2LOZA

The novel binding mode of dlc1 and tensin2 ptb domain
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
147
structure length
147
Chain Sequence
MSTAADLLRQGAACSVLYLTSVETESLTGPQAVARASSAALSCSPRPTPAVVHFKVSAQGITLTDNQRKLFFRRHYPVNSITFSSTDPQDRRWTNPDGTTSKIFGFVAKKPGSPWENVCHLFAELDPDQPAGAIVTFITKVLLGQRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Tensin-like C1 domain-containing phosphatase
publication title Solution structure of the PTB domain of human Tensin2 in complex with deleted in liver cancer 1 (DLC1) peptide reveals a novel peptide binding mode
doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase activator
total genus 25
structure length 147
sequence length 147
ec nomenclature ec 3.1.3.-:
pdb deposition date 2012-01-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08416 PTB Phosphotyrosine-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2lozA00
4MT7A 1OQNA 2ROZB 5KCVA 1LW3A 5J3QA 1RJ2A 4IOYX 1FB8A 3AU5A 4KHBB 5GOWB 2BCJA 2COCA 4HAUB 3FM8C 3WYFB 4HHVA 1X05A 1X1GA 2MWNB 2QKMA 1QC6A 5C5BB 3KSYA 1MAIA 2YRYA 3ODXA 5DIFB 5D3WA 2E2XA 1V5UA 2ZPYA 2DFKA 3IVFA 2RVBB 1I7AA 4DBBA 1XR0B 3X23A 1Z87A 3PZDA 1EGXA 1XCGA 2L2IA 4ZRKA 1Q67A 2ELAA 1U29A 1U5EA 4NSWA 4DXAB 2R0DA 2DLWA 2P8VA 4EMOA 1MIZB 1MKEA 4K17A 5FI0A 4F7GA 2KUPA 1AQCA 3F5RA 5CLQB 1DYNA 1Y19B 3ULCA 1UNRA 4WVFB 2NMBA 2LYDA 1ZVRA 1P5TA 1N3HA 3ODWA 2CY5A 3KY9A 2J0KA 2GJYA 1WGUA 1MIXA 2CY4A 1U5FA 4MY6A 3RCPA 2EC1A 2J59M 2Z0QA 1FHWA 4HB4B 2EMTA 1V5PA 2ELBA 4CHMA 2CODA 2Q13A 3O96A 2H7EA 5JLJB 1WG7A 3HW2B 1IRSA 1W1DA 3LJUX 2RLOA 4YL8A 2HE7A 3BINA 1ZM0A 4GPTB 5DH9B 4A6FA 1H4RA 3BJIA 3VOQA 4Y94A 3PVUA 3MPXA 1OY2A 2K2UA 3PVWA 1J0WA 2COAA 1P6SA 2I5CA 1EAZA 4L6EA 3DXCA 5LONB 3GYPA 1XODA 2J0MA 5D3VA 1WGQA 3SUZA 1OMWA 3P7ZA 2I5FA 3TFMA 2OTXA 3KRXA 2QKLA 2K00A 2NZ8B 2IYBA 1TQZA 1UNQA 1GC7A 3WA0A 1WJMA 4GXBA 4K81A 1M7EA 2D9XA 1GC6A 2DX1A 1NTYA 2D9ZA 4KHOA 2IFSA 2DA0A 2VSZA 1M7RA 3ZVRA 1SHCA 2W2XC 3PG7A 1NTVA 1B55A 3ZDTA 2L1CA 1UNPA 3AU4A 5CLLB 3SV1A 4C0AA 2VRWB 1GG3A 3PVLA 3GYOA 2LKOA 1UEFA 2PZ1A 1Y5OA 2LOZA 3HK0A 1FGZA 2MKRA 2G35A 1U27A 3DXEA 4H8SA 2OQBA 2Z0OA 4NY0A 5HE2A 1DBHA 4HB3B 4Z2NA 3PEGA 2R09A 2D9VA 5J3TA 1DDWA 1FAOA 3OANA 5L81A 1DDVA 5D3YA 4EJNA 4HATB 1V88A 1I2HA 2EJ8A 1X11A 2HTHB 3A98B 5LOPB 2ROVA 3SO6A 1BTKA 3TW1A 4KAXB 5JHHA 2LULA 3ULBA 5D3XA 1AWEA 2DYNA 5DHAB 1P3RA 5EFXA 3D8EA 1X86A 3A8QA 3FEHA 4HAVB 4A5KA 1XX0A 2GS0A 2YSZA 4F7HA 1PMSA 1K5GB 2P0DA 1WI1A 4HDQA 4ZRJA 2FJLA 3HQCA 1W1HA 1MPHA 4BBKA 4DX8A 2COFA 4WJ7A 4P7IA 4HB0B 2CRFA 4MK0A 1UPQA 5C79A 1FGYA 3T06A 4K2PA 3VIAA 4IFSA 1ZSQA 5HE1A 2UZSA 3PP2A 1U5GA 3SNHA 1U2BA 2RUKB 4HB2B 2UZRA 1H10A 2DYQA 2D4QA 3CXBB 2YT1A 4A6FB 2GCJA 1EF1A 1SGHA 3NSUA 3QWMA 2ADZA 4Z2MB 2JP2A 3SYXA 2I1JA 1KI1B 4K2OA 2DKQA 5JP4A 4IAPA 3TO1A 3D8DA 4PQ0A 5KQ4A 3CIKA 1UPRA 2GCLA 5C5BA 2LG1A 3QBVB 3TVVA 2KGXB 3TCAA 5D27A 1WJ1A 1XD4A 1V89A 4KHAA 4DX90 2RSGA 4HAYB 2DHKA 1WVHA 3MDBC 4F7UP 3P6AA 4TKNA 2AL6A 2Y8GA 1V5MA 3ODOA 1BAKA 3DXDA 5KQ1A 1X1FA 2YT0A 1MK7B 1MK9B 2YS3A 1KZ7A 1FOEA 2D2QA 3QIJA 3U7DA 4TYZA 3N7CA 1FHXA 4B6HA 4GMXB 4CYEA 1FHOA 1DDMA 2D9YA 5DHFB 2DTCA 2EMSA 1RRPB 2H7DA 4EKUA 2DKPA 2KCJA 2V76A 3ML4A 1PFJA 2M14A 4WSFA 5C6RA 2XQNM 3KZ1A 1BWNA 1E5WA 2VKIA 2J0JA 2DHIA 1LB1A 2DX5A 2CAYA 2YVCA 5HE0A 2K2JA 2M38A 1TXDA 1K5DB 2YS1A 2LOXA 1V61A 1ISNA 2X18A 4ZRIA 4HAZB 2YS5A 2DN6A 2W2WA 4HDOA 4GN1A 4D0NB 4XWXA 2DHJA 2MFQA 5C16A 3AJ4A 4HAWB 3KRWA 2N23A 1KZGA 2RNRB 4HAXB 2MDXA 1ZC3B 1NU2A 4GZUA 5JHGA 1J19A 4A6KA 4YONA 3A8PA 3F0WA 3FSSA 3G9WA 5J3YA 5FI1A 2YF0A 5HE3A 2Z0PA 1PLSA 1DROA 2RGNB 3UZTA 1ZC4B 2AEHA 2P0FA 3PSCA 2I1KA 4CHJA 1TJ6A 2UVMA 2P0HA 2Y8FA 2D10A 3D8FA 4GMVA 2D11A 1NI2A 4KVGB 2W2XD 3U8ZA 1EVHA 1QQGA 1W1GA 1U5DA 2D9WA 1BTNA 5DI9B 4A6HA 4PNKA 2Y7BA 2N0YA 3V5WA 3M1IB 1XKEA
chains in the Genus database with same CATH superfamily
4MT7A 1OQNA 2ROZB 5KCVA 2KIEA 1LW3A 5J3QA 1RJ2A 4IOYX 1FB8A 3AU5A 4KHBB 5GOWB 2BCJA 2COCA 4HAUB 3FM8C 3WYFB 4HHVA 1X05A 1X1GA 2MWNB 2QKMA 1QC6A 5C5BB 3KSYA 4OSNA 1MAIA 2YRYA 3ODXA 5DIFB 5D3WA 2E2XA 1V5UA 2ZPYA 2DFKA 3IVFA 2RVBB 1I7AA 3NWAA 4DBBA 1XR0B 3X23A 1Z87A 3PZDA 1EGXA 1XCGA 2L2IA 4ZRKA 1Q67A 2ELAA 1U29A 1U5EA 4NSWA 4DXAB 2R0DA 2DLWA 2P8VA 4EMOA 1MIZB 1MKEA 4K17A 5FI0A 4F7GA 2KUPA 1AQCA 3F5RA 5CLQB 1DYNA 1Y19B 3ULCA 3U12A 1UNRA 4WVFB 2NMBA 2LYDA 1ZVRA 1P5TA 1N3HA 3ODWA 2CY5A 3KY9A 2J0KA 2GUMA 2GJYA 1WGUA 1MIXA 2CY4A 4QJ3B 5I2SA 1U5FA 2RRFA 4MY6A 3RCPA 2EC1A 2J59M 2Z0QA 1FHWA 4HB4B 2EMTA 1V5PA 2ELBA 4CHMA 2CODA 2Q13A 3O96A 2H7EA 4HSIA 5JLJB 1WG7A 3HW2B 5M4YB 3OHMB 1IRSA 1W1DA 3LJUX 2RLOA 4YL8A 2HE7A 3BINA 1ZM0A 4GPTB 5DH9B 4A6FA 4D6WA 4L1RA 1H4RA 3BJIA 3VOQA 4QJ5B 4Y94A 3HIEA 3PVUA 3MPXA 1OY2A 2K2UA 3PVWA 1J0WA 2COAA 1P6SA 2I5CA 1EAZA 4L6EA 3DXCA 5LONB 3GYPA 1XODA 2J0MA 5D3VA 1WGQA 3SUZA 1OMWA 3P7ZA 2I5FA 3TFMA 2OTXA 3KRXA 2QKLA 2K00A 2NZ8B 2IYBA 1TQZA 1UNQA 1GC7A 3WA0A 1WJMA 4GXBA 4K81A 3NW8A 1M7EA 2D9XA 1GC6A 2DX1A 1NTYA 2D9ZA 4KHOA 2IFSA 2DA0A 4QJ4B 2VSZA 1M7RA 3ZVRA 1SHCA 2W2XC 3PG7A 1NTVA 1B55A 3ZDTA 2L1CA 1UNPA 3AU4A 5CLLB 3SV1A 4C0AA 4CSQA 2VRWB 1GG3A 3PVLA 3GYOA 3HSAA 2LKOA 1UEFA 2PZ1A 1Y5OA 2LOZA 3HK0A 1FGZA 2MKRA 1T77A 2G35A 1U27A 3DXEA 4DIXA 4H8SA 2OQBA 2Z0OA 4NY0A 5HE2A 1DBHA 3FVCA 4HB3B 4Z2NA 3PEGA 2R09A 2D9VA 5J3TA 1DDWA 1FAOA 2Z4DA 3OANA 5L81A 1DDVA 2K49A 5D3YA 3DCXA 4EJNA 4HATB 1V88A 1I2HA 2EJ8A 1X11A 2HTHB 3A98B 5LOPB 3NWDA 2ROVA 3SO6A 1BTKA 3TW1A 4KAXB 5JHHA 2LULA 3ULBA 5D3XA 2Z14A 1AWEA 2DYNA 5DHAB 4GNKB 1P3RA 5EFXA 3D8EA 1X86A 3A8QA 3FEHA 4HAVB 4A5KA 4OT1A 1XX0A 2GS0A 2YSZA 4F7HA 3NWFA 1PMSA 1K5GB 2P0DA 1WI1A 4HDQA 4ZRJA 2FJLA 3HQCA 1W1HA 1MPHA 4BBKA 4DX8A 2COFA 4WJ7A 4P7IA 4HB0B 2CRFA 4MK0A 1MI1A 1UPQA 2Z13A 5C79A 1FGYA 3T06A 4K2PA 3VIAA 4IFSA 1ZSQA 5HE1A 2UZSA 3PP2A 1U5GA 2FJUB 2ZKMX 3SNHA 1U2BA 2RUKB 4HB2B 2UZRA 1H10A 2DYQA 2D4QA 3CXBB 2YT1A 4A6FB 2GCJA 1EF1A 1SGHA 2KUQA 3NSUA 3QWMA 2ADZA 4Z2MB 2JP2A 4KHBA 3SYXA 2KR0A 2I1JA 1KI1B 4K2OA 2DKQA 5JP4A 4IAPA 3TO1A 3D8DA 4PQ0A 5KQ4A 3CIKA 2K8EA 1UPRA 2GCLA 5C5BA 2LG1A 3QBVB 3TVVA 2KGXB 3TCAA 5D27A 2KIGA 1WJ1A 4QXAB 1XD4A 1V89A 4KHAA 4DX90 2RSGA 2R2YA 4HAYB 2DHKA 1WVHA 3MDBC 4F7UP 3P6AA 4TKNA 2AL6A 2Y8GA 1V5MA 3ODOA 1BAKA 3DXDA 5KQ1A 1X1FA 2YT0A 1MK7B 1MK9B 2YS3A 1KZ7A 1FOEA 2D2QA 3QIJA 3U7DA 4TYZA 3N7CA 1FHXA 4B6HA 4GMXB 4CYEA 1FHOA 1DDMA 2D9YA 3B77A 5DHFB 2DTCA 2EMSA 1RRPB 2H7DA 4EKUA 2DKPA 2KCJA 2V76A 3ML4A 1PFJA 2M14A 4WSFA 5C6RA 2XQNM 3KZ1A 1BWNA 1E5WA 2VKIA 2J0JA 1ZYIA 2DHIA 1LB1A 2DX5A 2CAYA 2YVCA 5HE0A 2K2JA 2M38A 1TXDA 1K5DB 2YS1A 2LOXA 1V61A 1ISNA 2X18A 4ZRIA 4HAZB 2YS5A 2DN6A 2W2WA 4HDOA 4GN1A 4D0NB 4XWXA 2DHJA 2MFQA 3A58A 5C16A 3AJ4A 4HAWB 3KRWA 2N23A 1KZGA 5IRSA 2RNRB 4HAXB 2MDXA 1ZC3B 1NU2A 4GZUA 5JHGA 1J19A 4A6KA 4YONA 3A8PA 3F0WA 3FSSA 3G9WA 5J3YA 5FI1A 2YF0A 5HE3A 2Z0PA 1PLSA 1DROA 2RGNB 3UZTA 1ZC4B 2AEHA 2P0FA 3PSCA 2I1KA 4CHJA 1TJ6A 2UVMA 2P0HA 5LG4B 2Y8FA 2D10A 2Z59A 3D8FA 2NBVA 4GMVA 5I2MA 2D11A 2YT2A 1NI2A 4KVGB 2W2XD 3U8ZA 1EVHA 1QQGA 4GOUA 1W1GA 1U5DA 2D9WA 1BTNA 5DI9B 4A6HA 4PNKA 2Y7BA 2N0YA 3V5WA 3M1IB 1XKEA
chains in the Genus database with same CATH topology
4MT7A 1OQNA 2ROZB 5KCVA 1LW3A 5J3QA 1RJ2A 4IOYX 1FB8A 3AU5A 4KHBB 5GOWB 2BCJA 2COCA 4HAUB 3FM8C 3WYFB 4HHVA 1X05A 1X1GA 2MWNB 2QKMA 1QC6A 5C5BB 3KSYA 1MAIA 2YRYA 3ODXA 5DIFB 5D3WA 2E2XA 1V5UA 2ZPYA 2DFKA 3IVFA 2RVBB 1I7AA 4DBBA 1XR0B 3X23A 1Z87A 3PZDA 1EGXA 1XCGA 2L2IA 4ZRKA 1Q67A 2ELAA 1U29A 1U5EA 4NSWA 4DXAB 2R0DA 2DLWA 2P8VA 4EMOA 1MIZB 1MKEA 4K17A 5FI0A 4F7GA 2KUPA 1AQCA 3F5RA 5CLQB 1DYNA 1Y19B 3ULCA 1UNRA 4WVFB 2NMBA 2LYDA 1ZVRA 1P5TA 1N3HA 3ODWA 2CY5A 3KY9A 2J0KA 2GJYA 1WGUA 1MIXA 2CY4A 1U5FA 4MY6A 3RCPA 2EC1A 2J59M 2Z0QA 1FHWA 4HB4B 2EMTA 1V5PA 2ELBA 4CHMA 2CODA 2Q13A 3O96A 2H7EA 5JLJB 1WG7A 3HW2B 1IRSA 1W1DA 3LJUX 2RLOA 4YL8A 2HE7A 3BINA 1ZM0A 4GPTB 5DH9B 4A6FA 1H4RA 3BJIA 3VOQA 4Y94A 3PVUA 3MPXA 1OY2A 2K2UA 3PVWA 1J0WA 2COAA 1P6SA 2I5CA 1EAZA 4L6EA 3DXCA 5LONB 3GYPA 1XODA 2J0MA 5D3VA 1WGQA 3SUZA 1OMWA 3P7ZA 2I5FA 3TFMA 2OTXA 3KRXA 2QKLA 2K00A 2NZ8B 2IYBA 1TQZA 1UNQA 1GC7A 3WA0A 1WJMA 4GXBA 4K81A 1M7EA 2D9XA 1GC6A 2DX1A 1NTYA 2D9ZA 4KHOA 2IFSA 2DA0A 2VSZA 1M7RA 3ZVRA 1SHCA 2W2XC 3PG7A 1NTVA 1B55A 3ZDTA 2L1CA 1UNPA 3AU4A 5CLLB 3SV1A 4C0AA 2VRWB 1GG3A 3PVLA 3GYOA 2LKOA 1UEFA 2PZ1A 1Y5OA 2LOZA 3HK0A 1FGZA 2MKRA 2G35A 1U27A 3DXEA 4H8SA 2OQBA 2Z0OA 4NY0A 5HE2A 1DBHA 4HB3B 4Z2NA 3PEGA 2R09A 2D9VA 5J3TA 1DDWA 1FAOA 3OANA 5L81A 1DDVA 5D3YA 4EJNA 4HATB 1V88A 1I2HA 2EJ8A 1X11A 2HTHB 3A98B 5LOPB 2ROVA 3SO6A 1BTKA 3TW1A 4KAXB 5JHHA 2LULA 3ULBA 5D3XA 1AWEA 2DYNA 5DHAB 1P3RA 5EFXA 3D8EA 1X86A 3A8QA 3FEHA 4HAVB 4A5KA 1XX0A 2GS0A 2YSZA 4F7HA 1PMSA 1K5GB 2P0DA 1WI1A 4HDQA 4ZRJA 2FJLA 3HQCA 1W1HA 1MPHA 4BBKA 4DX8A 2COFA 4WJ7A 4P7IA 4HB0B 2CRFA 4MK0A 1UPQA 5C79A 1FGYA 3T06A 4K2PA 3VIAA 4IFSA 1ZSQA 5HE1A 2UZSA 3PP2A 1U5GA 3SNHA 1U2BA 2RUKB 4HB2B 2UZRA 1H10A 2DYQA 2D4QA 3CXBB 2YT1A 4A6FB 2GCJA 1EF1A 1SGHA 3NSUA 3QWMA 2ADZA 4Z2MB 2JP2A 3SYXA 2I1JA 1KI1B 4K2OA 2DKQA 5JP4A 4IAPA 3TO1A 3D8DA 4PQ0A 5KQ4A 3CIKA 1UPRA 2GCLA 5C5BA 2LG1A 3QBVB 3TVVA 2KGXB 3TCAA 5D27A 1WJ1A 1XD4A 1V89A 4KHAA 4DX90 2RSGA 4HAYB 2DHKA 1WVHA 3MDBC 4F7UP 3P6AA 4TKNA 2AL6A 2Y8GA 1V5MA 3ODOA 1BAKA 3DXDA 5KQ1A 1X1FA 2YT0A 1MK7B 1MK9B 2YS3A 1KZ7A 1FOEA 2D2QA 3QIJA 3U7DA 4TYZA 3N7CA 1FHXA 4B6HA 4GMXB 4CYEA 1FHOA 1DDMA 2D9YA 5DHFB 2DTCA 2EMSA 1RRPB 2H7DA 4EKUA 2DKPA 2KCJA 2V76A 3ML4A 1PFJA 2M14A 4WSFA 5C6RA 2XQNM 3KZ1A 1BWNA 1E5WA 2VKIA 2J0JA 2DHIA 1LB1A 2DX5A 2CAYA 2YVCA 5HE0A 2K2JA 2M38A 1TXDA 1K5DB 2YS1A 2LOXA 1V61A 1ISNA 2X18A 4ZRIA 4HAZB 2YS5A 2DN6A 2W2WA 4HDOA 4GN1A 4D0NB 4XWXA 2DHJA 2MFQA 5C16A 3AJ4A 4HAWB 3KRWA 2N23A 1KZGA 2RNRB 4HAXB 2MDXA 1ZC3B 1NU2A 4GZUA 5JHGA 1J19A 4A6KA 4YONA 3A8PA 3F0WA 3FSSA 3G9WA 5J3YA 5FI1A 2YF0A 5HE3A 2Z0PA 1PLSA 1DROA 2RGNB 3UZTA 1ZC4B 2AEHA 2P0FA 3PSCA 2I1KA 4CHJA 1TJ6A 2UVMA 2P0HA 2Y8FA 2D10A 3D8FA 4GMVA 2D11A 1NI2A 4KVGB 2W2XD 3U8ZA 1EVHA 1QQGA 1W1GA 1U5DA 2D9WA 1BTNA 5DI9B 4A6HA 4PNKA 2Y7BA 2N0YA 3V5WA 3M1IB 1XKEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MT7 A;  1OQN A;  2ROZ B;  5KCV A;  1LW3 A;  5J3Q A;  1RJ2 A;  4IOY X;  1FB8 A;  3AU5 A;  4KHB B;  5GOW B;  2BCJ A;  2COC A;  4HAU B;  3FM8 C;  3WYF B;  4HHV A;  1X05 A;  1X1G A;  2MWN B;  2QKM A;  1QC6 A;  5C5B B;  3KSY A;  1MAI A;  2YRY A;  3ODX A;  5DIF B;  5D3W A;  2E2X A;  1V5U A;  2ZPY A;  2DFK A;  3IVF A;  2RVB B;  1I7A A;  4DBB A;  1XR0 B;  3X23 A;  1Z87 A;  3PZD A;  1EGX A;  1XCG A;  2L2I A;  4ZRK A;  1Q67 A;  2ELA A;  1U29 A;  1U5E A;  4NSW A;  4DXA B;  2R0D A;  2DLW A;  2P8V A;  4EMO A;  1MIZ B;  1MKE A;  4K17 A;  5FI0 A;  4F7G A;  2KUP A;  1AQC A;  3F5R A;  5CLQ B;  1DYN A;  1Y19 B;  3ULC A;  1UNR A;  4WVF B;  2NMB A;  2LYD A;  1ZVR A;  1P5T A;  1N3H A;  3ODW A;  2CY5 A;  3KY9 A;  2J0K A;  2GJY A;  1WGU A;  1MIX A;  2CY4 A;  1U5F A;  4MY6 A;  3RCP A;  2EC1 A;  2J59 M;  2Z0Q A;  1FHW A;  4HB4 B;  2EMT A;  1V5P A;  2ELB A;  4CHM A;  2COD A;  2Q13 A;  3O96 A;  2H7E A;  5JLJ B;  1WG7 A;  3HW2 B;  1IRS A;  1W1D A;  3LJU X;  2RLO A;  4YL8 A;  2HE7 A;  3BIN A;  1ZM0 A;  4GPT B;  5DH9 B;  4A6F A;  1H4R A;  3BJI A;  3VOQ A;  4Y94 A;  3PVU A;  3MPX A;  1OY2 A;  2K2U A;  3PVW A;  1J0W A;  2COA A;  1P6S A;  2I5C A;  1EAZ A;  4L6E A;  3DXC A;  5LON B;  3GYP A;  1XOD A;  2J0M A;  5D3V A;  1WGQ A;  3SUZ A;  1OMW A;  3P7Z A;  2I5F A;  3TFM A;  2OTX A;  3KRX A;  2QKL A;  2K00 A;  2NZ8 B;  2IYB A;  1TQZ A;  1UNQ A;  1GC7 A;  3WA0 A;  1WJM A;  4GXB A;  4K81 A;  1M7E A;  2D9X A;  1GC6 A;  2DX1 A;  1NTY A;  2D9Z A;  4KHO A;  2IFS A;  2DA0 A;  2VSZ A;  1M7R A;  3ZVR A;  1SHC A;  2W2X C;  3PG7 A;  1NTV A;  1B55 A;  3ZDT A;  2L1C A;  1UNP A;  3AU4 A;  5CLL B;  3SV1 A;  4C0A A;  2VRW B;  1GG3 A;  3PVL A;  3GYO A;  2LKO A;  1UEF A;  2PZ1 A;  1Y5O A;  2LOZ A;  3HK0 A;  1FGZ A;  2MKR A;  2G35 A;  1U27 A;  3DXE A;  4H8S A;  2OQB A;  2Z0O A;  4NY0 A;  5HE2 A;  1DBH A;  4HB3 B;  4Z2N A;  3PEG A;  2R09 A;  2D9V A;  5J3T A;  1DDW A;  1FAO A;  3OAN A;  5L81 A;  1DDV A;  5D3Y A;  4EJN A;  4HAT B;  1V88 A;  1I2H A;  2EJ8 A;  1X11 A;  2HTH B;  3A98 B;  5LOP B;  2ROV A;  3SO6 A;  1BTK A;  3TW1 A;  4KAX B;  5JHH A;  2LUL A;  3ULB A;  5D3X A;  1AWE A;  2DYN A;  5DHA B;  1P3R A;  5EFX A;  3D8E A;  1X86 A;  3A8Q A;  3FEH A;  4HAV B;  4A5K A;  1XX0 A;  2GS0 A;  2YSZ A;  4F7H A;  1PMS A;  1K5G B;  2P0D A;  1WI1 A;  4HDQ A;  4ZRJ A;  2FJL A;  3HQC A;  1W1H A;  1MPH A;  4BBK A;  4DX8 A;  2COF A;  4WJ7 A;  4P7I A;  4HB0 B;  2CRF A;  4MK0 A;  1UPQ A;  5C79 A;  1FGY A;  3T06 A;  4K2P A;  3VIA A;  4IFS A;  1ZSQ A;  5HE1 A;  2UZS A;  3PP2 A;  1U5G A;  3SNH A;  1U2B A;  2RUK B;  4HB2 B;  2UZR A;  1H10 A;  2DYQ A;  2D4Q A;  3CXB B;  2YT1 A;  4A6F B;  2GCJ A;  1EF1 A;  1SGH A;  3NSU A;  3QWM A;  2ADZ A;  4Z2M B;  2JP2 A;  3SYX A;  2I1J A;  1KI1 B;  4K2O A;  2DKQ A;  5JP4 A;  4IAP A;  3TO1 A;  3D8D A;  4PQ0 A;  5KQ4 A;  3CIK A;  1UPR A;  2GCL A;  5C5B A;  2LG1 A;  3QBV B;  3TVV A;  2KGX B;  3TCA A;  5D27 A;  1WJ1 A;  1XD4 A;  1V89 A;  4KHA A;  4DX9 0;  2RSG A;  4HAY B;  2DHK A;  1WVH A;  3MDB C;  4F7U P;  3P6A A;  4TKN A;  2AL6 A;  2Y8G A;  1V5M A;  3ODO A;  1BAK A;  3DXD A;  5KQ1 A;  1X1F A;  2YT0 A;  1MK7 B;  1MK9 B;  2YS3 A;  1KZ7 A;  1FOE A;  2D2Q A;  3QIJ A;  3U7D A;  4TYZ A;  3N7C A;  1FHX A;  4B6H A;  4GMX B;  4CYE A;  1FHO A;  1DDM A;  2D9Y A;  5DHF B;  2DTC A;  2EMS A;  1RRP B;  2H7D A;  4EKU A;  2DKP A;  2KCJ A;  2V76 A;  3ML4 A;  1PFJ A;  2M14 A;  4WSF A;  5C6R A;  2XQN M;  3KZ1 A;  1BWN A;  1E5W A;  2VKI A;  2J0J A;  2DHI A;  1LB1 A;  2DX5 A;  2CAY A;  2YVC A;  5HE0 A;  2K2J A;  2M38 A;  1TXD A;  1K5D B;  2YS1 A;  2LOX A;  1V61 A;  1ISN A;  2X18 A;  4ZRI A;  4HAZ B;  2YS5 A;  2DN6 A;  2W2W A;  4HDO A;  4GN1 A;  4D0N B;  4XWX A;  2DHJ A;  2MFQ A;  5C16 A;  3AJ4 A;  4HAW B;  3KRW A;  2N23 A;  1KZG A;  2RNR B;  4HAX B;  2MDX A;  1ZC3 B;  1NU2 A;  4GZU A;  5JHG A;  1J19 A;  4A6K A;  4YON A;  3A8P A;  3F0W A;  3FSS A;  3G9W A;  5J3Y A;  5FI1 A;  2YF0 A;  5HE3 A;  2Z0P A;  1PLS A;  1DRO A;  2RGN B;  3UZT A;  1ZC4 B;  2AEH A;  2P0F A;  3PSC A;  2I1K A;  4CHJ A;  1TJ6 A;  2UVM A;  2P0H A;  2Y8F A;  2D10 A;  3D8F A;  4GMV A;  2D11 A;  1NI2 A;  4KVG B;  2W2X D;  3U8Z A;  1EVH A;  1QQG A;  1W1G A;  1U5D A;  2D9W A;  1BTN A;  5DI9 B;  4A6H A;  4PNK A;  2Y7B A;  2N0Y A;  3V5W A;  3M1I B;  1XKE A; 
#chains in the Genus database with same CATH topology
 4MT7 A;  1OQN A;  2ROZ B;  5KCV A;  2KIE A;  1LW3 A;  5J3Q A;  1RJ2 A;  4IOY X;  1FB8 A;  3AU5 A;  4KHB B;  5GOW B;  2BCJ A;  2COC A;  4HAU B;  3FM8 C;  3WYF B;  4HHV A;  1X05 A;  1X1G A;  2MWN B;  2QKM A;  1QC6 A;  5C5B B;  3KSY A;  4OSN A;  1MAI A;  2YRY A;  3ODX A;  5DIF B;  5D3W A;  2E2X A;  1V5U A;  2ZPY A;  2DFK A;  3IVF A;  2RVB B;  1I7A A;  3NWA A;  4DBB A;  1XR0 B;  3X23 A;  1Z87 A;  3PZD A;  1EGX A;  1XCG A;  2L2I A;  4ZRK A;  1Q67 A;  2ELA A;  1U29 A;  1U5E A;  4NSW A;  4DXA B;  2R0D A;  2DLW A;  2P8V A;  4EMO A;  1MIZ B;  1MKE A;  4K17 A;  5FI0 A;  4F7G A;  2KUP A;  1AQC A;  3F5R A;  5CLQ B;  1DYN A;  1Y19 B;  3ULC A;  3U12 A;  1UNR A;  4WVF B;  2NMB A;  2LYD A;  1ZVR A;  1P5T A;  1N3H A;  3ODW A;  2CY5 A;  3KY9 A;  2J0K A;  2GUM A;  2GJY A;  1WGU A;  1MIX A;  2CY4 A;  4QJ3 B;  5I2S A;  1U5F A;  2RRF A;  4MY6 A;  3RCP A;  2EC1 A;  2J59 M;  2Z0Q A;  1FHW A;  4HB4 B;  2EMT A;  1V5P A;  2ELB A;  4CHM A;  2COD A;  2Q13 A;  3O96 A;  2H7E A;  4HSI A;  5JLJ B;  1WG7 A;  3HW2 B;  5M4Y B;  3OHM B;  1IRS A;  1W1D A;  3LJU X;  2RLO A;  4YL8 A;  2HE7 A;  3BIN A;  1ZM0 A;  4GPT B;  5DH9 B;  4A6F A;  4D6W A;  4L1R A;  1H4R A;  3BJI A;  3VOQ A;  4QJ5 B;  4Y94 A;  3HIE A;  3PVU A;  3MPX A;  1OY2 A;  2K2U A;  3PVW A;  1J0W A;  2COA A;  1P6S A;  2I5C A;  1EAZ A;  4L6E A;  3DXC A;  5LON B;  3GYP A;  1XOD A;  2J0M A;  5D3V A;  1WGQ A;  3SUZ A;  1OMW A;  3P7Z A;  2I5F A;  3TFM A;  2OTX A;  3KRX A;  2QKL A;  2K00 A;  2NZ8 B;  2IYB A;  1TQZ A;  1UNQ A;  1GC7 A;  3WA0 A;  1WJM A;  4GXB A;  4K81 A;  3NW8 A;  1M7E A;  2D9X A;  1GC6 A;  2DX1 A;  1NTY A;  2D9Z A;  4KHO A;  2IFS A;  2DA0 A;  4QJ4 B;  2VSZ A;  1M7R A;  3ZVR A;  1SHC A;  2W2X C;  3PG7 A;  1NTV A;  1B55 A;  3ZDT A;  2L1C A;  1UNP A;  3AU4 A;  5CLL B;  3SV1 A;  4C0A A;  4CSQ A;  2VRW B;  1GG3 A;  3PVL A;  3GYO A;  3HSA A;  2LKO A;  1UEF A;  2PZ1 A;  1Y5O A;  2LOZ A;  3HK0 A;  1FGZ A;  2MKR A;  1T77 A;  2G35 A;  1U27 A;  3DXE A;  4DIX A;  4H8S A;  2OQB A;  2Z0O A;  4NY0 A;  5HE2 A;  1DBH A;  3FVC A;  4HB3 B;  4Z2N A;  3PEG A;  2R09 A;  2D9V A;  5J3T A;  1DDW A;  1FAO A;  2Z4D A;  3OAN A;  5L81 A;  1DDV A;  2K49 A;  5D3Y A;  3DCX A;  4EJN A;  4HAT B;  1V88 A;  1I2H A;  2EJ8 A;  1X11 A;  2HTH B;  3A98 B;  5LOP B;  3NWD A;  2ROV A;  3SO6 A;  1BTK A;  3TW1 A;  4KAX B;  5JHH A;  2LUL A;  3ULB A;  5D3X A;  2Z14 A;  1AWE A;  2DYN A;  5DHA B;  4GNK B;  1P3R A;  5EFX A;  3D8E A;  1X86 A;  3A8Q A;  3FEH A;  4HAV B;  4A5K A;  4OT1 A;  1XX0 A;  2GS0 A;  2YSZ A;  4F7H A;  3NWF A;  1PMS A;  1K5G B;  2P0D A;  1WI1 A;  4HDQ A;  4ZRJ A;  2FJL A;  3HQC A;  1W1H A;  1MPH A;  4BBK A;  4DX8 A;  2COF A;  4WJ7 A;  4P7I A;  4HB0 B;  2CRF A;  4MK0 A;  1MI1 A;  1UPQ A;  2Z13 A;  5C79 A;  1FGY A;  3T06 A;  4K2P A;  3VIA A;  4IFS A;  1ZSQ A;  5HE1 A;  2UZS A;  3PP2 A;  1U5G A;  2FJU B;  2ZKM X;  3SNH A;  1U2B A;  2RUK B;  4HB2 B;  2UZR A;  1H10 A;  2DYQ A;  2D4Q A;  3CXB B;  2YT1 A;  4A6F B;  2GCJ A;  1EF1 A;  1SGH A;  2KUQ A;  3NSU A;  3QWM A;  2ADZ A;  4Z2M B;  2JP2 A;  4KHB A;  3SYX A;  2KR0 A;  2I1J A;  1KI1 B;  4K2O A;  2DKQ A;  5JP4 A;  4IAP A;  3TO1 A;  3D8D A;  4PQ0 A;  5KQ4 A;  3CIK A;  2K8E A;  1UPR A;  2GCL A;  5C5B A;  2LG1 A;  3QBV B;  3TVV A;  2KGX B;  3TCA A;  5D27 A;  2KIG A;  1WJ1 A;  4QXA B;  1XD4 A;  1V89 A;  4KHA A;  4DX9 0;  2RSG A;  2R2Y A;  4HAY B;  2DHK A;  1WVH A;  3MDB C;  4F7U P;  3P6A A;  4TKN A;  2AL6 A;  2Y8G A;  1V5M A;  3ODO A;  1BAK A;  3DXD A;  5KQ1 A;  1X1F A;  2YT0 A;  1MK7 B;  1MK9 B;  2YS3 A;  1KZ7 A;  1FOE A;  2D2Q A;  3QIJ A;  3U7D A;  4TYZ A;  3N7C A;  1FHX A;  4B6H A;  4GMX B;  4CYE A;  1FHO A;  1DDM A;  2D9Y A;  3B77 A;  5DHF B;  2DTC A;  2EMS A;  1RRP B;  2H7D A;  4EKU A;  2DKP A;  2KCJ A;  2V76 A;  3ML4 A;  1PFJ A;  2M14 A;  4WSF A;  5C6R A;  2XQN M;  3KZ1 A;  1BWN A;  1E5W A;  2VKI A;  2J0J A;  1ZYI A;  2DHI A;  1LB1 A;  2DX5 A;  2CAY A;  2YVC A;  5HE0 A;  2K2J A;  2M38 A;  1TXD A;  1K5D B;  2YS1 A;  2LOX A;  1V61 A;  1ISN A;  2X18 A;  4ZRI A;  4HAZ B;  2YS5 A;  2DN6 A;  2W2W A;  4HDO A;  4GN1 A;  4D0N B;  4XWX A;  2DHJ A;  2MFQ A;  3A58 A;  5C16 A;  3AJ4 A;  4HAW B;  3KRW A;  2N23 A;  1KZG A;  5IRS A;  2RNR B;  4HAX B;  2MDX A;  1ZC3 B;  1NU2 A;  4GZU A;  5JHG A;  1J19 A;  4A6K A;  4YON A;  3A8P A;  3F0W A;  3FSS A;  3G9W A;  5J3Y A;  5FI1 A;  2YF0 A;  5HE3 A;  2Z0P A;  1PLS A;  1DRO A;  2RGN B;  3UZT A;  1ZC4 B;  2AEH A;  2P0F A;  3PSC A;  2I1K A;  4CHJ A;  1TJ6 A;  2UVM A;  2P0H A;  5LG4 B;  2Y8F A;  2D10 A;  2Z59 A;  3D8F A;  2NBV A;  4GMV A;  5I2M A;  2D11 A;  2YT2 A;  1NI2 A;  4KVG B;  2W2X D;  3U8Z A;  1EVH A;  1QQG A;  4GOU A;  1W1G A;  1U5D A;  2D9W A;  1BTN A;  5DI9 B;  4A6H A;  4PNK A;  2Y7B A;  2N0Y A;  3V5W A;  3M1I B;  1XKE A; 
#chains in the Genus database with same CATH homology
 4MT7 A;  1OQN A;  2ROZ B;  5KCV A;  1LW3 A;  5J3Q A;  1RJ2 A;  4IOY X;  1FB8 A;  3AU5 A;  4KHB B;  5GOW B;  2BCJ A;  2COC A;  4HAU B;  3FM8 C;  3WYF B;  4HHV A;  1X05 A;  1X1G A;  2MWN B;  2QKM A;  1QC6 A;  5C5B B;  3KSY A;  1MAI A;  2YRY A;  3ODX A;  5DIF B;  5D3W A;  2E2X A;  1V5U A;  2ZPY A;  2DFK A;  3IVF A;  2RVB B;  1I7A A;  4DBB A;  1XR0 B;  3X23 A;  1Z87 A;  3PZD A;  1EGX A;  1XCG A;  2L2I A;  4ZRK A;  1Q67 A;  2ELA A;  1U29 A;  1U5E A;  4NSW A;  4DXA B;  2R0D A;  2DLW A;  2P8V A;  4EMO A;  1MIZ B;  1MKE A;  4K17 A;  5FI0 A;  4F7G A;  2KUP A;  1AQC A;  3F5R A;  5CLQ B;  1DYN A;  1Y19 B;  3ULC A;  1UNR A;  4WVF B;  2NMB A;  2LYD A;  1ZVR A;  1P5T A;  1N3H A;  3ODW A;  2CY5 A;  3KY9 A;  2J0K A;  2GJY A;  1WGU A;  1MIX A;  2CY4 A;  1U5F A;  4MY6 A;  3RCP A;  2EC1 A;  2J59 M;  2Z0Q A;  1FHW A;  4HB4 B;  2EMT A;  1V5P A;  2ELB A;  4CHM A;  2COD A;  2Q13 A;  3O96 A;  2H7E A;  5JLJ B;  1WG7 A;  3HW2 B;  1IRS A;  1W1D A;  3LJU X;  2RLO A;  4YL8 A;  2HE7 A;  3BIN A;  1ZM0 A;  4GPT B;  5DH9 B;  4A6F A;  1H4R A;  3BJI A;  3VOQ A;  4Y94 A;  3PVU A;  3MPX A;  1OY2 A;  2K2U A;  3PVW A;  1J0W A;  2COA A;  1P6S A;  2I5C A;  1EAZ A;  4L6E A;  3DXC A;  5LON B;  3GYP A;  1XOD A;  2J0M A;  5D3V A;  1WGQ A;  3SUZ A;  1OMW A;  3P7Z A;  2I5F A;  3TFM A;  2OTX A;  3KRX A;  2QKL A;  2K00 A;  2NZ8 B;  2IYB A;  1TQZ A;  1UNQ A;  1GC7 A;  3WA0 A;  1WJM A;  4GXB A;  4K81 A;  1M7E A;  2D9X A;  1GC6 A;  2DX1 A;  1NTY A;  2D9Z A;  4KHO A;  2IFS A;  2DA0 A;  2VSZ A;  1M7R A;  3ZVR A;  1SHC A;  2W2X C;  3PG7 A;  1NTV A;  1B55 A;  3ZDT A;  2L1C A;  1UNP A;  3AU4 A;  5CLL B;  3SV1 A;  4C0A A;  2VRW B;  1GG3 A;  3PVL A;  3GYO A;  2LKO A;  1UEF A;  2PZ1 A;  1Y5O A;  2LOZ A;  3HK0 A;  1FGZ A;  2MKR A;  2G35 A;  1U27 A;  3DXE A;  4H8S A;  2OQB A;  2Z0O A;  4NY0 A;  5HE2 A;  1DBH A;  4HB3 B;  4Z2N A;  3PEG A;  2R09 A;  2D9V A;  5J3T A;  1DDW A;  1FAO A;  3OAN A;  5L81 A;  1DDV A;  5D3Y A;  4EJN A;  4HAT B;  1V88 A;  1I2H A;  2EJ8 A;  1X11 A;  2HTH B;  3A98 B;  5LOP B;  2ROV A;  3SO6 A;  1BTK A;  3TW1 A;  4KAX B;  5JHH A;  2LUL A;  3ULB A;  5D3X A;  1AWE A;  2DYN A;  5DHA B;  1P3R A;  5EFX A;  3D8E A;  1X86 A;  3A8Q A;  3FEH A;  4HAV B;  4A5K A;  1XX0 A;  2GS0 A;  2YSZ A;  4F7H A;  1PMS A;  1K5G B;  2P0D A;  1WI1 A;  4HDQ A;  4ZRJ A;  2FJL A;  3HQC A;  1W1H A;  1MPH A;  4BBK A;  4DX8 A;  2COF A;  4WJ7 A;  4P7I A;  4HB0 B;  2CRF A;  4MK0 A;  1UPQ A;  5C79 A;  1FGY A;  3T06 A;  4K2P A;  3VIA A;  4IFS A;  1ZSQ A;  5HE1 A;  2UZS A;  3PP2 A;  1U5G A;  3SNH A;  1U2B A;  2RUK B;  4HB2 B;  2UZR A;  1H10 A;  2DYQ A;  2D4Q A;  3CXB B;  2YT1 A;  4A6F B;  2GCJ A;  1EF1 A;  1SGH A;  3NSU A;  3QWM A;  2ADZ A;  4Z2M B;  2JP2 A;  3SYX A;  2I1J A;  1KI1 B;  4K2O A;  2DKQ A;  5JP4 A;  4IAP A;  3TO1 A;  3D8D A;  4PQ0 A;  5KQ4 A;  3CIK A;  1UPR A;  2GCL A;  5C5B A;  2LG1 A;  3QBV B;  3TVV A;  2KGX B;  3TCA A;  5D27 A;  1WJ1 A;  1XD4 A;  1V89 A;  4KHA A;  4DX9 0;  2RSG A;  4HAY B;  2DHK A;  1WVH A;  3MDB C;  4F7U P;  3P6A A;  4TKN A;  2AL6 A;  2Y8G A;  1V5M A;  3ODO A;  1BAK A;  3DXD A;  5KQ1 A;  1X1F A;  2YT0 A;  1MK7 B;  1MK9 B;  2YS3 A;  1KZ7 A;  1FOE A;  2D2Q A;  3QIJ A;  3U7D A;  4TYZ A;  3N7C A;  1FHX A;  4B6H A;  4GMX B;  4CYE A;  1FHO A;  1DDM A;  2D9Y A;  5DHF B;  2DTC A;  2EMS A;  1RRP B;  2H7D A;  4EKU A;  2DKP A;  2KCJ A;  2V76 A;  3ML4 A;  1PFJ A;  2M14 A;  4WSF A;  5C6R A;  2XQN M;  3KZ1 A;  1BWN A;  1E5W A;  2VKI A;  2J0J A;  2DHI A;  1LB1 A;  2DX5 A;  2CAY A;  2YVC A;  5HE0 A;  2K2J A;  2M38 A;  1TXD A;  1K5D B;  2YS1 A;  2LOX A;  1V61 A;  1ISN A;  2X18 A;  4ZRI A;  4HAZ B;  2YS5 A;  2DN6 A;  2W2W A;  4HDO A;  4GN1 A;  4D0N B;  4XWX A;  2DHJ A;  2MFQ A;  5C16 A;  3AJ4 A;  4HAW B;  3KRW A;  2N23 A;  1KZG A;  2RNR B;  4HAX B;  2MDX A;  1ZC3 B;  1NU2 A;  4GZU A;  5JHG A;  1J19 A;  4A6K A;  4YON A;  3A8P A;  3F0W A;  3FSS A;  3G9W A;  5J3Y A;  5FI1 A;  2YF0 A;  5HE3 A;  2Z0P A;  1PLS A;  1DRO A;  2RGN B;  3UZT A;  1ZC4 B;  2AEH A;  2P0F A;  3PSC A;  2I1K A;  4CHJ A;  1TJ6 A;  2UVM A;  2P0H A;  2Y8F A;  2D10 A;  3D8F A;  4GMV A;  2D11 A;  1NI2 A;  4KVG B;  2W2X D;  3U8Z A;  1EVH A;  1QQG A;  1W1G A;  1U5D A;  2D9W A;  1BTN A;  5DI9 B;  4A6H A;  4PNK A;  2Y7B A;  2N0Y A;  3V5W A;  3M1I B;  1XKE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...