2LOZA

The novel binding mode of dlc1 and tensin2 ptb domain
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
147
structure length
147
Chain Sequence
MSTAADLLRQGAACSVLYLTSVETESLTGPQAVARASSAALSCSPRPTPAVVHFKVSAQGITLTDNQRKLFFRRHYPVNSITFSSTDPQDRRWTNPDGTTSKIFGFVAKKPGSPWENVCHLFAELDPDQPAGAIVTFITKVLLGQRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Solution structure of the PTB domain of human Tensin2 in complex with deleted in liver cancer 1 (DLC1) peptide reveals a novel peptide binding mode
doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase activator
molecule keywords Tensin-like C1 domain-containing phosphatase
total genus 25
structure length 147
sequence length 147
ec nomenclature ec 3.1.3.-:
pdb deposition date 2012-01-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08416 PTB Phosphotyrosine-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2lozA00
2W2XC 4KVGB 1FHWA 5HE3A 3A98B 4GMVA 2EC1A 2Y7BA 2NZ8B 2K2UA 2VRWB 3PG7A 5FI0A 4F7HA 2GCLA 3ULBA 1V5PA 2CAYA 2R09A 2N23A 2KUPA 1ZM0A 1EVHA 1WJ1A 5DHAB 4GN1A 5KQ1A 2D9YA 2LULA 1FGYA 4CHJA 2DA0A 1WVHA 1SGHA 3PVUA 1MAIA 4GZUA 4GMXB 5D3XA 3PP2A 2EMSA 3A8PA 2LYDA 1H4RA 1ZC4B 4HDQA 5C6RA 1N3HA 2UZRA 4A5KA 1NTVA 3TVVA 1XKEA 3HK0A 2AEHA 3PVLA 4CYEA 2E2XA 2V76A 2UZSA 2J0MA 3RCPA 2GJYA 4A6KA 4DX90 1W1DA 2P8VA 4MK0A 1V5UA 1ZSQA 2COAA 2W2WA 2P0FA 2H7EA 3KY9A 1U29A 2RLOA 1DDMA 4H8SA 1EAZA 4WVFB 2D2QA 3KRXA 3D8EA 3NSUA 3MDBC 3ODWA 3ML4A 4MY6A 3TCAA 2QKLA 1OY2A 2P0DA 1M7RA 3SUZA 5J3TA 1XCGA 1DBHA 1FOEA 3QIJA 5LOPB 2DKPA 1K5DB 4WJ7A 2LOXA 2YS3A 3TO1A 3GYOA 2ROVA 2DHKA 5D3VA 3SYXA 2UVMA 4HAUB 1WG7A 1UNRA 3F5RA 3F0WA 3SV1A 1SHCA 1XX0A 3VOQA 2DHIA 1X86A 3PSCA 3PEGA 4HAXB 1WJMA 3OANA 5J3YA 1DYNA 4F7GA 2L2IA 2DYNA 4A6FB 2FJLA 4Z2NA 2IFSA 5FI1A 1OQNA 2D11A 3PVWA 1PLSA 4HB3B 2MFQA 3U7DA 1K5GB 2YS5A 1AQCA 1DDWA 1X05A 2PZ1A 1GC6A 1MK7B 4HAYB 2DKQA 2DX5A 4ZRKA 1WGUA 4B6HA 3CXBB 4IFSA 1UPQA 3LJUX 2CODA 5EFXA 4C0AA 2Z0OA 2D10A 4IOYX 3FSSA 1KI1B 3DXDA 2M14A 5HE0A 1Q67A 4XWXA 2COCA 4KHBB 4L6EA 5HE1A 1OMWA 1U5EA 2RSGA 5C16A 4YONA 2D9VA 1LB1A 4Z2MB 2DX1A 1BWNA 2RNRB 5KQ4A 1H10A 4K17A 1U27A 2W2XD 2DLWA 3ZVRA 2D9ZA 1PMSA 2KCJA 4K2PA 3VIAA 2OQBA 3P6AA 2YF0A 2ADZA 1WI1A 2I5CA 3KRWA 2YRYA 4BBKA 2Y8GA 4HB4B 3TFMA 1DROA 1Y19B 2QKMA 4K2OA 1Z87A 2MKRA 3ULCA 4GPTB 2DTCA 3D8FA 1LW3A 3A8QA 2YT0A 2Z0QA 2JP2A 2DN6A 2DYQA 5HE2A 2X18A 1UEFA 2HTHB 5C79A 3X23A 2RUKB 3DXCA 4D0NB 4EMOA 1DDVA 1QQGA 4CHMA 5DH9B 4KHOA 2COFA 5KCVA 1W1HA 1EF1A 2K2JA 2NMBA 2YT1A 2N0YA 1J0WA 5LONB 1MK9B 1AWEA 2CY5A 2Y8FA 1NI2A 3T06A 4F7UP 5J3QA 3U8ZA 2DFKA 2G35A 2J0JA 2MDXA 3AU4A 4NSWA 4NY0A 1ZVRA 1E5WA 1V88A 4HAZB 3GYPA 2Z0PA 1MIZB 1GG3A 1EGXA 5L81A 4TYZA 4PQ0A 4Y94A 2IYBA 3ODXA 5D27A 1KZGA 1FB8A 5CLLB 1X1GA 4HATB 4HAWB 3V5WA 3FM8C 3UZTA 2J59M 4HB0B 3D8DA 1ISNA 3HQCA 3P7ZA 2HE7A 1NU2A 4GXBA 1UNPA 2J0KA 4A6FA 5GOWB 3M1IB 3SNHA 3TW1A 4A6HA 1P3RA 1V5MA 3QWMA 4MT7A 4YL8A 1BTNA 1KZ7A 3ZDTA 2XQNM 4EJNA 4IAPA 1U2BA 1MIXA 4HAVB 2D9WA 1Y5OA 4EKUA 1FGZA 4DBBA 2GCJA 2CY4A 2ZPYA 2OTXA 1M7EA 3ODOA 5JHGA 1FHXA 3KZ1A 1X11A 5DI9B 3SO6A 4WSFA 2I1KA 1XD4A 3FEHA 2BCJA 3IVFA 5D3YA 1TQZA 2D9XA 2CRFA 3G9WA 4TKNA 5DIFB 5DHFB 1FHOA 1I7AA 2YSZA 2Q13A 3AJ4A 2I1JA 1PFJA 3BINA 4ZRJA 2LOZA 2LKOA 5D3WA 1MPHA 2VKIA 2YVCA 2ELBA 1IRSA 2VSZA 1J19A 2L1CA 4ZRIA 1TJ6A 2RVBB 1V61A 3AU5A 4PNKA 1BTKA 1RRPB 4DXAB 1TXDA 2ROZB 2EJ8A 4KHAA 1P6SA 1U5FA 4HB2B 1U5DA 1GC7A 3WYFB 3CIKA 3N7CA 2D4QA 3DXEA 5JLJB 4HDOA 2RGNB 1X1FA 1BAKA 1U5GA 1P5TA 5JP4A 2H7DA 1B55A 1WGQA 2GS0A 3QBVB 1UNQA 1RJ2A 5CLQB 2YS1A 3BJIA 3O96A 3PZDA 1I2HA 4P7IA 1QC6A 3KSYA 1FAOA 3MPXA 1MKEA 3HW2B 4K81A 2KGXB 5C5BB 1ZC3B 5JHHA 2EMTA 2K00A 1XODA 4KAXB 1W1GA 2P0HA 1UPRA 1XR0B 2MWNB 2ELAA 1V89A 2I5FA 2DHJA 1NTYA 2AL6A 2M38A 2R0DA 2LG1A 4HHVA 4DX8A 3WA0A 5C5BA
chains in the Genus database with same CATH superfamily
1MI1A 2W2XC 4KVGB 1FHWA 5HE3A 3A98B 4GMVA 2EC1A 2Y7BA 3U12A 2NZ8B 2K2UA 3B77A 2VRWB 3PG7A 5FI0A 4F7HA 2GCLA 3ULBA 1V5PA 2CAYA 2R09A 2N23A 2KUPA 1ZM0A 1EVHA 1WJ1A 5DHAB 2KIEA 4GN1A 5KQ1A 2D9YA 2LULA 2Z59A 1FGYA 4CHJA 5IRSA 2DA0A 1WVHA 1SGHA 3PVUA 1MAIA 4GZUA 4GMXB 5D3XA 3PP2A 2EMSA 3A8PA 2LYDA 1H4RA 1ZC4B 4HDQA 5C6RA 1N3HA 2UZRA 4A5KA 1NTVA 3TVVA 1XKEA 3HK0A 2AEHA 3PVLA 4CYEA 2E2XA 2V76A 2UZSA 2J0MA 3RCPA 2GJYA 4A6KA 4DX90 1W1DA 2K49A 2P8VA 4MK0A 1V5UA 1ZSQA 2COAA 2W2WA 2P0FA 2H7EA 3KY9A 1U29A 2RLOA 1DDMA 4H8SA 1EAZA 4WVFB 2D2QA 3KRXA 3D8EA 3NSUA 3MDBC 3ODWA 3ML4A 4MY6A 3TCAA 2QKLA 1OY2A 2P0DA 1M7RA 3HIEA 3SUZA 5J3TA 1XCGA 1DBHA 1FOEA 3QIJA 4GOUA 5LOPB 2DKPA 1K5DB 4WJ7A 2LOXA 2YS3A 3TO1A 3GYOA 2ROVA 2DHKA 5D3VA 3SYXA 2UVMA 4HAUB 1WG7A 1UNRA 3F5RA 3F0WA 5LG4B 3SV1A 1SHCA 1XX0A 3VOQA 2DHIA 3NWFA 1X86A 2ZKMX 3PSCA 3PEGA 4HAXB 1WJMA 3OANA 3DCXA 5J3YA 2KR0A 4HSIA 1DYNA 4F7GA 2L2IA 2DYNA 4A6FB 2FJLA 4Z2NA 2IFSA 3NWAA 4D6WA 5FI1A 1OQNA 2D11A 3PVWA 1PLSA 4HB3B 2MFQA 3U7DA 1K5GB 2YS5A 1AQCA 1DDWA 1X05A 2PZ1A 1GC6A 1MK7B 4HAYB 2DKQA 2DX5A 4ZRKA 1WGUA 4B6HA 3CXBB 4IFSA 1UPQA 3LJUX 2CODA 5EFXA 4C0AA 2Z0OA 3NWDA 2D10A 4IOYX 3FSSA 1KI1B 3DXDA 2M14A 5HE0A 1Q67A 4XWXA 2COCA 4KHBB 4L6EA 5HE1A 1OMWA 1U5EA 5I2MA 1T77A 2RSGA 5C16A 4YONA 2D9VA 2YT2A 1LB1A 4CSQA 4Z2MB 2DX1A 1BWNA 2RNRB 5KQ4A 1H10A 4K17A 1U27A 2W2XD 4OT1A 2DLWA 3ZVRA 2D9ZA 1PMSA 2KCJA 4K2PA 3VIAA 2OQBA 3P6AA 2YF0A 2ADZA 1WI1A 2I5CA 3KRWA 2YRYA 4QJ3B 4BBKA 2Y8GA 4HB4B 3TFMA 1DROA 2R2YA 1Y19B 2QKMA 4K2OA 1Z87A 2MKRA 3ULCA 4GPTB 2DTCA 3D8FA 1LW3A 3A8QA 2YT0A 2Z0QA 2JP2A 5M4YB 2DN6A 2DYQA 5HE2A 2X18A 1UEFA 2HTHB 5C79A 3X23A 2RUKB 3DXCA 4D0NB 4EMOA 1DDVA 1QQGA 4CHMA 4KHBA 5DH9B 4KHOA 2COFA 5KCVA 1W1HA 1EF1A 2K2JA 2NMBA 2YT1A 2N0YA 1J0WA 5LONB 1MK9B 1AWEA 2CY5A 2Y8FA 1NI2A 3T06A 4F7UP 5J3QA 3U8ZA 2DFKA 2G35A 2J0JA 2MDXA 3AU4A 4NSWA 4NY0A 1ZVRA 1E5WA 1V88A 4HAZB 3GYPA 2Z0PA 1MIZB 1GG3A 1EGXA 4QJ4B 5L81A 4TYZA 4PQ0A 4Y94A 2IYBA 3ODXA 5D27A 1KZGA 1FB8A 5CLLB 1X1GA 4HATB 4HAWB 3V5WA 3FM8C 3UZTA 2J59M 4OSNA 4HB0B 3D8DA 1ISNA 3HQCA 3P7ZA 2HE7A 1NU2A 4GXBA 1UNPA 2J0KA 4A6FA 5GOWB 3M1IB 3SNHA 3TW1A 4A6HA 1P3RA 1V5MA 3QWMA 4MT7A 4YL8A 1BTNA 1KZ7A 2FJUB 3ZDTA 2XQNM 4EJNA 2K8EA 3A58A 4IAPA 1U2BA 1MIXA 4HAVB 2D9WA 1Y5OA 4EKUA 1FGZA 4QJ5B 4DBBA 2GCJA 2CY4A 2ZPYA 2OTXA 1M7EA 3ODOA 5JHGA 2KIGA 1FHXA 3KZ1A 1X11A 5DI9B 2Z4DA 3SO6A 4WSFA 2I1KA 2GUMA 1XD4A 2NBVA 3FEHA 2Z13A 2BCJA 3IVFA 5D3YA 1TQZA 2D9XA 2CRFA 3G9WA 4TKNA 5DIFB 5DHFB 1FHOA 1I7AA 2YSZA 2Q13A 3AJ4A 2I1JA 1PFJA 3BINA 3NW8A 4ZRJA 2LOZA 2LKOA 5D3WA 1MPHA 2VKIA 2YVCA 2ELBA 1IRSA 2VSZA 1J19A 3OHMB 2L1CA 4DIXA 4ZRIA 1TJ6A 2RVBB 2RRFA 1V61A 3AU5A 4PNKA 1BTKA 1RRPB 4DXAB 1TXDA 2ROZB 2EJ8A 4KHAA 1P6SA 1U5FA 4HB2B 1U5DA 1GC7A 3WYFB 3CIKA 3N7CA 2D4QA 4GNKB 3DXEA 5JLJB 4HDOA 2RGNB 1X1FA 1BAKA 1U5GA 1P5TA 5JP4A 2H7DA 1B55A 1WGQA 2GS0A 3QBVB 1UNQA 1RJ2A 5CLQB 2YS1A 3BJIA 3O96A 3PZDA 1I2HA 3HSAA 4P7IA 1QC6A 3KSYA 1FAOA 3MPXA 1MKEA 3HW2B 4K81A 2KGXB 5C5BB 1ZC3B 5JHHA 2EMTA 2K00A 1XODA 4KAXB 5I2SA 1W1GA 2P0HA 1UPRA 2KUQA 3FVCA 1XR0B 2MWNB 2ELAA 1V89A 2I5FA 2DHJA 1NTYA 4QXAB 2AL6A 4L1RA 2M38A 2R0DA 2LG1A 4HHVA 4DX8A 3WA0A 1ZYIA 5C5BA 2Z14A
chains in the Genus database with same CATH topology
2W2XC 4KVGB 1FHWA 5HE3A 3A98B 4GMVA 2EC1A 2Y7BA 2NZ8B 2K2UA 2VRWB 3PG7A 5FI0A 4F7HA 2GCLA 3ULBA 1V5PA 2CAYA 2R09A 2N23A 2KUPA 1ZM0A 1EVHA 1WJ1A 5DHAB 4GN1A 5KQ1A 2D9YA 2LULA 1FGYA 4CHJA 2DA0A 1WVHA 1SGHA 3PVUA 1MAIA 4GZUA 4GMXB 5D3XA 3PP2A 2EMSA 3A8PA 2LYDA 1H4RA 1ZC4B 4HDQA 5C6RA 1N3HA 2UZRA 4A5KA 1NTVA 3TVVA 1XKEA 3HK0A 2AEHA 3PVLA 4CYEA 2E2XA 2V76A 2UZSA 2J0MA 3RCPA 2GJYA 4A6KA 4DX90 1W1DA 2P8VA 4MK0A 1V5UA 1ZSQA 2COAA 2W2WA 2P0FA 2H7EA 3KY9A 1U29A 2RLOA 1DDMA 4H8SA 1EAZA 4WVFB 2D2QA 3KRXA 3D8EA 3NSUA 3MDBC 3ODWA 3ML4A 4MY6A 3TCAA 2QKLA 1OY2A 2P0DA 1M7RA 3SUZA 5J3TA 1XCGA 1DBHA 1FOEA 3QIJA 5LOPB 2DKPA 1K5DB 4WJ7A 2LOXA 2YS3A 3TO1A 3GYOA 2ROVA 2DHKA 5D3VA 3SYXA 2UVMA 4HAUB 1WG7A 1UNRA 3F5RA 3F0WA 3SV1A 1SHCA 1XX0A 3VOQA 2DHIA 1X86A 3PSCA 3PEGA 4HAXB 1WJMA 3OANA 5J3YA 1DYNA 4F7GA 2L2IA 2DYNA 4A6FB 2FJLA 4Z2NA 2IFSA 5FI1A 1OQNA 2D11A 3PVWA 1PLSA 4HB3B 2MFQA 3U7DA 1K5GB 2YS5A 1AQCA 1DDWA 1X05A 2PZ1A 1GC6A 1MK7B 4HAYB 2DKQA 2DX5A 4ZRKA 1WGUA 4B6HA 3CXBB 4IFSA 1UPQA 3LJUX 2CODA 5EFXA 4C0AA 2Z0OA 2D10A 4IOYX 3FSSA 1KI1B 3DXDA 2M14A 5HE0A 1Q67A 4XWXA 2COCA 4KHBB 4L6EA 5HE1A 1OMWA 1U5EA 2RSGA 5C16A 4YONA 2D9VA 1LB1A 4Z2MB 2DX1A 1BWNA 2RNRB 5KQ4A 1H10A 4K17A 1U27A 2W2XD 2DLWA 3ZVRA 2D9ZA 1PMSA 2KCJA 4K2PA 3VIAA 2OQBA 3P6AA 2YF0A 2ADZA 1WI1A 2I5CA 3KRWA 2YRYA 4BBKA 2Y8GA 4HB4B 3TFMA 1DROA 1Y19B 2QKMA 4K2OA 1Z87A 2MKRA 3ULCA 4GPTB 2DTCA 3D8FA 1LW3A 3A8QA 2YT0A 2Z0QA 2JP2A 2DN6A 2DYQA 5HE2A 2X18A 1UEFA 2HTHB 5C79A 3X23A 2RUKB 3DXCA 4D0NB 4EMOA 1DDVA 1QQGA 4CHMA 5DH9B 4KHOA 2COFA 5KCVA 1W1HA 1EF1A 2K2JA 2NMBA 2YT1A 2N0YA 1J0WA 5LONB 1MK9B 1AWEA 2CY5A 2Y8FA 1NI2A 3T06A 4F7UP 5J3QA 3U8ZA 2DFKA 2G35A 2J0JA 2MDXA 3AU4A 4NSWA 4NY0A 1ZVRA 1E5WA 1V88A 4HAZB 3GYPA 2Z0PA 1MIZB 1GG3A 1EGXA 5L81A 4TYZA 4PQ0A 4Y94A 2IYBA 3ODXA 5D27A 1KZGA 1FB8A 5CLLB 1X1GA 4HATB 4HAWB 3V5WA 3FM8C 3UZTA 2J59M 4HB0B 3D8DA 1ISNA 3HQCA 3P7ZA 2HE7A 1NU2A 4GXBA 1UNPA 2J0KA 4A6FA 5GOWB 3M1IB 3SNHA 3TW1A 4A6HA 1P3RA 1V5MA 3QWMA 4MT7A 4YL8A 1BTNA 1KZ7A 3ZDTA 2XQNM 4EJNA 4IAPA 1U2BA 1MIXA 4HAVB 2D9WA 1Y5OA 4EKUA 1FGZA 4DBBA 2GCJA 2CY4A 2ZPYA 2OTXA 1M7EA 3ODOA 5JHGA 1FHXA 3KZ1A 1X11A 5DI9B 3SO6A 4WSFA 2I1KA 1XD4A 3FEHA 2BCJA 3IVFA 5D3YA 1TQZA 2D9XA 2CRFA 3G9WA 4TKNA 5DIFB 5DHFB 1FHOA 1I7AA 2YSZA 2Q13A 3AJ4A 2I1JA 1PFJA 3BINA 4ZRJA 2LOZA 2LKOA 5D3WA 1MPHA 2VKIA 2YVCA 2ELBA 1IRSA 2VSZA 1J19A 2L1CA 4ZRIA 1TJ6A 2RVBB 1V61A 3AU5A 4PNKA 1BTKA 1RRPB 4DXAB 1TXDA 2ROZB 2EJ8A 4KHAA 1P6SA 1U5FA 4HB2B 1U5DA 1GC7A 3WYFB 3CIKA 3N7CA 2D4QA 3DXEA 5JLJB 4HDOA 2RGNB 1X1FA 1BAKA 1U5GA 1P5TA 5JP4A 2H7DA 1B55A 1WGQA 2GS0A 3QBVB 1UNQA 1RJ2A 5CLQB 2YS1A 3BJIA 3O96A 3PZDA 1I2HA 4P7IA 1QC6A 3KSYA 1FAOA 3MPXA 1MKEA 3HW2B 4K81A 2KGXB 5C5BB 1ZC3B 5JHHA 2EMTA 2K00A 1XODA 4KAXB 1W1GA 2P0HA 1UPRA 1XR0B 2MWNB 2ELAA 1V89A 2I5FA 2DHJA 1NTYA 2AL6A 2M38A 2R0DA 2LG1A 4HHVA 4DX8A 3WA0A 5C5BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2W2X C;  4KVG B;  1FHW A;  5HE3 A;  3A98 B;  4GMV A;  2EC1 A;  2Y7B A;  2NZ8 B;  2K2U A;  2VRW B;  3PG7 A;  5FI0 A;  4F7H A;  2GCL A;  3ULB A;  1V5P A;  2CAY A;  2R09 A;  2N23 A;  2KUP A;  1ZM0 A;  1EVH A;  1WJ1 A;  5DHA B;  4GN1 A;  5KQ1 A;  2D9Y A;  2LUL A;  1FGY A;  4CHJ A;  2DA0 A;  1WVH A;  1SGH A;  3PVU A;  1MAI A;  4GZU A;  4GMX B;  5D3X A;  3PP2 A;  2EMS A;  3A8P A;  2LYD A;  1H4R A;  1ZC4 B;  4HDQ A;  5C6R A;  1N3H A;  2UZR A;  4A5K A;  1NTV A;  3TVV A;  1XKE A;  3HK0 A;  2AEH A;  3PVL A;  4CYE A;  2E2X A;  2V76 A;  2UZS A;  2J0M A;  3RCP A;  2GJY A;  4A6K A;  4DX9 0;  1W1D A;  2P8V A;  4MK0 A;  1V5U A;  1ZSQ A;  2COA A;  2W2W A;  2P0F A;  2H7E A;  3KY9 A;  1U29 A;  2RLO A;  1DDM A;  4H8S A;  1EAZ A;  4WVF B;  2D2Q A;  3KRX A;  3D8E A;  3NSU A;  3MDB C;  3ODW A;  3ML4 A;  4MY6 A;  3TCA A;  2QKL A;  1OY2 A;  2P0D A;  1M7R A;  3SUZ A;  5J3T A;  1XCG A;  1DBH A;  1FOE A;  3QIJ A;  5LOP B;  2DKP A;  1K5D B;  4WJ7 A;  2LOX A;  2YS3 A;  3TO1 A;  3GYO A;  2ROV A;  2DHK A;  5D3V A;  3SYX A;  2UVM A;  4HAU B;  1WG7 A;  1UNR A;  3F5R A;  3F0W A;  3SV1 A;  1SHC A;  1XX0 A;  3VOQ A;  2DHI A;  1X86 A;  3PSC A;  3PEG A;  4HAX B;  1WJM A;  3OAN A;  5J3Y A;  1DYN A;  4F7G A;  2L2I A;  2DYN A;  4A6F B;  2FJL A;  4Z2N A;  2IFS A;  5FI1 A;  1OQN A;  2D11 A;  3PVW A;  1PLS A;  4HB3 B;  2MFQ A;  3U7D A;  1K5G B;  2YS5 A;  1AQC A;  1DDW A;  1X05 A;  2PZ1 A;  1GC6 A;  1MK7 B;  4HAY B;  2DKQ A;  2DX5 A;  4ZRK A;  1WGU A;  4B6H A;  3CXB B;  4IFS A;  1UPQ A;  3LJU X;  2COD A;  5EFX A;  4C0A A;  2Z0O A;  2D10 A;  4IOY X;  3FSS A;  1KI1 B;  3DXD A;  2M14 A;  5HE0 A;  1Q67 A;  4XWX A;  2COC A;  4KHB B;  4L6E A;  5HE1 A;  1OMW A;  1U5E A;  2RSG A;  5C16 A;  4YON A;  2D9V A;  1LB1 A;  4Z2M B;  2DX1 A;  1BWN A;  2RNR B;  5KQ4 A;  1H10 A;  4K17 A;  1U27 A;  2W2X D;  2DLW A;  3ZVR A;  2D9Z A;  1PMS A;  2KCJ A;  4K2P A;  3VIA A;  2OQB A;  3P6A A;  2YF0 A;  2ADZ A;  1WI1 A;  2I5C A;  3KRW A;  2YRY A;  4BBK A;  2Y8G A;  4HB4 B;  3TFM A;  1DRO A;  1Y19 B;  2QKM A;  4K2O A;  1Z87 A;  2MKR A;  3ULC A;  4GPT B;  2DTC A;  3D8F A;  1LW3 A;  3A8Q A;  2YT0 A;  2Z0Q A;  2JP2 A;  2DN6 A;  2DYQ A;  5HE2 A;  2X18 A;  1UEF A;  2HTH B;  5C79 A;  3X23 A;  2RUK B;  3DXC A;  4D0N B;  4EMO A;  1DDV A;  1QQG A;  4CHM A;  5DH9 B;  4KHO A;  2COF A;  5KCV A;  1W1H A;  1EF1 A;  2K2J A;  2NMB A;  2YT1 A;  2N0Y A;  1J0W A;  5LON B;  1MK9 B;  1AWE A;  2CY5 A;  2Y8F A;  1NI2 A;  3T06 A;  4F7U P;  5J3Q A;  3U8Z A;  2DFK A;  2G35 A;  2J0J A;  2MDX A;  3AU4 A;  4NSW A;  4NY0 A;  1ZVR A;  1E5W A;  1V88 A;  4HAZ B;  3GYP A;  2Z0P A;  1MIZ B;  1GG3 A;  1EGX A;  5L81 A;  4TYZ A;  4PQ0 A;  4Y94 A;  2IYB A;  3ODX A;  5D27 A;  1KZG A;  1FB8 A;  5CLL B;  1X1G A;  4HAT B;  4HAW B;  3V5W A;  3FM8 C;  3UZT A;  2J59 M;  4HB0 B;  3D8D A;  1ISN A;  3HQC A;  3P7Z A;  2HE7 A;  1NU2 A;  4GXB A;  1UNP A;  2J0K A;  4A6F A;  5GOW B;  3M1I B;  3SNH A;  3TW1 A;  4A6H A;  1P3R A;  1V5M A;  3QWM A;  4MT7 A;  4YL8 A;  1BTN A;  1KZ7 A;  3ZDT A;  2XQN M;  4EJN A;  4IAP A;  1U2B A;  1MIX A;  4HAV B;  2D9W A;  1Y5O A;  4EKU A;  1FGZ A;  4DBB A;  2GCJ A;  2CY4 A;  2ZPY A;  2OTX A;  1M7E A;  3ODO A;  5JHG A;  1FHX A;  3KZ1 A;  1X11 A;  5DI9 B;  3SO6 A;  4WSF A;  2I1K A;  1XD4 A;  3FEH A;  2BCJ A;  3IVF A;  5D3Y A;  1TQZ A;  2D9X A;  2CRF A;  3G9W A;  4TKN A;  5DIF B;  5DHF B;  1FHO A;  1I7A A;  2YSZ A;  2Q13 A;  3AJ4 A;  2I1J A;  1PFJ A;  3BIN A;  4ZRJ A;  2LOZ A;  2LKO A;  5D3W A;  1MPH A;  2VKI A;  2YVC A;  2ELB A;  1IRS A;  2VSZ A;  1J19 A;  2L1C A;  4ZRI A;  1TJ6 A;  2RVB B;  1V61 A;  3AU5 A;  4PNK A;  1BTK A;  1RRP B;  4DXA B;  1TXD A;  2ROZ B;  2EJ8 A;  4KHA A;  1P6S A;  1U5F A;  4HB2 B;  1U5D A;  1GC7 A;  3WYF B;  3CIK A;  3N7C A;  2D4Q A;  3DXE A;  5JLJ B;  4HDO A;  2RGN B;  1X1F A;  1BAK A;  1U5G A;  1P5T A;  5JP4 A;  2H7D A;  1B55 A;  1WGQ A;  2GS0 A;  3QBV B;  1UNQ A;  1RJ2 A;  5CLQ B;  2YS1 A;  3BJI A;  3O96 A;  3PZD A;  1I2H A;  4P7I A;  1QC6 A;  3KSY A;  1FAO A;  3MPX A;  1MKE A;  3HW2 B;  4K81 A;  2KGX B;  5C5B B;  1ZC3 B;  5JHH A;  2EMT A;  2K00 A;  1XOD A;  4KAX B;  1W1G A;  2P0H A;  1UPR A;  1XR0 B;  2MWN B;  2ELA A;  1V89 A;  2I5F A;  2DHJ A;  1NTY A;  2AL6 A;  2M38 A;  2R0D A;  2LG1 A;  4HHV A;  4DX8 A;  3WA0 A;  5C5B A; 
#chains in the Genus database with same CATH topology
 1MI1 A;  2W2X C;  4KVG B;  1FHW A;  5HE3 A;  3A98 B;  4GMV A;  2EC1 A;  2Y7B A;  3U12 A;  2NZ8 B;  2K2U A;  3B77 A;  2VRW B;  3PG7 A;  5FI0 A;  4F7H A;  2GCL A;  3ULB A;  1V5P A;  2CAY A;  2R09 A;  2N23 A;  2KUP A;  1ZM0 A;  1EVH A;  1WJ1 A;  5DHA B;  2KIE A;  4GN1 A;  5KQ1 A;  2D9Y A;  2LUL A;  2Z59 A;  1FGY A;  4CHJ A;  5IRS A;  2DA0 A;  1WVH A;  1SGH A;  3PVU A;  1MAI A;  4GZU A;  4GMX B;  5D3X A;  3PP2 A;  2EMS A;  3A8P A;  2LYD A;  1H4R A;  1ZC4 B;  4HDQ A;  5C6R A;  1N3H A;  2UZR A;  4A5K A;  1NTV A;  3TVV A;  1XKE A;  3HK0 A;  2AEH A;  3PVL A;  4CYE A;  2E2X A;  2V76 A;  2UZS A;  2J0M A;  3RCP A;  2GJY A;  4A6K A;  4DX9 0;  1W1D A;  2K49 A;  2P8V A;  4MK0 A;  1V5U A;  1ZSQ A;  2COA A;  2W2W A;  2P0F A;  2H7E A;  3KY9 A;  1U29 A;  2RLO A;  1DDM A;  4H8S A;  1EAZ A;  4WVF B;  2D2Q A;  3KRX A;  3D8E A;  3NSU A;  3MDB C;  3ODW A;  3ML4 A;  4MY6 A;  3TCA A;  2QKL A;  1OY2 A;  2P0D A;  1M7R A;  3HIE A;  3SUZ A;  5J3T A;  1XCG A;  1DBH A;  1FOE A;  3QIJ A;  4GOU A;  5LOP B;  2DKP A;  1K5D B;  4WJ7 A;  2LOX A;  2YS3 A;  3TO1 A;  3GYO A;  2ROV A;  2DHK A;  5D3V A;  3SYX A;  2UVM A;  4HAU B;  1WG7 A;  1UNR A;  3F5R A;  3F0W A;  5LG4 B;  3SV1 A;  1SHC A;  1XX0 A;  3VOQ A;  2DHI A;  3NWF A;  1X86 A;  2ZKM X;  3PSC A;  3PEG A;  4HAX B;  1WJM A;  3OAN A;  3DCX A;  5J3Y A;  2KR0 A;  4HSI A;  1DYN A;  4F7G A;  2L2I A;  2DYN A;  4A6F B;  2FJL A;  4Z2N A;  2IFS A;  3NWA A;  4D6W A;  5FI1 A;  1OQN A;  2D11 A;  3PVW A;  1PLS A;  4HB3 B;  2MFQ A;  3U7D A;  1K5G B;  2YS5 A;  1AQC A;  1DDW A;  1X05 A;  2PZ1 A;  1GC6 A;  1MK7 B;  4HAY B;  2DKQ A;  2DX5 A;  4ZRK A;  1WGU A;  4B6H A;  3CXB B;  4IFS A;  1UPQ A;  3LJU X;  2COD A;  5EFX A;  4C0A A;  2Z0O A;  3NWD A;  2D10 A;  4IOY X;  3FSS A;  1KI1 B;  3DXD A;  2M14 A;  5HE0 A;  1Q67 A;  4XWX A;  2COC A;  4KHB B;  4L6E A;  5HE1 A;  1OMW A;  1U5E A;  5I2M A;  1T77 A;  2RSG A;  5C16 A;  4YON A;  2D9V A;  2YT2 A;  1LB1 A;  4CSQ A;  4Z2M B;  2DX1 A;  1BWN A;  2RNR B;  5KQ4 A;  1H10 A;  4K17 A;  1U27 A;  2W2X D;  4OT1 A;  2DLW A;  3ZVR A;  2D9Z A;  1PMS A;  2KCJ A;  4K2P A;  3VIA A;  2OQB A;  3P6A A;  2YF0 A;  2ADZ A;  1WI1 A;  2I5C A;  3KRW A;  2YRY A;  4QJ3 B;  4BBK A;  2Y8G A;  4HB4 B;  3TFM A;  1DRO A;  2R2Y A;  1Y19 B;  2QKM A;  4K2O A;  1Z87 A;  2MKR A;  3ULC A;  4GPT B;  2DTC A;  3D8F A;  1LW3 A;  3A8Q A;  2YT0 A;  2Z0Q A;  2JP2 A;  5M4Y B;  2DN6 A;  2DYQ A;  5HE2 A;  2X18 A;  1UEF A;  2HTH B;  5C79 A;  3X23 A;  2RUK B;  3DXC A;  4D0N B;  4EMO A;  1DDV A;  1QQG A;  4CHM A;  4KHB A;  5DH9 B;  4KHO A;  2COF A;  5KCV A;  1W1H A;  1EF1 A;  2K2J A;  2NMB A;  2YT1 A;  2N0Y A;  1J0W A;  5LON B;  1MK9 B;  1AWE A;  2CY5 A;  2Y8F A;  1NI2 A;  3T06 A;  4F7U P;  5J3Q A;  3U8Z A;  2DFK A;  2G35 A;  2J0J A;  2MDX A;  3AU4 A;  4NSW A;  4NY0 A;  1ZVR A;  1E5W A;  1V88 A;  4HAZ B;  3GYP A;  2Z0P A;  1MIZ B;  1GG3 A;  1EGX A;  4QJ4 B;  5L81 A;  4TYZ A;  4PQ0 A;  4Y94 A;  2IYB A;  3ODX A;  5D27 A;  1KZG A;  1FB8 A;  5CLL B;  1X1G A;  4HAT B;  4HAW B;  3V5W A;  3FM8 C;  3UZT A;  2J59 M;  4OSN A;  4HB0 B;  3D8D A;  1ISN A;  3HQC A;  3P7Z A;  2HE7 A;  1NU2 A;  4GXB A;  1UNP A;  2J0K A;  4A6F A;  5GOW B;  3M1I B;  3SNH A;  3TW1 A;  4A6H A;  1P3R A;  1V5M A;  3QWM A;  4MT7 A;  4YL8 A;  1BTN A;  1KZ7 A;  2FJU B;  3ZDT A;  2XQN M;  4EJN A;  2K8E A;  3A58 A;  4IAP A;  1U2B A;  1MIX A;  4HAV B;  2D9W A;  1Y5O A;  4EKU A;  1FGZ A;  4QJ5 B;  4DBB A;  2GCJ A;  2CY4 A;  2ZPY A;  2OTX A;  1M7E A;  3ODO A;  5JHG A;  2KIG A;  1FHX A;  3KZ1 A;  1X11 A;  5DI9 B;  2Z4D A;  3SO6 A;  4WSF A;  2I1K A;  2GUM A;  1XD4 A;  2NBV A;  3FEH A;  2Z13 A;  2BCJ A;  3IVF A;  5D3Y A;  1TQZ A;  2D9X A;  2CRF A;  3G9W A;  4TKN A;  5DIF B;  5DHF B;  1FHO A;  1I7A A;  2YSZ A;  2Q13 A;  3AJ4 A;  2I1J A;  1PFJ A;  3BIN A;  3NW8 A;  4ZRJ A;  2LOZ A;  2LKO A;  5D3W A;  1MPH A;  2VKI A;  2YVC A;  2ELB A;  1IRS A;  2VSZ A;  1J19 A;  3OHM B;  2L1C A;  4DIX A;  4ZRI A;  1TJ6 A;  2RVB B;  2RRF A;  1V61 A;  3AU5 A;  4PNK A;  1BTK A;  1RRP B;  4DXA B;  1TXD A;  2ROZ B;  2EJ8 A;  4KHA A;  1P6S A;  1U5F A;  4HB2 B;  1U5D A;  1GC7 A;  3WYF B;  3CIK A;  3N7C A;  2D4Q A;  4GNK B;  3DXE A;  5JLJ B;  4HDO A;  2RGN B;  1X1F A;  1BAK A;  1U5G A;  1P5T A;  5JP4 A;  2H7D A;  1B55 A;  1WGQ A;  2GS0 A;  3QBV B;  1UNQ A;  1RJ2 A;  5CLQ B;  2YS1 A;  3BJI A;  3O96 A;  3PZD A;  1I2H A;  3HSA A;  4P7I A;  1QC6 A;  3KSY A;  1FAO A;  3MPX A;  1MKE A;  3HW2 B;  4K81 A;  2KGX B;  5C5B B;  1ZC3 B;  5JHH A;  2EMT A;  2K00 A;  1XOD A;  4KAX B;  5I2S A;  1W1G A;  2P0H A;  1UPR A;  2KUQ A;  3FVC A;  1XR0 B;  2MWN B;  2ELA A;  1V89 A;  2I5F A;  2DHJ A;  1NTY A;  4QXA B;  2AL6 A;  4L1R A;  2M38 A;  2R0D A;  2LG1 A;  4HHV A;  4DX8 A;  3WA0 A;  1ZYI A;  5C5B A;  2Z14 A; 
#chains in the Genus database with same CATH homology
 2W2X C;  4KVG B;  1FHW A;  5HE3 A;  3A98 B;  4GMV A;  2EC1 A;  2Y7B A;  2NZ8 B;  2K2U A;  2VRW B;  3PG7 A;  5FI0 A;  4F7H A;  2GCL A;  3ULB A;  1V5P A;  2CAY A;  2R09 A;  2N23 A;  2KUP A;  1ZM0 A;  1EVH A;  1WJ1 A;  5DHA B;  4GN1 A;  5KQ1 A;  2D9Y A;  2LUL A;  1FGY A;  4CHJ A;  2DA0 A;  1WVH A;  1SGH A;  3PVU A;  1MAI A;  4GZU A;  4GMX B;  5D3X A;  3PP2 A;  2EMS A;  3A8P A;  2LYD A;  1H4R A;  1ZC4 B;  4HDQ A;  5C6R A;  1N3H A;  2UZR A;  4A5K A;  1NTV A;  3TVV A;  1XKE A;  3HK0 A;  2AEH A;  3PVL A;  4CYE A;  2E2X A;  2V76 A;  2UZS A;  2J0M A;  3RCP A;  2GJY A;  4A6K A;  4DX9 0;  1W1D A;  2P8V A;  4MK0 A;  1V5U A;  1ZSQ A;  2COA A;  2W2W A;  2P0F A;  2H7E A;  3KY9 A;  1U29 A;  2RLO A;  1DDM A;  4H8S A;  1EAZ A;  4WVF B;  2D2Q A;  3KRX A;  3D8E A;  3NSU A;  3MDB C;  3ODW A;  3ML4 A;  4MY6 A;  3TCA A;  2QKL A;  1OY2 A;  2P0D A;  1M7R A;  3SUZ A;  5J3T A;  1XCG A;  1DBH A;  1FOE A;  3QIJ A;  5LOP B;  2DKP A;  1K5D B;  4WJ7 A;  2LOX A;  2YS3 A;  3TO1 A;  3GYO A;  2ROV A;  2DHK A;  5D3V A;  3SYX A;  2UVM A;  4HAU B;  1WG7 A;  1UNR A;  3F5R A;  3F0W A;  3SV1 A;  1SHC A;  1XX0 A;  3VOQ A;  2DHI A;  1X86 A;  3PSC A;  3PEG A;  4HAX B;  1WJM A;  3OAN A;  5J3Y A;  1DYN A;  4F7G A;  2L2I A;  2DYN A;  4A6F B;  2FJL A;  4Z2N A;  2IFS A;  5FI1 A;  1OQN A;  2D11 A;  3PVW A;  1PLS A;  4HB3 B;  2MFQ A;  3U7D A;  1K5G B;  2YS5 A;  1AQC A;  1DDW A;  1X05 A;  2PZ1 A;  1GC6 A;  1MK7 B;  4HAY B;  2DKQ A;  2DX5 A;  4ZRK A;  1WGU A;  4B6H A;  3CXB B;  4IFS A;  1UPQ A;  3LJU X;  2COD A;  5EFX A;  4C0A A;  2Z0O A;  2D10 A;  4IOY X;  3FSS A;  1KI1 B;  3DXD A;  2M14 A;  5HE0 A;  1Q67 A;  4XWX A;  2COC A;  4KHB B;  4L6E A;  5HE1 A;  1OMW A;  1U5E A;  2RSG A;  5C16 A;  4YON A;  2D9V A;  1LB1 A;  4Z2M B;  2DX1 A;  1BWN A;  2RNR B;  5KQ4 A;  1H10 A;  4K17 A;  1U27 A;  2W2X D;  2DLW A;  3ZVR A;  2D9Z A;  1PMS A;  2KCJ A;  4K2P A;  3VIA A;  2OQB A;  3P6A A;  2YF0 A;  2ADZ A;  1WI1 A;  2I5C A;  3KRW A;  2YRY A;  4BBK A;  2Y8G A;  4HB4 B;  3TFM A;  1DRO A;  1Y19 B;  2QKM A;  4K2O A;  1Z87 A;  2MKR A;  3ULC A;  4GPT B;  2DTC A;  3D8F A;  1LW3 A;  3A8Q A;  2YT0 A;  2Z0Q A;  2JP2 A;  2DN6 A;  2DYQ A;  5HE2 A;  2X18 A;  1UEF A;  2HTH B;  5C79 A;  3X23 A;  2RUK B;  3DXC A;  4D0N B;  4EMO A;  1DDV A;  1QQG A;  4CHM A;  5DH9 B;  4KHO A;  2COF A;  5KCV A;  1W1H A;  1EF1 A;  2K2J A;  2NMB A;  2YT1 A;  2N0Y A;  1J0W A;  5LON B;  1MK9 B;  1AWE A;  2CY5 A;  2Y8F A;  1NI2 A;  3T06 A;  4F7U P;  5J3Q A;  3U8Z A;  2DFK A;  2G35 A;  2J0J A;  2MDX A;  3AU4 A;  4NSW A;  4NY0 A;  1ZVR A;  1E5W A;  1V88 A;  4HAZ B;  3GYP A;  2Z0P A;  1MIZ B;  1GG3 A;  1EGX A;  5L81 A;  4TYZ A;  4PQ0 A;  4Y94 A;  2IYB A;  3ODX A;  5D27 A;  1KZG A;  1FB8 A;  5CLL B;  1X1G A;  4HAT B;  4HAW B;  3V5W A;  3FM8 C;  3UZT A;  2J59 M;  4HB0 B;  3D8D A;  1ISN A;  3HQC A;  3P7Z A;  2HE7 A;  1NU2 A;  4GXB A;  1UNP A;  2J0K A;  4A6F A;  5GOW B;  3M1I B;  3SNH A;  3TW1 A;  4A6H A;  1P3R A;  1V5M A;  3QWM A;  4MT7 A;  4YL8 A;  1BTN A;  1KZ7 A;  3ZDT A;  2XQN M;  4EJN A;  4IAP A;  1U2B A;  1MIX A;  4HAV B;  2D9W A;  1Y5O A;  4EKU A;  1FGZ A;  4DBB A;  2GCJ A;  2CY4 A;  2ZPY A;  2OTX A;  1M7E A;  3ODO A;  5JHG A;  1FHX A;  3KZ1 A;  1X11 A;  5DI9 B;  3SO6 A;  4WSF A;  2I1K A;  1XD4 A;  3FEH A;  2BCJ A;  3IVF A;  5D3Y A;  1TQZ A;  2D9X A;  2CRF A;  3G9W A;  4TKN A;  5DIF B;  5DHF B;  1FHO A;  1I7A A;  2YSZ A;  2Q13 A;  3AJ4 A;  2I1J A;  1PFJ A;  3BIN A;  4ZRJ A;  2LOZ A;  2LKO A;  5D3W A;  1MPH A;  2VKI A;  2YVC A;  2ELB A;  1IRS A;  2VSZ A;  1J19 A;  2L1C A;  4ZRI A;  1TJ6 A;  2RVB B;  1V61 A;  3AU5 A;  4PNK A;  1BTK A;  1RRP B;  4DXA B;  1TXD A;  2ROZ B;  2EJ8 A;  4KHA A;  1P6S A;  1U5F A;  4HB2 B;  1U5D A;  1GC7 A;  3WYF B;  3CIK A;  3N7C A;  2D4Q A;  3DXE A;  5JLJ B;  4HDO A;  2RGN B;  1X1F A;  1BAK A;  1U5G A;  1P5T A;  5JP4 A;  2H7D A;  1B55 A;  1WGQ A;  2GS0 A;  3QBV B;  1UNQ A;  1RJ2 A;  5CLQ B;  2YS1 A;  3BJI A;  3O96 A;  3PZD A;  1I2H A;  4P7I A;  1QC6 A;  3KSY A;  1FAO A;  3MPX A;  1MKE A;  3HW2 B;  4K81 A;  2KGX B;  5C5B B;  1ZC3 B;  5JHH A;  2EMT A;  2K00 A;  1XOD A;  4KAX B;  1W1G A;  2P0H A;  1UPR A;  1XR0 B;  2MWN B;  2ELA A;  1V89 A;  2I5F A;  2DHJ A;  1NTY A;  2AL6 A;  2M38 A;  2R0D A;  2LG1 A;  4HHV A;  4DX8 A;  3WA0 A;  5C5B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...