV1A 3KRWA 3VTUA 4NY0A 1SHCA 1E5WA 1X1GA 2JY6A 4GMXB 2C60A 4BKSD 4E71A 1XT9B 5J3YA 2WWZA 2KHWB 2UVMA 1UNRA 2DHKA 4EMOA 3K9PB 2XQNM 4W9CA 4HB2B 4HXDA 3A9JA 5JP4A 2PE9A 4E3CA 4KZCA 1V5PA 1FGZA 3ZDTA 2D11A 5CLLB 1DBHA 4XWXA 2MWSB 3JSVA 1V6EA 3OAWA 4IUMB 2IBIB 4FN2A 4IM2A 4IWQA 3VAWA 1M7EA 2GOWA 3AXCA 1E8XA 2GBMA 2JRIB 2N9EB 4A3PA 5JHBA 3WANA 1SE9A 2XK5B 1U5DA 2RGNB 4KIKA 4HAYB 3SHQA 2JZZA 2V1YA 3D32A 5GMVA 2Z0EB 1IP9A 2ZCCA 1Z2MA 2WX1A 4KDLB 4NQLB 5CTRC 2JZ3B 1PQSA 4K2OA 5JHHA 1WE6A 2N1WA 1KOTA 2MBQA 1DDWA 2UZSA 5C1ZA 3PRPB 1V5UA 4G0NB 2W2XC 3QCAA 1YQBA 3QBVB 4MELA 3WIMA 3TVVA 1NDDA 3DOWA 4WJQA 2Y5BB 1W1DA 1WXSA 2OOBB 4IC7B 2L05A 1V86A 3B0AA 5DHAB 1XR0B 2N23A 2L76A 5D7GA 1XD4A 4TKNA 1C1YB 2XK5A 3LDZE 3ZVRA 2BPSA 2DYMA 2KOXA 3R7QA 3QC8B 2JRHA 4DX8A 2YT0A 3EFUA 3NZUA 1WXAA 3QK0A 4AP4C 5D3WA 1NBFC 1DYNA 2KWVB 5CHVC 2KGXB 3RZWC 2HTHA 3ZVVA 1PMSA 3VTVA 2D9YA 1E8ZA 5DI9B 2IYBA 3T06A 3ZNGC 4WJOA 3R7RA 1ZGUB 3VUYA 1OY2A 4DHJB 3HQCA 2COCA 2IO2B 2O6VA 4LCDE 3RZFA 4HLEA 2KX3A 2JPHA 2DENB 3IBEA 1Y19B 4HDQA 1PLSA 5C6RA 2YS1A 1OMWA 1IRSA 4PQ0A 4DXAB 5CHFA 2KWUB 3OLMD 4F7ZA 1V2YA 4GIVA 5J3TA 4NNJB 4EEWA 2ZPNA 3WYFB 1TQZA 4OVVA 1IYFA 2DHZA 4NSWA 5LONB 1Q5WB 2O2VA 4PS7A 3VVWB 2MCNB 1FHXA 2DZJA 2AL3A 2G4SA 4W9EA 1I35A 3R3MA 1ZW7A 4LDTD 2Z0PA 4EKUA 1P9DU 3H7PB 3I3TB 4HWIB 2CY4A 3ZO5B 3RCPA 1FHOA 3U30A 2PZ1A 2K8HA 1AQCA 3V6CB 4HHVA 2KC2A 2BKRB 1V80A 2KTRA 2KANA 3DPDA 4KZ0A 2LYDA 4DHZB 1RJ2A 1WGQA 3GYPA 2HD5B 3W1SA 4PNKA 5J18A 3MJWA 1E8WA 2ROZB 2FIDA 4WQOB 4C0AA 5DCNA 4CO7A 3BJIA 5EDSA 4B6WA 1R4MI 1SIFA 3DBRI 1RRBA 3EC8A 1UBQA 1WGDA 3PT2B 3QQ8B 4LDTB 4KVGB 4JIOU 4MJSB 5DPRA 2CR5A 3PLUA 4KDIC 2K2UA 4MT7A 4NAWA 4D0NB 2KD0A 1ISNA 2K8CA 1BWNA 2H7EA 2L00B 3TMPB 3L54A 3APFA 2LXAA 2J0KA 2LOZA 4B95A 1MPHA 1VCBA 3NZSA 2C7HA 4NQKE 1Z87A 3QHTA 3KH0A 3ZDMC 4MEMA 4YONA 2RVBB 4HATB 1V5MA 4HVBA 4HPMB 4RM9A 1EGXA 3A33B 1RRPB 4G3XB 4II2B 2GMIC 3DVNU 2L2IA 4K2PA 1BTKA 4N9F4 2JWZA 4HAZB 4FADA 4MGYE 2R2QA 2O2VB 1WE7A 2D9WA 2DX5A 4FA6A 3ZNHB 2OTXA 3OANA 2ASQA 2NPTB 3DCGA 2DKQA 1NI2A 3PSEB 4EZLA 2KQSA 5KHQA 3B08A 1WIAA 4JLCA 2GCJA 2GCLA 2P0HA 1OTRB 2CKHB 5JHAA 2CHWA 2LWPA 2EKEC 2K00A 2W9NA 2D4QA 3DXEA 3APCA 4K81A 4AUQC 1F9JA 2IY1B 1AWEA 2REXA 3NOBA 3PS6A 2MBEA 2MFQA 3CF6E 4A5KA 1Q67A 1WGGA 2P8VA 2LJ5A 2YRYA 1L7YA 1RLFA 3DQVA 3KSYA 4H8SA 1WY8A 3L16A 2ZNVB 5AZGA 2A4ZA 1P6SA 2DX5B 3PSCA 3A1QA 4NPNA 3V61A 3F5RA 2DZIA 4EUTA 4HB4B 3N7CA 5CLQB 1WGYA 2GBJA 2M4NA 4G11A 2H7DA 4L6EA 2E2XA 1FXTB 5C5BA 2RNRB 3A8QA 4I6NB 2QKLA 2L7RA 5C79A 1OEYA 5L81A 2YVCA 2O6VD 4IAPA 1MKEA 1G6JA 4FJZA 2CS4A 2CHZA 3D8EA 3O96A 4GZUA 5JLJB 3PRZA 3PP2A 5KQ4A 3AI5A 2FCNA 2KJRA 2I5FA 2DHIA 3O65B 2AEHA 2LD9A 2J0JA 3ENEA 2JT4B 5HE1A 4F7UP 1Q1OA 1WH3A 2LXCA 2DTCA 4ANUA 2FCMA 1I2HA 3SU8X 1XD3B 3VXWA 1H4RA 3A9JB 2FJLA 2KJHB 1EF1A 1P0RA 1LXDA 2ZEQA 2X18A 3AULA 3HIZA 3PLVA 4TQ0A 1KLVA 4FULA 1LW3A 2LGYA 5E6OA 4AOFA 5BO4B 3CMMB 4HK2A 2RR9A 4XC2A 1TZ1A 3PVLA 2DYOA 1WVHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KHO A;  4MSM B;  1WJN A;  2XBB C;  3VIA A;  2FCQ A;  3JVZ X;  4WJP A;  4KIK B;  4M8N A;  3ZNI D;  4JQW C;  1R4N I;  2MWN B;  3DBS A;  2P0F A;  5CX3 A;  5FR6 A;  2K39 A;  3UIN B;  1C3T A;  2KUP A;  2CRF A;  2IZV B;  5KHO A;  4ASW C;  4BBN C;  1M7R A;  1U5F A;  4GGQ A;  2K2J A;  1J0G A;  4NJ7 A;  1WM2 A;  1OEY J;  1GJZ A;  1MK7 B;  4GB9 A;  3NS8 A;  4OVU A;  3ODW A;  3TW1 A;  1P1A A;  3QIJ A;  1U5E A;  3CSF A;  4HJK A;  4A3O A;  1WYW B;  3APD A;  4FHK A;  2N7D A;  4W9H A;  3A9K B;  2WX0 A;  4A20 A;  3PHW B;  2KDI A;  1P3Q U;  3P6A A;  3ZTD A;  1TJ6 A;  2AYO B;  3ULC A;  3FSS A;  4KAX B;  2MP2 A;  2PE6 B;  4MGZ E;  3B1L X;  1P3R A;  2Z59 B;  4W9D A;  1TXD A;  3MTN B;  2ZNV C;  3VH3 B;  2FAZ A;  2M14 A;  3QWM A;  1WZ3 A;  3QX1 A;  1QC6 A;  2ROV A;  2IO0 B;  1TBE A;  3TIX A;  1J8C A;  2KDE B;  2LRW A;  4E74 A;  3V6E B;  4HAU B;  1FGY A;  3HW2 B;  1SGH A;  4Z2N A;  1V9J A;  2KTR B;  3UZT A;  2MRP A;  2UWQ A;  3DVG X;  2MBB B;  3DVG Y;  4GOC A;  4IWP A;  4J6I A;  5L95 C;  3DBH I;  4HCP B;  1IPG A;  2KQ7 A;  4PS3 A;  5FI1 A;  1WM3 A;  3DXD A;  2DYB A;  2MLB A;  3MDB C;  1XX0 A;  1QQG A;  3M1I B;  2KKC A;  2NBU A;  3RD2 A;  3W1Y A;  4JGH B;  1NTY A;  2OQB A;  1LFD A;  3T8M A;  2KDF B;  2PPH A;  1Y5O A;  2FNJ B;  2RGF A;  5IAA C;  3TJP A;  2D2Q A;  1KI1 B;  4DHZ E;  2RUK B;  2MX2 A;  4BBN F;  2JUO A;  5KQ1 A;  1U5G A;  2MQJ A;  4XZ4 A;  1EVH A;  2KFJ A;  2ZJD A;  2JXX A;  2NVU I;  1U29 A;  1U2B A;  2DYQ A;  2DZK A;  4K1R B;  2Z0Q A;  1WF9 A;  2C9W B;  2G4D B;  1TTN A;  2R2O A;  4M0W B;  1FAO A;  2D3G A;  3H7P A;  4PYU A;  3KYD D;  3TCA A;  3V62 A;  2RSU A;  1UBI A;  1JRU A;  1WXM A;  2MW5 A;  3A4R A;  3VQI A;  3WAO A;  1I42 A;  4BVU C;  3VUW A;  3MPX A;  2N1V A;  4KV2 A;  3DXC A;  4HDO A;  4F7H A;  5E6P A;  4GDL B;  3RT3 B;  1UNP A;  3GZN I;  4I6L B;  2C7M B;  1N3H A;  4WVF B;  3PTF C;  4URK A;  4TYZ A;  2L8J A;  2QHO A;  1K5G B;  3KRX A;  2VKI A;  1ZSQ A;  3ML9 A;  3VUX A;  5HKH A;  2CY5 A;  4IFS A;  3Q3F A;  1UEF A;  2XEW A;  2ZZP B;  3RUL A;  2KLG A;  4A6F B;  3VDZ A;  1XQQ A;  2N9X A;  4NAW B;  2L1C A;  1BAK A;  2NPT A;  1I7A A;  2YS5 A;  2RSG A;  2A5U A;  3VTW A;  1X05 A;  5DHF B;  4Z2M B;  4HPL B;  4A6K A;  1M94 A;  3KUC B;  1CMX B;  2LVO A;  2DAF A;  2IYD B;  4G50 A;  1WMH A;  3SDL C;  3ZTC A;  2BYF A;  2BCJ A;  3TL5 A;  4RMA A;  2KFK A;  3CST A;  4BKT A;  2GBN A;  3RUI B;  5IA7 A;  3H6N A;  3WAP A;  2UZR A;  3ZIM A;  3BIN A;  2ZCB A;  3ODX A;  3PZD A;  2M17 A;  3KYC D;  3ODO A;  3M3J A;  3ML4 A;  2KDB A;  3UIP B;  2V3S A;  2WDT B;  1P98 A;  1GG3 A;  3HHM A;  5D6J B;  2LGD A;  2COD A;  3C0R B;  2LUL A;  4GDK A;  4DDI D;  1MK9 B;  2D10 A;  5C5B B;  2COF A;  2ZVO A;  1WZ0 A;  3HM3 A;  4WJN A;  2ELB A;  1GC6 A;  4DX9 0;  4IG7 B;  2LAS A;  5C23 A;  2PJH A;  4K7S A;  1WG7 A;  1OGW A;  2GBK A;  2MBO A;  3H1U A;  2D9Z A;  2Y8F A;  2YT1 A;  2QKM A;  2JP2 A;  1UZX B;  3FM8 C;  1FOE A;  3KUZ A;  3L17 A;  3OJ3 A;  4LJO B;  3V5W A;  2V4L A;  3SO6 A;  2BKF A;  2Q13 A;  1XKE A;  3SV1 A;  1LQB A;  3KVF B;  3IFW B;  3ZNZ B;  4BOZ B;  4HCN B;  4HAX B;  2J59 M;  2N9P C;  1EUV B;  2I5C A;  1E90 A;  1WX9 A;  2I1J A;  1WGR A;  3EEC A;  3IHP C;  2W2X D;  3MHS D;  4AJW A;  4HAW B;  4GDK B;  1ZC4 B;  4F1S A;  2COA A;  5D3Y A;  1HE8 A;  2K6Q A;  1UPQ A;  4HB0 B;  2LVQ A;  2I1K A;  4KSK C;  4XX5 A;  4W9K A;  3A8P A;  2Y7B A;  3A98 B;  4GDL A;  1AAR A;  3L13 A;  1KZG A;  2EMS A;  3PRM B;  2BF8 B;  3UQA A;  3KW5 B;  3RYT A;  1KM7 A;  1S3S G;  2MA9 B;  2R09 A;  4GN1 A;  4B6H A;  2M38 A;  3WAL A;  1DDV A;  5DPW A;  4WWO A;  2EC1 A;  4HAV B;  3L10 B;  1XCG A;  1XOD A;  4MY6 A;  1WJ6 A;  3HK0 A;  4MM3 A;  3ZKJ C;  1WMH B;  3VOQ A;  3TBL D;  4ZRK A;  2NMB A;  1WRD B;  3LJ3 A;  2NCN A;  5G55 A;  3AJ4 A;  3DDC B;  5DIF B;  4DBG A;  1MAI A;  2KJ6 A;  4KHA A;  1LM8 B;  1WI0 A;  4X57 B;  4EJN A;  1MG8 A;  2LOX A;  3W1S C;  2Z0O A;  2CAY A;  4WSF A;  2BWF A;  3A9K A;  3H7S A;  5TR5 A;  3QAQ A;  2DFK A;  2KVR A;  4MGK E;  5LOP B;  2N0Y A;  2LGX A;  1YJ1 A;  2DKP A;  2P0D A;  4WJ7 A;  5D27 A;  4F7G A;  1RFA A;  4BFR A;  2BWE S;  1ZC3 B;  3HM6 X;  1KJT A;  1V5O A;  2LVP A;  2LI5 A;  2W2W A;  4MDK E;  3OJ4 B;  4DK5 A;  4IWO A;  5DPT A;  3VHT C;  2BGF A;  3UIO B;  2R0D A;  3NSU A;  2K25 A;  5C16 A;  2WYQ A;  4W9G A;  3UF8 A;  4ZDV A;  4GSW A;  4LJP B;  3GOE A;  3L0W B;  3ZUN A;  5J17 A;  2NBW B;  2YSZ A;  2DHJ A;  1WR1 A;  3DVN V;  1V5T A;  3P7Z A;  3QAR A;  4FJY A;  3U7D A;  2MKR A;  1GC7 A;  4K17 A;  4Y94 A;  5D3V A;  5DH9 B;  1MIZ B;  2DYN A;  1WJ1 A;  1WJ4 A;  1YX5 B;  2KXJ A;  4TQ1 A;  5DPS A;  4MGI E;  4P7I A;  5D94 A;  2D9X A;  4F8C B;  4FJV B;  1D3Z A;  2V76 A;  3D8D A;  2ZPY A;  4IOY X;  3PGE A;  2L0F A;  1U4A A;  4K7U A;  2ADZ A;  1FHW A;  2D07 B;  3KZ1 A;  2RD0 A;  3ONS A;  4ANV A;  2NZ8 B;  4GPT B;  2L3Z A;  2L0T A;  2N7E A;  3PG7 A;  3K9O B;  3NY5 A;  2AL6 A;  4EFO A;  2G35 A;  1WGU A;  3D8F A;  5EFX A;  1ZKH A;  1GNU A;  2ZVN A;  3QWZ B;  4W9J A;  1U27 A;  4ZYN A;  4BKG A;  4FBJ B;  4MH0 E;  1H8C A;  3N3K B;  2KMC A;  3SYX A;  4EZJ A;  2MP2 B;  2KC1 A;  1A5R A;  3T9L A;  2MSE D;  3RCZ A;  3QA8 A;  1E7U A;  1S1Q B;  3BY4 B;  2NBV B;  3IG3 A;  3U8Z A;  2HE7 A;  2HJ8 A;  3M63 B;  4BOS C;  1OQY A;  4FHJ A;  4BKS A;  2PEA A;  1H10 A;  1YX6 B;  4I6P A;  4GXB A;  5CHW A;  2BYE A;  2G45 B;  4AJY B;  2K6D B;  3QJZ A;  2LZ6 A;  2KLC A;  2JVC A;  2GBR A;  4TUU A;  4WWP A;  2M8S A;  1X11 A;  4ZRJ A;  2RPQ A;  4B9K A;  5HE2 A;  1EF5 A;  1WX8 A;  1UPR A;  1WX7 A;  4HB3 B;  1V89 A;  1UNQ A;  4A6F A;  2J7Q B;  2KZR A;  4CHM A;  1WJU A;  5AEK B;  2KN5 A;  3M62 B;  3X0W A;  1OQN A;  3UQB A;  3ML8 A;  3ALB A;  3PHX B;  1NU2 A;  2HTH B;  1TGZ B;  4W9L A;  1LB1 A;  1E7V A;  1Y8R C;  3VH4 B;  2KX0 A;  1ZVR A;  2DAJ A;  2O6V B;  3L08 A;  2YLM A;  2KO3 A;  2Z0D B;  3R66 C;  5D2M B;  5AZF A;  3ZW3 A;  5L83 A;  2MDX A;  2OJR A;  1B55 A;  2AWT A;  2KFK B;  4ANX A;  4EZK A;  5LXI B;  1J19 A;  4BBK A;  2NR2 A;  1X86 A;  4IM3 A;  4MSQ B;  3ZRC A;  5D3X A;  3LJU X;  2CU1 A;  2EJ8 A;  3PRE A;  3TFM A;  1BTN A;  3PVW A;  5HE3 A;  4CYE A;  4M8M A;  2YS3 A;  4ZRI A;  1WXV A;  2DN6 A;  3CXB B;  5HE0 A;  3AU5 A;  2DZM A;  2J0M A;  1RAX A;  2IY0 B;  1T0Y A;  2EMT A;  3WA0 A;  1Z5S B;  3PPA A;  4GU2 A;  4IW0 A;  2LG1 A;  2GS0 A;  3VFK A;  3SUZ A;  2FCS A;  3DBL I;  3H9D A;  3ZLZ A;  4AWJ A;  2LKO A;  2CHX A;  1W1H A;  2G3Q B;  3Q3J A;  5G2N A;  1DDM A;  4W9F A;  1Q0W B;  1KZ7 A;  5GOW B;  2D9V A;  1EAZ A;  2VRR B;  2IO1 B;  1V49 A;  4FLH A;  4PYZ A;  3ULB A;  1UH6 A;  5JHG A;  4GMV A;  5FI0 A;  4ANW A;  2KNB A;  1BT0 A;  4DHJ D;  1V88 A;  3JSV B;  4YL8 A;  2IO3 B;  1V61 A;  2NS5 A;  2KMA A;  3S2A A;  2M0X A;  1FB8 A;  5KCV A;  1WR6 E;  3X23 A;  2FIF A;  3F0W A;  2RLO A;  1QZE A;  2BYV E;  2LRU A;  1WI1 A;  4II3 B;  4IM0 A;  5JH5 C;  1E8Y A;  4MK0 A;  3N32 A;  2VSZ A;  4EOY A;  4DDG D;  1WFY A;  5LXH A;  5AZH A;  4KHB B;  4WAA A;  1YD8 U;  2DX1 A;  4DWF A;  3JW0 X;  2GJY A;  2KWC A;  2UYZ B;  5JZE B;  1NTV A;  4W9I A;  3P2B A;  1VD2 A;  5J2R A;  3N30 A;  3NHE B;  4KSL C;  4MJS A;  4TV3 A;  1YIW A;  4PS8 A;  2M1M A;  3KUD B;  5J3Q A;  2FUH B;  3TO1 A;  2N4F A;  1X1M A;  1J0W A;  4DBB A;  1UD7 A;  2JF5 A;  2C7N B;  2K1F A;  4WWN A;  3UGB B;  3V60 A;  4CHK A;  2VRW B;  1DRO A;  2YF0 A;  1UEL A;  1WGH A;  1MIX A;  5LLI A;  2ELA A;  1K8R B;  2K8B A;  2DLW A;  3PEG A;  2MBH A;  3A4S C;  3ECI A;  3SD5 A;  1L2N A;  1PFJ A;  1WJM A;  2C5L C;  3GYO A;  2B3A A;  5E6N A;  2IFS A;  3A1Q B;  4K7W A;  1V81 A;  4A6H A;  2KK8 A;  1ZM0 A;  4RM8 A;  3JYU A;  1K5D B;  4JL9 A;  4NJ6 A;  1P5T A;  3AU4 A;  1W1G A;  3G9W A;  1X1F A;  2LUE A;  3EHV A;  3M95 A;  4ICU A;  4ICV A;  3SNH A;  3PVU A;  1GUA B;  3ZRF A;  4CHJ A;  1UGM A;  3FEH A;  2KCJ A;  2Y8G A;  3WAM A;  2KTF A;  1EO6 A;  3IVF A;  2DA0 A;  3CIK A;  3KY9 A;  3PV1 A;  3KRW A;  3VTU A;  4NY0 A;  1SHC A;  1E5W A;  1X1G A;  2JY6 A;  4GMX B;  2C60 A;  4BKS D;  4E71 A;  1XT9 B;  5J3Y A;  2WWZ A;  2KHW B;  2UVM A;  1UNR A;  2DHK A;  4EMO A;  3K9P B;  2XQN M;  4W9C A;  4HB2 B;  4HXD A;  3A9J A;  5JP4 A;  2PE9 A;  4E3C A;  4KZC A;  1V5P A;  1FGZ A;  3ZDT A;  2D11 A;  5CLL B;  1DBH A;  4XWX A;  2MWS B;  3JSV A;  1V6E A;  3OAW A;  4IUM B;  2IBI B;  4FN2 A;  4IM2 A;  4IWQ A;  3VAW A;  1M7E A;  2GOW A;  3AXC A;  1E8X A;  2GBM A;  2JRI B;  2N9E B;  4A3P A;  5JHB A;  3WAN A;  1SE9 A;  2XK5 B;  1U5D A;  2RGN B;  4KIK A;  4HAY B;  3SHQ A;  2JZZ A;  2V1Y A;  3D32 A;  5GMV A;  2Z0E B;  1IP9 A;  2ZCC A;  1Z2M A;  2WX1 A;  4KDL B;  4NQL B;  5CTR C;  2JZ3 B;  1PQS A;  4K2O A;  5JHH A;  1WE6 A;  2N1W A;  1KOT A;  2MBQ A;  1DDW A;  2UZS A;  5C1Z A;  3PRP B;  1V5U A;  4G0N B;  2W2X C;  3QCA A;  1YQB A;  3QBV B;  4MEL A;  3WIM A;  3TVV A;  1NDD A;  3DOW A;  4WJQ A;  2Y5B B;  1W1D A;  1WXS A;  2OOB B;  4IC7 B;  2L05 A;  1V86 A;  3B0A A;  5DHA B;  1XR0 B;  2N23 A;  2L76 A;  5D7G A;  1XD4 A;  4TKN A;  1C1Y B;  2XK5 A;  3LDZ E;  3ZVR A;  2BPS A;  2DYM A;  2KOX A;  3R7Q A;  3QC8 B;  2JRH A;  4DX8 A;  2YT0 A;  3EFU A;  3NZU A;  1WXA A;  3QK0 A;  4AP4 C;  5D3W A;  1NBF C;  1DYN A;  2KWV B;  5CHV C;  2KGX B;  3RZW C;  2HTH A;  3ZVV A;  1PMS A;  3VTV A;  2D9Y A;  1E8Z A;  5DI9 B;  2IYB A;  3T06 A;  3ZNG C;  4WJO A;  3R7R A;  1ZGU B;  3VUY A;  1OY2 A;  4DHJ B;  3HQC A;  2COC A;  2IO2 B;  2O6V A;  4LCD E;  3RZF A;  4HLE A;  2KX3 A;  2JPH A;  2DEN B;  3IBE A;  1Y19 B;  4HDQ A;  1PLS A;  5C6R A;  2YS1 A;  1OMW A;  1IRS A;  4PQ0 A;  4DXA B;  5CHF A;  2KWU B;  3OLM D;  4F7Z A;  1V2Y A;  4GIV A;  5J3T A;  4NNJ B;  4EEW A;  2ZPN A;  3WYF B;  1TQZ A;  4OVV A;  1IYF A;  2DHZ A;  4NSW A;  5LON B;  1Q5W B;  2O2V A;  4PS7 A;  3VVW B;  2MCN B;  1FHX A;  2DZJ A;  2AL3 A;  2G4S A;  4W9E A;  1I35 A;  3R3M A;  1ZW7 A;  4LDT D;  2Z0P A;  4EKU A;  1P9D U;  3H7P B;  3I3T B;  4HWI B;  2CY4 A;  3ZO5 B;  3RCP A;  1FHO A;  3U30 A;  2PZ1 A;  2K8H A;  1AQC A;  3V6C B;  4HHV A;  2KC2 A;  2BKR B;  1V80 A;  2KTR A;  2KAN A;  3DPD A;  4KZ0 A;  2LYD A;  4DHZ B;  1RJ2 A;  1WGQ A;  3GYP A;  2HD5 B;  3W1S A;  4PNK A;  5J18 A;  3MJW A;  1E8W A;  2ROZ B;  2FID A;  4WQO B;  4C0A A;  5DCN A;  4CO7 A;  3BJI A;  5EDS A;  4B6W A;  1R4M I;  1SIF A;  3DBR I;  1RRB A;  3EC8 A;  1UBQ A;  1WGD A;  3PT2 B;  3QQ8 B;  4LDT B;  4KVG B;  4JIO U;  4MJS B;  5DPR A;  2CR5 A;  3PLU A;  4KDI C;  2K2U A;  4MT7 A;  4NAW A;  4D0N B;  2KD0 A;  1ISN A;  2K8C A;  1BWN A;  2H7E A;  2L00 B;  3TMP B;  3L54 A;  3APF A;  2LXA A;  2J0K A;  2LOZ A;  4B95 A;  1MPH A;  1VCB A;  3NZS A;  2C7H A;  4NQK E;  1Z87 A;  3QHT A;  3KH0 A;  3ZDM C;  4MEM A;  4YON A;  2RVB B;  4HAT B;  1V5M A;  4HVB A;  4HPM B;  4RM9 A;  1EGX A;  3A33 B;  1RRP B;  4G3X B;  4II2 B;  2GMI C;  3DVN U;  2L2I A;  4K2P A;  1BTK A;  4N9F 4;  2JWZ A;  4HAZ B;  4FAD A;  4MGY E;  2R2Q A;  2O2V B;  1WE7 A;  2D9W A;  2DX5 A;  4FA6 A;  3ZNH B;  2OTX A;  3OAN A;  2ASQ A;  2NPT B;  3DCG A;  2DKQ A;  1NI2 A;  3PSE B;  4EZL A;  2KQS A;  5KHQ A;  3B08 A;  1WIA A;  4JLC A;  2GCJ A;  2GCL A;  2P0H A;  1OTR B;  2CKH B;  5JHA A;  2CHW A;  2LWP A;  2EKE C;  2K00 A;  2W9N A;  2D4Q A;  3DXE A;  3APC A;  4K81 A;  4AUQ C;  1F9J A;  2IY1 B;  1AWE A;  2REX A;  3NOB A;  3PS6 A;  2MBE A;  2MFQ A;  3CF6 E;  4A5K A;  1Q67 A;  1WGG A;  2P8V A;  2LJ5 A;  2YRY A;  1L7Y A;  1RLF A;  3DQV A;  3KSY A;  4H8S A;  1WY8 A;  3L16 A;  2ZNV B;  5AZG A;  2A4Z A;  1P6S A;  2DX5 B;  3PSC A;  3A1Q A;  4NPN A;  3V61 A;  3F5R A;  2DZI A;  4EUT A;  4HB4 B;  3N7C A;  5CLQ B;  1WGY A;  2GBJ A;  2M4N A;  4G11 A;  2H7D A;  4L6E A;  2E2X A;  1FXT B;  5C5B A;  2RNR B;  3A8Q A;  4I6N B;  2QKL A;  2L7R A;  5C79 A;  1OEY A;  5L81 A;  2YVC A;  2O6V D;  4IAP A;  1MKE A;  1G6J A;  4FJZ A;  2CS4 A;  2CHZ A;  3D8E A;  3O96 A;  4GZU A;  5JLJ B;  3PRZ A;  3PP2 A;  5KQ4 A;  3AI5 A;  2FCN A;  2KJR A;  2I5F A;  2DHI A;  3O65 B;  2AEH A;  2LD9 A;  2J0J A;  3ENE A;  2JT4 B;  5HE1 A;  4F7U P;  1Q1O A;  1WH3 A;  2LXC A;  2DTC A;  4ANU A;  2FCM A;  1I2H A;  3SU8 X;  1XD3 B;  3VXW A;  1H4R A;  3A9J B;  2FJL A;  2KJH B;  1EF1 A;  1P0R A;  1LXD A;  2ZEQ A;  2X18 A;  3AUL A;  3HIZ A;  3PLV A;  4TQ0 A;  1KLV A;  4FUL A;  1LW3 A;  2LGY A;  5E6O A;  4AOF A;  5BO4 B;  3CMM B;  4HK2 A;  2RR9 A;  4XC2 A;  1TZ1 A;  3PVL A;  2DYO A;  1WVH A; 
#chains in the Genus database with same CATH topology
 4MSM B;  1WJN A;  2FCQ A;  4WJP A;  2QIE B;  4M8N A;  4JQW C;  1R4N I;  2MWN B;  1C3T A;  2KUP A;  2IZV B;  4BBN C;  1J0G A;  1U5F A;  2K2J A;  2INN E;  1T6B X;  2BT6 A;  3J9C A;  2L1A A;  3NS8 A;  3ODW A;  3TW1 A;  1P1A A;  3QIJ A;  1XCT L;  2NTT A;  1RFK A;  2WX0 A;  2KDI A;  1TJ6 A;  1ZDV A;  3FSS A;  2Z59 B;  2H89 B;  2ZNV C;  1TZO A;  2IGD A;  2QMT A;  1J8C A;  2IO0 B;  1TBE A;  3ZJV A;  4ACF A;  2V9H A;  3Q8F A;  1V9J A;  1FGY A;  2ZJD A;  4WWM A;  2KTR B;  3V6E B;  3DVG X;  1UGJ A;  2QC8 A;  2MLB A;  2BTE A;  1ACC A;  3RD2 A;  2OQB A;  1TY2 A;  2PPH A;  2ZKM X;  5IAA C;  2MX2 A;  2JUO A;  1V8C A;  2K0P A;  1UNS A;  5IO9 A;  2NVU I;  1U2B A;  2DYQ A;  2Z0Q A;  2C9W B;  4M0W B;  2D3G A;  3KYD D;  3TCA A;  3V62 A;  1UBI A;  1YN4 A;  3VUW A;  4KV2 A;  3DXC A;  3BVZ A;  4GDL B;  1N6Z A;  3GP7 A;  3GZN B;  4I6L B;  1N3H A;  3PTF C;  4URK A;  1ZSQ A;  1BML C;  3VUX A;  4IFS A;  4NAW B;  3RNA C;  3W2D A;  2RSG A;  4HPL B;  1PFD A;  1EU4 A;  3KUC B;  1CMX B;  4G50 A;  2BYF A;  4P6V F;  4RMA A;  5IA7 A;  4CSQ A;  2UZR A;  2MH7 A;  3KYC D;  4NAM A;  4KGR A;  2I38 A;  3ODO A;  1WYG A;  3ML4 A;  4D2K A;  5HFY A;  2WDT B;  2KDM A;  3C0R B;  1MK9 B;  5E6O A;  1WZ0 A;  2ELB A;  1GC6 A;  4IG7 B;  1ZXI A;  1WG7 A;  2AQ1 B;  2VH1 A;  3H1U A;  3TEZ A;  3L17 A;  1UZX B;  2V4L A;  3SO6 A;  2WS3 B;  2Q13 A;  1TKY A;  3SV1 A;  1I4P A;  1LQB A;  3AE2 B;  3MHS D;  2I1J A;  1ZC4 B;  2K6Q A;  3A8P A;  3C19 A;  3A98 B;  1AAR A;  5GXG B;  2EMS A;  2BF8 B;  4TSS A;  4GN1 A;  3I5J C;  3WAL A;  2PMV A;  4WWO A;  3L10 B;  1WJ6 A;  4MM3 A;  1IUE A;  3VOQ A;  2RMM A;  2NMB A;  1WRD B;  5G55 A;  3EGR A;  4X57 B;  1PGA A;  1MG8 A;  2CAY A;  1GB4 A;  3H7S A;  4MGK E;  2WDV B;  4WJ7 A;  3AE7 B;  5AUK A;  1ZC3 B;  1V5O A;  2LVP A;  2WXO A;  3R2I A;  2W2W A;  1ET9 A;  1XCQ L;  1I4X A;  2WQY B;  1BXT A;  1E0Z A;  3UIO B;  2K25 A;  4W9G A;  2CJN A;  4LJP B;  4XDD A;  1TJE A;  1WR1 A;  1V5T A;  3DVN V;  3QAR A;  3TEW A;  2KJ6 A;  5D3V A;  1NI3 A;  5DH9 B;  1MIZ B;  2DYN A;  2D9X A;  3GS2 A;  4A90 A;  3D8D A;  3Q3N C;  2WP9 B;  1FMA D;  4QAY A;  3PG7 A;  4EFO A;  3D8F A;  3AM9 A;  5EFX A;  1ZKH A;  2ZVN A;  4FBJ B;  1IGC A;  3SYX A;  2J42 A;  1A5R A;  2MSE D;  1WRI A;  3IAM 1;  5FK9 C;  3P1M A;  1OQY A;  1C4C A;  4I6P A;  4GXB A;  5G5H A;  2BYE A;  4HEA 1;  3I9V 1;  3SFD B;  4L2Y A;  2K49 A;  4ZRJ A;  4B9K A;  5HE2 A;  3AB5 A;  1MVK A;  1WX7 A;  2KZR A;  1C9F A;  1XEE A;  1WJU A;  1XF5 L;  2K9X A;  1OQN A;  3PHX B;  4RNA A;  2DAJ A;  3L08 A;  5AZF A;  3R66 C;  2WNM A;  4LLG M;  1K53 A;  4ANX A;  2GLS A;  2UU7 A;  1VZ6 A;  2CU1 A;  2YT2 A;  3TFM A;  1K51 A;  1WXV A;  2WXH A;  3I63 C;  2J0M A;  2CU3 A;  3IAS 1;  4IW0 A;  2GS0 A;  3H9D A;  4AWJ A;  3U4E G;  5G2N A;  2W54 A;  1KZ7 A;  1EAZ A;  4KX6 B;  4PYZ A;  3ULB A;  1UH6 A;  5JHG A;  5FI0 A;  2KNB A;  4NZL B;  1V88 A;  2IGH A;  2M0X A;  2SEB D;  3X23 A;  1I7H A;  3F0W A;  1QZE A;  3LYY A;  5HG2 A;  4W9I A;  4PS8 A;  2N4F A;  1YJJ A;  3AED B;  1J0W A;  4DBB A;  2K1F A;  4WWN A;  4CHK A;  1DRO A;  1MIX A;  3A4S C;  1KH0 A;  4NJC A;  1PFJ A;  2E3T A;  1F77 A;  3HVZ A;  2KK8 A;  1ZM0 A;  3N1Y C;  3AU4 A;  1E6E B;  4P1B C;  3EHV A;  1F2R C;  3ZRF A;  4CHJ A;  1UGM A;  2Y8G A;  3WAM A;  4C56 C;  3PV1 A;  2KR0 A;  4NY0 A;  1X1G A;  4BKS D;  1XT9 B;  2WWZ A;  2KHW B;  2B76 B;  2DHK A;  4HB2 B;  4HXD A;  3A9J A;  5E6J A;  4N58 A;  1L6U A;  1A70 A;  3R7R A;  3JSV A;  2BQQ A;  3UQB A;  4XWX A;  3EA6 A;  2ACZ B;  2QDF A;  4IM2 A;  4IWQ A;  1FFV A;  1PGX A;  1M7E A;  2LUM A;  3AXC A;  4BAX A;  1ET6 A;  4JPS A;  2XK5 B;  1U5D A;  4HAY B;  1IP9 A;  1ROE A;  3KLS X;  5CTR C;  1WE6 A;  1B9R A;  1DDW A;  3RNE C;  4G0N B;  1HZ6 A;  4RGM A;  1RM6 C;  2KQ4 X;  1W1D A;  4KGT A;  2M19 A;  1VDV A;  4TKN A;  1C1Y B;  2XK5 A;  3LDZ E;  3R7Q A;  4O1N A;  2JRH A;  3EFU A;  1WXA A;  3N1X C;  1JCK B;  2HTH A;  1WSP A;  2D9Y A;  5DI9 B;  2N0S B;  2KX3 A;  1I4R A;  1Y19 B;  4HDQ A;  1FFU A;  2YS1 A;  5CHF A;  4F7Z A;  1V2Y A;  4GIV A;  5J3T A;  4NNJ B;  2ZPN A;  3WYF B;  1QF6 A;  1TQZ A;  4LNI A;  2ZW1 A;  1IYF A;  2DHZ A;  2KWD A;  2LGI A;  4PS7 A;  2O2V A;  3VVW B;  1ZP0 B;  4W9E A;  3R3M A;  3HSA A;  1EM7 A;  1P9D U;  4HWI B;  2CY4 A;  4US8 A;  2PZ1 A;  2K8H A;  2GUM A;  5C3J B;  2BKR B;  2KAN A;  2LYD A;  4DHZ B;  1RJ2 A;  2HD5 B;  3IT4 B;  2JQR B;  5LG4 B;  3RNF C;  4CO7 A;  4B6W A;  1R4M I;  3PT2 B;  2NTS A;  3EUB 2;  3PLU A;  1PDX A;  2K8C A;  2H7E A;  4JWU C;  4B95 A;  3ZQ4 A;  1VCB A;  4OZC A;  4XYC A;  2FUG 1;  3QHT A;  3NRZ A;  3AEB B;  2Y3A A;  4N9F 4;  2WU5 B;  4HAZ B;  2R2Q A;  2WXF A;  2D9W A;  2DX5 A;  5KHQ A;  4EZL A;  1WIA A;  2P0H A;  2GCL A;  1OTR B;  2RDG A;  1MG4 A;  3B2G A;  3NWF A;  2D4Q A;  4K81 A;  3NWA A;  2IY1 B;  1F9J A;  1AWE A;  2IGG A;  3ZLZ A;  4PK1 A;  4ZHP A;  2P8V A;  1T0Q C;  1GAQ B;  4H8S A;  2DX5 B;  4HB4 B;  3N7C A;  2M4N A;  4L6E A;  2E2X A;  1FXT B;  2QEJ C;  1ZE3 D;  3GE3 C;  2L7R A;  2O6V D;  2CS4 A;  3D8E A;  1SE2 A;  4WH4 A;  4GLS C;  4JWS C;  2KJR A;  2DHI A;  3O65 B;  2J0J A;  5HI1 A;  3ENE A;  5HE1 A;  4ARI A;  4F7U P;  1Q1O A;  1WH3 A;  2BS3 B;  2DTC A;  4GNK B;  1I2H A;  1H4R A;  2KJH B;  3P4S B;  3RMK C;  1EF1 A;  2X18 A;  3HIZ A;  3AMZ A;  1VZ7 A;  4FUL A;  5T8I A;  4AOF A;  2W3S A;  1NVI D;  2DYO A;  3AEG B;  2RRF A;  3JVZ X;  2XBB C;  4KIK B;  5CX3 A;  1KLG D;  2BVC A;  4GGQ A;  2J4X A;  2MEK A;  1U5E A;  2MJD A;  1WYW B;  1JWS D;  3Q8C A;  3FIL B;  2N7D A;  3A9K B;  3N20 C;  4LTU A;  3PHW B;  1F52 A;  3P6A A;  4XWT A;  5BYS A;  3ULC A;  4MGZ E;  4W9D A;  4AQ7 A;  3MTN B;  1HTO A;  2FAZ A;  1WZ3 A;  1SEB D;  3QX1 A;  1QC6 A;  2ROV A;  2V3P A;  1SXT A;  1N5X A;  2UWQ A;  2YEP F;  3TEY A;  3DBH I;  3TUO A;  5FI1 A;  1WM3 A;  3DXD A;  2DYB A;  3MDB C;  1ZUD 2;  1XX0 A;  1QQG A;  2NBU A;  1FO4 A;  2WXN A;  2EKI A;  1Y5O A;  1KI1 B;  2RUK B;  1HEZ E;  3NVZ A;  2PKO A;  1L6V A;  2ZW0 A;  2MQJ A;  4XZ4 A;  1U29 A;  4K1R B;  1WF9 A;  4PYU A;  4LNO A;  2BB6 A;  2RSU A;  1E7P B;  2N9K A;  2QSD A;  2WU2 B;  1DOI A;  1HTQ A;  2WXJ A;  1R4N B;  4BVU C;  3NJT A;  5E6P A;  3RT3 B;  4ARC A;  3GZN I;  4WVF B;  2L8J A;  1NYR A;  3KRX A;  5EE0 A;  3ML9 A;  4K3C A;  2CY5 A;  3RUL A;  4A6F B;  3GB1 A;  3VDZ A;  3DBR B;  1I7A A;  2YS5 A;  3Q3M C;  3VTW A;  4US9 A;  1M94 A;  4QJ4 B;  2IYD B;  4MM3 B;  2ONQ A;  2BCJ A;  2KFK A;  3RUI B;  3BIN A;  2ZCB A;  1UWM A;  2KDB A;  4AS1 A;  2ICI A;  1FXI A;  3HHM A;  5D6J B;  2LGD A;  2COD A;  4B0E A;  4GDK A;  2D10 A;  2ZVO A;  5C23 A;  1FNW A;  1R7S A;  1QKZ A;  2X8X X;  4N6E B;  2RDH A;  2I2Y A;  2Y8F A;  2YT1 A;  2QKM A;  1JRP A;  1VRA B;  3DWG C;  3ZNZ B;  3N1Z C;  2N9P C;  1E90 A;  1WGR A;  4AJW A;  1DOY A;  4GDK B;  4F1S A;  2COA A;  2W82 A;  1HA5 A;  4HB0 B;  3DCX A;  4KSK C;  2Y7B A;  3L13 A;  3KW5 B;  1V1O A;  1XLQ A;  5DPW A;  1DDV A;  4HAV B;  1XOD A;  3NUH B;  3ZKJ C;  3TBL D;  4ZRK A;  3LJ3 A;  3OWE B;  4RGO S;  2KVZ A;  3AJ4 A;  3DDC B;  1MI0 A;  1MAI A;  4J3O D;  3AE5 B;  2LOX A;  3BVG A;  2Z0O A;  4WSF A;  1RYJ A;  2E6X A;  4IOI E;  5TR5 A;  3QAQ A;  3ZYY X;  2KVR A;  5LOP B;  2LGX A;  4F7G A;  3HM6 X;  5FR3 A;  1QQR A;  1E10 A;  4GSW A;  3GOE A;  3L0W B;  3KWL A;  5J17 A;  2YSZ A;  2LJI A;  3P7Z A;  2QJL A;  2WXI A;  3AI5 A;  1GC7 A;  4Y94 A;  3W1Y A;  5DPS A;  2KXJ A;  1WJ1 A;  4DXG A;  4F8C B;  4YXD B;  4P7I A;  4FJV B;  2JSV X;  3RNB C;  1KLU D;  4IOY X;  1QOF A;  4K7U A;  2ADZ A;  1FHW A;  4ANV A;  2NZ8 B;  4GPT B;  2N7E A;  1N60 A;  2AL6 A;  3QWZ B;  3BII D;  4MH0 E;  2FBW B;  2WDQ B;  2KMC A;  2KC1 A;  3RCZ A;  1E7U A;  1JML A;  1NEN B;  3U8Z A;  2HJ8 A;  1SF0 A;  4FHJ A;  2PEA A;  3AH7 A;  1YX6 B;  2MHJ A;  2G45 B;  4AJY B;  4WWP A;  2JVC A;  2GBR A;  2J53 A;  4C4V B;  2RPQ A;  1WX8 A;  1UNQ A;  4CHM A;  1D6E C;  1J7A A;  2WXG A;  3ZJU A;  2KN4 A;  1AWD A;  1TGZ B;  2SAK A;  1EWC A;  4W9L A;  1ZVR A;  2O6V B;  2KO3 A;  3ZW3 A;  2OJR A;  4LK0 M;  2AWT A;  2KFK B;  3NVV A;  1J19 A;  5I2S A;  2NR2 A;  3V05 A;  1YMH E;  3LJU X;  2EJ8 A;  1BTN A;  3MJ5 A;  4CYE A;  4ZRI A;  2DN6 A;  1SE3 A;  2IY0 B;  2EMT A;  1Z5S B;  4L1R A;  1L0V B;  5BMH A;  3Q3J A;  1W1H A;  4HKZ E;  1EWY C;  1DDM A;  1Q0W B;  2VZK D;  4MT5 A;  5GOW B;  2IO1 B;  4XE0 A;  1MHH E;  4C00 A;  3L4P A;  4ANW A;  1FB8 A;  1C4P A;  2FIF A;  5JH5 C;  2RLO A;  2LRU A;  4II3 B;  1GB1 A;  1WI1 A;  4IM0 A;  1E8Y A;  4IDI A;  4DDG D;  4KHB B;  4WAA A;  1QLB B;  1T77 A;  2UYZ B;  1NTV A;  5J2R A;  3N30 A;  4KSL C;  4MJS A;  4TV3 A;  1TIF A;  3KUD B;  4M01 A;  2JF5 A;  2VRW B;  1YN3 A;  1UEL A;  3AV8 A;  1CZP A;  2ELA A;  2K8B A;  3TEX A;  2MBH A;  3PEG A;  1WJM A;  2C5L C;  2K22 A;  3GYO A;  1I4H A;  2HTM E;  1Q10 A;  4K7W A;  1V81 A;  4A6H A;  3JYU A;  1D5Z C;  4L1B A;  1P5T A;  3DWM A;  2FJU B;  3G9W A;  2LUE A;  3CIR B;  3SNH A;  1GUA B;  5I2M A;  2LHE A;  3CIK A;  2KIE A;  4E71 A;  4GMX B;  3AE9 B;  5J3Y A;  2UVM A;  4EMO A;  3K9P B;  4M0W A;  3Q14 C;  4KZC A;  1V5P A;  3ZDT A;  2D11 A;  3OAW A;  1V6E A;  4FN2 A;  5IN7 A;  2GBM A;  1C76 A;  2JRI B;  2BW2 A;  4A3P A;  1MPE A;  1JWM D;  1XO3 A;  4KIK A;  3SHQ A;  2JZZ A;  3D32 A;  5GMV A;  2ZCC A;  4NQL B;  2N1W A;  1KOT A;  2MBQ A;  3PRP B;  3BZD B;  3QCA A;  4MEL A;  1YQB A;  1ESF A;  3TVV A;  2PIA A;  3DOW A;  4WJQ A;  4IC7 B;  2L05 A;  3B0A A;  1XR0 B;  2L76 A;  1XD4 A;  2K5P A;  3ZVR A;  2BPS A;  2KOX A;  5EE9 A;  4C4V A;  4WAF A;  4DX8 A;  2YT0 A;  3QK0 A;  3FVC A;  5D3W A;  1NBF C;  4QXA B;  1DYN A;  1SBB B;  5CHV C;  4LNK A;  4RGN A;  3ZVV A;  1PMS A;  4EE2 A;  3T06 A;  3ZNG C;  1FRD A;  1PGB A;  2O6V A;  4LCD E;  1FM0 D;  2JPH A;  2EEL A;  3IBE A;  1OQR A;  3Q2A C;  1IRS A;  2VH2 A;  3OHM B;  2KWU B;  3OLM D;  4DXF A;  2AQ2 B;  4KKJ A;  4P16 A;  3ABV B;  2MCN B;  3U7Z A;  2AL3 A;  3O13 A;  2KIG A;  2Z0P A;  3H7P B;  4XWW A;  3I3T B;  3ZO5 B;  1AQC A;  1VZ8 A;  2KC2 A;  1NYQ A;  3W1S A;  2ROZ B;  4WQO B;  5DCN A;  5EDS A;  2W3R A;  1JWU D;  3DBR I;  3QQ8 B;  4LDT B;  1WGD A;  4MJS B;  5DPR A;  1IBX A;  4JIO U;  3NZ3 A;  2CR5 A;  4MH8 A;  2K2U A;  2L00 B;  3APF A;  2J0K A;  1VLB A;  4ZHO A;  1N5W A;  1T0R C;  2C7H A;  5TSS A;  1Z87 A;  2JYT A;  3AE4 B;  2X38 A;  2HDE A;  4HPM B;  4L23 A;  1HXY D;  3A33 B;  4II2 B;  3RNG C;  1LGR A;  2L2I A;  2QCZ A;  3HRD D;  3WCQ A;  2JWZ A;  4MGY E;  4BZA A;  3NS1 A;  5HHD G;  3ZNH B;  4P1C C;  2INC C;  3OAN A;  3PSE B;  2GCJ A;  2CHW A;  1WGK A;  1NEK B;  2K00 A;  2W9N A;  4H2A A;  3DXE A;  4WUR A;  3APC A;  2D5G A;  1IGD A;  3HIE A;  3PS6 A;  4DHJ D;  3CF6 E;  3R8B A;  2YRY A;  2DNF A;  5AZG A;  3KSY A;  2KUQ A;  1P6S A;  3A1Q A;  3V61 A;  4NPN A;  3F5R A;  2DZI A;  2Y5C A;  3FIL A;  4EUT A;  4G11 A;  3Q8B A;  4BOZ B;  4OT1 A;  5C5B A;  5L81 A;  3MC0 B;  3DBH B;  2Z4D A;  5JXV A;  3PRZ A;  1FCL A;  5KQ4 A;  2I5F A;  2WXR A;  3NVW A;  4YT0 B;  1KLV A;  3AUL A;  3A58 A;  3PLV A;  4TQ0 A;  1LW3 A;  2LGY A;  4OVZ A;  4HRS A;  1TZ1 A;  3C8Y A;  1WVH A;  3VIA A;  1YJI A;  4HPP A;  3ZNI D;  3UIN B;  3DBS A;  3MHZ A;  2K39 A;  4ASW C;  2JYE A;  4Q2J A;  1WM2 A;  1OEY J;  1GJZ A;  1MK7 B;  1T0S C;  4GB9 A;  1MJD A;  4HJK A;  4JE3 B;  3APD A;  4W9H A;  4A20 A;  4KAX B;  1P3R A;  4C7Z A;  2M14 A;  3QWM A;  3TIX A;  2KDE B;  2LRW A;  3RFZ B;  2NBV A;  4HAU B;  3HW2 B;  4Z2N A;  4GOC A;  3DVG Y;  4J6I A;  4IWP A;  3U12 A;  5L95 C;  4HCP B;  3M1I B;  3ETR A;  2KKC A;  1NTY A;  3T8M A;  2KDF B;  3EFC A;  4QJ3 B;  2FNJ B;  3P4P B;  3TJP A;  4BBN F;  2JU6 X;  3AEE B;  1U5G A;  1EVH A;  2KFJ A;  2JXX A;  2DZK A;  3SEB A;  1TTN A;  2R2O A;  1FAO A;  3H7P A;  5BMG A;  1JRU A;  3MPX A;  4HDO A;  1XLP A;  1K5G B;  2D3C A;  2VKI A;  1L0Y B;  3Q3F A;  1I4Q A;  1UEF A;  2AX5 A;  2ZZP B;  2KLG A;  2VZK B;  1XQQ A;  2N9X A;  4N59 A;  4ZRQ A;  2L1C A;  1BAK A;  1N61 A;  2A5U A;  1X05 A;  4Z2M B;  2KYW A;  2RDB C;  2GRI A;  1F1H A;  4DIX A;  2DAF A;  3SDL C;  3ZTC A;  1V97 A;  2G9H D;  3Q8E A;  1SB3 C;  3CST A;  4BKT A;  1YN5 A;  1QT9 A;  3BVM A;  1JRO A;  3ZIM A;  3ODX A;  3PZD A;  2M17 A;  2XNA C;  3M3J A;  1L4Z B;  2JWU A;  3UIP B;  1KFY B;  4DDI D;  4KKI A;  3AE6 B;  5C5B B;  4XDC A;  5BYR A;  4DX9 0;  4OW0 A;  2LAS A;  2MBO A;  3VUY A;  1K52 A;  3KUZ A;  3OJ3 A;  1FOE A;  3BWU D;  4LJO B;  3V5W A;  1C77 A;  1F0Z A;  3IFW B;  4HAX B;  2J59 M;  1EUV B;  2I5C A;  1WX9 A;  2W2X D;  2BB5 A;  5D3Y A;  1HE8 A;  1UPQ A;  2WXQ A;  4C80 A;  2I1K A;  4GDL A;  3GE8 C;  1KZG A;  3RYT A;  1S3S G;  2R09 A;  2M38 A;  3MC9 A;  4YTM B;  4MY6 A;  2M56 B;  3HK0 A;  1WMH B;  2WXP A;  2GB1 A;  2N7J A;  4KHA A;  1TYG B;  2JZP A;  4HSI A;  3A9K A;  3B9J A;  2DFK A;  2DKP A;  4BFR A;  2BWE S;  4HJG E;  2LI5 A;  4MDK E;  2DLB A;  2KT7 A;  4DK5 A;  1DGJ A;  4IWO A;  5DPT A;  3NSU A;  5C16 A;  4ZDV A;  1XLN A;  2WHI A;  3ZUN A;  2DHJ A;  3I57 A;  1EU3 A;  3U7D A;  5EE3 A;  4TQ1 A;  3T3N A;  1D3Z A;  4MGI E;  5D94 A;  2JXT A;  2ZPY A;  2FE8 A;  3PGE A;  2L0F A;  3ONS A;  3TSS A;  3KZ1 A;  2L0T A;  3NY5 A;  1WGU A;  4W9J A;  4BKG A;  4ZYN A;  1FPY A;  3N3K B;  4EZJ A;  2MP2 B;  2AQ3 B;  1S1Q B;  2NBV B;  3AN1 A;  2K6D B;  2IJ0 A;  2KLC A;  1FD6 A;  2BS4 B;  1EF5 A;  4HB3 B;  5AEK B;  4A6F A;  4XGA B;  3MP9 A;  3X0W A;  3ALB A;  1NU2 A;  4A6Q A;  4MAC A;  1E7V A;  1Y8R C;  3RNC C;  2PVG C;  2KX0 A;  3P4Q B;  3VH4 B;  5D2M B;  2YLM A;  4OHJ A;  5H92 C;  1UF0 A;  1L5P A;  3KQ4 A;  4QJ5 B;  5D3X A;  3PRE A;  3PVW A;  4M8M A;  4NJ7 A;  3E56 A;  2DZM A;  3IG3 A;  5KHO A;  5HE0 A;  2CJO A;  1P7E A;  3PPA A;  1T0Y A;  3VFK A;  4GU2 A;  2LG1 A;  3SUZ A;  2D3B A;  2K3U A;  5IOI A;  2LKO A;  1ZXH A;  2G3Q B;  4FLH A;  4RCO A;  4A8X C;  1MI1 A;  5H8Y E;  3JSV B;  2KMA A;  3DBL B;  3S2A A;  2IDY A;  5KCV A;  1WR6 E;  1ZYI A;  1WXQ A;  3IT6 B;  1CQV A;  1V1P A;  5AZH A;  2DX1 A;  5JZE B;  3JW0 X;  2GJY A;  2KWC A;  3P2B A;  1VD2 A;  3NHE B;  1I4G A;  2Z59 A;  3TO1 A;  1X1M A;  2G1E A;  2C7N B;  3V60 A;  3BK1 A;  1WGH A;  5LLI A;  2DLW A;  3SD5 A;  3ECI A;  3P42 A;  1SJE D;  3A1Q B;  3PZ7 A;  4RM8 A;  4RH6 A;  3M95 A;  4ICV A;  3PVU A;  4YSX B;  5IP4 D;  2KCJ A;  1EO6 A;  2DA0 A;  2WGS A;  3KRW A;  2OJW A;  1SHC A;  1E5W A;  2C60 A;  2OHF A;  4W9C A;  2XQN M;  1TKE A;  5JP4 A;  5LXH A;  5CLL B;  3VAW A;  4JX1 C;  5G5G A;  2GOW A;  1CK1 A;  1E8X A;  1GPX A;  5JHB A;  2Z8L A;  3WAN A;  1SE9 A;  2JX5 A;  2RGN B;  1FNV A;  1Z2M A;  1JAL A;  1PQS A;  4K2O A;  5JHH A;  4KGS A;  2W2X C;  3WIM A;  2Y5B B;  1WXS A;  3LB8 C;  3AE8 B;  4CQN A;  2N23 A;  1YNT E;  2DYM A;  1K50 A;  2J52 A;  3RI7 C;  3ZXR A;  2KGX B;  2DBY A;  4R3D A;  1XXG A;  2IYB A;  4WJO A;  1ZGU B;  2BYT A;  2R2Y A;  1OY2 A;  3E9S A;  2IO2 B;  1HZ5 A;  1UWX A;  5C6R A;  4EEW A;  2KAJ A;  1UUP A;  4OVV A;  4NSW A;  2KMM A;  1FHX A;  2G4S A;  1I35 A;  1TT5 B;  1MHX A;  4LDT D;  3RCP A;  3U30 A;  3V6C B;  4HHV A;  4KZ0 A;  3Q3O C;  2KTR A;  3DPD A;  3MC8 A;  3GYP A;  1E8W A;  2FID A;  4C0A A;  3BJI A;  1MFW A;  1SIF A;  2LMC A;  3EC8 A;  1UBQ A;  3IXS A;  4UDU C;  1BWN A;  3PZ8 A;  3TMP B;  3VR8 B;  2LOZ A;  1MPH A;  4NQK E;  1JW9 D;  4MEM A;  2RVB B;  2KAC A;  4HAT B;  5EE1 A;  4RM9 A;  1AYF A;  3BYT B;  1EGX A;  1RRP B;  3DVN U;  4K2P A;  1V1P B;  4RFB A;  4RF0 A;  1WE7 A;  2IND C;  1WWT A;  2NPT B;  1ENF A;  4YTP B;  1PUT A;  5JHA A;  2LWP A;  4S17 A;  4AUQ C;  3NOB A;  4LNN A;  2MBE A;  4A5K A;  3H6N A;  3SU8 X;  4E74 A;  3DQV A;  1RLF A;  1WY8 A;  3L16 A;  2ZNV B;  2A4Z A;  3PSC A;  3T9L A;  5CLQ B;  2GBJ A;  2RNR B;  4GOU A;  5C79 A;  2YVC A;  2Z13 A;  4IAP A;  3O96 A;  5JLJ B;  3PP2 A;  2FCN A;  1M4V A;  2L52 A;  2LD9 A;  2JT4 B;  1OQQ A;  4ANU A;  2FCM A;  1N63 A;  1C79 A;  2FJL A;  2NMQ A;  3W9C B;  1P0R A;  1LXD A;  2ZEQ A;  3Q69 A;  3CMM B;  4HK2 A;  2RR9 A;  4XC2 A;  3PVL A;  2WXL A;  4AP4 C;  3B77 A;  4KHO A;  1D5X C;  2LGS A;  2P0F A;  5FR6 A;  1FXA A;  4ZRP A;  2CRF A;  2MJE A;  1M7R A;  4DQO C;  4C7Y A;  1QOG A;  4OVU A;  3CWI A;  3AE3 B;  3CSF A;  4A3O A;  3Q6B A;  4FHK A;  1TS4 A;  3N9Y C;  1P3Q U;  3ZTD A;  2AYO B;  2MP2 A;  1N62 A;  2PE6 B;  3B1L X;  1TXD A;  3T3O A;  3VH3 B;  3LXF A;  1SGH A;  2MRP A;  3L54 A;  3UF8 A;  3UZT A;  1AN8 A;  2MBB B;  1IPG A;  2KQ7 A;  1BUI C;  3NW8 A;  4PS3 A;  2L83 A;  4JGH B;  1LFD A;  3H8H A;  2RGF A;  2LEK A;  2D2Q A;  2R61 A;  5C2T B;  4DHZ E;  5KQ1 A;  1JWB D;  3SFE B;  2G4D B;  4USA A;  3FKY A;  1TS3 A;  1WXM A;  2MW5 A;  3A4R A;  3RN9 C;  2WXM A;  3VQI A;  3WAO A;  1I42 A;  3AEA B;  2N1V A;  4F7H A;  4IKG A;  1UNP A;  2C7M B;  4WQM A;  2QHO A;  4TYZ A;  1ZPS A;  4A55 A;  5HKH A;  2D3A A;  2XEW A;  2NPT A;  2Y5P A;  5BMI A;  5IKC M;  5DHF B;  4WIP A;  2RPV A;  4A6K A;  2LVO A;  5FKA C;  1WMH A;  1T3Q A;  1ZOY B;  3TL5 A;  1FIQ A;  2V3N A;  2GBN A;  2BBC A;  1D4B A;  3WAP A;  1STE A;  3OG5 A;  3ZXV A;  3HUI A;  4ZYS A;  2V3S A;  1P98 A;  1GG3 A;  2PVO D;  3FAH A;  1VR9 A;  2LUL A;  1TS5 A;  2COF A;  3HM3 A;  4WJN A;  2PW9 A;  2PJH A;  4K7S A;  3SR6 A;  1OGW A;  2GBK A;  1VJK A;  2D9Z A;  3RPF C;  2JP2 A;  3FM8 C;  2BKF A;  1AW7 A;  1TY0 A;  1XKE A;  3KVF B;  4HCN B;  3EEC A;  3IHP C;  4HAW B;  2HJ1 A;  5D3I B;  3U52 E;  4XX5 A;  2LVQ A;  4W9K A;  3PRM B;  3UQA A;  1HQR D;  1KM7 A;  2MA9 B;  4B6H A;  1JWA D;  2EC1 A;  1XCG A;  2NCN A;  5DIF B;  4DBG A;  4B0M A;  3W1S C;  1LM8 B;  1WI0 A;  4EJN A;  5M4Y B;  1KF6 B;  1B1Z A;  1PYW D;  1FCC C;  2BWF A;  2N0Y A;  1YJ1 A;  2P0D A;  5D27 A;  1RFA A;  1KJT A;  4M02 A;  3OJ4 B;  3BK2 A;  4S0R A;  3VHT C;  2K8E A;  1IBX B;  2BGF A;  2R0D A;  2WYQ A;  4OZA A;  1KTK A;  2M0A A;  2NBW B;  4FJY A;  4RF1 A;  2V0G A;  3NVY A;  1KRH A;  2MKR A;  4K17 A;  2H88 B;  2W55 A;  1YX5 B;  1WJ4 A;  4YSY B;  2V76 A;  3P4R B;  1U4A A;  2RD0 A;  2D07 B;  3URY A;  2L3Z A;  3K9O B;  2G35 A;  1GNU A;  1U27 A;  1H8C A;  1P7F A;  3AEC B;  3QA8 A;  3BY4 B;  1TS2 A;  1LO5 D;  2HE7 A;  3M63 B;  4BOS C;  4BKS A;  2Z14 A;  1H10 A;  5CHW A;  3QJZ A;  2WLB A;  2LZ6 A;  4TUU A;  3V3X A;  2M8S A;  1X11 A;  4D6W A;  1UPR A;  1V89 A;  2J7Q B;  2DWQ A;  2KN5 A;  3M62 B;  3ML8 A;  4REZ A;  2HTH B;  2LHD A;  1LB1 A;  4HRO A;  1DYQ A;  2Z0D B;  3W5U B;  5L83 A;  2MDX A;  1B55 A;  4LNF A;  4EZK A;  5LXI B;  1J7C A;  4BBK A;  4RGT A;  4IM3 A;  1X86 A;  4ZOH C;  4MSQ B;  3ZRC A;  5HE3 A;  2YS3 A;  3CXB B;  3AU5 A;  1RAX A;  2Q5W D;  3WA0 A;  2FCS A;  3DBL I;  2CHX A;  4W9F A;  1FRR A;  2D9V A;  2VRR B;  1YQ4 B;  1GOZ A;  1V49 A;  3Q8A A;  2TSS A;  4YTN B;  4GMV A;  1XLO A;  1BT0 A;  3NWD A;  4YL8 A;  2IO3 B;  1V61 A;  2NS5 A;  2YEP B;  2BYV E;  3N32 A;  4MK0 A;  2VSZ A;  4EOY A;  1WFY A;  5I4D A;  1YD8 U;  4DWF A;  1YIW A;  2M1M A;  5J3Q A;  2FUH B;  1UD7 A;  3UGB B;  5AUI A;  4TMA B;  2YF0 A;  1K8R B;  1L2N A;  2MJ3 A;  1JQ4 A;  3ZGZ A;  3NG0 A;  2B3A A;  5E6N A;  2IFS A;  1K5D B;  4JL9 A;  4NJ6 A;  1W1G A;  1X1F A;  4ICU A;  2XN9 C;  3MFG A;  2PLP A;  3FEH A;  2KTF A;  3IVF A;  5D3D A;  3KY9 A;  2PTL A;  5LNK 1;  4FXC A;  1F2R I;  3VTU A;  2JY6 A;  1TKG A;  3UI3 A;  1UNR A;  2PE9 A;  1R4M B;  4E3C A;  1FGZ A;  2MWS B;  1DBH A;  3AE1 B;  4IUM B;  2IBI B;  2N9E B;  2V4I B;  1QOB A;  4KHB A;  1L4D B;  2V1Y A;  3HVD A;  2Z0E B;  2WX1 A;  4KDL B;  2JZ3 B;  3FC4 A;  2UZS A;  5C1Z A;  1V5U A;  3QBV B;  3DHG C;  1OFF A;  1NDD A;  1SSN A;  1SJH D;  2OOB B;  1Y56 A;  1V86 A;  3ZJT A;  5DHA B;  4M00 A;  2WXK A;  1FEH A;  5D7G A;  1SE4 A;  3DHH C;  3QC8 B;  2ON8 A;  3AEF B;  3NZU A;  1J7B A;  2KWV B;  3RZW C;  3VTV A;  1E8Z A;  3U2S C;  1C4A A;  3VRB B;  4DHJ B;  3HQC A;  2COC A;  3RZF A;  4HLE A;  4PT5 A;  2WDR B;  2OED A;  2DEN B;  3R2T A;  1PLS A;  1OMW A;  3DHI C;  4PQ0 A;  4DXA B;  1DOX A;  3PO0 A;  5LON B;  1Q5W B;  2DZJ A;  4OZB A;  1ZW7 A;  5MPO A;  4EKU A;  2LFI A;  1FHO A;  1V80 A;  5J18 A;  1WGQ A;  4PNK A;  3MJW A;  3W5V B;  3B2F A;  1RRB A;  4KVG B;  4A9A A;  5IRS A;  4KDI C;  4MT7 A;  4NAW A;  4D0N B;  1QIL A;  2KD0 A;  1ISN A;  1L0X B;  2LXA A;  4OSN A;  3NZS A;  2IPK D;  3KH0 A;  3ZDM C;  4YON A;  1V5M A;  5BYQ A;  4HVB A;  1SIJ A;  4G3X B;  2GMI C;  3P63 A;  1BTK A;  1FNU A;  4YSZ B;  4FAD A;  1CJE A;  2INP E;  2O2V B;  4FA6 A;  2OTX A;  2GI9 A;  2ASQ A;  3DCG A;  2DKQ A;  1NI2 A;  4YWG G;  2KQS A;  3B08 A;  4K3B A;  4JLC A;  2CKH B;  2EKE C;  1ZDX A;  2BS2 B;  2REX A;  2L32 A;  1C78 A;  2MFQ A;  1T5X D;  2LJ5 A;  1Q67 A;  1WGG A;  1D5M C;  1L7Y A;  1RWS A;  3VRA B;  3VR9 B;  2QIL A;  1WGY A;  2H7D A;  4I6N B;  4HKQ A;  3A8Q A;  2QKL A;  1OEY A;  1E9M A;  1QOA A;  1YOV B;  1MKE A;  1G6J A;  4FJZ A;  2CHZ A;  4GZU A;  1YQ3 B;  4ITK A;  3BYY B;  2N9L A;  2AEH A;  2LXC A;  1XD3 B;  3VXW A;  3A9J B;  3KWV A;  5BO4 B; 
#chains in the Genus database with same CATH homology
 4KHO A;  4MSM B;  1WJN A;  2XBB C;  3VIA A;  2FCQ A;  3JVZ X;  4WJP A;  4KIK B;  4M8N A;  3ZNI D;  4JQW C;  1R4N I;  2MWN B;  3DBS A;  2P0F A;  5CX3 A;  5FR6 A;  2K39 A;  3UIN B;  1C3T A;  2KUP A;  2CRF A;  2IZV B;  5KHO A;  4ASW C;  4BBN C;  1M7R A;  1U5F A;  4GGQ A;  2K2J A;  1J0G A;  4NJ7 A;  1WM2 A;  1OEY J;  1GJZ A;  1MK7 B;  4GB9 A;  3NS8 A;  4OVU A;  3ODW A;  3TW1 A;  1P1A A;  3QIJ A;  1U5E A;  3CSF A;  4HJK A;  4A3O A;  1WYW B;  3APD A;  4FHK A;  2N7D A;  4W9H A;  3A9K B;  2WX0 A;  4A20 A;  3PHW B;  2KDI A;  1P3Q U;  3P6A A;  3ZTD A;  1TJ6 A;  2AYO B;  3ULC A;  3FSS A;  4KAX B;  2MP2 A;  2PE6 B;  4MGZ E;  3B1L X;  1P3R A;  2Z59 B;  4W9D A;  1TXD A;  3MTN B;  2ZNV C;  3VH3 B;  2FAZ A;  2M14 A;  3QWM A;  1WZ3 A;  3QX1 A;  1QC6 A;  2ROV A;  2IO0 B;  1TBE A;  3TIX A;  1J8C A;  2KDE B;  2LRW A;  4E74 A;  3V6E B;  4HAU B;  1FGY A;  3HW2 B;  1SGH A;  4Z2N A;  1V9J A;  2KTR B;  3UZT A;  2MRP A;  2UWQ A;  3DVG X;  2MBB B;  3DVG Y;  4GOC A;  4IWP A;  4J6I A;  5L95 C;  3DBH I;  4HCP B;  1IPG A;  2KQ7 A;  4PS3 A;  5FI1 A;  1WM3 A;  3DXD A;  2DYB A;  2MLB A;  3MDB C;  1XX0 A;  1QQG A;  3M1I B;  2KKC A;  2NBU A;  3RD2 A;  3W1Y A;  4JGH B;  1NTY A;  2OQB A;  1LFD A;  3T8M A;  2KDF B;  2PPH A;  1Y5O A;  2FNJ B;  2RGF A;  5IAA C;  3TJP A;  2D2Q A;  1KI1 B;  4DHZ E;  2RUK B;  2MX2 A;  4BBN F;  2JUO A;  5KQ1 A;  1U5G A;  2MQJ A;  4XZ4 A;  1EVH A;  2KFJ A;  2ZJD A;  2JXX A;  2NVU I;  1U29 A;  1U2B A;  2DYQ A;  2DZK A;  4K1R B;  2Z0Q A;  1WF9 A;  2C9W B;  2G4D B;  1TTN A;  2R2O A;  4M0W B;  1FAO A;  2D3G A;  3H7P A;  4PYU A;  3KYD D;  3TCA A;  3V62 A;  2RSU A;  1UBI A;  1JRU A;  1WXM A;  2MW5 A;  3A4R A;  3VQI A;  3WAO A;  1I42 A;  4BVU C;  3VUW A;  3MPX A;  2N1V A;  4KV2 A;  3DXC A;  4HDO A;  4F7H A;  5E6P A;  4GDL B;  3RT3 B;  1UNP A;  3GZN I;  4I6L B;  2C7M B;  1N3H A;  4WVF B;  3PTF C;  4URK A;  4TYZ A;  2L8J A;  2QHO A;  1K5G B;  3KRX A;  2VKI A;  1ZSQ A;  3ML9 A;  3VUX A;  5HKH A;  2CY5 A;  4IFS A;  3Q3F A;  1UEF A;  2XEW A;  2ZZP B;  3RUL A;  2KLG A;  4A6F B;  3VDZ A;  1XQQ A;  2N9X A;  4NAW B;  2L1C A;  1BAK A;  2NPT A;  1I7A A;  2YS5 A;  2RSG A;  2A5U A;  3VTW A;  1X05 A;  5DHF B;  4Z2M B;  4HPL B;  4A6K A;  1M94 A;  3KUC B;  1CMX B;  2LVO A;  2DAF A;  2IYD B;  4G50 A;  1WMH A;  3SDL C;  3ZTC A;  2BYF A;  2BCJ A;  3TL5 A;  4RMA A;  2KFK A;  3CST A;  4BKT A;  2GBN A;  3RUI B;  5IA7 A;  3H6N A;  3WAP A;  2UZR A;  3ZIM A;  3BIN A;  2ZCB A;  3ODX A;  3PZD A;  2M17 A;  3KYC D;  3ODO A;  3M3J A;  3ML4 A;  2KDB A;  3UIP B;  2V3S A;  2WDT B;  1P98 A;  1GG3 A;  3HHM A;  5D6J B;  2LGD A;  2COD A;  3C0R B;  2LUL A;  4GDK A;  4DDI D;  1MK9 B;  2D10 A;  5C5B B;  2COF A;  2ZVO A;  1WZ0 A;  3HM3 A;  4WJN A;  2ELB A;  1GC6 A;  4DX9 0;  4IG7 B;  2LAS A;  5C23 A;  2PJH A;  4K7S A;  1WG7 A;  1OGW A;  2GBK A;  2MBO A;  3H1U A;  2D9Z A;  2Y8F A;  2YT1 A;  2QKM A;  2JP2 A;  1UZX B;  3FM8 C;  1FOE A;  3KUZ A;  3L17 A;  3OJ3 A;  4LJO B;  3V5W A;  2V4L A;  3SO6 A;  2BKF A;  2Q13 A;  1XKE A;  3SV1 A;  1LQB A;  3KVF B;  3IFW B;  3ZNZ B;  4BOZ B;  4HCN B;  4HAX B;  2J59 M;  2N9P C;  1EUV B;  2I5C A;  1E90 A;  1WX9 A;  2I1J A;  1WGR A;  3EEC A;  3IHP C;  2W2X D;  3MHS D;  4AJW A;  4HAW B;  4GDK B;  1ZC4 B;  4F1S A;  2COA A;  5D3Y A;  1HE8 A;  2K6Q A;  1UPQ A;  4HB0 B;  2LVQ A;  2I1K A;  4KSK C;  4XX5 A;  4W9K A;  3A8P A;  2Y7B A;  3A98 B;  4GDL A;  1AAR A;  3L13 A;  1KZG A;  2EMS A;  3PRM B;  2BF8 B;  3UQA A;  3KW5 B;  3RYT A;  1KM7 A;  1S3S G;  2MA9 B;  2R09 A;  4GN1 A;  4B6H A;  2M38 A;  3WAL A;  1DDV A;  5DPW A;  4WWO A;  2EC1 A;  4HAV B;  3L10 B;  1XCG A;  1XOD A;  4MY6 A;  1WJ6 A;  3HK0 A;  4MM3 A;  3ZKJ C;  1WMH B;  3VOQ A;  3TBL D;  4ZRK A;  2NMB A;  1WRD B;  3LJ3 A;  2NCN A;  5G55 A;  3AJ4 A;  3DDC B;  5DIF B;  4DBG A;  1MAI A;  2KJ6 A;  4KHA A;  1LM8 B;  1WI0 A;  4X57 B;  4EJN A;  1MG8 A;  2LOX A;  3W1S C;  2Z0O A;  2CAY A;  4WSF A;  2BWF A;  3A9K A;  3H7S A;  5TR5 A;  3QAQ A;  2DFK A;  2KVR A;  4MGK E;  5LOP B;  2N0Y A;  2LGX A;  1YJ1 A;  2DKP A;  2P0D A;  4WJ7 A;  5D27 A;  4F7G A;  1RFA A;  4BFR A;  2BWE S;  1ZC3 B;  3HM6 X;  1KJT A;  1V5O A;  2LVP A;  2LI5 A;  2W2W A;  4MDK E;  3OJ4 B;  4DK5 A;  4IWO A;  5DPT A;  3VHT C;  2BGF A;  3UIO B;  2R0D A;  3NSU A;  2K25 A;  5C16 A;  2WYQ A;  4W9G A;  3UF8 A;  4ZDV A;  4GSW A;  4LJP B;  3GOE A;  3L0W B;  3ZUN A;  5J17 A;  2NBW B;  2YSZ A;  2DHJ A;  1WR1 A;  3DVN V;  1V5T A;  3P7Z A;  3QAR A;  4FJY A;  3U7D A;  2MKR A;  1GC7 A;  4K17 A;  4Y94 A;  5D3V A;  5DH9 B;  1MIZ B;  2DYN A;  1WJ1 A;  1WJ4 A;  1YX5 B;  2KXJ A;  4TQ1 A;  5DPS A;  4MGI E;  4P7I A;  5D94 A;  2D9X A;  4F8C B;  4FJV B;  1D3Z A;  2V76 A;  3D8D A;  2ZPY A;  4IOY X;  3PGE A;  2L0F A;  1U4A A;  4K7U A;  2ADZ A;  1FHW A;  2D07 B;  3KZ1 A;  2RD0 A;  3ONS A;  4ANV A;  2NZ8 B;  4GPT B;  2L3Z A;  2L0T A;  2N7E A;  3PG7 A;  3K9O B;  3NY5 A;  2AL6 A;  4EFO A;  2G35 A;  1WGU A;  3D8F A;  5EFX A;  1ZKH A;  1GNU A;  2ZVN A;  3QWZ B;  4W9J A;  1U27 A;  4ZYN A;  4BKG A;  4FBJ B;  4MH0 E;  1H8C A;  3N3K B;  2KMC A;  3SYX A;  4EZJ A;  2MP2 B;  2KC1 A;  1A5R A;  3T9L A;  2MSE D;  3RCZ A;  3QA8 A;  1E7U A;  1S1Q B;  3BY4 B;  2NBV B;  3IG3 A;  3U8Z A;  2HE7 A;  2HJ8 A;  3M63 B;  4BOS C;  1OQY A;  4FHJ A;  4BKS A;  2PEA A;  1H10 A;  1YX6 B;  4I6P A;  4GXB A;  5CHW A;  2BYE A;  2G45 B;  4AJY B;  2K6D B;  3QJZ A;  2LZ6 A;  2KLC A;  2JVC A;  2GBR A;  4TUU A;  4WWP A;  2M8S A;  1X11 A;  4ZRJ A;  2RPQ A;  4B9K A;  5HE2 A;  1EF5 A;  1WX8 A;  1UPR A;  1WX7 A;  4HB3 B;  1V89 A;  1UNQ A;  4A6F A;  2J7Q B;  2KZR A;  4CHM A;  1WJU A;  5AEK B;  2KN5 A;  3M62 B;  3X0W A;  1OQN A;  3UQB A;  3ML8 A;  3ALB A;  3PHX B;  1NU2 A;  2HTH B;  1TGZ B;  4W9L A;  1LB1 A;  1E7V A;  1Y8R C;  3VH4 B;  2KX0 A;  1ZVR A;  2DAJ A;  2O6V B;  3L08 A;  2YLM A;  2KO3 A;  2Z0D B;  3R66 C;  5D2M B;  5AZF A;  3ZW3 A;  5L83 A;  2MDX A;  2OJR A;  1B55 A;  2AWT A;  2KFK B;  4ANX A;  4EZK A;  5LXI B;  1J19 A;  4BBK A;  2NR2 A;  1X86 A;  4IM3 A;  4MSQ B;  3ZRC A;  5D3X A;  3LJU X;  2CU1 A;  2EJ8 A;  3PRE A;  3TFM A;  1BTN A;  3PVW A;  5HE3 A;  4CYE A;  4M8M A;  2YS3 A;  4ZRI A;  1WXV A;  2DN6 A;  3CXB B;  5HE0 A;  3AU5 A;  2DZM A;  2J0M A;  1RAX A;  2IY0 B;  1T0Y A;  2EMT A;  3WA0 A;  1Z5S B;  3PPA A;  4GU2 A;  4IW0 A;  2LG1 A;  2GS0 A;  3VFK A;  3SUZ A;  2FCS A;  3DBL I;  3H9D A;  3ZLZ A;  4AWJ A;  2LKO A;  2CHX A;  1W1H A;  2G3Q B;  3Q3J A;  5G2N A;  1DDM A;  4W9F A;  1Q0W B;  1KZ7 A;  5GOW B;  2D9V A;  1EAZ A;  2VRR B;  2IO1 B;  1V49 A;  4FLH A;  4PYZ A;  3ULB A;  1UH6 A;  5JHG A;  4GMV A;  5FI0 A;  4ANW A;  2KNB A;  1BT0 A;  4DHJ D;  1V88 A;  3JSV B;  4YL8 A;  2IO3 B;  1V61 A;  2NS5 A;  2KMA A;  3S2A A;  2M0X A;  1FB8 A;  5KCV A;  1WR6 E;  3X23 A;  2FIF A;  3F0W A;  2RLO A;  1QZE A;  2BYV E;  2LRU A;  1WI1 A;  4II3 B;  4IM0 A;  5JH5 C;  1E8Y A;  4MK0 A;  3N32 A;  2VSZ A;  4EOY A;  4DDG D;  1WFY A;  5LXH A;  5AZH A;  4KHB B;  4WAA A;  1YD8 U;  2DX1 A;  4DWF A;  3JW0 X;  2GJY A;  2KWC A;  2UYZ B;  5JZE B;  1NTV A;  4W9I A;  3P2B A;  1VD2 A;  5J2R A;  3N30 A;  3NHE B;  4KSL C;  4MJS A;  4TV3 A;  1YIW A;  4PS8 A;  2M1M A;  3KUD B;  5J3Q A;  2FUH B;  3TO1 A;  2N4F A;  1X1M A;  1J0W A;  4DBB A;  1UD7 A;  2JF5 A;  2C7N B;  2K1F A;  4WWN A;  3UGB B;  3V60 A;  4CHK A;  2VRW B;  1DRO A;  2YF0 A;  1UEL A;  1WGH A;  1MIX A;  5LLI A;  2ELA A;  1K8R B;  2K8B A;  2DLW A;  3PEG A;  2MBH A;  3A4S C;  3ECI A;  3SD5 A;  1L2N A;  1PFJ A;  1WJM A;  2C5L C;  3GYO A;  2B3A A;  5E6N A;  2IFS A;  3A1Q B;  4K7W A;  1V81 A;  4A6H A;  2KK8 A;  1ZM0 A;  4RM8 A;  3JYU A;  1K5D B;  4JL9 A;  4NJ6 A;  1P5T A;  3AU4 A;  1W1G A;  3G9W A;  1X1F A;  2LUE A;  3EHV A;  3M95 A;  4ICU A;  4ICV A;  3SNH A;  3PVU A;  1GUA B;  3ZRF A;  4CHJ A;  1UGM A;  3FEH A;  2KCJ A;  2Y8G A;  3WAM A;  2KTF A;  1EO6 A;  3IVF A;  2DA0 A;  3CIK A;  3KY9 A;  3PV1 A;  3KRW A;  3VTU A;  4NY0 A;  1SHC A;  1E5W A;  1X1G A;  2JY6 A;  4GMX B;  2C60 A;  4BKS D;  4E71 A;  1XT9 B;  5J3Y A;  2WWZ A;  2KHW B;  2UVM A;  1UNR A;  2DHK A;  4EMO A;  3K9P B;  2XQN M;  4W9C A;  4HB2 B;  4HXD A;  3A9J A;  5JP4 A;  2PE9 A;  4E3C A;  4KZC A;  1V5P A;  1FGZ A;  3ZDT A;  2D11 A;  5CLL B;  1DBH A;  4XWX A;  2MWS B;  3JSV A;  1V6E A;  3OAW A;  4IUM B;  2IBI B;  4FN2 A;  4IM2 A;  4IWQ A;  3VAW A;  1M7E A;  2GOW A;  3AXC A;  1E8X A;  2GBM A;  2JRI B;  2N9E B;  4A3P A;  5JHB A;  3WAN A;  1SE9 A;  2XK5 B;  1U5D A;  2RGN B;  4KIK A;  4HAY B;  3SHQ A;  2JZZ A;  2V1Y A;  3D32 A;  5GMV A;  2Z0E B;  1IP9 A;  2ZCC A;  1Z2M A;  2WX1 A;  4KDL B;  4NQL B;  5CTR C;  2JZ3 B;  1PQS A;  4K2O A;  5JHH A;  1WE6 A;  2N1W A;  1KOT A;  2MBQ A;  1DDW A;  2UZS A;  5C1Z A;  3PRP B;  1V5U A;  4G0N B;  2W2X C;  3QCA A;  1YQB A;  3QBV B;  4MEL A;  3WIM A;  3TVV A;  1NDD A;  3DOW A;  4WJQ A;  2Y5B B;  1W1D A;  1WXS A;  2OOB B;  4IC7 B;  2L05 A;  1V86 A;  3B0A A;  5DHA B;  1XR0 B;  2N23 A;  2L76 A;  5D7G A;  1XD4 A;  4TKN A;  1C1Y B;  2XK5 A;  3LDZ E;  3ZVR A;  2BPS A;  2DYM A;  2KOX A;  3R7Q A;  3QC8 B;  2JRH A;  4DX8 A;  2YT0 A;  3EFU A;  3NZU A;  1WXA A;  3QK0 A;  4AP4 C;  5D3W A;  1NBF C;  1DYN A;  2KWV B;  5CHV C;  2KGX B;  3RZW C;  2HTH A;  3ZVV A;  1PMS A;  3VTV A;  2D9Y A;  1E8Z A;  5DI9 B;  2IYB A;  3T06 A;  3ZNG C;  4WJO A;  3R7R A;  1ZGU B;  3VUY A;  1OY2 A;  4DHJ B;  3HQC A;  2COC A;  2IO2 B;  2O6V A;  4LCD E;  3RZF A;  4HLE A;  2KX3 A;  2JPH A;  2DEN B;  3IBE A;  1Y19 B;  4HDQ A;  1PLS A;  5C6R A;  2YS1 A;  1OMW A;  1IRS A;  4PQ0 A;  4DXA B;  5CHF A;  2KWU B;  3OLM D;  4F7Z A;  1V2Y A;  4GIV A;  5J3T A;  4NNJ B;  4EEW A;  2ZPN A;  3WYF B;  1TQZ A;  4OVV A;  1IYF A;  2DHZ A;  4NSW A;  5LON B;  1Q5W B;  2O2V A;  4PS7 A;  3VVW B;  2MCN B;  1FHX A;  2DZJ A;  2AL3 A;  2G4S A;  4W9E A;  1I35 A;  3R3M A;  1ZW7 A;  4LDT D;  2Z0P A;  4EKU A;  1P9D U;  3H7P B;  3I3T B;  4HWI B;  2CY4 A;  3ZO5 B;  3RCP A;  1FHO A;  3U30 A;  2PZ1 A;  2K8H A;  1AQC A;  3V6C B;  4HHV A;  2KC2 A;  2BKR B;  1V80 A;  2KTR A;  2KAN A;  3DPD A;  4KZ0 A;  2LYD A;  4DHZ B;  1RJ2 A;  1WGQ A;  3GYP A;  2HD5 B;  3W1S A;  4PNK A;  5J18 A;  3MJW A;  1E8W A;  2ROZ B;  2FID A;  4WQO B;  4C0A A;  5DCN A;  4CO7 A;  3BJI A;  5EDS A;  4B6W A;  1R4M I;  1SIF A;  3DBR I;  1RRB A;  3EC8 A;  1UBQ A;  1WGD A;  3PT2 B;  3QQ8 B;  4LDT B;  4KVG B;  4JIO U;  4MJS B;  5DPR A;  2CR5 A;  3PLU A;  4KDI C;  2K2U A;  4MT7 A;  4NAW A;  4D0N B;  2KD0 A;  1ISN A;  2K8C A;  1BWN A;  2H7E A;  2L00 B;  3TMP B;  3L54 A;  3APF A;  2LXA A;  2J0K A;  2LOZ A;  4B95 A;  1MPH A;  1VCB A;  3NZS A;  2C7H A;  4NQK E;  1Z87 A;  3QHT A;  3KH0 A;  3ZDM C;  4MEM A;  4YON A;  2RVB B;  4HAT B;  1V5M A;  4HVB A;  4HPM B;  4RM9 A;  1EGX A;  3A33 B;  1RRP B;  4G3X B;  4II2 B;  2GMI C;  3DVN U;  2L2I A;  4K2P A;  1BTK A;  4N9F 4;  2JWZ A;  4HAZ B;  4FAD A;  4MGY E;  2R2Q A;  2O2V B;  1WE7 A;  2D9W A;  2DX5 A;  4FA6 A;  3ZNH B;  2OTX A;  3OAN A;  2ASQ A;  2NPT B;  3DCG A;  2DKQ A;  1NI2 A;  3PSE B;  4EZL A;  2KQS A;  5KHQ A;  3B08 A;  1WIA A;  4JLC A;  2GCJ A;  2GCL A;  2P0H A;  1OTR B;  2CKH B;  5JHA A;  2CHW A;  2LWP A;  2EKE C;  2K00 A;  2W9N A;  2D4Q A;  3DXE A;  3APC A;  4K81 A;  4AUQ C;  1F9J A;  2IY1 B;  1AWE A;  2REX A;  3NOB A;  3PS6 A;  2MBE A;  2MFQ A;  3CF6 E;  4A5K A;  1Q67 A;  1WGG A;  2P8V A;  2LJ5 A;  2YRY A;  1L7Y A;  1RLF A;  3DQV A;  3KSY A;  4H8S A;  1WY8 A;  3L16 A;  2ZNV B;  5AZG A;  2A4Z A;  1P6S A;  2DX5 B;  3PSC A;  3A1Q A;  4NPN A;  3V61 A;  3F5R A;  2DZI A;  4EUT A;  4HB4 B;  3N7C A;  5CLQ B;  1WGY A;  2GBJ A;  2M4N A;  4G11 A;  2H7D A;  4L6E A;  2E2X A;  1FXT B;  5C5B A;  2RNR B;  3A8Q A;  4I6N B;  2QKL A;  2L7R A;  5C79 A;  1OEY A;  5L81 A;  2YVC A;  2O6V D;  4IAP A;  1MKE A;  1G6J A;  4FJZ A;  2CS4 A;  2CHZ A;  3D8E A;  3O96 A;  4GZU A;  5JLJ B;  3PRZ A;  3PP2 A;  5KQ4 A;  3AI5 A;  2FCN A;  2KJR A;  2I5F A;  2DHI A;  3O65 B;  2AEH A;  2LD9 A;  2J0J A;  3ENE A;  2JT4 B;  5HE1 A;  4F7U P;  1Q1O A;  1WH3 A;  2LXC A;  2DTC A;  4ANU A;  2FCM A;  1I2H A;  3SU8 X;  1XD3 B;  3VXW A;  1H4R A;  3A9J B;  2FJL A;  2KJH B;  1EF1 A;  1P0R A;  1LXD A;  2ZEQ A;  2X18 A;  3AUL A;  3HIZ A;  3PLV A;  4TQ0 A;  1KLV A;  4FUL A;  1LW3 A;  2LGY A;  5E6O A;  4AOF A;  5BO4 B;  3CMM B;  4HK2 A;  2RR9 A;  4XC2 A;  1TZ1 A;  3PVL A;  2DYO A;  1WVH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...