2LOZA

The novel binding mode of dlc1 and tensin2 ptb domain
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
147
structure length
147
Chain Sequence
MSTAADLLRQGAACSVLYLTSVETESLTGPQAVARASSAALSCSPRPTPAVVHFKVSAQGITLTDNQRKLFFRRHYPVNSITFSSTDPQDRRWTNPDGTTSKIFGFVAKKPGSPWENVCHLFAELDPDQPAGAIVTFITKVLLGQRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase/hydrolase activator
molecule keywords Tensin-like C1 domain-containing phosphatase
publication title Solution structure of the PTB domain of human Tensin2 in complex with deleted in liver cancer 1 (DLC1) peptide reveals a novel peptide binding mode
doi rcsb
source organism Homo sapiens
total genus 25
structure length 147
sequence length 147
ec nomenclature ec 3.1.3.-:
pdb deposition date 2012-01-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08416 PTB Phosphotyrosine-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2lozA00
2J0KA 5D3YA 3TW1A 1MAIA 2ROVA 5LONB 1U2BA 1OMWA 4HB2B 2P0FA 4DX8A 3PEGA 2DFKA 2XQNM 3PVLA 3DXCA 3OANA 2HTHB 4F7GA 1OQNA 3WA0A 2KUPA 2DN6A 4C0AA 2DX1A 2VSZA 3KRXA 1U5FA 2Z0PA 1K5GB 2YRYA 4F7HA 4A5KA 2NZ8B 4HAZB 2Z0OA 5HE1A 5JHHA 3CIKA 5DHAB 1X1FA 2Y8FA 3VOQA 2MDXA 2CODA 2EMTA 5L81A 4K2PA 4NSWA 2P8VA 3A8PA 3ODXA 1WVHA 2IYBA 4GXBA 3PVWA 2W2XC 1V5MA 4CHMA 3PG7A 4GZUA 2CAYA 2D11A 3O96A 4MY6A 4HHVA 5LOPB 5DIFB 4TYZA 1DDMA 1ISNA 1KI1B 1P5TA 1I7AA 4ZRKA 2DHIA 2DLWA 4GPTB 2Q13A 2KGXB 4HAWB 3WYFB 3SUZA 2RSGA 2DKPA 3AU5A 2JP2A 3AU4A 2H7DA 3ZDTA 1V89A 3QBVB 1P6SA 2YF0A 3AJ4A 1U29A 3PZDA 2D9VA 1WJ1A 1EGXA 2N23A 1Y5OA 2LULA 5HE3A 3M1IB 5KQ1A 2UVMA 4A6KA 5KCVA 3ULCA 4GN1A 5DHFB 4HAXB 2IFSA 2COCA 2J59M 3QIJA 5FI0A 3TO1A 5C6RA 4HB3B 1OY2A 3PVUA 1IRSA 1PFJA 1MK7B 1XKEA 3ZVRA 1N3HA 1EF1A 2D9WA 2I5CA 2L1CA 2LKOA 3MDBC 1MKEA 2V76A 1X05A 1KZ7A 5GOWB 2YS1A 4EJNA 1NTYA 3SNHA 2I1JA 1V61A 3G9WA 3DXDA 1W1HA 1ZC4B 2DA0A 3GYOA 2M38A 4EKUA 2LOXA 3A98B 3X23A 3N7CA 3ODWA 4HB4B 4Y94A 2DHJA 1J0WA 1U27A 1B55A 2RNRB 3KZ1A 3KSYA 1MK9B 1M7EA 3HK0A 3ODOA 3D8FA 2CRFA 1MIXA 1X86A 4CHJA 1WI1A 4KAXB 1FAOA 1GG3A 1RRPB 5CLLB 1X1GA 3PP2A 1MPHA 3KRWA 2ROZB 5C79A 4K81A 2GS0A 2Y8GA 4A6HA 1UPRA 1XX0A 3LJUX 4IAPA 4MT7A 5HE2A 5D3VA 2DYNA 2EC1A 2D2QA 3P7ZA 4D0NB 4A6FB 3ULBA 2J0JA 2FJLA 3F0WA 4DX90 3RCPA 2M14A 1FHXA 1TJ6A 2Z0QA 5DH9B 2COAA 4GMXB 2MFQA 2ZPYA 1WG7A 2K2UA 5J3TA 5KQ4A 4A6FA 5C16A 1QQGA 2LYDA 2MWNB 4BBKA 1J19A 3DXEA 1XCGA 4PQ0A 4DBBA 3PSCA 2GJYA 1WJMA 3U8ZA 2YVCA 4KHBB 3SO6A 3CXBB 1BWNA 2QKMA 4HAUB 1LW3A 1DBHA 1KZGA 2RVBB 1Z87A 1K5DB 2ELAA 3T06A 4XWXA 4YL8A 2ADZA 1BTKA 4NY0A 2AL6A 2UZRA 3HW2B 1DROA 1FB8A 1NI2A 5JP4A 3UZTA 4HAYB 1TXDA 1UEFA 1U5GA 2I5FA 4H8SA 4KHOA 1WGQA 2YT0A 1DDVA 1AWEA 1I2HA 2W2XD 3HQCA 4GMVA 2D9XA 1H10A 4Z2NA 1W1DA 4HDOA 5FI1A 4EMOA 2J0MA 1GC6A 2W2WA 1MIZB 2K2JA 1RJ2A 2D4QA 1W1GA 3D8DA 1FOEA 1V5UA 3KY9A 1Y19B 3ML4A 2DX5A 2P0HA 1PLSA 1P3RA 2YS3A 1U5DA 1ZSQA 2K00A 1UNQA 2DKQA 1FHWA 4Z2MB 1AQCA 4PNKA 1PMSA 5DI9B 2D10A 2X18A 3NSUA 3P6AA 4K2OA 4ZRIA 1GC7A 3SV1A 2ELBA 4B6HA 4DXAB 4P7IA 2UZSA 5D3XA 1ZC3B 1DDWA 2PZ1A 1SGHA 2L2IA 5JLJB 4HB0B 3A8QA 3F5RA 1V5PA 1WGUA 1SHCA 1H4RA 1BAKA 2VKIA 1EVHA 2EJ8A 2I1KA 2N0YA 4CYEA 2YT1A 1E5WA 2R0DA 4IOYX 1XODA 1LB1A 3D8EA 3FSSA 3BINA 2D9YA 1Q67A 2DHKA 4YONA 1FGYA 2GCJA 3SYXA 2P0DA 2RGNB 4TKNA 2R09A 1FGZA 2VRWB 1EAZA 3MPXA 2CY4A 3V5WA 2MKRA 1U5EA 2CY5A 1UNRA 2OTXA 2HE7A 2OQBA 4KHAA 2BCJA 5C5BB 1NTVA 5EFXA 1X11A 3IVFA 5D27A 1V88A 3VIAA 5D3WA 2DTCA 1UNPA 3FEHA 1ZM0A 4HDQA 3GYPA 2RLOA 1M7RA 4WJ7A 1FHOA 5JHGA 2QKLA 1TQZA 2KCJA 2GCLA 1XR0B 1DYNA 3QWMA 2DYQA 5C5BA 1UPQA 3BJIA 2G35A 4HAVB 5J3QA 2AEHA 5CLQB 4WSFA 2RUKB 2LG1A 5HE0A 4WVFB 3FM8C 3TVVA 3TFMA 4IFSA 3U7DA 2YSZA 1QC6A 2NMBA 2LOZA 2Y7BA 1XD4A 3TCAA 2E2XA 2H7EA 1ZVRA 4ZRJA 4F7UP 5J3YA 1BTNA 2COFA 2EMSA 4K17A 4L6EA 2D9ZA 4MK0A 4KVGB 2YS5A 1NU2A 4HATB
chains in the Genus database with same CATH superfamily
2J0KA 5D3YA 3TW1A 1MAIA 2ROVA 5LONB 2KIEA 1U2BA 1OMWA 4HB2B 2P0FA 4DX8A 5IRSA 3PEGA 2DFKA 2XQNM 3PVLA 3DXCA 3OANA 2HTHB 4F7GA 1OQNA 3WA0A 2KUPA 3NWAA 2DN6A 4C0AA 2DX1A 2VSZA 3KRXA 1U5FA 2YT2A 2Z0PA 1K5GB 2YRYA 4F7HA 4A5KA 2NZ8B 4HAZB 2Z0OA 5HE1A 5I2SA 5JHHA 3CIKA 5DHAB 1X1FA 2Y8FA 3VOQA 2MDXA 2CODA 2EMTA 3NWFA 5L81A 4K2PA 4D6WA 4NSWA 2P8VA 3A8PA 3ODXA 1WVHA 2IYBA 4GXBA 3PVWA 2W2XC 1V5MA 5LG4B 4CHMA 1T77A 3PG7A 4GZUA 2CAYA 2D11A 3O96A 4MY6A 4HHVA 5LOPB 5DIFB 4TYZA 1DDMA 1ISNA 1KI1B 1P5TA 1I7AA 4ZRKA 2DHIA 2DLWA 4GPTB 2Q13A 2KGXB 4HAWB 3WYFB 1MI1A 3SUZA 2RSGA 2Z13A 2DKPA 3AU5A 3B77A 2JP2A 3AU4A 2H7DA 3ZDTA 1V89A 3QBVB 2Z14A 1P6SA 2YF0A 3AJ4A 1U29A 3PZDA 2D9VA 1WJ1A 1EGXA 2N23A 4KHBA 1Y5OA 2LULA 5HE3A 3M1IB 5KQ1A 2UVMA 4A6KA 4DIXA 2FJUB 5KCVA 3ULCA 4GN1A 5DHFB 4HAXB 2KIGA 2IFSA 2COCA 2J59M 3QIJA 5FI0A 3TO1A 5C6RA 4HB3B 1OY2A 3PVUA 1IRSA 1PFJA 1MK7B 1XKEA 3ZVRA 1N3HA 1EF1A 2D9WA 2I5CA 2L1CA 2LKOA 3MDBC 1MKEA 2V76A 1X05A 3NWDA 1KZ7A 5GOWB 2YS1A 4EJNA 1NTYA 3SNHA 2I1JA 1V61A 3G9WA 3DXDA 1W1HA 1ZC4B 3U12A 2DA0A 3GYOA 2M38A 4EKUA 2LOXA 3A98B 3X23A 3N7CA 3ODWA 4HB4B 4Y94A 2DHJA 4GOUA 1J0WA 1U27A 1B55A 2RNRB 4L1RA 3KZ1A 3KSYA 1MK9B 1M7EA 3HK0A 3ODOA 3D8FA 2CRFA 2KUQA 1MIXA 1X86A 4CHJA 1WI1A 4KAXB 1FAOA 1GG3A 1RRPB 5CLLB 1X1GA 3PP2A 1MPHA 3KRWA 2ROZB 5C79A 4K81A 2GS0A 3NW8A 2Y8GA 4A6HA 1UPRA 1XX0A 3LJUX 4IAPA 4MT7A 5HE2A 5D3VA 2DYNA 2EC1A 2D2QA 3P7ZA 4D0NB 4A6FB 4OT1A 3ULBA 2J0JA 4OSNA 2FJLA 3F0WA 4DX90 2K49A 3RCPA 2M14A 1FHXA 1TJ6A 2Z0QA 5DH9B 2COAA 4GMXB 2MFQA 2ZPYA 1WG7A 2K2UA 5J3TA 5KQ4A 4A6FA 1ZYIA 5C16A 1QQGA 2LYDA 2MWNB 4BBKA 1J19A 3DXEA 1XCGA 4PQ0A 4DBBA 2GUMA 3PSCA 2GJYA 2Z59A 1WJMA 2R2YA 3U8ZA 2YVCA 4KHBB 3SO6A 3CXBB 1BWNA 2QKMA 4HAUB 1LW3A 1DBHA 1KZGA 2RVBB 1Z87A 2RRFA 1K5DB 2ELAA 3T06A 4XWXA 4YL8A 2ADZA 3OHMB 1BTKA 4NY0A 4CSQA 2AL6A 2UZRA 3HW2B 3DCXA 1DROA 1FB8A 1NI2A 5JP4A 3UZTA 4HAYB 1TXDA 1UEFA 1U5GA 2I5FA 4H8SA 4KHOA 1WGQA 3FVCA 2YT0A 1DDVA 1AWEA 1I2HA 5I2MA 2W2XD 3HQCA 4GMVA 2D9XA 1H10A 4Z2NA 1W1DA 4HDOA 5FI1A 4EMOA 2J0MA 1GC6A 2W2WA 1MIZB 2Z4DA 2K2JA 1RJ2A 2D4QA 1W1GA 3D8DA 4QJ4B 1FOEA 1V5UA 3KY9A 1Y19B 3ML4A 2DX5A 3HSAA 2P0HA 1PLSA 1P3RA 2YS3A 1U5DA 1ZSQA 2K00A 1UNQA 2DKQA 2K8EA 1FHWA 4Z2MB 1AQCA 4PNKA 1PMSA 5DI9B 2D10A 2X18A 3NSUA 3P6AA 4K2OA 4ZRIA 1GC7A 3SV1A 2ELBA 4B6HA 4QJ5B 4DXAB 4P7IA 2UZSA 5D3XA 1ZC3B 1DDWA 2PZ1A 1SGHA 2L2IA 5M4YB 5JLJB 4HB0B 3A8QA 3F5RA 1V5PA 1WGUA 1SHCA 1H4RA 4QJ3B 1BAKA 2VKIA 1EVHA 2EJ8A 2I1KA 2N0YA 4CYEA 2YT1A 1E5WA 3HIEA 2R0DA 4IOYX 1XODA 1LB1A 2NBVA 2KR0A 3D8EA 3FSSA 3BINA 3A58A 2D9YA 1Q67A 2DHKA 4YONA 1FGYA 2GCJA 3SYXA 2P0DA 2RGNB 4TKNA 4GNKB 2R09A 1FGZA 2VRWB 1EAZA 3MPXA 2CY4A 3V5WA 2MKRA 1U5EA 2CY5A 1UNRA 2OTXA 4QXAB 2HE7A 2OQBA 4KHAA 2BCJA 5C5BB 1NTVA 5EFXA 1X11A 3IVFA 4HSIA 5D27A 1V88A 3VIAA 5D3WA 2ZKMX 2DTCA 1UNPA 3FEHA 1ZM0A 4HDQA 3GYPA 2RLOA 1M7RA 4WJ7A 1FHOA 5JHGA 2QKLA 1TQZA 2KCJA 2GCLA 1XR0B 1DYNA 3QWMA 2DYQA 5C5BA 1UPQA 3BJIA 2G35A 4HAVB 5J3QA 2AEHA 5CLQB 4WSFA 2RUKB 2LG1A 5HE0A 4WVFB 3FM8C 3TVVA 3TFMA 4IFSA 3U7DA 2YSZA 1QC6A 2NMBA 2LOZA 2Y7BA 1XD4A 3TCAA 2E2XA 2H7EA 1ZVRA 4ZRJA 4F7UP 5J3YA 1BTNA 2COFA 2EMSA 4K17A 4L6EA 2D9ZA 4MK0A 4KVGB 2YS5A 1NU2A 4HATB
chains in the Genus database with same CATH topology
2J0KA 5D3YA 3TW1A 1MAIA 2ROVA 5LONB 1U2BA 1OMWA 4HB2B 2P0FA 4DX8A 3PEGA 2DFKA 2XQNM 3PVLA 3DXCA 3OANA 2HTHB 4F7GA 1OQNA 3WA0A 2KUPA 2DN6A 4C0AA 2DX1A 2VSZA 3KRXA 1U5FA 2Z0PA 1K5GB 2YRYA 4F7HA 4A5KA 2NZ8B 4HAZB 2Z0OA 5HE1A 5JHHA 3CIKA 5DHAB 1X1FA 2Y8FA 3VOQA 2MDXA 2CODA 2EMTA 5L81A 4K2PA 4NSWA 2P8VA 3A8PA 3ODXA 1WVHA 2IYBA 4GXBA 3PVWA 2W2XC 1V5MA 4CHMA 3PG7A 4GZUA 2CAYA 2D11A 3O96A 4MY6A 4HHVA 5LOPB 5DIFB 4TYZA 1DDMA 1ISNA 1KI1B 1P5TA 1I7AA 4ZRKA 2DHIA 2DLWA 4GPTB 2Q13A 2KGXB 4HAWB 3WYFB 3SUZA 2RSGA 2DKPA 3AU5A 2JP2A 3AU4A 2H7DA 3ZDTA 1V89A 3QBVB 1P6SA 2YF0A 3AJ4A 1U29A 3PZDA 2D9VA 1WJ1A 1EGXA 2N23A 1Y5OA 2LULA 5HE3A 3M1IB 5KQ1A 2UVMA 4A6KA 5KCVA 3ULCA 4GN1A 5DHFB 4HAXB 2IFSA 2COCA 2J59M 3QIJA 5FI0A 3TO1A 5C6RA 4HB3B 1OY2A 3PVUA 1IRSA 1PFJA 1MK7B 1XKEA 3ZVRA 1N3HA 1EF1A 2D9WA 2I5CA 2L1CA 2LKOA 3MDBC 1MKEA 2V76A 1X05A 1KZ7A 5GOWB 2YS1A 4EJNA 1NTYA 3SNHA 2I1JA 1V61A 3G9WA 3DXDA 1W1HA 1ZC4B 2DA0A 3GYOA 2M38A 4EKUA 2LOXA 3A98B 3X23A 3N7CA 3ODWA 4HB4B 4Y94A 2DHJA 1J0WA 1U27A 1B55A 2RNRB 3KZ1A 3KSYA 1MK9B 1M7EA 3HK0A 3ODOA 3D8FA 2CRFA 1MIXA 1X86A 4CHJA 1WI1A 4KAXB 1FAOA 1GG3A 1RRPB 5CLLB 1X1GA 3PP2A 1MPHA 3KRWA 2ROZB 5C79A 4K81A 2GS0A 2Y8GA 4A6HA 1UPRA 1XX0A 3LJUX 4IAPA 4MT7A 5HE2A 5D3VA 2DYNA 2EC1A 2D2QA 3P7ZA 4D0NB 4A6FB 3ULBA 2J0JA 2FJLA 3F0WA 4DX90 3RCPA 2M14A 1FHXA 1TJ6A 2Z0QA 5DH9B 2COAA 4GMXB 2MFQA 2ZPYA 1WG7A 2K2UA 5J3TA 5KQ4A 4A6FA 5C16A 1QQGA 2LYDA 2MWNB 4BBKA 1J19A 3DXEA 1XCGA 4PQ0A 4DBBA 3PSCA 2GJYA 1WJMA 3U8ZA 2YVCA 4KHBB 3SO6A 3CXBB 1BWNA 2QKMA 4HAUB 1LW3A 1DBHA 1KZGA 2RVBB 1Z87A 1K5DB 2ELAA 3T06A 4XWXA 4YL8A 2ADZA 1BTKA 4NY0A 2AL6A 2UZRA 3HW2B 1DROA 1FB8A 1NI2A 5JP4A 3UZTA 4HAYB 1TXDA 1UEFA 1U5GA 2I5FA 4H8SA 4KHOA 1WGQA 2YT0A 1DDVA 1AWEA 1I2HA 2W2XD 3HQCA 4GMVA 2D9XA 1H10A 4Z2NA 1W1DA 4HDOA 5FI1A 4EMOA 2J0MA 1GC6A 2W2WA 1MIZB 2K2JA 1RJ2A 2D4QA 1W1GA 3D8DA 1FOEA 1V5UA 3KY9A 1Y19B 3ML4A 2DX5A 2P0HA 1PLSA 1P3RA 2YS3A 1U5DA 1ZSQA 2K00A 1UNQA 2DKQA 1FHWA 4Z2MB 1AQCA 4PNKA 1PMSA 5DI9B 2D10A 2X18A 3NSUA 3P6AA 4K2OA 4ZRIA 1GC7A 3SV1A 2ELBA 4B6HA 4DXAB 4P7IA 2UZSA 5D3XA 1ZC3B 1DDWA 2PZ1A 1SGHA 2L2IA 5JLJB 4HB0B 3A8QA 3F5RA 1V5PA 1WGUA 1SHCA 1H4RA 1BAKA 2VKIA 1EVHA 2EJ8A 2I1KA 2N0YA 4CYEA 2YT1A 1E5WA 2R0DA 4IOYX 1XODA 1LB1A 3D8EA 3FSSA 3BINA 2D9YA 1Q67A 2DHKA 4YONA 1FGYA 2GCJA 3SYXA 2P0DA 2RGNB 4TKNA 2R09A 1FGZA 2VRWB 1EAZA 3MPXA 2CY4A 3V5WA 2MKRA 1U5EA 2CY5A 1UNRA 2OTXA 2HE7A 2OQBA 4KHAA 2BCJA 5C5BB 1NTVA 5EFXA 1X11A 3IVFA 5D27A 1V88A 3VIAA 5D3WA 2DTCA 1UNPA 3FEHA 1ZM0A 4HDQA 3GYPA 2RLOA 1M7RA 4WJ7A 1FHOA 5JHGA 2QKLA 1TQZA 2KCJA 2GCLA 1XR0B 1DYNA 3QWMA 2DYQA 5C5BA 1UPQA 3BJIA 2G35A 4HAVB 5J3QA 2AEHA 5CLQB 4WSFA 2RUKB 2LG1A 5HE0A 4WVFB 3FM8C 3TVVA 3TFMA 4IFSA 3U7DA 2YSZA 1QC6A 2NMBA 2LOZA 2Y7BA 1XD4A 3TCAA 2E2XA 2H7EA 1ZVRA 4ZRJA 4F7UP 5J3YA 1BTNA 2COFA 2EMSA 4K17A 4L6EA 2D9ZA 4MK0A 4KVGB 2YS5A 1NU2A 4HATB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2J0K A;  5D3Y A;  3TW1 A;  1MAI A;  2ROV A;  5LON B;  1U2B A;  1OMW A;  4HB2 B;  2P0F A;  4DX8 A;  3PEG A;  2DFK A;  2XQN M;  3PVL A;  3DXC A;  3OAN A;  2HTH B;  4F7G A;  1OQN A;  3WA0 A;  2KUP A;  2DN6 A;  4C0A A;  2DX1 A;  2VSZ A;  3KRX A;  1U5F A;  2Z0P A;  1K5G B;  2YRY A;  4F7H A;  4A5K A;  2NZ8 B;  4HAZ B;  2Z0O A;  5HE1 A;  5JHH A;  3CIK A;  5DHA B;  1X1F A;  2Y8F A;  3VOQ A;  2MDX A;  2COD A;  2EMT A;  5L81 A;  4K2P A;  4NSW A;  2P8V A;  3A8P A;  3ODX A;  1WVH A;  2IYB A;  4GXB A;  3PVW A;  2W2X C;  1V5M A;  4CHM A;  3PG7 A;  4GZU A;  2CAY A;  2D11 A;  3O96 A;  4MY6 A;  4HHV A;  5LOP B;  5DIF B;  4TYZ A;  1DDM A;  1ISN A;  1KI1 B;  1P5T A;  1I7A A;  4ZRK A;  2DHI A;  2DLW A;  4GPT B;  2Q13 A;  2KGX B;  4HAW B;  3WYF B;  3SUZ A;  2RSG A;  2DKP A;  3AU5 A;  2JP2 A;  3AU4 A;  2H7D A;  3ZDT A;  1V89 A;  3QBV B;  1P6S A;  2YF0 A;  3AJ4 A;  1U29 A;  3PZD A;  2D9V A;  1WJ1 A;  1EGX A;  2N23 A;  1Y5O A;  2LUL A;  5HE3 A;  3M1I B;  5KQ1 A;  2UVM A;  4A6K A;  5KCV A;  3ULC A;  4GN1 A;  5DHF B;  4HAX B;  2IFS A;  2COC A;  2J59 M;  3QIJ A;  5FI0 A;  3TO1 A;  5C6R A;  4HB3 B;  1OY2 A;  3PVU A;  1IRS A;  1PFJ A;  1MK7 B;  1XKE A;  3ZVR A;  1N3H A;  1EF1 A;  2D9W A;  2I5C A;  2L1C A;  2LKO A;  3MDB C;  1MKE A;  2V76 A;  1X05 A;  1KZ7 A;  5GOW B;  2YS1 A;  4EJN A;  1NTY A;  3SNH A;  2I1J A;  1V61 A;  3G9W A;  3DXD A;  1W1H A;  1ZC4 B;  2DA0 A;  3GYO A;  2M38 A;  4EKU A;  2LOX A;  3A98 B;  3X23 A;  3N7C A;  3ODW A;  4HB4 B;  4Y94 A;  2DHJ A;  1J0W A;  1U27 A;  1B55 A;  2RNR B;  3KZ1 A;  3KSY A;  1MK9 B;  1M7E A;  3HK0 A;  3ODO A;  3D8F A;  2CRF A;  1MIX A;  1X86 A;  4CHJ A;  1WI1 A;  4KAX B;  1FAO A;  1GG3 A;  1RRP B;  5CLL B;  1X1G A;  3PP2 A;  1MPH A;  3KRW A;  2ROZ B;  5C79 A;  4K81 A;  2GS0 A;  2Y8G A;  4A6H A;  1UPR A;  1XX0 A;  3LJU X;  4IAP A;  4MT7 A;  5HE2 A;  5D3V A;  2DYN A;  2EC1 A;  2D2Q A;  3P7Z A;  4D0N B;  4A6F B;  3ULB A;  2J0J A;  2FJL A;  3F0W A;  4DX9 0;  3RCP A;  2M14 A;  1FHX A;  1TJ6 A;  2Z0Q A;  5DH9 B;  2COA A;  4GMX B;  2MFQ A;  2ZPY A;  1WG7 A;  2K2U A;  5J3T A;  5KQ4 A;  4A6F A;  5C16 A;  1QQG A;  2LYD A;  2MWN B;  4BBK A;  1J19 A;  3DXE A;  1XCG A;  4PQ0 A;  4DBB A;  3PSC A;  2GJY A;  1WJM A;  3U8Z A;  2YVC A;  4KHB B;  3SO6 A;  3CXB B;  1BWN A;  2QKM A;  4HAU B;  1LW3 A;  1DBH A;  1KZG A;  2RVB B;  1Z87 A;  1K5D B;  2ELA A;  3T06 A;  4XWX A;  4YL8 A;  2ADZ A;  1BTK A;  4NY0 A;  2AL6 A;  2UZR A;  3HW2 B;  1DRO A;  1FB8 A;  1NI2 A;  5JP4 A;  3UZT A;  4HAY B;  1TXD A;  1UEF A;  1U5G A;  2I5F A;  4H8S A;  4KHO A;  1WGQ A;  2YT0 A;  1DDV A;  1AWE A;  1I2H A;  2W2X D;  3HQC A;  4GMV A;  2D9X A;  1H10 A;  4Z2N A;  1W1D A;  4HDO A;  5FI1 A;  4EMO A;  2J0M A;  1GC6 A;  2W2W A;  1MIZ B;  2K2J A;  1RJ2 A;  2D4Q A;  1W1G A;  3D8D A;  1FOE A;  1V5U A;  3KY9 A;  1Y19 B;  3ML4 A;  2DX5 A;  2P0H A;  1PLS A;  1P3R A;  2YS3 A;  1U5D A;  1ZSQ A;  2K00 A;  1UNQ A;  2DKQ A;  1FHW A;  4Z2M B;  1AQC A;  4PNK A;  1PMS A;  5DI9 B;  2D10 A;  2X18 A;  3NSU A;  3P6A A;  4K2O A;  4ZRI A;  1GC7 A;  3SV1 A;  2ELB A;  4B6H A;  4DXA B;  4P7I A;  2UZS A;  5D3X A;  1ZC3 B;  1DDW A;  2PZ1 A;  1SGH A;  2L2I A;  5JLJ B;  4HB0 B;  3A8Q A;  3F5R A;  1V5P A;  1WGU A;  1SHC A;  1H4R A;  1BAK A;  2VKI A;  1EVH A;  2EJ8 A;  2I1K A;  2N0Y A;  4CYE A;  2YT1 A;  1E5W A;  2R0D A;  4IOY X;  1XOD A;  1LB1 A;  3D8E A;  3FSS A;  3BIN A;  2D9Y A;  1Q67 A;  2DHK A;  4YON A;  1FGY A;  2GCJ A;  3SYX A;  2P0D A;  2RGN B;  4TKN A;  2R09 A;  1FGZ A;  2VRW B;  1EAZ A;  3MPX A;  2CY4 A;  3V5W A;  2MKR A;  1U5E A;  2CY5 A;  1UNR A;  2OTX A;  2HE7 A;  2OQB A;  4KHA A;  2BCJ A;  5C5B B;  1NTV A;  5EFX A;  1X11 A;  3IVF A;  5D27 A;  1V88 A;  3VIA A;  5D3W A;  2DTC A;  1UNP A;  3FEH A;  1ZM0 A;  4HDQ A;  3GYP A;  2RLO A;  1M7R A;  4WJ7 A;  1FHO A;  5JHG A;  2QKL A;  1TQZ A;  2KCJ A;  2GCL A;  1XR0 B;  1DYN A;  3QWM A;  2DYQ A;  5C5B A;  1UPQ A;  3BJI A;  2G35 A;  4HAV B;  5J3Q A;  2AEH A;  5CLQ B;  4WSF A;  2RUK B;  2LG1 A;  5HE0 A;  4WVF B;  3FM8 C;  3TVV A;  3TFM A;  4IFS A;  3U7D A;  2YSZ A;  1QC6 A;  2NMB A;  2LOZ A;  2Y7B A;  1XD4 A;  3TCA A;  2E2X A;  2H7E A;  1ZVR A;  4ZRJ A;  4F7U P;  5J3Y A;  1BTN A;  2COF A;  2EMS A;  4K17 A;  4L6E A;  2D9Z A;  4MK0 A;  4KVG B;  2YS5 A;  1NU2 A;  4HAT B; 
#chains in the Genus database with same CATH topology
 2J0K A;  5D3Y A;  3TW1 A;  1MAI A;  2ROV A;  5LON B;  2KIE A;  1U2B A;  1OMW A;  4HB2 B;  2P0F A;  4DX8 A;  5IRS A;  3PEG A;  2DFK A;  2XQN M;  3PVL A;  3DXC A;  3OAN A;  2HTH B;  4F7G A;  1OQN A;  3WA0 A;  2KUP A;  3NWA A;  2DN6 A;  4C0A A;  2DX1 A;  2VSZ A;  3KRX A;  1U5F A;  2YT2 A;  2Z0P A;  1K5G B;  2YRY A;  4F7H A;  4A5K A;  2NZ8 B;  4HAZ B;  2Z0O A;  5HE1 A;  5I2S A;  5JHH A;  3CIK A;  5DHA B;  1X1F A;  2Y8F A;  3VOQ A;  2MDX A;  2COD A;  2EMT A;  3NWF A;  5L81 A;  4K2P A;  4D6W A;  4NSW A;  2P8V A;  3A8P A;  3ODX A;  1WVH A;  2IYB A;  4GXB A;  3PVW A;  2W2X C;  1V5M A;  5LG4 B;  4CHM A;  1T77 A;  3PG7 A;  4GZU A;  2CAY A;  2D11 A;  3O96 A;  4MY6 A;  4HHV A;  5LOP B;  5DIF B;  4TYZ A;  1DDM A;  1ISN A;  1KI1 B;  1P5T A;  1I7A A;  4ZRK A;  2DHI A;  2DLW A;  4GPT B;  2Q13 A;  2KGX B;  4HAW B;  3WYF B;  1MI1 A;  3SUZ A;  2RSG A;  2Z13 A;  2DKP A;  3AU5 A;  3B77 A;  2JP2 A;  3AU4 A;  2H7D A;  3ZDT A;  1V89 A;  3QBV B;  2Z14 A;  1P6S A;  2YF0 A;  3AJ4 A;  1U29 A;  3PZD A;  2D9V A;  1WJ1 A;  1EGX A;  2N23 A;  4KHB A;  1Y5O A;  2LUL A;  5HE3 A;  3M1I B;  5KQ1 A;  2UVM A;  4A6K A;  4DIX A;  2FJU B;  5KCV A;  3ULC A;  4GN1 A;  5DHF B;  4HAX B;  2KIG A;  2IFS A;  2COC A;  2J59 M;  3QIJ A;  5FI0 A;  3TO1 A;  5C6R A;  4HB3 B;  1OY2 A;  3PVU A;  1IRS A;  1PFJ A;  1MK7 B;  1XKE A;  3ZVR A;  1N3H A;  1EF1 A;  2D9W A;  2I5C A;  2L1C A;  2LKO A;  3MDB C;  1MKE A;  2V76 A;  1X05 A;  3NWD A;  1KZ7 A;  5GOW B;  2YS1 A;  4EJN A;  1NTY A;  3SNH A;  2I1J A;  1V61 A;  3G9W A;  3DXD A;  1W1H A;  1ZC4 B;  3U12 A;  2DA0 A;  3GYO A;  2M38 A;  4EKU A;  2LOX A;  3A98 B;  3X23 A;  3N7C A;  3ODW A;  4HB4 B;  4Y94 A;  2DHJ A;  4GOU A;  1J0W A;  1U27 A;  1B55 A;  2RNR B;  4L1R A;  3KZ1 A;  3KSY A;  1MK9 B;  1M7E A;  3HK0 A;  3ODO A;  3D8F A;  2CRF A;  2KUQ A;  1MIX A;  1X86 A;  4CHJ A;  1WI1 A;  4KAX B;  1FAO A;  1GG3 A;  1RRP B;  5CLL B;  1X1G A;  3PP2 A;  1MPH A;  3KRW A;  2ROZ B;  5C79 A;  4K81 A;  2GS0 A;  3NW8 A;  2Y8G A;  4A6H A;  1UPR A;  1XX0 A;  3LJU X;  4IAP A;  4MT7 A;  5HE2 A;  5D3V A;  2DYN A;  2EC1 A;  2D2Q A;  3P7Z A;  4D0N B;  4A6F B;  4OT1 A;  3ULB A;  2J0J A;  4OSN A;  2FJL A;  3F0W A;  4DX9 0;  2K49 A;  3RCP A;  2M14 A;  1FHX A;  1TJ6 A;  2Z0Q A;  5DH9 B;  2COA A;  4GMX B;  2MFQ A;  2ZPY A;  1WG7 A;  2K2U A;  5J3T A;  5KQ4 A;  4A6F A;  1ZYI A;  5C16 A;  1QQG A;  2LYD A;  2MWN B;  4BBK A;  1J19 A;  3DXE A;  1XCG A;  4PQ0 A;  4DBB A;  2GUM A;  3PSC A;  2GJY A;  2Z59 A;  1WJM A;  2R2Y A;  3U8Z A;  2YVC A;  4KHB B;  3SO6 A;  3CXB B;  1BWN A;  2QKM A;  4HAU B;  1LW3 A;  1DBH A;  1KZG A;  2RVB B;  1Z87 A;  2RRF A;  1K5D B;  2ELA A;  3T06 A;  4XWX A;  4YL8 A;  2ADZ A;  3OHM B;  1BTK A;  4NY0 A;  4CSQ A;  2AL6 A;  2UZR A;  3HW2 B;  3DCX A;  1DRO A;  1FB8 A;  1NI2 A;  5JP4 A;  3UZT A;  4HAY B;  1TXD A;  1UEF A;  1U5G A;  2I5F A;  4H8S A;  4KHO A;  1WGQ A;  3FVC A;  2YT0 A;  1DDV A;  1AWE A;  1I2H A;  5I2M A;  2W2X D;  3HQC A;  4GMV A;  2D9X A;  1H10 A;  4Z2N A;  1W1D A;  4HDO A;  5FI1 A;  4EMO A;  2J0M A;  1GC6 A;  2W2W A;  1MIZ B;  2Z4D A;  2K2J A;  1RJ2 A;  2D4Q A;  1W1G A;  3D8D A;  4QJ4 B;  1FOE A;  1V5U A;  3KY9 A;  1Y19 B;  3ML4 A;  2DX5 A;  3HSA A;  2P0H A;  1PLS A;  1P3R A;  2YS3 A;  1U5D A;  1ZSQ A;  2K00 A;  1UNQ A;  2DKQ A;  2K8E A;  1FHW A;  4Z2M B;  1AQC A;  4PNK A;  1PMS A;  5DI9 B;  2D10 A;  2X18 A;  3NSU A;  3P6A A;  4K2O A;  4ZRI A;  1GC7 A;  3SV1 A;  2ELB A;  4B6H A;  4QJ5 B;  4DXA B;  4P7I A;  2UZS A;  5D3X A;  1ZC3 B;  1DDW A;  2PZ1 A;  1SGH A;  2L2I A;  5M4Y B;  5JLJ B;  4HB0 B;  3A8Q A;  3F5R A;  1V5P A;  1WGU A;  1SHC A;  1H4R A;  4QJ3 B;  1BAK A;  2VKI A;  1EVH A;  2EJ8 A;  2I1K A;  2N0Y A;  4CYE A;  2YT1 A;  1E5W A;  3HIE A;  2R0D A;  4IOY X;  1XOD A;  1LB1 A;  2NBV A;  2KR0 A;  3D8E A;  3FSS A;  3BIN A;  3A58 A;  2D9Y A;  1Q67 A;  2DHK A;  4YON A;  1FGY A;  2GCJ A;  3SYX A;  2P0D A;  2RGN B;  4TKN A;  4GNK B;  2R09 A;  1FGZ A;  2VRW B;  1EAZ A;  3MPX A;  2CY4 A;  3V5W A;  2MKR A;  1U5E A;  2CY5 A;  1UNR A;  2OTX A;  4QXA B;  2HE7 A;  2OQB A;  4KHA A;  2BCJ A;  5C5B B;  1NTV A;  5EFX A;  1X11 A;  3IVF A;  4HSI A;  5D27 A;  1V88 A;  3VIA A;  5D3W A;  2ZKM X;  2DTC A;  1UNP A;  3FEH A;  1ZM0 A;  4HDQ A;  3GYP A;  2RLO A;  1M7R A;  4WJ7 A;  1FHO A;  5JHG A;  2QKL A;  1TQZ A;  2KCJ A;  2GCL A;  1XR0 B;  1DYN A;  3QWM A;  2DYQ A;  5C5B A;  1UPQ A;  3BJI A;  2G35 A;  4HAV B;  5J3Q A;  2AEH A;  5CLQ B;  4WSF A;  2RUK B;  2LG1 A;  5HE0 A;  4WVF B;  3FM8 C;  3TVV A;  3TFM A;  4IFS A;  3U7D A;  2YSZ A;  1QC6 A;  2NMB A;  2LOZ A;  2Y7B A;  1XD4 A;  3TCA A;  2E2X A;  2H7E A;  1ZVR A;  4ZRJ A;  4F7U P;  5J3Y A;  1BTN A;  2COF A;  2EMS A;  4K17 A;  4L6E A;  2D9Z A;  4MK0 A;  4KVG B;  2YS5 A;  1NU2 A;  4HAT B; 
#chains in the Genus database with same CATH homology
 2J0K A;  5D3Y A;  3TW1 A;  1MAI A;  2ROV A;  5LON B;  1U2B A;  1OMW A;  4HB2 B;  2P0F A;  4DX8 A;  3PEG A;  2DFK A;  2XQN M;  3PVL A;  3DXC A;  3OAN A;  2HTH B;  4F7G A;  1OQN A;  3WA0 A;  2KUP A;  2DN6 A;  4C0A A;  2DX1 A;  2VSZ A;  3KRX A;  1U5F A;  2Z0P A;  1K5G B;  2YRY A;  4F7H A;  4A5K A;  2NZ8 B;  4HAZ B;  2Z0O A;  5HE1 A;  5JHH A;  3CIK A;  5DHA B;  1X1F A;  2Y8F A;  3VOQ A;  2MDX A;  2COD A;  2EMT A;  5L81 A;  4K2P A;  4NSW A;  2P8V A;  3A8P A;  3ODX A;  1WVH A;  2IYB A;  4GXB A;  3PVW A;  2W2X C;  1V5M A;  4CHM A;  3PG7 A;  4GZU A;  2CAY A;  2D11 A;  3O96 A;  4MY6 A;  4HHV A;  5LOP B;  5DIF B;  4TYZ A;  1DDM A;  1ISN A;  1KI1 B;  1P5T A;  1I7A A;  4ZRK A;  2DHI A;  2DLW A;  4GPT B;  2Q13 A;  2KGX B;  4HAW B;  3WYF B;  3SUZ A;  2RSG A;  2DKP A;  3AU5 A;  2JP2 A;  3AU4 A;  2H7D A;  3ZDT A;  1V89 A;  3QBV B;  1P6S A;  2YF0 A;  3AJ4 A;  1U29 A;  3PZD A;  2D9V A;  1WJ1 A;  1EGX A;  2N23 A;  1Y5O A;  2LUL A;  5HE3 A;  3M1I B;  5KQ1 A;  2UVM A;  4A6K A;  5KCV A;  3ULC A;  4GN1 A;  5DHF B;  4HAX B;  2IFS A;  2COC A;  2J59 M;  3QIJ A;  5FI0 A;  3TO1 A;  5C6R A;  4HB3 B;  1OY2 A;  3PVU A;  1IRS A;  1PFJ A;  1MK7 B;  1XKE A;  3ZVR A;  1N3H A;  1EF1 A;  2D9W A;  2I5C A;  2L1C A;  2LKO A;  3MDB C;  1MKE A;  2V76 A;  1X05 A;  1KZ7 A;  5GOW B;  2YS1 A;  4EJN A;  1NTY A;  3SNH A;  2I1J A;  1V61 A;  3G9W A;  3DXD A;  1W1H A;  1ZC4 B;  2DA0 A;  3GYO A;  2M38 A;  4EKU A;  2LOX A;  3A98 B;  3X23 A;  3N7C A;  3ODW A;  4HB4 B;  4Y94 A;  2DHJ A;  1J0W A;  1U27 A;  1B55 A;  2RNR B;  3KZ1 A;  3KSY A;  1MK9 B;  1M7E A;  3HK0 A;  3ODO A;  3D8F A;  2CRF A;  1MIX A;  1X86 A;  4CHJ A;  1WI1 A;  4KAX B;  1FAO A;  1GG3 A;  1RRP B;  5CLL B;  1X1G A;  3PP2 A;  1MPH A;  3KRW A;  2ROZ B;  5C79 A;  4K81 A;  2GS0 A;  2Y8G A;  4A6H A;  1UPR A;  1XX0 A;  3LJU X;  4IAP A;  4MT7 A;  5HE2 A;  5D3V A;  2DYN A;  2EC1 A;  2D2Q A;  3P7Z A;  4D0N B;  4A6F B;  3ULB A;  2J0J A;  2FJL A;  3F0W A;  4DX9 0;  3RCP A;  2M14 A;  1FHX A;  1TJ6 A;  2Z0Q A;  5DH9 B;  2COA A;  4GMX B;  2MFQ A;  2ZPY A;  1WG7 A;  2K2U A;  5J3T A;  5KQ4 A;  4A6F A;  5C16 A;  1QQG A;  2LYD A;  2MWN B;  4BBK A;  1J19 A;  3DXE A;  1XCG A;  4PQ0 A;  4DBB A;  3PSC A;  2GJY A;  1WJM A;  3U8Z A;  2YVC A;  4KHB B;  3SO6 A;  3CXB B;  1BWN A;  2QKM A;  4HAU B;  1LW3 A;  1DBH A;  1KZG A;  2RVB B;  1Z87 A;  1K5D B;  2ELA A;  3T06 A;  4XWX A;  4YL8 A;  2ADZ A;  1BTK A;  4NY0 A;  2AL6 A;  2UZR A;  3HW2 B;  1DRO A;  1FB8 A;  1NI2 A;  5JP4 A;  3UZT A;  4HAY B;  1TXD A;  1UEF A;  1U5G A;  2I5F A;  4H8S A;  4KHO A;  1WGQ A;  2YT0 A;  1DDV A;  1AWE A;  1I2H A;  2W2X D;  3HQC A;  4GMV A;  2D9X A;  1H10 A;  4Z2N A;  1W1D A;  4HDO A;  5FI1 A;  4EMO A;  2J0M A;  1GC6 A;  2W2W A;  1MIZ B;  2K2J A;  1RJ2 A;  2D4Q A;  1W1G A;  3D8D A;  1FOE A;  1V5U A;  3KY9 A;  1Y19 B;  3ML4 A;  2DX5 A;  2P0H A;  1PLS A;  1P3R A;  2YS3 A;  1U5D A;  1ZSQ A;  2K00 A;  1UNQ A;  2DKQ A;  1FHW A;  4Z2M B;  1AQC A;  4PNK A;  1PMS A;  5DI9 B;  2D10 A;  2X18 A;  3NSU A;  3P6A A;  4K2O A;  4ZRI A;  1GC7 A;  3SV1 A;  2ELB A;  4B6H A;  4DXA B;  4P7I A;  2UZS A;  5D3X A;  1ZC3 B;  1DDW A;  2PZ1 A;  1SGH A;  2L2I A;  5JLJ B;  4HB0 B;  3A8Q A;  3F5R A;  1V5P A;  1WGU A;  1SHC A;  1H4R A;  1BAK A;  2VKI A;  1EVH A;  2EJ8 A;  2I1K A;  2N0Y A;  4CYE A;  2YT1 A;  1E5W A;  2R0D A;  4IOY X;  1XOD A;  1LB1 A;  3D8E A;  3FSS A;  3BIN A;  2D9Y A;  1Q67 A;  2DHK A;  4YON A;  1FGY A;  2GCJ A;  3SYX A;  2P0D A;  2RGN B;  4TKN A;  2R09 A;  1FGZ A;  2VRW B;  1EAZ A;  3MPX A;  2CY4 A;  3V5W A;  2MKR A;  1U5E A;  2CY5 A;  1UNR A;  2OTX A;  2HE7 A;  2OQB A;  4KHA A;  2BCJ A;  5C5B B;  1NTV A;  5EFX A;  1X11 A;  3IVF A;  5D27 A;  1V88 A;  3VIA A;  5D3W A;  2DTC A;  1UNP A;  3FEH A;  1ZM0 A;  4HDQ A;  3GYP A;  2RLO A;  1M7R A;  4WJ7 A;  1FHO A;  5JHG A;  2QKL A;  1TQZ A;  2KCJ A;  2GCL A;  1XR0 B;  1DYN A;  3QWM A;  2DYQ A;  5C5B A;  1UPQ A;  3BJI A;  2G35 A;  4HAV B;  5J3Q A;  2AEH A;  5CLQ B;  4WSF A;  2RUK B;  2LG1 A;  5HE0 A;  4WVF B;  3FM8 C;  3TVV A;  3TFM A;  4IFS A;  3U7D A;  2YSZ A;  1QC6 A;  2NMB A;  2LOZ A;  2Y7B A;  1XD4 A;  3TCA A;  2E2X A;  2H7E A;  1ZVR A;  4ZRJ A;  4F7U P;  5J3Y A;  1BTN A;  2COF A;  2EMS A;  4K17 A;  4L6E A;  2D9Z A;  4MK0 A;  4KVG B;  2YS5 A;  1NU2 A;  4HAT B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...