4GN1A

Crystal structure of the ra and ph domains of lamellipodin
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
251
structure length
251
Chain Sequence
VKKLVIRVHMSDDSSKTMMVDERQTVRQVLDNLMDKSHCGYSLDWSLVETVSELQMERIFEDHENLVENLLNWTRDSQNKLIFMERIEKYALFKNPQNYLLGKKETAEMADRNKEVLLEECFCGSSVTVPEIEGVLWLKDDGKKSWKKRYFLLRASGIYYVPKGKAKVSRDLVCFLQLDHVNVYYGQDYRNKYKAPTDYCLVLKHPQIQKKSQYIKYLCCDDVRTLHQWVNGIRIAKYGKQLYMNYQEALK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Signaling protein
molecule keywords Ras-associated and pleckstrin homology domains-containing pr
publication title Crystal structure of Lamellipodin implicates diverse functions in actin polymerization and Ras signaling.
pubmed doi rcsb
source organism Homo sapiens
total genus 69
structure length 251
sequence length 251
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2012-08-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00169 PH PH domain
A PF00788 RA Ras association (RalGDS/AF-6) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 4gn1A02
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 4gn1A01
2MRPA 1IP9A 1Z2MA 2DYMA 2L0TA 2X18A 4NPNA 2I5FA 4DX8A 1MK7B 3RYTA 4WVFB 1LFDA 2XK5B 1ZVRA 2MFQA 1OEYJ 3HIZA 1XD3B 2ZPYA 1WXAA 3PSEB 4F1SA 4K7WA 3M62B 5AZHA 1PQSA 5JHGA 4KDLB 4ANWA 3UQAA 4A6KA 4KHOA 1P98A 4I6NB 2KFKB 4PS8A 3MJWA 1U4AA 2KNBA 3ECIA 4LJOB 1P0RA 1UELA 2GS0A 2MWSB 3ZKJC 1UNPA 1UD7A 2OTXA 2DX1A 2D11A 2WX1A 4EZJA 1TQZA 3Q3FA 3A9JB 4IUMB 4FN2A 2D3GA 3Q3JA 4BKTA 2KANA 2DA0A 2PE9A 3SD5A 2R09A 4M0WB 1J8CA 1XKEA 2JPHA 1DROA 2BKFA 2KWCA 3OJ4B 5LXIB 3L08A 2UZRA 4MELA 4NAWB 2LXCA 3LJUX 2DZMA 3K9PB 2R2OA 3DVGY 1P5TA 3FM8C 3VQIA 3CSFA 4KIKB 1FGYA 2N7DA 2MLBA 1NTYA 2JT4B 4ASWC 4HJKA 2CU1A 1V5TA 2ZCCA 1X05A 1P1AA 1V5PA 3I3TB 5JHHA 2RGFA 2RPQA 4MJSA 1E7UA 3V61A 2EC1A 3KW5B 4G11A 1SGHA 2GBRA 5J3TA 3KSYA 1T0YA 3SU8X 2DAFA 4LDTD 3QBVB 5DIFB 3QJZA 3DOWA 2ADZA 2KX3A 1RLFA 3A4SC 1WVHA 1YX6B 3IBEA 3PLUA 2FNJB 2JY6A 1YX5B 4XWXA 3PLVA 3GZNI 3UIOB 4EUTA 3KY9A 2V1YA 2N1WA 1X86A 1E90A 3TFMA 2RNRB 3N32A 1DDWA 2P0DA 4HB0B 4A6FB 4BKSD 1Z87A 4HAWB 2YS3A 3PSCA 3VAWA 5FI1A 3CIKA 1ZW7A 4DHJD 2VRRB 4KSLC 2N9EB 2D9VA 4OVUA 3H6NA 5L81A 1WGUA 2MA9B 1X1FA 3DVNU 3V6EB 1NBFC 5FI0A 4TQ0A 4DHZB 2BYEA 1V61A 1V5MA 4TQ1A 1C1YB 2MBOA 3DBSA 2K8HA 2BWFA 1U5EA 2J0KA 1WMHB 4WJPA 3QWZB 3PP2A 4FBJB 2ASQA 3IHPC 5E6OA 4LJPB 4HAXB 1PMSA 3K9OB 1BTNA 4GDKB 5D7GA 2W2WA 3H7SA 5TR5A 4HCPB 1OMWA 5J17A 3JYUA 2KDEB 4HAYB 2GCLA 3EHVA 3R3MA 2NMBA 2K2JA 4HK2A 2KTRA 3HW2B 4EOYA 3TCAA 2DHKA 2KTFA 2LYDA 2D9WA 2AYOB 1DBHA 4KZCA 2NVUI 1X1MA 4I6PA 2Z0QA 2A5UA 2NZ8B 1XX0A 2G35A 4W9HA 2IO1B 3ULBA 1RFAA 2DX5B 1MK9B 2OOBB 4MGZE 2EKEC 1XT9B 4F8CB 4W9JA 2E2XA 3V60A 1Z5SB 4IWOA 1Q0WB 4ICUA 3LDZE 4HDQA 3RZFA 3U8ZA 2DKPA 1LQBA 1WXVA 3PTFC 2GBJA 1WGYA 3NS8A 2NPTA 2DFKA 1UNRA 4WJQA 2GBKA 2KJRA 3DCGA 2HTHB 2NR2A 4HLEA 4DK5A 4AJWA 3SNHA 4WQOB 2I1KA 1OGWA 2Y5BB 4IWPA 5C23A 5D27A 2BCJA 2H7DA 2NCNA 2LGYA 5BO4B 3ZTDA 2WYQA 2AL6A 1EUVB 2COCA 2COAA 3UF8A 2V4LA 1RJ2A 1XR0B 5HE2A 2C5LC 3VUXA 3L0WB 2RSGA 2W2XD 3ULCA 5L95C 1WF9A 1A5RA 2KWUB 1I35A 1FB8A 2CR5A 3PPAA 3WAOA 3EFUA 1ZSQA 1FXTB 4ZRKA 3H1UA 3IVFA 3A9KB 2UVMA 3AU4A 4GN1A 1SIFA 2XQNM 4KHAA 3VTUA 1MAIA 3PHWB 4A6HA 3QAQA 1U27A 3VUYA 3A8QA 2L76A 1UPRA 4W9CA 3PHXB 3L10B 1V5UA 5AZGA 2C9WB 4DDGD 5DH9B 5D2MB 4BBNF 2Y8FA 3A1QA 4B6WA 2DTCA 4XX5A 5J18A 3PEGA 1X1GA 2BKRB 3RZWC 2NBUA 1WI0A 3C0RB 5C5BA 3VH4B 3VIAA 5JHBA 4IM0A 1UPQA 4HB3B 3WAMA 2Z0OA 3ALBA 4MSQB 2ZNVB 1WI1A 3OAWA 1FHXA 1K5GB 1KOTA 4EJNA 4DXAB 1KZ7A 4N9F4 1TJ6A 4GOCA 1B55A 2KX0A 2K25A 2PZ1A 2RD0A 1BAKA 1MKEA 1TGZB 1WGQA 2O2VA 4ANXA 1UEFA 2QKMA 1V2YA 4K7UA 4H8SA 3ZTCA 2CRFA 4EZLA 1NTVA 3MTNB 2M38A 2V3SA 2IBIB 3P2BA 2O6VB 4FULA 4KVGB 3ML4A 2IYBA 1L2NA 4TV3A 3SYXA 1L7YA 2Y8GA 2QHOA 2YVCA 2XK5A 2PPHA 2CHZA 3T06A 5HE3A 2UYZB 3JW0X 3PVUA 3JSVB 5GMVA 2CODA 1SHCA 2KFKA 4A5KA 2J7QB 1TBEA 2J0JA 4HDOA 1V80A 2JZZA 4IAPA 2LVPA 5CHWA 2CHXA 1WX7A 1MIXA 4NQKE 2KLCA 4RM8A 2PEAA 3X0WA 1RRBA 4A3OA 4MGYE 5C1ZA 4GMVA 3NSUA 3KVFB 4PYUA 2DYBA 4WWOA 3WAPA 3MPXA 1WR6E 4K17A 4NAWA 2B3AA 4DBBA 3W1YA 2YT1A 2IY1B 1W1GA 2R2QA 4KIKA 4IC7B 1EVHA 1H8CA 2RR9A 1YQBA 5DPRA 3KH0A 2D10A 3PRZA 1WZ0A 3JVZX 1MG8A 3H7PB 1M7RA 1KI1B 3HM6X 4IM2A 2ZCBA 1WIAA 4BKGA 4GSWA 3UZTA 5AZFA 3TO1A 1I42A 3PV1A 2R0DA 3WYFB 1LM8B 2BF8B 3QHTA 4GB9A 2LD9A 4IWQA 5DCNA 1QC6A 4W9FA 2QKLA 2MCNB 2AEHA 1GJZA 2N7EA 2UWQA 1V49A 2N23A 2P8VA 3PG7A 3EC8A 2RVBB 3TIXA 1U5DA 1TTNA 3ZW3A 1WJNA 3A98B 4A6FA 4BBNC 2YSZA 1AQCA 3VXWA 3ZVRA 5HKHA 3WA0A 4HATB 3TBLD 2MDXA 5LONB 2DHJA 2LXAA 4MH0E 2N0YA 2HJ8A 4WAAA 3SHQA 2I5CA 2D9ZA 3TL5A 2JUOA 1E8ZA 5JZEB 2M14A 1W1DA 2KGXB 2LUEA 2KJHB 1WMHA 2C7NB 4W9IA 4E71A 1G6JA 2MP2B 2HE7A 3NHEB 4K1RB 3SUZA 3QX1A 1ISNA 1QQGA 5J2RA 2BYFA 3ZVVA 2WDTB 2FUHB 2K6QA 2KWVB 3O65B 4KZ0A 3V5WA 4W9DA 5CHVC 2DENB 3RCPA 1WFYA 4LDTB 5DHFB 5FR6A 2FIDA 2KLGA 4ZRIA 1M7EA 2FAZA 4XC2A 3QIJA 3V62A 3SO6A 5CX3A 4P7IA 2C7HA 4ICVA 1IYFA 2XBBC 4RM9A 1WYWB 4BFRA 4CHJA 2YRYA 3RULA 3TMPB 4NJ7A 2L1CA 4DDID 1EGXA 4G0NB 3D8DA 1NU2A 2AWTA 2ZVOA 3L13A 2YT0A 3VUWA 4FADA 5KQ4A 2L05A 1P3RA 4F7ZA 2DKQA 3R7RA 4K81A 3OLMD 4DHJB 1R4MI 2K39A 2K8CA 4WWNA 4EFOA 2KDFB 1BTKA 2YS1A 5J3YA 2KFJA 4IOYX 1WY8A 2BPSA 2RLOA 1I2HA 1XD4A 4ANUA 1NI2A 3QC8B 2LG1A 3DBLI 1Q67A 4NQLB 3KYCD 3T9LA 4MT7A 4CYEA 4M8NA 2Y7BA 3SDLC 2MSED 4TYZA 2P0FA 3N30A 1NDDA 3WALA 2Z0DB 4ZDVA 1K5DB 4GDLB 2P0HA 1V5OA 2JF5A 4W9LA 2M1MA 4K7SA 2RSUA 1XCGA 3ZO5B 1WX8A 3KZ1A 3L54A 2LRWA 4K2PA 1H10A 4HB4B 4IM3A 3M95A 4WJNA 2JRIB 3TVVA 3O96A 1Y19B 5DPWA 1WJ4A 3ONSA 1ZKHA 5KHQA 3U7DA 1V81A 3AU5A 3BJIA 1E8XA 2EMTA 3KUZA 1UH6A 4NSWA 1V6EA 2L00B 2Z0PA 2LVQA 3NOBA 1J0GA 1OTRB 1J0WA 4CHMA 1E5WA 2D4QA 3A9KA 2D2QA 3OJ3A 4K2OA 3VTWA 1CMXB 4HWIB 4JQWC 1V89A 5DI9B 3TJPA 2MBHA 2ZZPB 4FA6A 2LJ5A 3VTVA 1OQNA 4IG7B 2KC1A 3ZNHB 5D3VA 2LOXA 1AARA 4HB2B 3R7QA 3B1LX 4HPMB 1P3QU 2L7RA 3KRXA 4RMAA 3KYDD 1Q1OA 4BOSC 4MY6A 5G55A 1KZGA 4DBGA 2OJRA 2KQ7A 2M17A 2IZVB 1EF1A 1WR1A 3ZNGC 3ZUNA 2ELAA 2CHWA 5IA7A 1GG3A 4TUUA 5D3WA 3M1IB 2KZRA 3PRMB 4X57B 1FAOA 2JXXA 1WM2A 3HK0A 2J59M 2KHWB 2KN5A 1GC7A 3A4RA 3D32A 2N9XA 2UZSA 4HXDA 1D3ZA 4BVUC 2NBVB 2YLMA 3AULA 3KUDB 3HQCA 3FEHA 1ZC4B 3WANA 1GNUA 2O6VA 3UINB 5DPSA 1N3HA 2J0MA 4C0AA 1FGZA 2BYVE 4Z2NA 2ZNVC 5L83A 2CAYA 1RRPB 2KCJA 2KC2A 1U29A 2COFA 3G9WA 2KDBA 3A33B 3JSVA 1LB1A 1WXSA 3VVWB 3P6AA 5IAAC 4BOZB 4LCDE 5CHFA 1WJMA 4AUQC 5C6RA 4KHBB 2IYDB 3UIPB 3VDZA 1WGHA 4IW0A 3GOEA 2DLWA 4E74A 2O2VB 2ROVA 1E8YA 3L17A 4ANVA 4NJ6A 4JIOU 3QA8A 2L0FA 3KRWA 4MEMA 2VSZA 2CY5A 1BWNA 3R66C 1V9JA 3ZRFA 3DVNV 5EDSA 2GCJA 4JLCA 5JH5C 1K8RB 5KQ1A 3U30A 3ZDTA 1ZC3B 1SE9A 1DYNA 1UNQA 2EMSA 2DAJA 3ML8A 1Y8RC 2V76A 2M4NA 3N3KB 3A9JA 2ZEQA 5HE0A 4EMOA 2HD5B 2KK8A 5C16A 1F9JA 5DHAB 4GIVA 3DXDA 1E7VA 3V6CB 4MGKE 3APCA 4Y94A 3IFWB 2D9YA 2D9XA 3CMMB 3H9DA 5AEKB 1WE7A 3RCZA 3H7PA 1WXMA 4W9EA 2GBMA 4HPLB 3ZIMA 3D8EA 4WJOA 2Q13A 4ZYNA 3ODOA 2LASA 4YONA 1WGDA 2KVRA 1XQQA 2REXA 5JP4A 5D6JB 2KD0A 2NBWB 1YD8U 3B08A 1WE6A 3N7CA 2IFSA 1Q5WB 4IFSA 4A3PA 2L3ZA 2IO3B 3ENEA 1R4NI 3AI5A 4FJVB 3QQ8B 3B0AA 1W1HA 2C60A 4F7UP 2LWPA 3NY5A 1RAXA 2DZIA 2ZPNA 1VCBA 2BWES 4AP4C 4GPTB 1VD2A 4GXBA 3CSTA 2N1VA 1DDMA 3X23A 2G4DB 5DPTA 4E3CA 2Z59B 4A20A 2MKRA 1WGRA 1IPGA 3FSSA 4PS3A 2YF0A 4D0NB 3GYOA 3DQVA 2DN6A 1WZ3A 4AOFA 4HVBA 4EKUA 4F7GA 4GU2A 1OQYA 1WJ1A 2LGDA 2MP2A 3ODXA 3PZDA 3F0WA 4I6LB 2PE6B 5CLQB 4KDIC 4FHKA 4MSMB 5E6NA 4MJSB 4FJZA 2LOZA 1MPHA 4B9KA 1E8WA 3TW1A 2KJ6A 2KMAA 2AL3A 1S3SG 4GDKA 1UBIA 4AWJA 1EF5A 3QARA 1J19A 3QK0A 3S2AA 1EAZA 2K6DB 5D3XA 3A8PA 1PFJA 2LI5A 3MHSD 1S1QB 2IO2B 2VKIA 3UGBB 2DYQA 2A4ZA 2D07B 3L16A 2KUPA 3PGEA 1GUAB 1V88A 1QZEA 4BKSA 4EEWA 3RUIB 2XEWA 2M8SA 1I7AA 2KKCA 1DDVA 1WRDB 4G50A 3AJ4A 5KHOA 2FIFA 4NNJB 3ZDMC 4JL9A 2I1JA 3HHMA 1KM7A 3NZSA 2DHIA 1WG7A 2DX5A 3BY4B 3DXEA 5C79A 3PS6A 4XZ4A 5JLJB 1JRUA 1UBQA 4FJYA 4CO7A 2WWZA 1FOEA 2CY4A 2ZJDA 4BBKA 3PVWA 3P7ZA 2LVOA 5LLIA 3RD2A 5D3YA 1WX9A 2KXJA 2EJ8A 3DBRI 3APFA 2PJHA 4M8MA 1TXDA 3BINA 4II2B 3DXCA 2FJLA 4PS7A 5JHAA 3M3JA 1X11A 3VH3B 2HTHA 4GDLA 1ZGUB 2LULA 4MGIE 2KTRB 2FCQA 1M94A 4GZUA 3WIMA 2G3QB 2MW5A 1UGMA 3NZUA 3F5RA 1BT0A 1WM3A 4G3XB 2KO3A 4KSKC 4MDKE 4URKA 1Y5OA 1U2BA 4GMXB 3ZLZA 2GMIC 2Z0EB 3EECA 2IY0B 2L2IA 2H7EA 2YS5A 1KJTA 2ZVNA 3VHTC 1U5GA 3OANA 3CF6E 4GGQA 4HAUB 3GYPA 2KOXA 2M0XA 3W1SA 5LOPB 2C7MB 2MBBB 3IG3A 1KLVA 2IO0B 3D8FA 2NPTB 3PT2B 3T8MA 4MK0A 3PREA 1LXDA 4YL8A 3RT3B 4AJYB 1WJUA 2G4SA 1OY2A 5D94A 2LKOA 4KV2A 3DBHI 2FCMA 2DYOA 5J3QA 1ZM0A 1MIZB 3CXBB 2K8BA 4PQ0A 2KDIA 3VOQA 1IRSA 1FHWA 2RUKB 3DDCB 4II3B 3ZNZB 3KUCB 1U5FA 4PNKA 4FLHA 3AXCA 1EO6A 4HHVA 1UZXB 4Z2MB 3W1SC 2MX2A 4DWFA 2DYNA 3ZRCA 4HAZB 2VRWB 2GJYA 1XODA 2MWNB 4TKNA 4B95A 2LGXA 3QCAA 1YJ1A 2DZJA 4JGHB 2CS4A 3ODWA 2JZ3B 2G45B 4PYZA 5HE1A 5E6PA 3APDA 4FHJA 2LZ6A 1OEYA 4OVVA 1C3TA 4MM3A 4KAXB 3DVGX 5KCVA 1TZ1A 2K1FA 3ZNID 2FCNA 5G2NA 4DX90 3ML9A 1AWEA 4W9GA 1YIWA 4HAVB 2O6VD 2JP2A 4NY0A 4WSFA 1P9DU 2RGNB 1PLSA 3MDBC 5GOWB 2MQJA 5CTRC 2GBNA 2GOWA 2OQBA 3A1QB 2W2XC 2MBEA 3PRPB 4B6HA 4J6IA 2L8JA 1GC6A 2FCSA 3PVLA 2W9NA 2JVCA 4F7HA 3VFKA 2K00A 2CKHB 5C5BB 1LW3A 2JWZA 4HCNB 4ZRJA 4EZKA 4DHZE 2ELBA 2WX0A 2ROZB 2DZKA 1H4RA 4CHKA 2NS5A 3HM3A 2N4FA 1WJ6A 2LRUA 1WGGA 5EFXA 2MBQA 5CLLB 2KQSA 2K2UA 3SV1A 4WJ7A 4L6EA 5LXHA 3QWMA 2JRHA 3DPDA 2KMCA 1P6SA 4W9KA 1HE8A 1V86A 1FHOA 4WWPA 3LJ3A 3UQBA 2BGFA 2DHZA 2N9PC 3M63B 1WH3A
chains in the Genus database with same CATH superfamily
1ACCA 2MRPA 3DCXA 1IP9A 5BMIA 1Z2MA 2KIGA 2DYMA 2BTEA 2L0TA 2X18A 4NPNA 2I5FA 4DX8A 1J7BA 1MK7B 3RYTA 4KGSA 5IO9A 4WVFB 1GB1A 1LFDA 4S17A 2XK5B 1ZVRA 2MFQA 1OEYJ 3HIZA 1XD3B 2ZPYA 3N1YC 1WXAA 1VDVA 3PSEB 4F1SA 4K7WA 3M62B 1SB3C 3DWMA 1N5WA 3AN1A 5AZHA 1PQSA 5HG2A 3RPFC 5IP4D 5JHGA 4KDLB 4ANWA 2KYWA 4NAMA 3UQAA 4A6KA 4KHOA 1P98A 2J53A 4I6NB 4C80A 2KFKB 4PS8A 3MJWA 1I4HA 1CQVA 1U4AA 2D3BA 1T0RC 2KNBA 2ACZB 3ECIA 4LJOB 1P0RA 1UELA 1EM7A 2GS0A 2MWSB 3ZKJC 1UNPA 1XLQA 4YTMB 1UD7A 2OTXA 2DX1A 2D11A 1OQRA 2WX1A 4EZJA 1FCCC 3IXSA 3ZQ4A 1TQZA 3Q3FA 3A9JB 2WXNA 4PT5A 3U4EG 1RYJA 4IUMB 4FN2A 4XGAB 2INNE 2D3GA 2KUQA 4YSZB 3Q3JA 4BKTA 1DOIA 2KANA 2DA0A 2PE9A 3EGRA 3SD5A 2R09A 4M0WB 1J8CA 1XKEA 2JPHA 1DROA 1JQ4A 2BKFA 2KWCA 3OJ4B 5LXIB 1N61A 3L08A 2W3RA 3FKYA 2UZRA 4MELA 4NAWB 3N20C 2LXCA 3LJUX 2DZMA 3MC9A 3K9PB 4HRSA 2R2OA 4ZRPA 1YQ3B 1D6EC 3DVGY 1P5TA 3FM8C 3VQIA 3CSFA 4KIKB 1FGYA 2N7DA 4HJGE 2MLBA 1NTYA 4ITKA 1T3QA 3T3OA 4KKJA 2CJNA 2JT4B 5IN7A 2OJWA 4ASWC 4RF0A 4HJKA 4WQMA 2CU1A 1V5TA 2ZCCA 1X05A 1P1AA 1V5PA 3I3TB 2WXOA 4B0EA 5JHHA 3U12A 1NVID 2PVOD 2RGFA 2RPQA 4MJSA 1E7UA 1NYRA 4KGTA 3V61A 2EC1A 3KW5B 4G11A 1SGHA 2GBRA 5J3TA 1LO5D 3KSYA 1PDXA 1T0YA 3AE1B 3SU8X 1MG4A 2DAFA 3B2GA 4LDTD 3QBVB 5DIFB 3QJZA 3DOWA 2KT7A 2ADZA 4S0RA 3W2DA 2KX3A 2AX5A 2OHFA 3AE8B 5BYQA 1RLFA 3A4SC 4RF1A 1WVHA 1YX6B 3IBEA 2BT6A 3PLUA 2FNJB 2JY6A 4C56C 2MJDA 1YX5B 4XWXA 3PLVA 3GZNI 3UIOB 4EUTA 3KY9A 1J7AA 2V1YA 2N1WA 1X86A 1E90A 3TFMA 2RNRB 2PIAA 3N32A 5I2SA 1DDWA 2P0DA 4HB0B 1IGDA 4ARIA 4A6FB 4BKSD 1Z87A 4HAWB 2YS3A 1JWUD 3PSCA 2FJUB 1YJIA 3TUOA 3VAWA 5FI1A 4RGMA 3CIKA 1ZW7A 4DHJD 1GPXA 2VRRB 4KSLC 2N9EB 2D9VA 4OVUA 3H6NA 5L81A 1WGUA 2MA9B 1X1FA 2KAJA 3DVNU 3V6EB 1NBFC 4RCOA 5FI0A 1HQRD 1FFUA 4TQ0A 4DHZB 2BYEA 1V61A 1V5MA 4TQ1A 4CSQA 1C1YB 2MBOA 4O1NA 3DBSA 2K8HA 2BWFA 3ZYYX 1U5EA 2J0KA 1WMHB 2JYTA 4WJPA 3QWZB 3PP2A 4FBJB 2ASQA 3IHPC 4LJPB 5E6OA 4HAXB 1PMSA 3K9OB 1BTNA 3RNFC 4GDKB 4A8XC 2BB5A 4XDCA 1V1PA 5D7GA 1JRPA 2QSDA 2W2WA 3H7SA 4K3CA 5TR5A 3WCQA 4HCPB 1OMWA 2V3PA 5J17A 4BAXA 1ROEA 3JYUA 4C7ZA 2KDEB 1M4VA 2PVGC 5HI1A 4HAYB 2GCLA 3EHVA 4XYCA 3R3MA 2NMBA 1TS5A 2K2JA 4HK2A 2KTRA 3HW2B 3H8HA 4JPSA 4EOYA 3TCAA 3P1MA 3NUHB 2DHKA 2GB1A 2KTFA 2LYDA 2D9WA 1OQQA 2CJOA 3Q8CA 2AYOB 1DBHA 3P4PB 2OEDA 4KZCA 4UDUC 2NVUI 3V05A 1X1MA 1YNTE 2MJ3A 2J52A 4I6PA 4OT1A 3FILA 2Z0QA 2A5UA 2NZ8B 1XX0A 2G35A 4W9HA 2IO1B 4FXCA 3ULBA 1RFAA 2DX5B 2G9HD 1MK9B 1R4MB 2OOBB 2WDRB 3NVYA 2EKEC 3O13A 4MGZE 1XT9B 4F8CB 4W9JA 3ZXRA 5M4YB 3ZGZA 2E2XA 3V60A 1IBXA 1Z5SB 4IWOA 1HA5A 1Q0WB 4ICUA 4US9A 5FR3A 3AE4B 3LDZE 3SR6A 4HDQA 4HEA1 3KQ4A 3RZFA 3U8ZA 2DKPA 3HSAA 1P7FA 3BYYB 1LQBA 2MJEA 1WXVA 3PTFC 2GBJA 1WGYA 2LFIA 3NS8A 2NPTA 3DBLB 2DFKA 1UNRA 4WJQA 2GBKA 2KJRA 3DCGA 4YXDB 2KMMA 2HTHB 2NR2A 2JU6X 1QLBB 4HLEA 4DK5A 4AJWA 3SNHA 4WQOB 3Q3OC 1SEBD 2I1KA 1OGWA 2Y5BB 4IWPA 5C23A 3ZJUA 5D27A 2BCJA 2H7DA 2BS2B 1FIQA 2NCNA 2LUMA 4N59A 2EELA 2LGYA 5BO4B 4HKQA 3ZTDA 2WYQA 1D5MC 2PKOA 2WXRA 1KF6B 2AL6A 1UGJA 3IAS1 3NVZA 2HTME 1EUVB 4XDDA 2COCA 1T5XD 2COAA 1I4QA 3UF8A 1C76A 1AW7A 2V4LA 1RJ2A 1XR0B 5HE2A 2C5LC 4D2KA 1QF6A 3VUXA 3L0WB 2RSGA 2W2XD 3ULCA 5L95C 1FCLA 1WF9A 3Q3MC 1A5RA 2KWUB 1I35A 3Q2AC 1XXGA 1FB8A 2CR5A 3PPAA 3WAOA 3EFUA 4LNKA 1ZSQA 2ON8A 4L2YA 1FXTB 4ZRKA 3RI7C 3H1UA 3IVFA 3A9KB 2UVMA 3AU4A 4RH6A 4RGTA 4C4VB 1YQ4B 4J3OD 4GN1A 2WXFA 1SIFA 2XQNM 4KHAA 3VTUA 1XF5L 1MAIA 4XE0A 3PHWB 1SE2A 4A6HA 5H92C 3QAQA 2INPE 1MJDA 1U27A 3VUYA 3A8QA 2L76A 3NWDA 1UPRA 4W9CA 3PHXB 3L10B 1V5UA 5AZGA 2C9WB 4DDGD 5DH9B 5D2MB 4BBNF 1TS4A 2Y8FA 3NVVA 2ZW1A 1DYQA 3A1QA 1E6EB 4B6WA 1D5ZC 2DTCA 4OZAA 5BYSA 2H89B 4XX5A 5J18A 3B77A 2Y3AA 3PEGA 1X1GA 1MI0A 2BKRB 5EE3A 3RZWC 2NBUA 1K52A 3Q8FA 1WI0A 1MFWA 3C0RB 5C5BA 2WXKA 3VH4B 4WURA 4K3BA 3VIAA 3Q3NC 5JHBA 4IM0A 1AWDA 1UPQA 4HB3B 3WAMA 2Z0OA 1QILA 3ALBA 4MSQB 2ZNVB 3EA6A 1WI1A 3OAWA 1FHXA 1K5GB 4P6VF 1KOTA 1XLNA 5BMHA 4XWWA 1BUIC 4EJNA 4DXAB 1KZ7A 4N9F4 1TJ6A 4GOCA 1B55A 4WH4A 2KX0A 2K25A 2PZ1A 3OHMB 3C8YA 2RD0A 1BAKA 1MKEA 1TGZB 1WGQA 2O2VA 4MT5A 1E0ZA 4ANXA 1UEFA 2QKMA 1V2YA 4K7UA 4H8SA 3ZTCA 2CRFA 3AE2B 1RM6C 4EZLA 1NTVA 3MTNB 2M38A 2V3SA 2IBIB 1FM0D 1DGJA 3P2BA 3Q8AA 1L4DB 2O6VB 2CU3A 4FULA 4KVGB 1SE3A 3ML4A 1F0ZA 5EE9A 2IYBA 1L2NA 2YEPF 4TV3A 3SYXA 1L7YA 3Q6BA 1FO4A 2Y8GA 2QMTA 2QHOA 2YVCA 1V8CA 2XK5A 2PPHA 5MPOA 2CHZA 3T06A 5HE3A 4QXAB 2UYZB 1UWMA 3JW0X 2V0GA 3PVUA 3RFZB 3JSVB 5GMVA 2CODA 1ZUD2 1L5PA 4DIXA 2IGHA 1SBBB 2KIEA 1SHCA 2KFKA 1SE4A 4A5KA 2J7QB 1I4GA 1TBEA 2M19A 2J0JA 1FPYA 4HDOA 1V80A 1K53A 2Y5CA 2WU5B 4JWSC 2JZZA 4IAPA 2LVPA 4REZA 3U2SC 5CHWA 2CHXA 1WX7A 4BZAA 1MIXA 4NQKE 3TEYA 2KLCA 3AE6B 4RM8A 1QOFA 2AQ1B 1NI3A 2PEAA 3X0WA 1RRBA 2AQ2B 4YSYB 3NW8A 3NJTA 4A3OA 1E10A 1FNUA 4MGYE 3FVCA 1KLGD 5C1ZA 3BVGA 4GMVA 1PGXA 3NSUA 3KVFB 3AEDB 3I9V1 1VJKA 4PYUA 3BVMA 4WIPA 2DYBA 4WWOA 3WAPA 2I2YA 3MPXA 4MH8A 1WR6E 4K17A 2W3SA 1ENFA 2B3AA 3J9CA 4NAWA 4DBBA 1T0SC 1FXAA 2FE8A 3W1YA 2YT1A 2IY1B 1W1GA 2R2QA 2V4IB 4RFBA 4KIKA 4IC7B 3Q14C 3U52E 1EVHA 4M01A 1H8CA 2RR9A 2R2YA 3RNBC 1YQBA 5DPRA 3KH0A 2D10A 3PRZA 1WZ0A 3JVZX 2J4XA 5FKAC 2TSSA 1MG8A 3P63A 2Z59A 1M7RA 3H7PB 1KI1B 3HM6X 4IM2A 1WWTA 3GP7A 2ZCBA 1N60A 1WIAA 4BKGA 3GB1A 3BZDB 4GSWA 1MI1A 2IPKD 3UZTA 5AZFA 3TO1A 1I42A 3PV1A 2R0DA 1SXTA 3WYFB 1TS3A 1LM8B 2BF8B 3QHTA 1FEHA 1Y56A 1R4NB 3Q8BA 3AEFB 2WXMA 4OZCA 4GB9A 2LD9A 4IWQA 3IT4B 5DCNA 1QC6A 4W9FA 2QKLA 2MCNB 2AEHA 2IGDA 2QDFA 1UUPA 1GJZA 2N7EA 3FAHA 2UWQA 1V49A 1TYGB 5LG4B 4ZRQA 2IDYA 1C4AA 2N23A 2Y5PA 2P8VA 3AE5B 3PG7A 3EC8A 1FNWA 2WHIA 2RVBB 4L23A 3TIXA 1U5DA 1L6VA 1T6BX 1TTNA 2BQQA 1D4BA 3ZW3A 1JWMD 2RPVA 2ONQA 1WJNA 3A98B 4GLSC 4A6FA 1PGBA 3BYTB 2SEBD 5AUIA 1A70A 4BBNC 2BBCA 2YSZA 1AQCA 3VXWA 3ABVB 5BMGA 3ZVRA 3SEBA 5HKHA 5EE1A 3B9JA 3WA0A 4HATB 3B2FA 1ET9A 3TBLD 1YOVB 2MDXA 5LONB 2DHJA 2LXAA 4MH0E 2WXLA 2N0YA 2HJ8A 2GI9A 4WAAA 3SHQA 2I5CA 2D9ZA 3TL5A 2JUOA 1E8ZA 5JZEB 2M14A 1C77A 1W1DA 2KGXB 2LUEA 4N6EB 2KJHB 1WMHA 2C7NB 1ET6A 4W9IA 4E71A 1G6JA 2MP2B 2HE7A 1TKYA 3NHEB 4HKZE 1ZDVA 4K1RB 3SUZA 3QX1A 1ISNA 2Z8LA 1QQGA 4LNFA 2BYFA 5J2RA 3ZVVA 2WDTB 2FUHB 2K6QA 3HVZA 3PZ8A 2KWVB 3N1ZC 3O65B 4KZ0A 1IUEA 2NTTA 1WSPA 1HZ6A 3V5WA 4W9DA 5CHVC 2DENB 2X38A 3RCPA 1WFYA 4LDTB 3W9CB 5DHFB 1MPEA 5FR6A 2FIDA 2KLGA 4ZRIA 1M7EA 1I7HA 2FAZA 4XC2A 3QIJA 3V62A 1FMAD 3SO6A 1E7PB 5CX3A 3GE3C 4P7IA 2C7HA 4M02A 4ICVA 1IYFA 2XBBC 4HROA 4RM9A 1WYWB 1XCQL 4BFRA 4CHJA 2YRYA 3A58A 3AV8A 3RULA 3BK2A 4NJ7A 3TMPB 2L1CA 2NTSA 4YTNB 4DDID 1EGXA 4G0NB 3D8DA 1NU2A 2WXGA 2AWTA 2ZVOA 3L13A 4LK0M 1WXQA 3KWLA 2YT0A 1JCKB 3VUWA 4FADA 1LGRA 5KQ4A 2L05A 1P3RA 4F7ZA 2DKQA 2LGIA 3R7RA 1C78A 1PYWD 2K9XA 4K81A 3OLMD 4DHJB 4US8A 1R4MI 2SAKA 1QQRA 2K39A 2K8CA 4WWNA 4EFOA 2KDFB 1JWSD 5FK9C 2K49A 1BTKA 2YS1A 5IOIA 1ZP0B 5J3YA 2KFJA 3KLSX 4IOYX 3MHZA 1K51A 1VZ6A 3DBRB 1WY8A 2LHEA 2BPSA 2RLOA 1I2HA 2V9HA 1XD4A 4ANUA 2WXQA 5E6JA 1NI2A 3QC8B 2FUG1 5IKCM 3EUB2 2LG1A 3DBLI 1Q67A 4NQLB 3KYCD 3T9LA 4MT7A 1ZYIA 4CYEA 4M8NA 4NZLB 1WGKA 2Y7BA 3SDLC 2MSED 4TYZA 2P0FA 2IJ0A 3N30A 1QT9A 4L1RA 1NDDA 3WALA 2Z0DB 4ZDVA 1K5DB 4GDLB 2MHJA 2MEKA 2P0HA 2E3TA 1KTKA 1V5OA 2JF5A 4W9LA 2M1MA 4K7SA 2WXJA 2RSUA 3R2IA 2DWQA 3MJ5A 1XCGA 3ZO5B 1WX8A 3KZ1A 3L54A 2LRWA 4LLGM 4K2PA 1H10A 4HB4B 4IM3A 3M95A 3BWUD 1WRIA 4WJNA 2JRIB 3TVVA 3O96A 1Y19B 5DPWA 1WJ4A 3DWGC 3ONSA 1ZKHA 5KHQA 3U7DA 1V81A 3AU5A 1F77A 3AB5A 2H88B 3Q8EA 4LNOA 3BJIA 1E8XA 2EMTA 3KUZA 1UH6A 4NSWA 1V6EA 2L00B 2Z0PA 2LVQA 4PK1A 3NOBA 1HEZE 1J0GA 1OTRB 1J0WA 4HPPA 1VZ7A 2D3AA 4CHMA 1E5WA 2D4QA 3ZXVA 3A9KA 4ZHPA 2D2QA 3OJ3A 4K2OA 3VTWA 4C4VA 4YSXB 1CMXB 4HWIB 4JQWC 1JWBD 2Q5WD 1TY2A 1V89A 2RDHA 4Q2JA 1L0YB 1C9FA 5DI9B 3TJPA 2MBHA 2WP9B 3DBHB 2ZZPB 3AM9A 5C2TB 4FA6A 2LJ5A 1F1HA 3VTVA 1MHHE 1OQNA 4IG7B 2KC1A 2B76B 2BW2A 3ZNHB 3T3NA 5D3VA 1I4PA 3W5UB 2WXIA 2LOXA 1AARA 4HB2B 3R7QA 3B1LX 4A9AA 1N6ZA 4HPMB 1V97A 1P3QU 2MH7A 2L7RA 3OWEB 3KRXA 4RMAA 2GLSA 2JSVX 3KYDD 1B1ZA 1Q1OA 4BOSC 4MY6A 5G55A 1KZGA 2WNMA 4DBGA 1ESFA 2WXHA 2OJRA 2KQ7A 2M17A 1JROA 4P16A 2BYTA 3W5VB 2IZVB 1EF1A 4OVZA 1WR1A 3P4RB 2IGGA 3ZNGC 2WXPA 3ZUNA 2ELAA 2CHWA 5IA7A 1GG3A 1SJED 4TUUA 5D3WA 2VZKB 3M1IB 2KZRA 3PRMB 4X57B 1FAOA 2JXXA 5EE0A 3NRZA 1EU3A 1WM2A 3TEWA 3HK0A 2J59M 2JWUA 2KHWB 2Z4DA 3EFCA 2KN5A 1GC7A 3A4RA 2LJIA 1TY0A 5I4DA 3D32A 1CZPA 2N9XA 2UZSA 1I4XA 1E9MA 4HXDA 1D3ZA 4BVUC 3N1XC 1R7SA 2NBVB 4MM3B 2YLMA 3AULA 3KUDB 1SIJA 3HQCA 3FEHA 1ZC4B 2YT2A 2BB6A 3MC8A 4IOIE 3WANA 2N9LA 2Z13A 1GNUA 4R3DA 2O6VA 3UINB 1SF0A 3P42A 5DPSA 2WGSA 1N3HA 4ZYSA 2J0MA 4C0AA 2RDGA 4CQNA 1FGZA 2GUMA 2BYVE 4Z2NA 3PO0A 2ZNVC 5L83A 1FFVA 2CAYA 1RRPB 4QAYA 2KCJA 2KC2A 1U29A 2COFA 3G9WA 1VR9A 2KDBA 3MFGA 3A33B 1C4CA 3JSVA 1LB1A 1WXSA 3V3XA 3VVWB 1BXTA 3P6AA 4OW0A 5IAAC 1FXIA 4BOZB 2PTLA 1IGCA 4LCDE 5CHFA 1WJMA 1KLUD 4GNKB 1AN8A 4AUQC 1HZ5A 5C6RA 4KHBB 2IYDB 3UIPB 3ZJTA 3VDZA 1WGHA 5C3JB 4IW0A 3GOEA 1YN3A 3BVZA 2W82A 2DLWA 3E56A 4E74A 2N9KA 3Q69A 2O2VB 2XN9C 3N9YC 2ROVA 1E8YA 3L17A 4ANVA 4NJ6A 2JZPA 4JIOU 3QA8A 2L0FA 3KRWA 3HRDD 4MEMA 2VSZA 2CY5A 1BWNA 1NENB 3R66C 4B0MA 1V9JA 3MC0B 4C00A 3ZRFA 2D3CA 1MVKA 3DVNV 5EDSA 1BMLC 2GCJA 3AEGB 4JLCA 5JH5C 1K8RB 5KQ1A 1AYFA 3LYYA 3U30A 3ZDTA 2ZW0A 1ZC3B 1SE9A 2BS4B 4TSSA 1DYNA 2ZKMX 3BIID 1UNQA 2EMSA 3TSSA 2DAJA 2G1EA 3ML8A 1Y8RC 4YWGG 2V76A 2M4NA 2WU2B 3N3KB 3A9JA 3RMKC 2ZEQA 5HE0A 2AQ3B 4EMOA 1JWAD 2HD5B 5LNK1 2KK8A 5C16A 1F9JA 5DHAB 4GIVA 4QJ4B 3DXDA 1E7VA 4M0WA 1K50A 4A55A 3V6CB 4MGKE 1TKEA 3AEBB 3APCA 4Y94A 2KACA 3IFWB 3RNAC 2D9YA 2D9XA 5GXGB 3CMMB 3H9DA 5BYRA 5AEKB 1WE7A 3RCZA 2PMVA 1WXMA 3H7PA 3L4PA 4W9EA 1KRHA 2GBMA 3VR9B 1YMHE 3SFDB 4HPLB 3ZIMA 3D8EA 4WJOA 2Q13A 4ZYNA 3ODOA 2LASA 4OHJA 4YONA 1WGDA 4LNNA 2LHDA 2KVRA 1XQQA 2REXA 5JP4A 5AUKA 5D6JB 2KD0A 2NBWB 1YD8U 3B08A 1WE6A 3N7CA 3ETRA 2IFSA 1HTQA 1Q5WB 4IFSA 1XCTL 4A3PA 2KN4A 3TEXA 1PFDA 2L3ZA 3FC4A 4KKIA 2IO3B 3ENEA 2KVZA 1R4NI 3AI5A 1EWYC 4JE3B 3HUIA 4FJVB 3NG0A 1FRDA 2K5PA 3URYA 2LMCA 3QQ8B 1JALA 3B0AA 1W1HA 2C60A 4F7UP 2LWPA 4DXGA 3NY5A 1RAXA 5TSSA 1L0VB 2DZIA 2ZPNA 2FBWB 3P4QB 1VCBA 2BWES 4AP4C 4GPTB 1VD2A 3IAM1 4GXBA 4N58A 4RNAA 3CSTA 1YN5A 2N1VA 1DDMA 3X23A 5T8IA 2G4DB 4MACA 2RRFA 5DPTA 3UI3A 3HIEA 1V1OA 4ACFA 2WQYB 1N62A 3TEZA 4E3CA 2Z59B 3RN9C 5G5GA 2KR0A 1EU4A 4A20A 2MKRA 2I38A 1WGRA 1IPGA 3FSSA 4AQ7A 4PS3A 2UU7A 1TKGA 2YF0A 3NWFA 4D0NB 2DNFA 3GYOA 3DQVA 2DN6A 3DHHC 2M56B 1WZ3A 4AOFA 2ICIA 4HVBA 4EKUA 4F7GA 3LXFA 2KQ4X 2LEKA 2HJ1A 4ZOHC 4GU2A 3R8BA 1C4PA 1DOYA 1OQYA 1WJ1A 2LGDA 2L83A 3GS2A 2WS3B 2MP2A 3ODXA 3PZDA 1PGAA 4RGOS 3NWAA 3F0WA 2QIEB 4I6LB 2PE6B 5CLQB 4KDIC 1RWSA 4FHKA 4A90A 4MSMB 5E6NA 4MJSB 4FJZA 2LOZA 1MPHA 3MP9A 2JQRB 2JYEA 4B9KA 2QC8A 1E8WA 3TW1A 1JMLA 2KJ6A 2KMAA 2AL3A 3AE9B 1QOAA 4DXFA 3AE3B 1S3SG 4P1BC 2QILA 4GDKA 1UBIA 4YTPB 4AWJA 1EF5A 3GZNB 3CIRB 3QARA 1J19A 3QK0A 3S2AA 1EAZA 2K6DB 5D3XA 3A8PA 3NVWA 1FNVA 1PFJA 2LI5A 2RDBC 3I57A 3MHSD 1S1QB 1HTOA 2IO2B 1L4ZB 2VKIA 3UGBB 2DYQA 2A4ZA 2WLBA 2D07B 3L16A 1F52A 2KUPA 2V3NA 3PGEA 3VR8B 1GUAB 1TIFA 1V88A 2WDVB 3I63C 1QZEA 4BKSA 4EEWA 3RUIB 1KFYB 4USAA 3PZ7A 1XLOA 2XEWA 2M8SA 1I7AA 2KKCA 1DDVA 1QOBA 2X8XX 1WRDB 4G50A 4RGNA 2W55A 3AJ4A 4OZBA 5KHOA 2YEPB 1N63A 2FIFA 1N5XA 1QKZA 4NNJB 1TT5B 3ZDMC 4OSNA 4DQOC 4JL9A 2INCC 2I1JA 3HHMA 1KM7A 2N7JA 2K8EA 3NZSA 2DHIA 1ZXIA 1WG7A 2DX5A 2E6XA 3BY4B 3DXEA 5C79A 3PS6A 4XZ4A 5JLJB 1JRUA 1TJEA 1XLPA 1UBQA 1VZ8A 4FJYA 4CO7A 2WWZA 4WAFA 1FOEA 4ZHOA 2CY4A 2ZJDA 4BBKA 1HXYD 1CK1A 3PVWA 1T0QC 3P7ZA 2LVOA 2QEJC 5LLIA 5D3YA 3RD2A 3SFEB 1WX9A 2KXJA 3KWVA 4M00A 4D6WA 2BS3B 2EJ8A 1T77A 2DLBA 3DBRI 4A6QA 2HDEA 3APFA 2PJHA 4M8MA 1V1PB 1TXDA 3BINA 4II2B 3DXCA 1STEA 3E9SA 2N0SB 2FJLA 2Z14A 4PS7A 2L52A 5JHAA 2W54A 4ARCA 3M3JA 1X11A 2VH2A 1OFFA 1RFKA 3VH3B 2HTHA 3C19A 4GDLA 1ZGUB 2LULA 2L1AA 4MGIE 2KTRB 2JX5A 2FCQA 3CWIA 3RNGC 1M94A 4GZUA 1QOGA 3WIMA 1XEEA 2G3QB 2MW5A 1JW9D 1UGMA 3NZUA 1VLBA 4KGRA 3F5RA 1BT0A 1WM3A 3IT6B 4LNIA 3AEEB 4G3XB 2KO3A 3FILB 2BVCA 1B9RA 4KSKC 1C79A 3DHGC 4MDKE 3DHIC 1TS2A 1TZOA 4URKA 1Y5OA 1U2BA 4GMXB 3ZLZA 1D5XC 2GMIC 2Z0EB 3BK1A 1NEKB 3EECA 2WDQB 2IY0B 3U7ZA 2L2IA 2H7EA 2YS5A 1IBXB 1KJTA 2ZVNA 3VHTC 3VRAB 5G5HA 1I4RA 2INDC 5HHDG 2GRIA 4AS1A 1U5GA 3OANA 3CF6E 4GGQA 4HAUB 3GYPA 3R2TA 3P4SB 2K3UA 2KOXA 3VRBB 1L0XB 2M0XA 3W1SA 5LOPB 2C7MB 2MBBB 1EWCA 4JWUC 3IG3A 1F2RI 1KLVA 2IO0B 3D8FA 4XWTA 1UNSA 1SJHD 2NPTB 3PT2B 3ZJVA 3T8MA 4MK0A 3PREA 1LXDA 4QJ5B 4YL8A 2EKIA 3RT3B 2QCZA 4AJYB 1WJUA 2G4SA 1OY2A 1KH0A 1SSNA 3AEAB 5D94A 2LKOA 4KV2A 3DBHI 2FCMA 2DYOA 5J3QA 1ZM0A 3RNEC 1ZE3D 1MIZB 3LB8C 4C7YA 3CXBB 2K8BA 4WWMA 4PQ0A 2KDIA 3VOQA 1IRSA 5H8YE 1FD6A 1FHWA 2RUKB 3DDCB 4II3B 3ZNZB 2VZKD 2QJLA 3KUCB 1U5FA 4PNKA 1FRRA 1F2RC 2D5GA 4IKGA 4FLHA 3AXCA 2XNAC 1EO6A 3AECB 2JXTA 4HHVA 1UZXB 4Z2MB 3W1SC 1J7CA 2MX2A 2DBYA 2L32A 4DWFA 1WYGA 2DYNA 3ZRCA 2KDMA 4HAZB 1CJEA 2VRWB 4JX1C 2GJYA 4NJCA 3RNCC 1XODA 2MWNB 4TKNA 4B95A 1YN4A 2K0PA 2LGXA 3QCAA 1YJ1A 2DZJA 4GOUA 2K22A 4JGHB 1GOZA 2CS4A 5IRSA 3ODWA 2JZ3B 2G45B 1XO3A 4PYZA 5HE1A 5E6PA 3APDA 1P7EA 4FHJA 2LZ6A 1ZXHA 1OEYA 4OVVA 2NBVA 2J42A 1C3TA 4MM3A 4KX6B 4KAXB 3DVGX 1MHXA 5KCVA 1ZOYB 5I2MA 1TZ1A 2K1FA 3ZNID 2FCNA 5G2NA 4DX90 2VH1A 1VRAB 3ML9A 1AWEA 1YIWA 2M0AA 4W9GA 1PUTA 4HAVB 2O6VD 2JP2A 4NY0A 4WSFA 1P9DU 2RGNB 1PLSA 1UWXA 5D3DA 3MDBC 5GOWB 3NS1A 2MQJA 2KWDA 5CTRC 2GBNA 2GOWA 2OQBA 3A1QB 1GB4A 2W2XC 1ZPSA 2MBEA 3PRPB 4B6HA 4J6IA 4P1CC 2L8JA 2RMMA 1GC6A 2FCSA 3PVLA 2W9NA 2JVCA 4F7HA 4YT0B 3VFKA 2K00A 4KHBA 2CKHB 5C5BB 1LW3A 4IDIA 2JWZA 4HCNB 2NMQA 4L1BA 4ZRJA 4HSIA 1GAQB 4EZKA 5JXVA 4DHZE 3GE8C 4EE2A 1DOXA 3HVDA 4TMAB 2ELBA 1L6UA 2ROZB 2WX0A 2DZKA 1H4RA 3NZ3A 2NS5A 2R61A 2LGSA 3HM3A 4CHKA 2N4FA 3OG5A 5D3IB 1WJ6A 2LRUA 1ZDXA 2PLPA 1WGGA 5EFXA 2MBQA 4LTUA 1YJJA 3AE7B 3AH7A 5CLLB 1UF0A 2KQSA 2K2UA 3SV1A 4WJ7A 4L6EA 5LXHA 3QWMA 3AMZA 2JRHA 3DPDA 1Q10A 2KMCA 1P6SA 4W9KA 1HE8A 1V86A 1FHOA 2PW9A 3I5JC 1NYQA 4WWPA 3LJ3A 3UQBA 2BGFA 4QJ3B 2DHZA 5HFYA 2N9PC 3M63B 1WH3A 4H2AA
chains in the Genus database with same CATH topology
2MRPA 1IP9A 1Z2MA 2DYMA 2L0TA 2X18A 4NPNA 2I5FA 4DX8A 1MK7B 3RYTA 4WVFB 1LFDA 2XK5B 1ZVRA 2MFQA 1OEYJ 3HIZA 1XD3B 2ZPYA 1WXAA 3PSEB 4F1SA 4K7WA 3M62B 5AZHA 1PQSA 5JHGA 4KDLB 4ANWA 3UQAA 4A6KA 4KHOA 1P98A 4I6NB 2KFKB 4PS8A 3MJWA 1U4AA 2KNBA 3ECIA 4LJOB 1P0RA 1UELA 2GS0A 2MWSB 3ZKJC 1UNPA 1UD7A 2OTXA 2DX1A 2D11A 2WX1A 4EZJA 1TQZA 3Q3FA 3A9JB 4IUMB 4FN2A 2D3GA 3Q3JA 4BKTA 2KANA 2DA0A 2PE9A 3SD5A 2R09A 4M0WB 1J8CA 1XKEA 2JPHA 1DROA 2BKFA 2KWCA 3OJ4B 5LXIB 3L08A 2UZRA 4MELA 4NAWB 2LXCA 3LJUX 2DZMA 3K9PB 2R2OA 3DVGY 1P5TA 3FM8C 3VQIA 3CSFA 4KIKB 1FGYA 2N7DA 2MLBA 1NTYA 2JT4B 4ASWC 4HJKA 2CU1A 1V5TA 2ZCCA 1X05A 1P1AA 1V5PA 3I3TB 5JHHA 2RGFA 2RPQA 4MJSA 1E7UA 3V61A 2EC1A 3KW5B 4G11A 1SGHA 2GBRA 5J3TA 3KSYA 1T0YA 3SU8X 2DAFA 4LDTD 3QBVB 5DIFB 3QJZA 3DOWA 2ADZA 2KX3A 1RLFA 3A4SC 1WVHA 1YX6B 3IBEA 3PLUA 2FNJB 2JY6A 1YX5B 4XWXA 3PLVA 3GZNI 3UIOB 4EUTA 3KY9A 2V1YA 2N1WA 1X86A 1E90A 3TFMA 2RNRB 3N32A 1DDWA 2P0DA 4HB0B 4A6FB 4BKSD 1Z87A 4HAWB 2YS3A 3PSCA 3VAWA 5FI1A 3CIKA 1ZW7A 4DHJD 2VRRB 4KSLC 2N9EB 2D9VA 4OVUA 3H6NA 5L81A 1WGUA 2MA9B 1X1FA 3DVNU 3V6EB 1NBFC 5FI0A 4TQ0A 4DHZB 2BYEA 1V61A 1V5MA 4TQ1A 1C1YB 2MBOA 3DBSA 2K8HA 2BWFA 1U5EA 2J0KA 1WMHB 4WJPA 3QWZB 3PP2A 4FBJB 2ASQA 3IHPC 5E6OA 4LJPB 4HAXB 1PMSA 3K9OB 1BTNA 4GDKB 5D7GA 2W2WA 3H7SA 5TR5A 4HCPB 1OMWA 5J17A 3JYUA 2KDEB 4HAYB 2GCLA 3EHVA 3R3MA 2NMBA 2K2JA 4HK2A 2KTRA 3HW2B 4EOYA 3TCAA 2DHKA 2KTFA 2LYDA 2D9WA 2AYOB 1DBHA 4KZCA 2NVUI 1X1MA 4I6PA 2Z0QA 2A5UA 2NZ8B 1XX0A 2G35A 4W9HA 2IO1B 3ULBA 1RFAA 2DX5B 1MK9B 2OOBB 4MGZE 2EKEC 1XT9B 4F8CB 4W9JA 2E2XA 3V60A 1Z5SB 4IWOA 1Q0WB 4ICUA 3LDZE 4HDQA 3RZFA 3U8ZA 2DKPA 1LQBA 1WXVA 3PTFC 2GBJA 1WGYA 3NS8A 2NPTA 2DFKA 1UNRA 4WJQA 2GBKA 2KJRA 3DCGA 2HTHB 2NR2A 4HLEA 4DK5A 4AJWA 3SNHA 4WQOB 2I1KA 1OGWA 2Y5BB 4IWPA 5C23A 5D27A 2BCJA 2H7DA 2NCNA 2LGYA 5BO4B 3ZTDA 2WYQA 2AL6A 1EUVB 2COCA 2COAA 3UF8A 2V4LA 1RJ2A 1XR0B 5HE2A 2C5LC 3VUXA 3L0WB 2RSGA 2W2XD 3ULCA 5L95C 1WF9A 1A5RA 2KWUB 1I35A 1FB8A 2CR5A 3PPAA 3WAOA 3EFUA 1ZSQA 1FXTB 4ZRKA 3H1UA 3IVFA 3A9KB 2UVMA 3AU4A 4GN1A 1SIFA 2XQNM 4KHAA 3VTUA 1MAIA 3PHWB 4A6HA 3QAQA 1U27A 3VUYA 3A8QA 2L76A 1UPRA 4W9CA 3PHXB 3L10B 1V5UA 5AZGA 2C9WB 4DDGD 5DH9B 5D2MB 4BBNF 2Y8FA 3A1QA 4B6WA 2DTCA 4XX5A 5J18A 3PEGA 1X1GA 2BKRB 3RZWC 2NBUA 1WI0A 3C0RB 5C5BA 3VH4B 3VIAA 5JHBA 4IM0A 1UPQA 4HB3B 3WAMA 2Z0OA 3ALBA 4MSQB 2ZNVB 1WI1A 3OAWA 1FHXA 1K5GB 1KOTA 4EJNA 4DXAB 1KZ7A 4N9F4 1TJ6A 4GOCA 1B55A 2KX0A 2K25A 2PZ1A 2RD0A 1BAKA 1MKEA 1TGZB 1WGQA 2O2VA 4ANXA 1UEFA 2QKMA 1V2YA 4K7UA 4H8SA 3ZTCA 2CRFA 4EZLA 1NTVA 3MTNB 2M38A 2V3SA 2IBIB 3P2BA 2O6VB 4FULA 4KVGB 3ML4A 2IYBA 1L2NA 4TV3A 3SYXA 1L7YA 2Y8GA 2QHOA 2YVCA 2XK5A 2PPHA 2CHZA 3T06A 5HE3A 2UYZB 3JW0X 3PVUA 3JSVB 5GMVA 2CODA 1SHCA 2KFKA 4A5KA 2J7QB 1TBEA 2J0JA 4HDOA 1V80A 2JZZA 4IAPA 2LVPA 5CHWA 2CHXA 1WX7A 1MIXA 4NQKE 2KLCA 4RM8A 2PEAA 3X0WA 1RRBA 4A3OA 4MGYE 5C1ZA 4GMVA 3NSUA 3KVFB 4PYUA 2DYBA 4WWOA 3WAPA 3MPXA 1WR6E 4K17A 4NAWA 2B3AA 4DBBA 3W1YA 2YT1A 2IY1B 1W1GA 2R2QA 4KIKA 4IC7B 1EVHA 1H8CA 2RR9A 1YQBA 5DPRA 3KH0A 2D10A 3PRZA 1WZ0A 3JVZX 1MG8A 3H7PB 1M7RA 1KI1B 3HM6X 4IM2A 2ZCBA 1WIAA 4BKGA 4GSWA 3UZTA 5AZFA 3TO1A 1I42A 3PV1A 2R0DA 3WYFB 1LM8B 2BF8B 3QHTA 4GB9A 2LD9A 4IWQA 5DCNA 1QC6A 4W9FA 2QKLA 2MCNB 2AEHA 1GJZA 2N7EA 2UWQA 1V49A 2N23A 2P8VA 3PG7A 3EC8A 2RVBB 3TIXA 1U5DA 1TTNA 3ZW3A 1WJNA 3A98B 4A6FA 4BBNC 2YSZA 1AQCA 3VXWA 3ZVRA 5HKHA 3WA0A 4HATB 3TBLD 2MDXA 5LONB 2DHJA 2LXAA 4MH0E 2N0YA 2HJ8A 4WAAA 3SHQA 2I5CA 2D9ZA 3TL5A 2JUOA 1E8ZA 5JZEB 2M14A 1W1DA 2KGXB 2LUEA 2KJHB 1WMHA 2C7NB 4W9IA 4E71A 1G6JA 2MP2B 2HE7A 3NHEB 4K1RB 3SUZA 3QX1A 1ISNA 1QQGA 5J2RA 2BYFA 3ZVVA 2WDTB 2FUHB 2K6QA 2KWVB 3O65B 4KZ0A 3V5WA 4W9DA 5CHVC 2DENB 3RCPA 1WFYA 4LDTB 5DHFB 5FR6A 2FIDA 2KLGA 4ZRIA 1M7EA 2FAZA 4XC2A 3QIJA 3V62A 3SO6A 5CX3A 4P7IA 2C7HA 4ICVA 1IYFA 2XBBC 4RM9A 1WYWB 4BFRA 4CHJA 2YRYA 3RULA 3TMPB 4NJ7A 2L1CA 4DDID 1EGXA 4G0NB 3D8DA 1NU2A 2AWTA 2ZVOA 3L13A 2YT0A 3VUWA 4FADA 5KQ4A 2L05A 1P3RA 4F7ZA 2DKQA 3R7RA 4K81A 3OLMD 4DHJB 1R4MI 2K39A 2K8CA 4WWNA 4EFOA 2KDFB 1BTKA 2YS1A 5J3YA 2KFJA 4IOYX 1WY8A 2BPSA 2RLOA 1I2HA 1XD4A 4ANUA 1NI2A 3QC8B 2LG1A 3DBLI 1Q67A 4NQLB 3KYCD 3T9LA 4MT7A 4CYEA 4M8NA 2Y7BA 3SDLC 2MSED 4TYZA 2P0FA 3N30A 1NDDA 3WALA 2Z0DB 4ZDVA 1K5DB 4GDLB 2P0HA 1V5OA 2JF5A 4W9LA 2M1MA 4K7SA 2RSUA 1XCGA 3ZO5B 1WX8A 3KZ1A 3L54A 2LRWA 4K2PA 1H10A 4HB4B 4IM3A 3M95A 4WJNA 2JRIB 3TVVA 3O96A 1Y19B 5DPWA 1WJ4A 3ONSA 1ZKHA 5KHQA 3U7DA 1V81A 3AU5A 3BJIA 1E8XA 2EMTA 3KUZA 1UH6A 4NSWA 1V6EA 2L00B 2Z0PA 2LVQA 3NOBA 1J0GA 1OTRB 1J0WA 4CHMA 1E5WA 2D4QA 3A9KA 2D2QA 3OJ3A 4K2OA 3VTWA 1CMXB 4HWIB 4JQWC 1V89A 5DI9B 3TJPA 2MBHA 2ZZPB 4FA6A 2LJ5A 3VTVA 1OQNA 4IG7B 2KC1A 3ZNHB 5D3VA 2LOXA 1AARA 4HB2B 3R7QA 3B1LX 4HPMB 1P3QU 2L7RA 3KRXA 4RMAA 3KYDD 1Q1OA 4BOSC 4MY6A 5G55A 1KZGA 4DBGA 2OJRA 2KQ7A 2M17A 2IZVB 1EF1A 1WR1A 3ZNGC 3ZUNA 2ELAA 2CHWA 5IA7A 1GG3A 4TUUA 5D3WA 3M1IB 2KZRA 3PRMB 4X57B 1FAOA 2JXXA 1WM2A 3HK0A 2J59M 2KHWB 2KN5A 1GC7A 3A4RA 3D32A 2N9XA 2UZSA 4HXDA 1D3ZA 4BVUC 2NBVB 2YLMA 3AULA 3KUDB 3HQCA 3FEHA 1ZC4B 3WANA 1GNUA 2O6VA 3UINB 5DPSA 1N3HA 2J0MA 4C0AA 1FGZA 2BYVE 4Z2NA 2ZNVC 5L83A 2CAYA 1RRPB 2KCJA 2KC2A 1U29A 2COFA 3G9WA 2KDBA 3A33B 3JSVA 1LB1A 1WXSA 3VVWB 3P6AA 5IAAC 4BOZB 4LCDE 5CHFA 1WJMA 4AUQC 5C6RA 4KHBB 2IYDB 3UIPB 3VDZA 1WGHA 4IW0A 3GOEA 2DLWA 4E74A 2O2VB 2ROVA 1E8YA 3L17A 4ANVA 4NJ6A 4JIOU 3QA8A 2L0FA 3KRWA 4MEMA 2VSZA 2CY5A 1BWNA 3R66C 1V9JA 3ZRFA 3DVNV 5EDSA 2GCJA 4JLCA 5JH5C 1K8RB 5KQ1A 3U30A 3ZDTA 1ZC3B 1SE9A 1DYNA 1UNQA 2EMSA 2DAJA 3ML8A 1Y8RC 2V76A 2M4NA 3N3KB 3A9JA 2ZEQA 5HE0A 4EMOA 2HD5B 2KK8A 5C16A 1F9JA 5DHAB 4GIVA 3DXDA 1E7VA 3V6CB 4MGKE 3APCA 4Y94A 3IFWB 2D9YA 2D9XA 3CMMB 3H9DA 5AEKB 1WE7A 3RCZA 3H7PA 1WXMA 4W9EA 2GBMA 4HPLB 3ZIMA 3D8EA 4WJOA 2Q13A 4ZYNA 3ODOA 2LASA 4YONA 1WGDA 2KVRA 1XQQA 2REXA 5JP4A 5D6JB 2KD0A 2NBWB 1YD8U 3B08A 1WE6A 3N7CA 2IFSA 1Q5WB 4IFSA 4A3PA 2L3ZA 2IO3B 3ENEA 1R4NI 3AI5A 4FJVB 3QQ8B 3B0AA 1W1HA 2C60A 4F7UP 2LWPA 3NY5A 1RAXA 2DZIA 2ZPNA 1VCBA 2BWES 4AP4C 4GPTB 1VD2A 4GXBA 3CSTA 2N1VA 1DDMA 3X23A 2G4DB 5DPTA 4E3CA 2Z59B 4A20A 2MKRA 1WGRA 1IPGA 3FSSA 4PS3A 2YF0A 4D0NB 3GYOA 3DQVA 2DN6A 1WZ3A 4AOFA 4HVBA 4EKUA 4F7GA 4GU2A 1OQYA 1WJ1A 2LGDA 2MP2A 3ODXA 3PZDA 3F0WA 4I6LB 2PE6B 5CLQB 4KDIC 4FHKA 4MSMB 5E6NA 4MJSB 4FJZA 2LOZA 1MPHA 4B9KA 1E8WA 3TW1A 2KJ6A 2KMAA 2AL3A 1S3SG 4GDKA 1UBIA 4AWJA 1EF5A 3QARA 1J19A 3QK0A 3S2AA 1EAZA 2K6DB 5D3XA 3A8PA 1PFJA 2LI5A 3MHSD 1S1QB 2IO2B 2VKIA 3UGBB 2DYQA 2A4ZA 2D07B 3L16A 2KUPA 3PGEA 1GUAB 1V88A 1QZEA 4BKSA 4EEWA 3RUIB 2XEWA 2M8SA 1I7AA 2KKCA 1DDVA 1WRDB 4G50A 3AJ4A 5KHOA 2FIFA 4NNJB 3ZDMC 4JL9A 2I1JA 3HHMA 1KM7A 3NZSA 2DHIA 1WG7A 2DX5A 3BY4B 3DXEA 5C79A 3PS6A 4XZ4A 5JLJB 1JRUA 1UBQA 4FJYA 4CO7A 2WWZA 1FOEA 2CY4A 2ZJDA 4BBKA 3PVWA 3P7ZA 2LVOA 5LLIA 3RD2A 5D3YA 1WX9A 2KXJA 2EJ8A 3DBRI 3APFA 2PJHA 4M8MA 1TXDA 3BINA 4II2B 3DXCA 2FJLA 4PS7A 5JHAA 3M3JA 1X11A 3VH3B 2HTHA 4GDLA 1ZGUB 2LULA 4MGIE 2KTRB 2FCQA 1M94A 4GZUA 3WIMA 2G3QB 2MW5A 1UGMA 3NZUA 3F5RA 1BT0A 1WM3A 4G3XB 2KO3A 4KSKC 4MDKE 4URKA 1Y5OA 1U2BA 4GMXB 3ZLZA 2GMIC 2Z0EB 3EECA 2IY0B 2L2IA 2H7EA 2YS5A 1KJTA 2ZVNA 3VHTC 1U5GA 3OANA 3CF6E 4GGQA 4HAUB 3GYPA 2KOXA 2M0XA 3W1SA 5LOPB 2C7MB 2MBBB 3IG3A 1KLVA 2IO0B 3D8FA 2NPTB 3PT2B 3T8MA 4MK0A 3PREA 1LXDA 4YL8A 3RT3B 4AJYB 1WJUA 2G4SA 1OY2A 5D94A 2LKOA 4KV2A 3DBHI 2FCMA 2DYOA 5J3QA 1ZM0A 1MIZB 3CXBB 2K8BA 4PQ0A 2KDIA 3VOQA 1IRSA 1FHWA 2RUKB 3DDCB 4II3B 3ZNZB 3KUCB 1U5FA 4PNKA 4FLHA 3AXCA 1EO6A 4HHVA 1UZXB 4Z2MB 3W1SC 2MX2A 4DWFA 2DYNA 3ZRCA 4HAZB 2VRWB 2GJYA 1XODA 2MWNB 4TKNA 4B95A 2LGXA 3QCAA 1YJ1A 2DZJA 4JGHB 2CS4A 3ODWA 2JZ3B 2G45B 4PYZA 5HE1A 5E6PA 3APDA 4FHJA 2LZ6A 1OEYA 4OVVA 1C3TA 4MM3A 4KAXB 3DVGX 5KCVA 1TZ1A 2K1FA 3ZNID 2FCNA 5G2NA 4DX90 3ML9A 1AWEA 4W9GA 1YIWA 4HAVB 2O6VD 2JP2A 4NY0A 4WSFA 1P9DU 2RGNB 1PLSA 3MDBC 5GOWB 2MQJA 5CTRC 2GBNA 2GOWA 2OQBA 3A1QB 2W2XC 2MBEA 3PRPB 4B6HA 4J6IA 2L8JA 1GC6A 2FCSA 3PVLA 2W9NA 2JVCA 4F7HA 3VFKA 2K00A 2CKHB 5C5BB 1LW3A 2JWZA 4HCNB 4ZRJA 4EZKA 4DHZE 2ELBA 2WX0A 2ROZB 2DZKA 1H4RA 4CHKA 2NS5A 3HM3A 2N4FA 1WJ6A 2LRUA 1WGGA 5EFXA 2MBQA 5CLLB 2KQSA 2K2UA 3SV1A 4WJ7A 4L6EA 5LXHA 3QWMA 2JRHA 3DPDA 2KMCA 1P6SA 4W9KA 1HE8A 1V86A 1FHOA 4WWPA 3LJ3A 3UQBA 2BGFA 2DHZA 2N9PC 3M63B 1WH3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MRP A;  1IP9 A;  1Z2M A;  2DYM A;  2L0T A;  2X18 A;  4NPN A;  2I5F A;  4DX8 A;  1MK7 B;  3RYT A;  4WVF B;  1LFD A;  2XK5 B;  1ZVR A;  2MFQ A;  1OEY J;  3HIZ A;  1XD3 B;  2ZPY A;  1WXA A;  3PSE B;  4F1S A;  4K7W A;  3M62 B;  5AZH A;  1PQS A;  5JHG A;  4KDL B;  4ANW A;  3UQA A;  4A6K A;  4KHO A;  1P98 A;  4I6N B;  2KFK B;  4PS8 A;  3MJW A;  1U4A A;  2KNB A;  3ECI A;  4LJO B;  1P0R A;  1UEL A;  2GS0 A;  2MWS B;  3ZKJ C;  1UNP A;  1UD7 A;  2OTX A;  2DX1 A;  2D11 A;  2WX1 A;  4EZJ A;  1TQZ A;  3Q3F A;  3A9J B;  4IUM B;  4FN2 A;  2D3G A;  3Q3J A;  4BKT A;  2KAN A;  2DA0 A;  2PE9 A;  3SD5 A;  2R09 A;  4M0W B;  1J8C A;  1XKE A;  2JPH A;  1DRO A;  2BKF A;  2KWC A;  3OJ4 B;  5LXI B;  3L08 A;  2UZR A;  4MEL A;  4NAW B;  2LXC A;  3LJU X;  2DZM A;  3K9P B;  2R2O A;  3DVG Y;  1P5T A;  3FM8 C;  3VQI A;  3CSF A;  4KIK B;  1FGY A;  2N7D A;  2MLB A;  1NTY A;  2JT4 B;  4ASW C;  4HJK A;  2CU1 A;  1V5T A;  2ZCC A;  1X05 A;  1P1A A;  1V5P A;  3I3T B;  5JHH A;  2RGF A;  2RPQ A;  4MJS A;  1E7U A;  3V61 A;  2EC1 A;  3KW5 B;  4G11 A;  1SGH A;  2GBR A;  5J3T A;  3KSY A;  1T0Y A;  3SU8 X;  2DAF A;  4LDT D;  3QBV B;  5DIF B;  3QJZ A;  3DOW A;  2ADZ A;  2KX3 A;  1RLF A;  3A4S C;  1WVH A;  1YX6 B;  3IBE A;  3PLU A;  2FNJ B;  2JY6 A;  1YX5 B;  4XWX A;  3PLV A;  3GZN I;  3UIO B;  4EUT A;  3KY9 A;  2V1Y A;  2N1W A;  1X86 A;  1E90 A;  3TFM A;  2RNR B;  3N32 A;  1DDW A;  2P0D A;  4HB0 B;  4A6F B;  4BKS D;  1Z87 A;  4HAW B;  2YS3 A;  3PSC A;  3VAW A;  5FI1 A;  3CIK A;  1ZW7 A;  4DHJ D;  2VRR B;  4KSL C;  2N9E B;  2D9V A;  4OVU A;  3H6N A;  5L81 A;  1WGU A;  2MA9 B;  1X1F A;  3DVN U;  3V6E B;  1NBF C;  5FI0 A;  4TQ0 A;  4DHZ B;  2BYE A;  1V61 A;  1V5M A;  4TQ1 A;  1C1Y B;  2MBO A;  3DBS A;  2K8H A;  2BWF A;  1U5E A;  2J0K A;  1WMH B;  4WJP A;  3QWZ B;  3PP2 A;  4FBJ B;  2ASQ A;  3IHP C;  5E6O A;  4LJP B;  4HAX B;  1PMS A;  3K9O B;  1BTN A;  4GDK B;  5D7G A;  2W2W A;  3H7S A;  5TR5 A;  4HCP B;  1OMW A;  5J17 A;  3JYU A;  2KDE B;  4HAY B;  2GCL A;  3EHV A;  3R3M A;  2NMB A;  2K2J A;  4HK2 A;  2KTR A;  3HW2 B;  4EOY A;  3TCA A;  2DHK A;  2KTF A;  2LYD A;  2D9W A;  2AYO B;  1DBH A;  4KZC A;  2NVU I;  1X1M A;  4I6P A;  2Z0Q A;  2A5U A;  2NZ8 B;  1XX0 A;  2G35 A;  4W9H A;  2IO1 B;  3ULB A;  1RFA A;  2DX5 B;  1MK9 B;  2OOB B;  4MGZ E;  2EKE C;  1XT9 B;  4F8C B;  4W9J A;  2E2X A;  3V60 A;  1Z5S B;  4IWO A;  1Q0W B;  4ICU A;  3LDZ E;  4HDQ A;  3RZF A;  3U8Z A;  2DKP A;  1LQB A;  1WXV A;  3PTF C;  2GBJ A;  1WGY A;  3NS8 A;  2NPT A;  2DFK A;  1UNR A;  4WJQ A;  2GBK A;  2KJR A;  3DCG A;  2HTH B;  2NR2 A;  4HLE A;  4DK5 A;  4AJW A;  3SNH A;  4WQO B;  2I1K A;  1OGW A;  2Y5B B;  4IWP A;  5C23 A;  5D27 A;  2BCJ A;  2H7D A;  2NCN A;  2LGY A;  5BO4 B;  3ZTD A;  2WYQ A;  2AL6 A;  1EUV B;  2COC A;  2COA A;  3UF8 A;  2V4L A;  1RJ2 A;  1XR0 B;  5HE2 A;  2C5L C;  3VUX A;  3L0W B;  2RSG A;  2W2X D;  3ULC A;  5L95 C;  1WF9 A;  1A5R A;  2KWU B;  1I35 A;  1FB8 A;  2CR5 A;  3PPA A;  3WAO A;  3EFU A;  1ZSQ A;  1FXT B;  4ZRK A;  3H1U A;  3IVF A;  3A9K B;  2UVM A;  3AU4 A;  4GN1 A;  1SIF A;  2XQN M;  4KHA A;  3VTU A;  1MAI A;  3PHW B;  4A6H A;  3QAQ A;  1U27 A;  3VUY A;  3A8Q A;  2L76 A;  1UPR A;  4W9C A;  3PHX B;  3L10 B;  1V5U A;  5AZG A;  2C9W B;  4DDG D;  5DH9 B;  5D2M B;  4BBN F;  2Y8F A;  3A1Q A;  4B6W A;  2DTC A;  4XX5 A;  5J18 A;  3PEG A;  1X1G A;  2BKR B;  3RZW C;  2NBU A;  1WI0 A;  3C0R B;  5C5B A;  3VH4 B;  3VIA A;  5JHB A;  4IM0 A;  1UPQ A;  4HB3 B;  3WAM A;  2Z0O A;  3ALB A;  4MSQ B;  2ZNV B;  1WI1 A;  3OAW A;  1FHX A;  1K5G B;  1KOT A;  4EJN A;  4DXA B;  1KZ7 A;  4N9F 4;  1TJ6 A;  4GOC A;  1B55 A;  2KX0 A;  2K25 A;  2PZ1 A;  2RD0 A;  1BAK A;  1MKE A;  1TGZ B;  1WGQ A;  2O2V A;  4ANX A;  1UEF A;  2QKM A;  1V2Y A;  4K7U A;  4H8S A;  3ZTC A;  2CRF A;  4EZL A;  1NTV A;  3MTN B;  2M38 A;  2V3S A;  2IBI B;  3P2B A;  2O6V B;  4FUL A;  4KVG B;  3ML4 A;  2IYB A;  1L2N A;  4TV3 A;  3SYX A;  1L7Y A;  2Y8G A;  2QHO A;  2YVC A;  2XK5 A;  2PPH A;  2CHZ A;  3T06 A;  5HE3 A;  2UYZ B;  3JW0 X;  3PVU A;  3JSV B;  5GMV A;  2COD A;  1SHC A;  2KFK A;  4A5K A;  2J7Q B;  1TBE A;  2J0J A;  4HDO A;  1V80 A;  2JZZ A;  4IAP A;  2LVP A;  5CHW A;  2CHX A;  1WX7 A;  1MIX A;  4NQK E;  2KLC A;  4RM8 A;  2PEA A;  3X0W A;  1RRB A;  4A3O A;  4MGY E;  5C1Z A;  4GMV A;  3NSU A;  3KVF B;  4PYU A;  2DYB A;  4WWO A;  3WAP A;  3MPX A;  1WR6 E;  4K17 A;  4NAW A;  2B3A A;  4DBB A;  3W1Y A;  2YT1 A;  2IY1 B;  1W1G A;  2R2Q A;  4KIK A;  4IC7 B;  1EVH A;  1H8C A;  2RR9 A;  1YQB A;  5DPR A;  3KH0 A;  2D10 A;  3PRZ A;  1WZ0 A;  3JVZ X;  1MG8 A;  3H7P B;  1M7R A;  1KI1 B;  3HM6 X;  4IM2 A;  2ZCB A;  1WIA A;  4BKG A;  4GSW A;  3UZT A;  5AZF A;  3TO1 A;  1I42 A;  3PV1 A;  2R0D A;  3WYF B;  1LM8 B;  2BF8 B;  3QHT A;  4GB9 A;  2LD9 A;  4IWQ A;  5DCN A;  1QC6 A;  4W9F A;  2QKL A;  2MCN B;  2AEH A;  1GJZ A;  2N7E A;  2UWQ A;  1V49 A;  2N23 A;  2P8V A;  3PG7 A;  3EC8 A;  2RVB B;  3TIX A;  1U5D A;  1TTN A;  3ZW3 A;  1WJN A;  3A98 B;  4A6F A;  4BBN C;  2YSZ A;  1AQC A;  3VXW A;  3ZVR A;  5HKH A;  3WA0 A;  4HAT B;  3TBL D;  2MDX A;  5LON B;  2DHJ A;  2LXA A;  4MH0 E;  2N0Y A;  2HJ8 A;  4WAA A;  3SHQ A;  2I5C A;  2D9Z A;  3TL5 A;  2JUO A;  1E8Z A;  5JZE B;  2M14 A;  1W1D A;  2KGX B;  2LUE A;  2KJH B;  1WMH A;  2C7N B;  4W9I A;  4E71 A;  1G6J A;  2MP2 B;  2HE7 A;  3NHE B;  4K1R B;  3SUZ A;  3QX1 A;  1ISN A;  1QQG A;  5J2R A;  2BYF A;  3ZVV A;  2WDT B;  2FUH B;  2K6Q A;  2KWV B;  3O65 B;  4KZ0 A;  3V5W A;  4W9D A;  5CHV C;  2DEN B;  3RCP A;  1WFY A;  4LDT B;  5DHF B;  5FR6 A;  2FID A;  2KLG A;  4ZRI A;  1M7E A;  2FAZ A;  4XC2 A;  3QIJ A;  3V62 A;  3SO6 A;  5CX3 A;  4P7I A;  2C7H A;  4ICV A;  1IYF A;  2XBB C;  4RM9 A;  1WYW B;  4BFR A;  4CHJ A;  2YRY A;  3RUL A;  3TMP B;  4NJ7 A;  2L1C A;  4DDI D;  1EGX A;  4G0N B;  3D8D A;  1NU2 A;  2AWT A;  2ZVO A;  3L13 A;  2YT0 A;  3VUW A;  4FAD A;  5KQ4 A;  2L05 A;  1P3R A;  4F7Z A;  2DKQ A;  3R7R A;  4K81 A;  3OLM D;  4DHJ B;  1R4M I;  2K39 A;  2K8C A;  4WWN A;  4EFO A;  2KDF B;  1BTK A;  2YS1 A;  5J3Y A;  2KFJ A;  4IOY X;  1WY8 A;  2BPS A;  2RLO A;  1I2H A;  1XD4 A;  4ANU A;  1NI2 A;  3QC8 B;  2LG1 A;  3DBL I;  1Q67 A;  4NQL B;  3KYC D;  3T9L A;  4MT7 A;  4CYE A;  4M8N A;  2Y7B A;  3SDL C;  2MSE D;  4TYZ A;  2P0F A;  3N30 A;  1NDD A;  3WAL A;  2Z0D B;  4ZDV A;  1K5D B;  4GDL B;  2P0H A;  1V5O A;  2JF5 A;  4W9L A;  2M1M A;  4K7S A;  2RSU A;  1XCG A;  3ZO5 B;  1WX8 A;  3KZ1 A;  3L54 A;  2LRW A;  4K2P A;  1H10 A;  4HB4 B;  4IM3 A;  3M95 A;  4WJN A;  2JRI B;  3TVV A;  3O96 A;  1Y19 B;  5DPW A;  1WJ4 A;  3ONS A;  1ZKH A;  5KHQ A;  3U7D A;  1V81 A;  3AU5 A;  3BJI A;  1E8X A;  2EMT A;  3KUZ A;  1UH6 A;  4NSW A;  1V6E A;  2L00 B;  2Z0P A;  2LVQ A;  3NOB A;  1J0G A;  1OTR B;  1J0W A;  4CHM A;  1E5W A;  2D4Q A;  3A9K A;  2D2Q A;  3OJ3 A;  4K2O A;  3VTW A;  1CMX B;  4HWI B;  4JQW C;  1V89 A;  5DI9 B;  3TJP A;  2MBH A;  2ZZP B;  4FA6 A;  2LJ5 A;  3VTV A;  1OQN A;  4IG7 B;  2KC1 A;  3ZNH B;  5D3V A;  2LOX A;  1AAR A;  4HB2 B;  3R7Q A;  3B1L X;  4HPM B;  1P3Q U;  2L7R A;  3KRX A;  4RMA A;  3KYD D;  1Q1O A;  4BOS C;  4MY6 A;  5G55 A;  1KZG A;  4DBG A;  2OJR A;  2KQ7 A;  2M17 A;  2IZV B;  1EF1 A;  1WR1 A;  3ZNG C;  3ZUN A;  2ELA A;  2CHW A;  5IA7 A;  1GG3 A;  4TUU A;  5D3W A;  3M1I B;  2KZR A;  3PRM B;  4X57 B;  1FAO A;  2JXX A;  1WM2 A;  3HK0 A;  2J59 M;  2KHW B;  2KN5 A;  1GC7 A;  3A4R A;  3D32 A;  2N9X A;  2UZS A;  4HXD A;  1D3Z A;  4BVU C;  2NBV B;  2YLM A;  3AUL A;  3KUD B;  3HQC A;  3FEH A;  1ZC4 B;  3WAN A;  1GNU A;  2O6V A;  3UIN B;  5DPS A;  1N3H A;  2J0M A;  4C0A A;  1FGZ A;  2BYV E;  4Z2N A;  2ZNV C;  5L83 A;  2CAY A;  1RRP B;  2KCJ A;  2KC2 A;  1U29 A;  2COF A;  3G9W A;  2KDB A;  3A33 B;  3JSV A;  1LB1 A;  1WXS A;  3VVW B;  3P6A A;  5IAA C;  4BOZ B;  4LCD E;  5CHF A;  1WJM A;  4AUQ C;  5C6R A;  4KHB B;  2IYD B;  3UIP B;  3VDZ A;  1WGH A;  4IW0 A;  3GOE A;  2DLW A;  4E74 A;  2O2V B;  2ROV A;  1E8Y A;  3L17 A;  4ANV A;  4NJ6 A;  4JIO U;  3QA8 A;  2L0F A;  3KRW A;  4MEM A;  2VSZ A;  2CY5 A;  1BWN A;  3R66 C;  1V9J A;  3ZRF A;  3DVN V;  5EDS A;  2GCJ A;  4JLC A;  5JH5 C;  1K8R B;  5KQ1 A;  3U30 A;  3ZDT A;  1ZC3 B;  1SE9 A;  1DYN A;  1UNQ A;  2EMS A;  2DAJ A;  3ML8 A;  1Y8R C;  2V76 A;  2M4N A;  3N3K B;  3A9J A;  2ZEQ A;  5HE0 A;  4EMO A;  2HD5 B;  2KK8 A;  5C16 A;  1F9J A;  5DHA B;  4GIV A;  3DXD A;  1E7V A;  3V6C B;  4MGK E;  3APC A;  4Y94 A;  3IFW B;  2D9Y A;  2D9X A;  3CMM B;  3H9D A;  5AEK B;  1WE7 A;  3RCZ A;  3H7P A;  1WXM A;  4W9E A;  2GBM A;  4HPL B;  3ZIM A;  3D8E A;  4WJO A;  2Q13 A;  4ZYN A;  3ODO A;  2LAS A;  4YON A;  1WGD A;  2KVR A;  1XQQ A;  2REX A;  5JP4 A;  5D6J B;  2KD0 A;  2NBW B;  1YD8 U;  3B08 A;  1WE6 A;  3N7C A;  2IFS A;  1Q5W B;  4IFS A;  4A3P A;  2L3Z A;  2IO3 B;  3ENE A;  1R4N I;  3AI5 A;  4FJV B;  3QQ8 B;  3B0A A;  1W1H A;  2C60 A;  4F7U P;  2LWP A;  3NY5 A;  1RAX A;  2DZI A;  2ZPN A;  1VCB A;  2BWE S;  4AP4 C;  4GPT B;  1VD2 A;  4GXB A;  3CST A;  2N1V A;  1DDM A;  3X23 A;  2G4D B;  5DPT A;  4E3C A;  2Z59 B;  4A20 A;  2MKR A;  1WGR A;  1IPG A;  3FSS A;  4PS3 A;  2YF0 A;  4D0N B;  3GYO A;  3DQV A;  2DN6 A;  1WZ3 A;  4AOF A;  4HVB A;  4EKU A;  4F7G A;  4GU2 A;  1OQY A;  1WJ1 A;  2LGD A;  2MP2 A;  3ODX A;  3PZD A;  3F0W A;  4I6L B;  2PE6 B;  5CLQ B;  4KDI C;  4FHK A;  4MSM B;  5E6N A;  4MJS B;  4FJZ A;  2LOZ A;  1MPH A;  4B9K A;  1E8W A;  3TW1 A;  2KJ6 A;  2KMA A;  2AL3 A;  1S3S G;  4GDK A;  1UBI A;  4AWJ A;  1EF5 A;  3QAR A;  1J19 A;  3QK0 A;  3S2A A;  1EAZ A;  2K6D B;  5D3X A;  3A8P A;  1PFJ A;  2LI5 A;  3MHS D;  1S1Q B;  2IO2 B;  2VKI A;  3UGB B;  2DYQ A;  2A4Z A;  2D07 B;  3L16 A;  2KUP A;  3PGE A;  1GUA B;  1V88 A;  1QZE A;  4BKS A;  4EEW A;  3RUI B;  2XEW A;  2M8S A;  1I7A A;  2KKC A;  1DDV A;  1WRD B;  4G50 A;  3AJ4 A;  5KHO A;  2FIF A;  4NNJ B;  3ZDM C;  4JL9 A;  2I1J A;  3HHM A;  1KM7 A;  3NZS A;  2DHI A;  1WG7 A;  2DX5 A;  3BY4 B;  3DXE A;  5C79 A;  3PS6 A;  4XZ4 A;  5JLJ B;  1JRU A;  1UBQ A;  4FJY A;  4CO7 A;  2WWZ A;  1FOE A;  2CY4 A;  2ZJD A;  4BBK A;  3PVW A;  3P7Z A;  2LVO A;  5LLI A;  3RD2 A;  5D3Y A;  1WX9 A;  2KXJ A;  2EJ8 A;  3DBR I;  3APF A;  2PJH A;  4M8M A;  1TXD A;  3BIN A;  4II2 B;  3DXC A;  2FJL A;  4PS7 A;  5JHA A;  3M3J A;  1X11 A;  3VH3 B;  2HTH A;  4GDL A;  1ZGU B;  2LUL A;  4MGI E;  2KTR B;  2FCQ A;  1M94 A;  4GZU A;  3WIM A;  2G3Q B;  2MW5 A;  1UGM A;  3NZU A;  3F5R A;  1BT0 A;  1WM3 A;  4G3X B;  2KO3 A;  4KSK C;  4MDK E;  4URK A;  1Y5O A;  1U2B A;  4GMX B;  3ZLZ A;  2GMI C;  2Z0E B;  3EEC A;  2IY0 B;  2L2I A;  2H7E A;  2YS5 A;  1KJT A;  2ZVN A;  3VHT C;  1U5G A;  3OAN A;  3CF6 E;  4GGQ A;  4HAU B;  3GYP A;  2KOX A;  2M0X A;  3W1S A;  5LOP B;  2C7M B;  2MBB B;  3IG3 A;  1KLV A;  2IO0 B;  3D8F A;  2NPT B;  3PT2 B;  3T8M A;  4MK0 A;  3PRE A;  1LXD A;  4YL8 A;  3RT3 B;  4AJY B;  1WJU A;  2G4S A;  1OY2 A;  5D94 A;  2LKO A;  4KV2 A;  3DBH I;  2FCM A;  2DYO A;  5J3Q A;  1ZM0 A;  1MIZ B;  3CXB B;  2K8B A;  4PQ0 A;  2KDI A;  3VOQ A;  1IRS A;  1FHW A;  2RUK B;  3DDC B;  4II3 B;  3ZNZ B;  3KUC B;  1U5F A;  4PNK A;  4FLH A;  3AXC A;  1EO6 A;  4HHV A;  1UZX B;  4Z2M B;  3W1S C;  2MX2 A;  4DWF A;  2DYN A;  3ZRC A;  4HAZ B;  2VRW B;  2GJY A;  1XOD A;  2MWN B;  4TKN A;  4B95 A;  2LGX A;  3QCA A;  1YJ1 A;  2DZJ A;  4JGH B;  2CS4 A;  3ODW A;  2JZ3 B;  2G45 B;  4PYZ A;  5HE1 A;  5E6P A;  3APD A;  4FHJ A;  2LZ6 A;  1OEY A;  4OVV A;  1C3T A;  4MM3 A;  4KAX B;  3DVG X;  5KCV A;  1TZ1 A;  2K1F A;  3ZNI D;  2FCN A;  5G2N A;  4DX9 0;  3ML9 A;  1AWE A;  4W9G A;  1YIW A;  4HAV B;  2O6V D;  2JP2 A;  4NY0 A;  4WSF A;  1P9D U;  2RGN B;  1PLS A;  3MDB C;  5GOW B;  2MQJ A;  5CTR C;  2GBN A;  2GOW A;  2OQB A;  3A1Q B;  2W2X C;  2MBE A;  3PRP B;  4B6H A;  4J6I A;  2L8J A;  1GC6 A;  2FCS A;  3PVL A;  2W9N A;  2JVC A;  4F7H A;  3VFK A;  2K00 A;  2CKH B;  5C5B B;  1LW3 A;  2JWZ A;  4HCN B;  4ZRJ A;  4EZK A;  4DHZ E;  2ELB A;  2WX0 A;  2ROZ B;  2DZK A;  1H4R A;  4CHK A;  2NS5 A;  3HM3 A;  2N4F A;  1WJ6 A;  2LRU A;  1WGG A;  5EFX A;  2MBQ A;  5CLL B;  2KQS A;  2K2U A;  3SV1 A;  4WJ7 A;  4L6E A;  5LXH A;  3QWM A;  2JRH A;  3DPD A;  2KMC A;  1P6S A;  4W9K A;  1HE8 A;  1V86 A;  1FHO A;  4WWP A;  3LJ3 A;  3UQB A;  2BGF A;  2DHZ A;  2N9P C;  3M63 B;  1WH3 A; 
#chains in the Genus database with same CATH topology
 1ACC A;  2MRP A;  3DCX A;  1IP9 A;  5BMI A;  1Z2M A;  2KIG A;  2DYM A;  2BTE A;  2L0T A;  2X18 A;  4NPN A;  2I5F A;  4DX8 A;  1J7B A;  1MK7 B;  3RYT A;  4KGS A;  5IO9 A;  4WVF B;  1GB1 A;  1LFD A;  4S17 A;  2XK5 B;  1ZVR A;  2MFQ A;  1OEY J;  3HIZ A;  1XD3 B;  2ZPY A;  3N1Y C;  1WXA A;  1VDV A;  3PSE B;  4F1S A;  4K7W A;  3M62 B;  1SB3 C;  3DWM A;  1N5W A;  3AN1 A;  5AZH A;  1PQS A;  5HG2 A;  3RPF C;  5IP4 D;  5JHG A;  4KDL B;  4ANW A;  2KYW A;  4NAM A;  3UQA A;  4A6K A;  4KHO A;  1P98 A;  2J53 A;  4I6N B;  4C80 A;  2KFK B;  4PS8 A;  3MJW A;  1I4H A;  1CQV A;  1U4A A;  2D3B A;  1T0R C;  2KNB A;  2ACZ B;  3ECI A;  4LJO B;  1P0R A;  1UEL A;  1EM7 A;  2GS0 A;  2MWS B;  3ZKJ C;  1UNP A;  1XLQ A;  4YTM B;  1UD7 A;  2OTX A;  2DX1 A;  2D11 A;  1OQR A;  2WX1 A;  4EZJ A;  1FCC C;  3IXS A;  3ZQ4 A;  1TQZ A;  3Q3F A;  3A9J B;  2WXN A;  4PT5 A;  3U4E G;  1RYJ A;  4IUM B;  4FN2 A;  4XGA B;  2INN E;  2D3G A;  2KUQ A;  4YSZ B;  3Q3J A;  4BKT A;  1DOI A;  2KAN A;  2DA0 A;  2PE9 A;  3EGR A;  3SD5 A;  2R09 A;  4M0W B;  1J8C A;  1XKE A;  2JPH A;  1DRO A;  1JQ4 A;  2BKF A;  2KWC A;  3OJ4 B;  5LXI B;  1N61 A;  3L08 A;  2W3R A;  3FKY A;  2UZR A;  4MEL A;  4NAW B;  3N20 C;  2LXC A;  3LJU X;  2DZM A;  3MC9 A;  3K9P B;  4HRS A;  2R2O A;  4ZRP A;  1YQ3 B;  1D6E C;  3DVG Y;  1P5T A;  3FM8 C;  3VQI A;  3CSF A;  4KIK B;  1FGY A;  2N7D A;  4HJG E;  2MLB A;  1NTY A;  4ITK A;  1T3Q A;  3T3O A;  4KKJ A;  2CJN A;  2JT4 B;  5IN7 A;  2OJW A;  4ASW C;  4RF0 A;  4HJK A;  4WQM A;  2CU1 A;  1V5T A;  2ZCC A;  1X05 A;  1P1A A;  1V5P A;  3I3T B;  2WXO A;  4B0E A;  5JHH A;  3U12 A;  1NVI D;  2PVO D;  2RGF A;  2RPQ A;  4MJS A;  1E7U A;  1NYR A;  4KGT A;  3V61 A;  2EC1 A;  3KW5 B;  4G11 A;  1SGH A;  2GBR A;  5J3T A;  1LO5 D;  3KSY A;  1PDX A;  1T0Y A;  3AE1 B;  3SU8 X;  1MG4 A;  2DAF A;  3B2G A;  4LDT D;  3QBV B;  5DIF B;  3QJZ A;  3DOW A;  2KT7 A;  2ADZ A;  4S0R A;  3W2D A;  2KX3 A;  2AX5 A;  2OHF A;  3AE8 B;  5BYQ A;  1RLF A;  3A4S C;  4RF1 A;  1WVH A;  1YX6 B;  3IBE A;  2BT6 A;  3PLU A;  2FNJ B;  2JY6 A;  4C56 C;  2MJD A;  1YX5 B;  4XWX A;  3PLV A;  3GZN I;  3UIO B;  4EUT A;  3KY9 A;  1J7A A;  2V1Y A;  2N1W A;  1X86 A;  1E90 A;  3TFM A;  2RNR B;  2PIA A;  3N32 A;  5I2S A;  1DDW A;  2P0D A;  4HB0 B;  1IGD A;  4ARI A;  4A6F B;  4BKS D;  1Z87 A;  4HAW B;  2YS3 A;  1JWU D;  3PSC A;  2FJU B;  1YJI A;  3TUO A;  3VAW A;  5FI1 A;  4RGM A;  3CIK A;  1ZW7 A;  4DHJ D;  1GPX A;  2VRR B;  4KSL C;  2N9E B;  2D9V A;  4OVU A;  3H6N A;  5L81 A;  1WGU A;  2MA9 B;  1X1F A;  2KAJ A;  3DVN U;  3V6E B;  1NBF C;  4RCO A;  5FI0 A;  1HQR D;  1FFU A;  4TQ0 A;  4DHZ B;  2BYE A;  1V61 A;  1V5M A;  4TQ1 A;  4CSQ A;  1C1Y B;  2MBO A;  4O1N A;  3DBS A;  2K8H A;  2BWF A;  3ZYY X;  1U5E A;  2J0K A;  1WMH B;  2JYT A;  4WJP A;  3QWZ B;  3PP2 A;  4FBJ B;  2ASQ A;  3IHP C;  4LJP B;  5E6O A;  4HAX B;  1PMS A;  3K9O B;  1BTN A;  3RNF C;  4GDK B;  4A8X C;  2BB5 A;  4XDC A;  1V1P A;  5D7G A;  1JRP A;  2QSD A;  2W2W A;  3H7S A;  4K3C A;  5TR5 A;  3WCQ A;  4HCP B;  1OMW A;  2V3P A;  5J17 A;  4BAX A;  1ROE A;  3JYU A;  4C7Z A;  2KDE B;  1M4V A;  2PVG C;  5HI1 A;  4HAY B;  2GCL A;  3EHV A;  4XYC A;  3R3M A;  2NMB A;  1TS5 A;  2K2J A;  4HK2 A;  2KTR A;  3HW2 B;  3H8H A;  4JPS A;  4EOY A;  3TCA A;  3P1M A;  3NUH B;  2DHK A;  2GB1 A;  2KTF A;  2LYD A;  2D9W A;  1OQQ A;  2CJO A;  3Q8C A;  2AYO B;  1DBH A;  3P4P B;  2OED A;  4KZC A;  4UDU C;  2NVU I;  3V05 A;  1X1M A;  1YNT E;  2MJ3 A;  2J52 A;  4I6P A;  4OT1 A;  3FIL A;  2Z0Q A;  2A5U A;  2NZ8 B;  1XX0 A;  2G35 A;  4W9H A;  2IO1 B;  4FXC A;  3ULB A;  1RFA A;  2DX5 B;  2G9H D;  1MK9 B;  1R4M B;  2OOB B;  2WDR B;  3NVY A;  2EKE C;  3O13 A;  4MGZ E;  1XT9 B;  4F8C B;  4W9J A;  3ZXR A;  5M4Y B;  3ZGZ A;  2E2X A;  3V60 A;  1IBX A;  1Z5S B;  4IWO A;  1HA5 A;  1Q0W B;  4ICU A;  4US9 A;  5FR3 A;  3AE4 B;  3LDZ E;  3SR6 A;  4HDQ A;  4HEA 1;  3KQ4 A;  3RZF A;  3U8Z A;  2DKP A;  3HSA A;  1P7F A;  3BYY B;  1LQB A;  2MJE A;  1WXV A;  3PTF C;  2GBJ A;  1WGY A;  2LFI A;  3NS8 A;  2NPT A;  3DBL B;  2DFK A;  1UNR A;  4WJQ A;  2GBK A;  2KJR A;  3DCG A;  4YXD B;  2KMM A;  2HTH B;  2NR2 A;  2JU6 X;  1QLB B;  4HLE A;  4DK5 A;  4AJW A;  3SNH A;  4WQO B;  3Q3O C;  1SEB D;  2I1K A;  1OGW A;  2Y5B B;  4IWP A;  5C23 A;  3ZJU A;  5D27 A;  2BCJ A;  2H7D A;  2BS2 B;  1FIQ A;  2NCN A;  2LUM A;  4N59 A;  2EEL A;  2LGY A;  5BO4 B;  4HKQ A;  3ZTD A;  2WYQ A;  1D5M C;  2PKO A;  2WXR A;  1KF6 B;  2AL6 A;  1UGJ A;  3IAS 1;  3NVZ A;  2HTM E;  1EUV B;  4XDD A;  2COC A;  1T5X D;  2COA A;  1I4Q A;  3UF8 A;  1C76 A;  1AW7 A;  2V4L A;  1RJ2 A;  1XR0 B;  5HE2 A;  2C5L C;  4D2K A;  1QF6 A;  3VUX A;  3L0W B;  2RSG A;  2W2X D;  3ULC A;  5L95 C;  1FCL A;  1WF9 A;  3Q3M C;  1A5R A;  2KWU B;  1I35 A;  3Q2A C;  1XXG A;  1FB8 A;  2CR5 A;  3PPA A;  3WAO A;  3EFU A;  4LNK A;  1ZSQ A;  2ON8 A;  4L2Y A;  1FXT B;  4ZRK A;  3RI7 C;  3H1U A;  3IVF A;  3A9K B;  2UVM A;  3AU4 A;  4RH6 A;  4RGT A;  4C4V B;  1YQ4 B;  4J3O D;  4GN1 A;  2WXF A;  1SIF A;  2XQN M;  4KHA A;  3VTU A;  1XF5 L;  1MAI A;  4XE0 A;  3PHW B;  1SE2 A;  4A6H A;  5H92 C;  3QAQ A;  2INP E;  1MJD A;  1U27 A;  3VUY A;  3A8Q A;  2L76 A;  3NWD A;  1UPR A;  4W9C A;  3PHX B;  3L10 B;  1V5U A;  5AZG A;  2C9W B;  4DDG D;  5DH9 B;  5D2M B;  4BBN F;  1TS4 A;  2Y8F A;  3NVV A;  2ZW1 A;  1DYQ A;  3A1Q A;  1E6E B;  4B6W A;  1D5Z C;  2DTC A;  4OZA A;  5BYS A;  2H89 B;  4XX5 A;  5J18 A;  3B77 A;  2Y3A A;  3PEG A;  1X1G A;  1MI0 A;  2BKR B;  5EE3 A;  3RZW C;  2NBU A;  1K52 A;  3Q8F A;  1WI0 A;  1MFW A;  3C0R B;  5C5B A;  2WXK A;  3VH4 B;  4WUR A;  4K3B A;  3VIA A;  3Q3N C;  5JHB A;  4IM0 A;  1AWD A;  1UPQ A;  4HB3 B;  3WAM A;  2Z0O A;  1QIL A;  3ALB A;  4MSQ B;  2ZNV B;  3EA6 A;  1WI1 A;  3OAW A;  1FHX A;  1K5G B;  4P6V F;  1KOT A;  1XLN A;  5BMH A;  4XWW A;  1BUI C;  4EJN A;  4DXA B;  1KZ7 A;  4N9F 4;  1TJ6 A;  4GOC A;  1B55 A;  4WH4 A;  2KX0 A;  2K25 A;  2PZ1 A;  3OHM B;  3C8Y A;  2RD0 A;  1BAK A;  1MKE A;  1TGZ B;  1WGQ A;  2O2V A;  4MT5 A;  1E0Z A;  4ANX A;  1UEF A;  2QKM A;  1V2Y A;  4K7U A;  4H8S A;  3ZTC A;  2CRF A;  3AE2 B;  1RM6 C;  4EZL A;  1NTV A;  3MTN B;  2M38 A;  2V3S A;  2IBI B;  1FM0 D;  1DGJ A;  3P2B A;  3Q8A A;  1L4D B;  2O6V B;  2CU3 A;  4FUL A;  4KVG B;  1SE3 A;  3ML4 A;  1F0Z A;  5EE9 A;  2IYB A;  1L2N A;  2YEP F;  4TV3 A;  3SYX A;  1L7Y A;  3Q6B A;  1FO4 A;  2Y8G A;  2QMT A;  2QHO A;  2YVC A;  1V8C A;  2XK5 A;  2PPH A;  5MPO A;  2CHZ A;  3T06 A;  5HE3 A;  4QXA B;  2UYZ B;  1UWM A;  3JW0 X;  2V0G A;  3PVU A;  3RFZ B;  3JSV B;  5GMV A;  2COD A;  1ZUD 2;  1L5P A;  4DIX A;  2IGH A;  1SBB B;  2KIE A;  1SHC A;  2KFK A;  1SE4 A;  4A5K A;  2J7Q B;  1I4G A;  1TBE A;  2M19 A;  2J0J A;  1FPY A;  4HDO A;  1V80 A;  1K53 A;  2Y5C A;  2WU5 B;  4JWS C;  2JZZ A;  4IAP A;  2LVP A;  4REZ A;  3U2S C;  5CHW A;  2CHX A;  1WX7 A;  4BZA A;  1MIX A;  4NQK E;  3TEY A;  2KLC A;  3AE6 B;  4RM8 A;  1QOF A;  2AQ1 B;  1NI3 A;  2PEA A;  3X0W A;  1RRB A;  2AQ2 B;  4YSY B;  3NW8 A;  3NJT A;  4A3O A;  1E10 A;  1FNU A;  4MGY E;  3FVC A;  1KLG D;  5C1Z A;  3BVG A;  4GMV A;  1PGX A;  3NSU A;  3KVF B;  3AED B;  3I9V 1;  1VJK A;  4PYU A;  3BVM A;  4WIP A;  2DYB A;  4WWO A;  3WAP A;  2I2Y A;  3MPX A;  4MH8 A;  1WR6 E;  4K17 A;  2W3S A;  1ENF A;  2B3A A;  3J9C A;  4NAW A;  4DBB A;  1T0S C;  1FXA A;  2FE8 A;  3W1Y A;  2YT1 A;  2IY1 B;  1W1G A;  2R2Q A;  2V4I B;  4RFB A;  4KIK A;  4IC7 B;  3Q14 C;  3U52 E;  1EVH A;  4M01 A;  1H8C A;  2RR9 A;  2R2Y A;  3RNB C;  1YQB A;  5DPR A;  3KH0 A;  2D10 A;  3PRZ A;  1WZ0 A;  3JVZ X;  2J4X A;  5FKA C;  2TSS A;  1MG8 A;  3P63 A;  2Z59 A;  1M7R A;  3H7P B;  1KI1 B;  3HM6 X;  4IM2 A;  1WWT A;  3GP7 A;  2ZCB A;  1N60 A;  1WIA A;  4BKG A;  3GB1 A;  3BZD B;  4GSW A;  1MI1 A;  2IPK D;  3UZT A;  5AZF A;  3TO1 A;  1I42 A;  3PV1 A;  2R0D A;  1SXT A;  3WYF B;  1TS3 A;  1LM8 B;  2BF8 B;  3QHT A;  1FEH A;  1Y56 A;  1R4N B;  3Q8B A;  3AEF B;  2WXM A;  4OZC A;  4GB9 A;  2LD9 A;  4IWQ A;  3IT4 B;  5DCN A;  1QC6 A;  4W9F A;  2QKL A;  2MCN B;  2AEH A;  2IGD A;  2QDF A;  1UUP A;  1GJZ A;  2N7E A;  3FAH A;  2UWQ A;  1V49 A;  1TYG B;  5LG4 B;  4ZRQ A;  2IDY A;  1C4A A;  2N23 A;  2Y5P A;  2P8V A;  3AE5 B;  3PG7 A;  3EC8 A;  1FNW A;  2WHI A;  2RVB B;  4L23 A;  3TIX A;  1U5D A;  1L6V A;  1T6B X;  1TTN A;  2BQQ A;  1D4B A;  3ZW3 A;  1JWM D;  2RPV A;  2ONQ A;  1WJN A;  3A98 B;  4GLS C;  4A6F A;  1PGB A;  3BYT B;  2SEB D;  5AUI A;  1A70 A;  4BBN C;  2BBC A;  2YSZ A;  1AQC A;  3VXW A;  3ABV B;  5BMG A;  3ZVR A;  3SEB A;  5HKH A;  5EE1 A;  3B9J A;  3WA0 A;  4HAT B;  3B2F A;  1ET9 A;  3TBL D;  1YOV B;  2MDX A;  5LON B;  2DHJ A;  2LXA A;  4MH0 E;  2WXL A;  2N0Y A;  2HJ8 A;  2GI9 A;  4WAA A;  3SHQ A;  2I5C A;  2D9Z A;  3TL5 A;  2JUO A;  1E8Z A;  5JZE B;  2M14 A;  1C77 A;  1W1D A;  2KGX B;  2LUE A;  4N6E B;  2KJH B;  1WMH A;  2C7N B;  1ET6 A;  4W9I A;  4E71 A;  1G6J A;  2MP2 B;  2HE7 A;  1TKY A;  3NHE B;  4HKZ E;  1ZDV A;  4K1R B;  3SUZ A;  3QX1 A;  1ISN A;  2Z8L A;  1QQG A;  4LNF A;  2BYF A;  5J2R A;  3ZVV A;  2WDT B;  2FUH B;  2K6Q A;  3HVZ A;  3PZ8 A;  2KWV B;  3N1Z C;  3O65 B;  4KZ0 A;  1IUE A;  2NTT A;  1WSP A;  1HZ6 A;  3V5W A;  4W9D A;  5CHV C;  2DEN B;  2X38 A;  3RCP A;  1WFY A;  4LDT B;  3W9C B;  5DHF B;  1MPE A;  5FR6 A;  2FID A;  2KLG A;  4ZRI A;  1M7E A;  1I7H A;  2FAZ A;  4XC2 A;  3QIJ A;  3V62 A;  1FMA D;  3SO6 A;  1E7P B;  5CX3 A;  3GE3 C;  4P7I A;  2C7H A;  4M02 A;  4ICV A;  1IYF A;  2XBB C;  4HRO A;  4RM9 A;  1WYW B;  1XCQ L;  4BFR A;  4CHJ A;  2YRY A;  3A58 A;  3AV8 A;  3RUL A;  3BK2 A;  4NJ7 A;  3TMP B;  2L1C A;  2NTS A;  4YTN B;  4DDI D;  1EGX A;  4G0N B;  3D8D A;  1NU2 A;  2WXG A;  2AWT A;  2ZVO A;  3L13 A;  4LK0 M;  1WXQ A;  3KWL A;  2YT0 A;  1JCK B;  3VUW A;  4FAD A;  1LGR A;  5KQ4 A;  2L05 A;  1P3R A;  4F7Z A;  2DKQ A;  2LGI A;  3R7R A;  1C78 A;  1PYW D;  2K9X A;  4K81 A;  3OLM D;  4DHJ B;  4US8 A;  1R4M I;  2SAK A;  1QQR A;  2K39 A;  2K8C A;  4WWN A;  4EFO A;  2KDF B;  1JWS D;  5FK9 C;  2K49 A;  1BTK A;  2YS1 A;  5IOI A;  1ZP0 B;  5J3Y A;  2KFJ A;  3KLS X;  4IOY X;  3MHZ A;  1K51 A;  1VZ6 A;  3DBR B;  1WY8 A;  2LHE A;  2BPS A;  2RLO A;  1I2H A;  2V9H A;  1XD4 A;  4ANU A;  2WXQ A;  5E6J A;  1NI2 A;  3QC8 B;  2FUG 1;  5IKC M;  3EUB 2;  2LG1 A;  3DBL I;  1Q67 A;  4NQL B;  3KYC D;  3T9L A;  4MT7 A;  1ZYI A;  4CYE A;  4M8N A;  4NZL B;  1WGK A;  2Y7B A;  3SDL C;  2MSE D;  4TYZ A;  2P0F A;  2IJ0 A;  3N30 A;  1QT9 A;  4L1R A;  1NDD A;  3WAL A;  2Z0D B;  4ZDV A;  1K5D B;  4GDL B;  2MHJ A;  2MEK A;  2P0H A;  2E3T A;  1KTK A;  1V5O A;  2JF5 A;  4W9L A;  2M1M A;  4K7S A;  2WXJ A;  2RSU A;  3R2I A;  2DWQ A;  3MJ5 A;  1XCG A;  3ZO5 B;  1WX8 A;  3KZ1 A;  3L54 A;  2LRW A;  4LLG M;  4K2P A;  1H10 A;  4HB4 B;  4IM3 A;  3M95 A;  3BWU D;  1WRI A;  4WJN A;  2JRI B;  3TVV A;  3O96 A;  1Y19 B;  5DPW A;  1WJ4 A;  3DWG C;  3ONS A;  1ZKH A;  5KHQ A;  3U7D A;  1V81 A;  3AU5 A;  1F77 A;  3AB5 A;  2H88 B;  3Q8E A;  4LNO A;  3BJI A;  1E8X A;  2EMT A;  3KUZ A;  1UH6 A;  4NSW A;  1V6E A;  2L00 B;  2Z0P A;  2LVQ A;  4PK1 A;  3NOB A;  1HEZ E;  1J0G A;  1OTR B;  1J0W A;  4HPP A;  1VZ7 A;  2D3A A;  4CHM A;  1E5W A;  2D4Q A;  3ZXV A;  3A9K A;  4ZHP A;  2D2Q A;  3OJ3 A;  4K2O A;  3VTW A;  4C4V A;  4YSX B;  1CMX B;  4HWI B;  4JQW C;  1JWB D;  2Q5W D;  1TY2 A;  1V89 A;  2RDH A;  4Q2J A;  1L0Y B;  1C9F A;  5DI9 B;  3TJP A;  2MBH A;  2WP9 B;  3DBH B;  2ZZP B;  3AM9 A;  5C2T B;  4FA6 A;  2LJ5 A;  1F1H A;  3VTV A;  1MHH E;  1OQN A;  4IG7 B;  2KC1 A;  2B76 B;  2BW2 A;  3ZNH B;  3T3N A;  5D3V A;  1I4P A;  3W5U B;  2WXI A;  2LOX A;  1AAR A;  4HB2 B;  3R7Q A;  3B1L X;  4A9A A;  1N6Z A;  4HPM B;  1V97 A;  1P3Q U;  2MH7 A;  2L7R A;  3OWE B;  3KRX A;  4RMA A;  2GLS A;  2JSV X;  3KYD D;  1B1Z A;  1Q1O A;  4BOS C;  4MY6 A;  5G55 A;  1KZG A;  2WNM A;  4DBG A;  1ESF A;  2WXH A;  2OJR A;  2KQ7 A;  2M17 A;  1JRO A;  4P16 A;  2BYT A;  3W5V B;  2IZV B;  1EF1 A;  4OVZ A;  1WR1 A;  3P4R B;  2IGG A;  3ZNG C;  2WXP A;  3ZUN A;  2ELA A;  2CHW A;  5IA7 A;  1GG3 A;  1SJE D;  4TUU A;  5D3W A;  2VZK B;  3M1I B;  2KZR A;  3PRM B;  4X57 B;  1FAO A;  2JXX A;  5EE0 A;  3NRZ A;  1EU3 A;  1WM2 A;  3TEW A;  3HK0 A;  2J59 M;  2JWU A;  2KHW B;  2Z4D A;  3EFC A;  2KN5 A;  1GC7 A;  3A4R A;  2LJI A;  1TY0 A;  5I4D A;  3D32 A;  1CZP A;  2N9X A;  2UZS A;  1I4X A;  1E9M A;  4HXD A;  1D3Z A;  4BVU C;  3N1X C;  1R7S A;  2NBV B;  4MM3 B;  2YLM A;  3AUL A;  3KUD B;  1SIJ A;  3HQC A;  3FEH A;  1ZC4 B;  2YT2 A;  2BB6 A;  3MC8 A;  4IOI E;  3WAN A;  2N9L A;  2Z13 A;  1GNU A;  4R3D A;  2O6V A;  3UIN B;  1SF0 A;  3P42 A;  5DPS A;  2WGS A;  1N3H A;  4ZYS A;  2J0M A;  4C0A A;  2RDG A;  4CQN A;  1FGZ A;  2GUM A;  2BYV E;  4Z2N A;  3PO0 A;  2ZNV C;  5L83 A;  1FFV A;  2CAY A;  1RRP B;  4QAY A;  2KCJ A;  2KC2 A;  1U29 A;  2COF A;  3G9W A;  1VR9 A;  2KDB A;  3MFG A;  3A33 B;  1C4C A;  3JSV A;  1LB1 A;  1WXS A;  3V3X A;  3VVW B;  1BXT A;  3P6A A;  4OW0 A;  5IAA C;  1FXI A;  4BOZ B;  2PTL A;  1IGC A;  4LCD E;  5CHF A;  1WJM A;  1KLU D;  4GNK B;  1AN8 A;  4AUQ C;  1HZ5 A;  5C6R A;  4KHB B;  2IYD B;  3UIP B;  3ZJT A;  3VDZ A;  1WGH A;  5C3J B;  4IW0 A;  3GOE A;  1YN3 A;  3BVZ A;  2W82 A;  2DLW A;  3E56 A;  4E74 A;  2N9K A;  3Q69 A;  2O2V B;  2XN9 C;  3N9Y C;  2ROV A;  1E8Y A;  3L17 A;  4ANV A;  4NJ6 A;  2JZP A;  4JIO U;  3QA8 A;  2L0F A;  3KRW A;  3HRD D;  4MEM A;  2VSZ A;  2CY5 A;  1BWN A;  1NEN B;  3R66 C;  4B0M A;  1V9J A;  3MC0 B;  4C00 A;  3ZRF A;  2D3C A;  1MVK A;  3DVN V;  5EDS A;  1BML C;  2GCJ A;  3AEG B;  4JLC A;  5JH5 C;  1K8R B;  5KQ1 A;  1AYF A;  3LYY A;  3U30 A;  3ZDT A;  2ZW0 A;  1ZC3 B;  1SE9 A;  2BS4 B;  4TSS A;  1DYN A;  2ZKM X;  3BII D;  1UNQ A;  2EMS A;  3TSS A;  2DAJ A;  2G1E A;  3ML8 A;  1Y8R C;  4YWG G;  2V76 A;  2M4N A;  2WU2 B;  3N3K B;  3A9J A;  3RMK C;  2ZEQ A;  5HE0 A;  2AQ3 B;  4EMO A;  1JWA D;  2HD5 B;  5LNK 1;  2KK8 A;  5C16 A;  1F9J A;  5DHA B;  4GIV A;  4QJ4 B;  3DXD A;  1E7V A;  4M0W A;  1K50 A;  4A55 A;  3V6C B;  4MGK E;  1TKE A;  3AEB B;  3APC A;  4Y94 A;  2KAC A;  3IFW B;  3RNA C;  2D9Y A;  2D9X A;  5GXG B;  3CMM B;  3H9D A;  5BYR A;  5AEK B;  1WE7 A;  3RCZ A;  2PMV A;  1WXM A;  3H7P A;  3L4P A;  4W9E A;  1KRH A;  2GBM A;  3VR9 B;  1YMH E;  3SFD B;  4HPL B;  3ZIM A;  3D8E A;  4WJO A;  2Q13 A;  4ZYN A;  3ODO A;  2LAS A;  4OHJ A;  4YON A;  1WGD A;  4LNN A;  2LHD A;  2KVR A;  1XQQ A;  2REX A;  5JP4 A;  5AUK A;  5D6J B;  2KD0 A;  2NBW B;  1YD8 U;  3B08 A;  1WE6 A;  3N7C A;  3ETR A;  2IFS A;  1HTQ A;  1Q5W B;  4IFS A;  1XCT L;  4A3P A;  2KN4 A;  3TEX A;  1PFD A;  2L3Z A;  3FC4 A;  4KKI A;  2IO3 B;  3ENE A;  2KVZ A;  1R4N I;  3AI5 A;  1EWY C;  4JE3 B;  3HUI A;  4FJV B;  3NG0 A;  1FRD A;  2K5P A;  3URY A;  2LMC A;  3QQ8 B;  1JAL A;  3B0A A;  1W1H A;  2C60 A;  4F7U P;  2LWP A;  4DXG A;  3NY5 A;  1RAX A;  5TSS A;  1L0V B;  2DZI A;  2ZPN A;  2FBW B;  3P4Q B;  1VCB A;  2BWE S;  4AP4 C;  4GPT B;  1VD2 A;  3IAM 1;  4GXB A;  4N58 A;  4RNA A;  3CST A;  1YN5 A;  2N1V A;  1DDM A;  3X23 A;  5T8I A;  2G4D B;  4MAC A;  2RRF A;  5DPT A;  3UI3 A;  3HIE A;  1V1O A;  4ACF A;  2WQY B;  1N62 A;  3TEZ A;  4E3C A;  2Z59 B;  3RN9 C;  5G5G A;  2KR0 A;  1EU4 A;  4A20 A;  2MKR A;  2I38 A;  1WGR A;  1IPG A;  3FSS A;  4AQ7 A;  4PS3 A;  2UU7 A;  1TKG A;  2YF0 A;  3NWF A;  4D0N B;  2DNF A;  3GYO A;  3DQV A;  2DN6 A;  3DHH C;  2M56 B;  1WZ3 A;  4AOF A;  2ICI A;  4HVB A;  4EKU A;  4F7G A;  3LXF A;  2KQ4 X;  2LEK A;  2HJ1 A;  4ZOH C;  4GU2 A;  3R8B A;  1C4P A;  1DOY A;  1OQY A;  1WJ1 A;  2LGD A;  2L83 A;  3GS2 A;  2WS3 B;  2MP2 A;  3ODX A;  3PZD A;  1PGA A;  4RGO S;  3NWA A;  3F0W A;  2QIE B;  4I6L B;  2PE6 B;  5CLQ B;  4KDI C;  1RWS A;  4FHK A;  4A90 A;  4MSM B;  5E6N A;  4MJS B;  4FJZ A;  2LOZ A;  1MPH A;  3MP9 A;  2JQR B;  2JYE A;  4B9K A;  2QC8 A;  1E8W A;  3TW1 A;  1JML A;  2KJ6 A;  2KMA A;  2AL3 A;  3AE9 B;  1QOA A;  4DXF A;  3AE3 B;  1S3S G;  4P1B C;  2QIL A;  4GDK A;  1UBI A;  4YTP B;  4AWJ A;  1EF5 A;  3GZN B;  3CIR B;  3QAR A;  1J19 A;  3QK0 A;  3S2A A;  1EAZ A;  2K6D B;  5D3X A;  3A8P A;  3NVW A;  1FNV A;  1PFJ A;  2LI5 A;  2RDB C;  3I57 A;  3MHS D;  1S1Q B;  1HTO A;  2IO2 B;  1L4Z B;  2VKI A;  3UGB B;  2DYQ A;  2A4Z A;  2WLB A;  2D07 B;  3L16 A;  1F52 A;  2KUP A;  2V3N A;  3PGE A;  3VR8 B;  1GUA B;  1TIF A;  1V88 A;  2WDV B;  3I63 C;  1QZE A;  4BKS A;  4EEW A;  3RUI B;  1KFY B;  4USA A;  3PZ7 A;  1XLO A;  2XEW A;  2M8S A;  1I7A A;  2KKC A;  1DDV A;  1QOB A;  2X8X X;  1WRD B;  4G50 A;  4RGN A;  2W55 A;  3AJ4 A;  4OZB A;  5KHO A;  2YEP B;  1N63 A;  2FIF A;  1N5X A;  1QKZ A;  4NNJ B;  1TT5 B;  3ZDM C;  4OSN A;  4DQO C;  4JL9 A;  2INC C;  2I1J A;  3HHM A;  1KM7 A;  2N7J A;  2K8E A;  3NZS A;  2DHI A;  1ZXI A;  1WG7 A;  2DX5 A;  2E6X A;  3BY4 B;  3DXE A;  5C79 A;  3PS6 A;  4XZ4 A;  5JLJ B;  1JRU A;  1TJE A;  1XLP A;  1UBQ A;  1VZ8 A;  4FJY A;  4CO7 A;  2WWZ A;  4WAF A;  1FOE A;  4ZHO A;  2CY4 A;  2ZJD A;  4BBK A;  1HXY D;  1CK1 A;  3PVW A;  1T0Q C;  3P7Z A;  2LVO A;  2QEJ C;  5LLI A;  5D3Y A;  3RD2 A;  3SFE B;  1WX9 A;  2KXJ A;  3KWV A;  4M00 A;  4D6W A;  2BS3 B;  2EJ8 A;  1T77 A;  2DLB A;  3DBR I;  4A6Q A;  2HDE A;  3APF A;  2PJH A;  4M8M A;  1V1P B;  1TXD A;  3BIN A;  4II2 B;  3DXC A;  1STE A;  3E9S A;  2N0S B;  2FJL A;  2Z14 A;  4PS7 A;  2L52 A;  5JHA A;  2W54 A;  4ARC A;  3M3J A;  1X11 A;  2VH2 A;  1OFF A;  1RFK A;  3VH3 B;  2HTH A;  3C19 A;  4GDL A;  1ZGU B;  2LUL A;  2L1A A;  4MGI E;  2KTR B;  2JX5 A;  2FCQ A;  3CWI A;  3RNG C;  1M94 A;  4GZU A;  1QOG A;  3WIM A;  1XEE A;  2G3Q B;  2MW5 A;  1JW9 D;  1UGM A;  3NZU A;  1VLB A;  4KGR A;  3F5R A;  1BT0 A;  1WM3 A;  3IT6 B;  4LNI A;  3AEE B;  4G3X B;  2KO3 A;  3FIL B;  2BVC A;  1B9R A;  4KSK C;  1C79 A;  3DHG C;  4MDK E;  3DHI C;  1TS2 A;  1TZO A;  4URK A;  1Y5O A;  1U2B A;  4GMX B;  3ZLZ A;  1D5X C;  2GMI C;  2Z0E B;  3BK1 A;  1NEK B;  3EEC A;  2WDQ B;  2IY0 B;  3U7Z A;  2L2I A;  2H7E A;  2YS5 A;  1IBX B;  1KJT A;  2ZVN A;  3VHT C;  3VRA B;  5G5H A;  1I4R A;  2IND C;  5HHD G;  2GRI A;  4AS1 A;  1U5G A;  3OAN A;  3CF6 E;  4GGQ A;  4HAU B;  3GYP A;  3R2T A;  3P4S B;  2K3U A;  2KOX A;  3VRB B;  1L0X B;  2M0X A;  3W1S A;  5LOP B;  2C7M B;  2MBB B;  1EWC A;  4JWU C;  3IG3 A;  1F2R I;  1KLV A;  2IO0 B;  3D8F A;  4XWT A;  1UNS A;  1SJH D;  2NPT B;  3PT2 B;  3ZJV A;  3T8M A;  4MK0 A;  3PRE A;  1LXD A;  4QJ5 B;  4YL8 A;  2EKI A;  3RT3 B;  2QCZ A;  4AJY B;  1WJU A;  2G4S A;  1OY2 A;  1KH0 A;  1SSN A;  3AEA B;  5D94 A;  2LKO A;  4KV2 A;  3DBH I;  2FCM A;  2DYO A;  5J3Q A;  1ZM0 A;  3RNE C;  1ZE3 D;  1MIZ B;  3LB8 C;  4C7Y A;  3CXB B;  2K8B A;  4WWM A;  4PQ0 A;  2KDI A;  3VOQ A;  1IRS A;  5H8Y E;  1FD6 A;  1FHW A;  2RUK B;  3DDC B;  4II3 B;  3ZNZ B;  2VZK D;  2QJL A;  3KUC B;  1U5F A;  4PNK A;  1FRR A;  1F2R C;  2D5G A;  4IKG A;  4FLH A;  3AXC A;  2XNA C;  1EO6 A;  3AEC B;  2JXT A;  4HHV A;  1UZX B;  4Z2M B;  3W1S C;  1J7C A;  2MX2 A;  2DBY A;  2L32 A;  4DWF A;  1WYG A;  2DYN A;  3ZRC A;  2KDM A;  4HAZ B;  1CJE A;  2VRW B;  4JX1 C;  2GJY A;  4NJC A;  3RNC C;  1XOD A;  2MWN B;  4TKN A;  4B95 A;  1YN4 A;  2K0P A;  2LGX A;  3QCA A;  1YJ1 A;  2DZJ A;  4GOU A;  2K22 A;  4JGH B;  1GOZ A;  2CS4 A;  5IRS A;  3ODW A;  2JZ3 B;  2G45 B;  1XO3 A;  4PYZ A;  5HE1 A;  5E6P A;  3APD A;  1P7E A;  4FHJ A;  2LZ6 A;  1ZXH A;  1OEY A;  4OVV A;  2NBV A;  2J42 A;  1C3T A;  4MM3 A;  4KX6 B;  4KAX B;  3DVG X;  1MHX A;  5KCV A;  1ZOY B;  5I2M A;  1TZ1 A;  2K1F A;  3ZNI D;  2FCN A;  5G2N A;  4DX9 0;  2VH1 A;  1VRA B;  3ML9 A;  1AWE A;  1YIW A;  2M0A A;  4W9G A;  1PUT A;  4HAV B;  2O6V D;  2JP2 A;  4NY0 A;  4WSF A;  1P9D U;  2RGN B;  1PLS A;  1UWX A;  5D3D A;  3MDB C;  5GOW B;  3NS1 A;  2MQJ A;  2KWD A;  5CTR C;  2GBN A;  2GOW A;  2OQB A;  3A1Q B;  1GB4 A;  2W2X C;  1ZPS A;  2MBE A;  3PRP B;  4B6H A;  4J6I A;  4P1C C;  2L8J A;  2RMM A;  1GC6 A;  2FCS A;  3PVL A;  2W9N A;  2JVC A;  4F7H A;  4YT0 B;  3VFK A;  2K00 A;  4KHB A;  2CKH B;  5C5B B;  1LW3 A;  4IDI A;  2JWZ A;  4HCN B;  2NMQ A;  4L1B A;  4ZRJ A;  4HSI A;  1GAQ B;  4EZK A;  5JXV A;  4DHZ E;  3GE8 C;  4EE2 A;  1DOX A;  3HVD A;  4TMA B;  2ELB A;  1L6U A;  2ROZ B;  2WX0 A;  2DZK A;  1H4R A;  3NZ3 A;  2NS5 A;  2R61 A;  2LGS A;  3HM3 A;  4CHK A;  2N4F A;  3OG5 A;  5D3I B;  1WJ6 A;  2LRU A;  1ZDX A;  2PLP A;  1WGG A;  5EFX A;  2MBQ A;  4LTU A;  1YJJ A;  3AE7 B;  3AH7 A;  5CLL B;  1UF0 A;  2KQS A;  2K2U A;  3SV1 A;  4WJ7 A;  4L6E A;  5LXH A;  3QWM A;  3AMZ A;  2JRH A;  3DPD A;  1Q10 A;  2KMC A;  1P6S A;  4W9K A;  1HE8 A;  1V86 A;  1FHO A;  2PW9 A;  3I5J C;  1NYQ A;  4WWP A;  3LJ3 A;  3UQB A;  2BGF A;  4QJ3 B;  2DHZ A;  5HFY A;  2N9P C;  3M63 B;  1WH3 A;  4H2A A; 
#chains in the Genus database with same CATH homology
 2MRP A;  1IP9 A;  1Z2M A;  2DYM A;  2L0T A;  2X18 A;  4NPN A;  2I5F A;  4DX8 A;  1MK7 B;  3RYT A;  4WVF B;  1LFD A;  2XK5 B;  1ZVR A;  2MFQ A;  1OEY J;  3HIZ A;  1XD3 B;  2ZPY A;  1WXA A;  3PSE B;  4F1S A;  4K7W A;  3M62 B;  5AZH A;  1PQS A;  5JHG A;  4KDL B;  4ANW A;  3UQA A;  4A6K A;  4KHO A;  1P98 A;  4I6N B;  2KFK B;  4PS8 A;  3MJW A;  1U4A A;  2KNB A;  3ECI A;  4LJO B;  1P0R A;  1UEL A;  2GS0 A;  2MWS B;  3ZKJ C;  1UNP A;  1UD7 A;  2OTX A;  2DX1 A;  2D11 A;  2WX1 A;  4EZJ A;  1TQZ A;  3Q3F A;  3A9J B;  4IUM B;  4FN2 A;  2D3G A;  3Q3J A;  4BKT A;  2KAN A;  2DA0 A;  2PE9 A;  3SD5 A;  2R09 A;  4M0W B;  1J8C A;  1XKE A;  2JPH A;  1DRO A;  2BKF A;  2KWC A;  3OJ4 B;  5LXI B;  3L08 A;  2UZR A;  4MEL A;  4NAW B;  2LXC A;  3LJU X;  2DZM A;  3K9P B;  2R2O A;  3DVG Y;  1P5T A;  3FM8 C;  3VQI A;  3CSF A;  4KIK B;  1FGY A;  2N7D A;  2MLB A;  1NTY A;  2JT4 B;  4ASW C;  4HJK A;  2CU1 A;  1V5T A;  2ZCC A;  1X05 A;  1P1A A;  1V5P A;  3I3T B;  5JHH A;  2RGF A;  2RPQ A;  4MJS A;  1E7U A;  3V61 A;  2EC1 A;  3KW5 B;  4G11 A;  1SGH A;  2GBR A;  5J3T A;  3KSY A;  1T0Y A;  3SU8 X;  2DAF A;  4LDT D;  3QBV B;  5DIF B;  3QJZ A;  3DOW A;  2ADZ A;  2KX3 A;  1RLF A;  3A4S C;  1WVH A;  1YX6 B;  3IBE A;  3PLU A;  2FNJ B;  2JY6 A;  1YX5 B;  4XWX A;  3PLV A;  3GZN I;  3UIO B;  4EUT A;  3KY9 A;  2V1Y A;  2N1W A;  1X86 A;  1E90 A;  3TFM A;  2RNR B;  3N32 A;  1DDW A;  2P0D A;  4HB0 B;  4A6F B;  4BKS D;  1Z87 A;  4HAW B;  2YS3 A;  3PSC A;  3VAW A;  5FI1 A;  3CIK A;  1ZW7 A;  4DHJ D;  2VRR B;  4KSL C;  2N9E B;  2D9V A;  4OVU A;  3H6N A;  5L81 A;  1WGU A;  2MA9 B;  1X1F A;  3DVN U;  3V6E B;  1NBF C;  5FI0 A;  4TQ0 A;  4DHZ B;  2BYE A;  1V61 A;  1V5M A;  4TQ1 A;  1C1Y B;  2MBO A;  3DBS A;  2K8H A;  2BWF A;  1U5E A;  2J0K A;  1WMH B;  4WJP A;  3QWZ B;  3PP2 A;  4FBJ B;  2ASQ A;  3IHP C;  5E6O A;  4LJP B;  4HAX B;  1PMS A;  3K9O B;  1BTN A;  4GDK B;  5D7G A;  2W2W A;  3H7S A;  5TR5 A;  4HCP B;  1OMW A;  5J17 A;  3JYU A;  2KDE B;  4HAY B;  2GCL A;  3EHV A;  3R3M A;  2NMB A;  2K2J A;  4HK2 A;  2KTR A;  3HW2 B;  4EOY A;  3TCA A;  2DHK A;  2KTF A;  2LYD A;  2D9W A;  2AYO B;  1DBH A;  4KZC A;  2NVU I;  1X1M A;  4I6P A;  2Z0Q A;  2A5U A;  2NZ8 B;  1XX0 A;  2G35 A;  4W9H A;  2IO1 B;  3ULB A;  1RFA A;  2DX5 B;  1MK9 B;  2OOB B;  4MGZ E;  2EKE C;  1XT9 B;  4F8C B;  4W9J A;  2E2X A;  3V60 A;  1Z5S B;  4IWO A;  1Q0W B;  4ICU A;  3LDZ E;  4HDQ A;  3RZF A;  3U8Z A;  2DKP A;  1LQB A;  1WXV A;  3PTF C;  2GBJ A;  1WGY A;  3NS8 A;  2NPT A;  2DFK A;  1UNR A;  4WJQ A;  2GBK A;  2KJR A;  3DCG A;  2HTH B;  2NR2 A;  4HLE A;  4DK5 A;  4AJW A;  3SNH A;  4WQO B;  2I1K A;  1OGW A;  2Y5B B;  4IWP A;  5C23 A;  5D27 A;  2BCJ A;  2H7D A;  2NCN A;  2LGY A;  5BO4 B;  3ZTD A;  2WYQ A;  2AL6 A;  1EUV B;  2COC A;  2COA A;  3UF8 A;  2V4L A;  1RJ2 A;  1XR0 B;  5HE2 A;  2C5L C;  3VUX A;  3L0W B;  2RSG A;  2W2X D;  3ULC A;  5L95 C;  1WF9 A;  1A5R A;  2KWU B;  1I35 A;  1FB8 A;  2CR5 A;  3PPA A;  3WAO A;  3EFU A;  1ZSQ A;  1FXT B;  4ZRK A;  3H1U A;  3IVF A;  3A9K B;  2UVM A;  3AU4 A;  4GN1 A;  1SIF A;  2XQN M;  4KHA A;  3VTU A;  1MAI A;  3PHW B;  4A6H A;  3QAQ A;  1U27 A;  3VUY A;  3A8Q A;  2L76 A;  1UPR A;  4W9C A;  3PHX B;  3L10 B;  1V5U A;  5AZG A;  2C9W B;  4DDG D;  5DH9 B;  5D2M B;  4BBN F;  2Y8F A;  3A1Q A;  4B6W A;  2DTC A;  4XX5 A;  5J18 A;  3PEG A;  1X1G A;  2BKR B;  3RZW C;  2NBU A;  1WI0 A;  3C0R B;  5C5B A;  3VH4 B;  3VIA A;  5JHB A;  4IM0 A;  1UPQ A;  4HB3 B;  3WAM A;  2Z0O A;  3ALB A;  4MSQ B;  2ZNV B;  1WI1 A;  3OAW A;  1FHX A;  1K5G B;  1KOT A;  4EJN A;  4DXA B;  1KZ7 A;  4N9F 4;  1TJ6 A;  4GOC A;  1B55 A;  2KX0 A;  2K25 A;  2PZ1 A;  2RD0 A;  1BAK A;  1MKE A;  1TGZ B;  1WGQ A;  2O2V A;  4ANX A;  1UEF A;  2QKM A;  1V2Y A;  4K7U A;  4H8S A;  3ZTC A;  2CRF A;  4EZL A;  1NTV A;  3MTN B;  2M38 A;  2V3S A;  2IBI B;  3P2B A;  2O6V B;  4FUL A;  4KVG B;  3ML4 A;  2IYB A;  1L2N A;  4TV3 A;  3SYX A;  1L7Y A;  2Y8G A;  2QHO A;  2YVC A;  2XK5 A;  2PPH A;  2CHZ A;  3T06 A;  5HE3 A;  2UYZ B;  3JW0 X;  3PVU A;  3JSV B;  5GMV A;  2COD A;  1SHC A;  2KFK A;  4A5K A;  2J7Q B;  1TBE A;  2J0J A;  4HDO A;  1V80 A;  2JZZ A;  4IAP A;  2LVP A;  5CHW A;  2CHX A;  1WX7 A;  1MIX A;  4NQK E;  2KLC A;  4RM8 A;  2PEA A;  3X0W A;  1RRB A;  4A3O A;  4MGY E;  5C1Z A;  4GMV A;  3NSU A;  3KVF B;  4PYU A;  2DYB A;  4WWO A;  3WAP A;  3MPX A;  1WR6 E;  4K17 A;  4NAW A;  2B3A A;  4DBB A;  3W1Y A;  2YT1 A;  2IY1 B;  1W1G A;  2R2Q A;  4KIK A;  4IC7 B;  1EVH A;  1H8C A;  2RR9 A;  1YQB A;  5DPR A;  3KH0 A;  2D10 A;  3PRZ A;  1WZ0 A;  3JVZ X;  1MG8 A;  3H7P B;  1M7R A;  1KI1 B;  3HM6 X;  4IM2 A;  2ZCB A;  1WIA A;  4BKG A;  4GSW A;  3UZT A;  5AZF A;  3TO1 A;  1I42 A;  3PV1 A;  2R0D A;  3WYF B;  1LM8 B;  2BF8 B;  3QHT A;  4GB9 A;  2LD9 A;  4IWQ A;  5DCN A;  1QC6 A;  4W9F A;  2QKL A;  2MCN B;  2AEH A;  1GJZ A;  2N7E A;  2UWQ A;  1V49 A;  2N23 A;  2P8V A;  3PG7 A;  3EC8 A;  2RVB B;  3TIX A;  1U5D A;  1TTN A;  3ZW3 A;  1WJN A;  3A98 B;  4A6F A;  4BBN C;  2YSZ A;  1AQC A;  3VXW A;  3ZVR A;  5HKH A;  3WA0 A;  4HAT B;  3TBL D;  2MDX A;  5LON B;  2DHJ A;  2LXA A;  4MH0 E;  2N0Y A;  2HJ8 A;  4WAA A;  3SHQ A;  2I5C A;  2D9Z A;  3TL5 A;  2JUO A;  1E8Z A;  5JZE B;  2M14 A;  1W1D A;  2KGX B;  2LUE A;  2KJH B;  1WMH A;  2C7N B;  4W9I A;  4E71 A;  1G6J A;  2MP2 B;  2HE7 A;  3NHE B;  4K1R B;  3SUZ A;  3QX1 A;  1ISN A;  1QQG A;  5J2R A;  2BYF A;  3ZVV A;  2WDT B;  2FUH B;  2K6Q A;  2KWV B;  3O65 B;  4KZ0 A;  3V5W A;  4W9D A;  5CHV C;  2DEN B;  3RCP A;  1WFY A;  4LDT B;  5DHF B;  5FR6 A;  2FID A;  2KLG A;  4ZRI A;  1M7E A;  2FAZ A;  4XC2 A;  3QIJ A;  3V62 A;  3SO6 A;  5CX3 A;  4P7I A;  2C7H A;  4ICV A;  1IYF A;  2XBB C;  4RM9 A;  1WYW B;  4BFR A;  4CHJ A;  2YRY A;  3RUL A;  3TMP B;  4NJ7 A;  2L1C A;  4DDI D;  1EGX A;  4G0N B;  3D8D A;  1NU2 A;  2AWT A;  2ZVO A;  3L13 A;  2YT0 A;  3VUW A;  4FAD A;  5KQ4 A;  2L05 A;  1P3R A;  4F7Z A;  2DKQ A;  3R7R A;  4K81 A;  3OLM D;  4DHJ B;  1R4M I;  2K39 A;  2K8C A;  4WWN A;  4EFO A;  2KDF B;  1BTK A;  2YS1 A;  5J3Y A;  2KFJ A;  4IOY X;  1WY8 A;  2BPS A;  2RLO A;  1I2H A;  1XD4 A;  4ANU A;  1NI2 A;  3QC8 B;  2LG1 A;  3DBL I;  1Q67 A;  4NQL B;  3KYC D;  3T9L A;  4MT7 A;  4CYE A;  4M8N A;  2Y7B A;  3SDL C;  2MSE D;  4TYZ A;  2P0F A;  3N30 A;  1NDD A;  3WAL A;  2Z0D B;  4ZDV A;  1K5D B;  4GDL B;  2P0H A;  1V5O A;  2JF5 A;  4W9L A;  2M1M A;  4K7S A;  2RSU A;  1XCG A;  3ZO5 B;  1WX8 A;  3KZ1 A;  3L54 A;  2LRW A;  4K2P A;  1H10 A;  4HB4 B;  4IM3 A;  3M95 A;  4WJN A;  2JRI B;  3TVV A;  3O96 A;  1Y19 B;  5DPW A;  1WJ4 A;  3ONS A;  1ZKH A;  5KHQ A;  3U7D A;  1V81 A;  3AU5 A;  3BJI A;  1E8X A;  2EMT A;  3KUZ A;  1UH6 A;  4NSW A;  1V6E A;  2L00 B;  2Z0P A;  2LVQ A;  3NOB A;  1J0G A;  1OTR B;  1J0W A;  4CHM A;  1E5W A;  2D4Q A;  3A9K A;  2D2Q A;  3OJ3 A;  4K2O A;  3VTW A;  1CMX B;  4HWI B;  4JQW C;  1V89 A;  5DI9 B;  3TJP A;  2MBH A;  2ZZP B;  4FA6 A;  2LJ5 A;  3VTV A;  1OQN A;  4IG7 B;  2KC1 A;  3ZNH B;  5D3V A;  2LOX A;  1AAR A;  4HB2 B;  3R7Q A;  3B1L X;  4HPM B;  1P3Q U;  2L7R A;  3KRX A;  4RMA A;  3KYD D;  1Q1O A;  4BOS C;  4MY6 A;  5G55 A;  1KZG A;  4DBG A;  2OJR A;  2KQ7 A;  2M17 A;  2IZV B;  1EF1 A;  1WR1 A;  3ZNG C;  3ZUN A;  2ELA A;  2CHW A;  5IA7 A;  1GG3 A;  4TUU A;  5D3W A;  3M1I B;  2KZR A;  3PRM B;  4X57 B;  1FAO A;  2JXX A;  1WM2 A;  3HK0 A;  2J59 M;  2KHW B;  2KN5 A;  1GC7 A;  3A4R A;  3D32 A;  2N9X A;  2UZS A;  4HXD A;  1D3Z A;  4BVU C;  2NBV B;  2YLM A;  3AUL A;  3KUD B;  3HQC A;  3FEH A;  1ZC4 B;  3WAN A;  1GNU A;  2O6V A;  3UIN B;  5DPS A;  1N3H A;  2J0M A;  4C0A A;  1FGZ A;  2BYV E;  4Z2N A;  2ZNV C;  5L83 A;  2CAY A;  1RRP B;  2KCJ A;  2KC2 A;  1U29 A;  2COF A;  3G9W A;  2KDB A;  3A33 B;  3JSV A;  1LB1 A;  1WXS A;  3VVW B;  3P6A A;  5IAA C;  4BOZ B;  4LCD E;  5CHF A;  1WJM A;  4AUQ C;  5C6R A;  4KHB B;  2IYD B;  3UIP B;  3VDZ A;  1WGH A;  4IW0 A;  3GOE A;  2DLW A;  4E74 A;  2O2V B;  2ROV A;  1E8Y A;  3L17 A;  4ANV A;  4NJ6 A;  4JIO U;  3QA8 A;  2L0F A;  3KRW A;  4MEM A;  2VSZ A;  2CY5 A;  1BWN A;  3R66 C;  1V9J A;  3ZRF A;  3DVN V;  5EDS A;  2GCJ A;  4JLC A;  5JH5 C;  1K8R B;  5KQ1 A;  3U30 A;  3ZDT A;  1ZC3 B;  1SE9 A;  1DYN A;  1UNQ A;  2EMS A;  2DAJ A;  3ML8 A;  1Y8R C;  2V76 A;  2M4N A;  3N3K B;  3A9J A;  2ZEQ A;  5HE0 A;  4EMO A;  2HD5 B;  2KK8 A;  5C16 A;  1F9J A;  5DHA B;  4GIV A;  3DXD A;  1E7V A;  3V6C B;  4MGK E;  3APC A;  4Y94 A;  3IFW B;  2D9Y A;  2D9X A;  3CMM B;  3H9D A;  5AEK B;  1WE7 A;  3RCZ A;  3H7P A;  1WXM A;  4W9E A;  2GBM A;  4HPL B;  3ZIM A;  3D8E A;  4WJO A;  2Q13 A;  4ZYN A;  3ODO A;  2LAS A;  4YON A;  1WGD A;  2KVR A;  1XQQ A;  2REX A;  5JP4 A;  5D6J B;  2KD0 A;  2NBW B;  1YD8 U;  3B08 A;  1WE6 A;  3N7C A;  2IFS A;  1Q5W B;  4IFS A;  4A3P A;  2L3Z A;  2IO3 B;  3ENE A;  1R4N I;  3AI5 A;  4FJV B;  3QQ8 B;  3B0A A;  1W1H A;  2C60 A;  4F7U P;  2LWP A;  3NY5 A;  1RAX A;  2DZI A;  2ZPN A;  1VCB A;  2BWE S;  4AP4 C;  4GPT B;  1VD2 A;  4GXB A;  3CST A;  2N1V A;  1DDM A;  3X23 A;  2G4D B;  5DPT A;  4E3C A;  2Z59 B;  4A20 A;  2MKR A;  1WGR A;  1IPG A;  3FSS A;  4PS3 A;  2YF0 A;  4D0N B;  3GYO A;  3DQV A;  2DN6 A;  1WZ3 A;  4AOF A;  4HVB A;  4EKU A;  4F7G A;  4GU2 A;  1OQY A;  1WJ1 A;  2LGD A;  2MP2 A;  3ODX A;  3PZD A;  3F0W A;  4I6L B;  2PE6 B;  5CLQ B;  4KDI C;  4FHK A;  4MSM B;  5E6N A;  4MJS B;  4FJZ A;  2LOZ A;  1MPH A;  4B9K A;  1E8W A;  3TW1 A;  2KJ6 A;  2KMA A;  2AL3 A;  1S3S G;  4GDK A;  1UBI A;  4AWJ A;  1EF5 A;  3QAR A;  1J19 A;  3QK0 A;  3S2A A;  1EAZ A;  2K6D B;  5D3X A;  3A8P A;  1PFJ A;  2LI5 A;  3MHS D;  1S1Q B;  2IO2 B;  2VKI A;  3UGB B;  2DYQ A;  2A4Z A;  2D07 B;  3L16 A;  2KUP A;  3PGE A;  1GUA B;  1V88 A;  1QZE A;  4BKS A;  4EEW A;  3RUI B;  2XEW A;  2M8S A;  1I7A A;  2KKC A;  1DDV A;  1WRD B;  4G50 A;  3AJ4 A;  5KHO A;  2FIF A;  4NNJ B;  3ZDM C;  4JL9 A;  2I1J A;  3HHM A;  1KM7 A;  3NZS A;  2DHI A;  1WG7 A;  2DX5 A;  3BY4 B;  3DXE A;  5C79 A;  3PS6 A;  4XZ4 A;  5JLJ B;  1JRU A;  1UBQ A;  4FJY A;  4CO7 A;  2WWZ A;  1FOE A;  2CY4 A;  2ZJD A;  4BBK A;  3PVW A;  3P7Z A;  2LVO A;  5LLI A;  3RD2 A;  5D3Y A;  1WX9 A;  2KXJ A;  2EJ8 A;  3DBR I;  3APF A;  2PJH A;  4M8M A;  1TXD A;  3BIN A;  4II2 B;  3DXC A;  2FJL A;  4PS7 A;  5JHA A;  3M3J A;  1X11 A;  3VH3 B;  2HTH A;  4GDL A;  1ZGU B;  2LUL A;  4MGI E;  2KTR B;  2FCQ A;  1M94 A;  4GZU A;  3WIM A;  2G3Q B;  2MW5 A;  1UGM A;  3NZU A;  3F5R A;  1BT0 A;  1WM3 A;  4G3X B;  2KO3 A;  4KSK C;  4MDK E;  4URK A;  1Y5O A;  1U2B A;  4GMX B;  3ZLZ A;  2GMI C;  2Z0E B;  3EEC A;  2IY0 B;  2L2I A;  2H7E A;  2YS5 A;  1KJT A;  2ZVN A;  3VHT C;  1U5G A;  3OAN A;  3CF6 E;  4GGQ A;  4HAU B;  3GYP A;  2KOX A;  2M0X A;  3W1S A;  5LOP B;  2C7M B;  2MBB B;  3IG3 A;  1KLV A;  2IO0 B;  3D8F A;  2NPT B;  3PT2 B;  3T8M A;  4MK0 A;  3PRE A;  1LXD A;  4YL8 A;  3RT3 B;  4AJY B;  1WJU A;  2G4S A;  1OY2 A;  5D94 A;  2LKO A;  4KV2 A;  3DBH I;  2FCM A;  2DYO A;  5J3Q A;  1ZM0 A;  1MIZ B;  3CXB B;  2K8B A;  4PQ0 A;  2KDI A;  3VOQ A;  1IRS A;  1FHW A;  2RUK B;  3DDC B;  4II3 B;  3ZNZ B;  3KUC B;  1U5F A;  4PNK A;  4FLH A;  3AXC A;  1EO6 A;  4HHV A;  1UZX B;  4Z2M B;  3W1S C;  2MX2 A;  4DWF A;  2DYN A;  3ZRC A;  4HAZ B;  2VRW B;  2GJY A;  1XOD A;  2MWN B;  4TKN A;  4B95 A;  2LGX A;  3QCA A;  1YJ1 A;  2DZJ A;  4JGH B;  2CS4 A;  3ODW A;  2JZ3 B;  2G45 B;  4PYZ A;  5HE1 A;  5E6P A;  3APD A;  4FHJ A;  2LZ6 A;  1OEY A;  4OVV A;  1C3T A;  4MM3 A;  4KAX B;  3DVG X;  5KCV A;  1TZ1 A;  2K1F A;  3ZNI D;  2FCN A;  5G2N A;  4DX9 0;  3ML9 A;  1AWE A;  4W9G A;  1YIW A;  4HAV B;  2O6V D;  2JP2 A;  4NY0 A;  4WSF A;  1P9D U;  2RGN B;  1PLS A;  3MDB C;  5GOW B;  2MQJ A;  5CTR C;  2GBN A;  2GOW A;  2OQB A;  3A1Q B;  2W2X C;  2MBE A;  3PRP B;  4B6H A;  4J6I A;  2L8J A;  1GC6 A;  2FCS A;  3PVL A;  2W9N A;  2JVC A;  4F7H A;  3VFK A;  2K00 A;  2CKH B;  5C5B B;  1LW3 A;  2JWZ A;  4HCN B;  4ZRJ A;  4EZK A;  4DHZ E;  2ELB A;  2WX0 A;  2ROZ B;  2DZK A;  1H4R A;  4CHK A;  2NS5 A;  3HM3 A;  2N4F A;  1WJ6 A;  2LRU A;  1WGG A;  5EFX A;  2MBQ A;  5CLL B;  2KQS A;  2K2U A;  3SV1 A;  4WJ7 A;  4L6E A;  5LXH A;  3QWM A;  2JRH A;  3DPD A;  2KMC A;  1P6S A;  4W9K A;  1HE8 A;  1V86 A;  1FHO A;  4WWP A;  3LJ3 A;  3UQB A;  2BGF A;  2DHZ A;  2N9P C;  3M63 B;  1WH3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...