2LOZA

The novel binding mode of dlc1 and tensin2 ptb domain
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
147
structure length
147
Chain Sequence
MSTAADLLRQGAACSVLYLTSVETESLTGPQAVARASSAALSCSPRPTPAVVHFKVSAQGITLTDNQRKLFFRRHYPVNSITFSSTDPQDRRWTNPDGTTSKIFGFVAKKPGSPWENVCHLFAELDPDQPAGAIVTFITKVLLGQRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Solution structure of the PTB domain of human Tensin2 in complex with deleted in liver cancer 1 (DLC1) peptide reveals a novel peptide binding mode
doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase activator
molecule keywords Tensin-like C1 domain-containing phosphatase
total genus 25
structure length 147
sequence length 147
ec nomenclature ec 3.1.3.-:
pdb deposition date 2012-01-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08416 PTB Phosphotyrosine-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2lozA00
5LOPB 4ZRKA 2LOXA 4EKUA 2OQBA 2YT0A 1X11A 5JP4A 1V88A 2L2IA 3BJIA 1V5MA 2LYDA 2LOZA 1MPHA 2FJLA 4B6HA 1RRPB 4F7UP 4KVGB 1ZM0A 4CHMA 5DIFB 3AJ4A 2D9ZA 1XKEA 1OMWA 2K00A 1X1GA 3P7ZA 4GXBA 4HAXB 3SUZA 2P0HA 4D0NB 2H7EA 1U5FA 3GYOA 2I5CA 2K2JA 1FGYA 4DXAB 4F7HA 3A98B 2COFA 1FGZA 2YF0A 4KHAA 1K5DB 1NU2A 1Y19B 3HK0A 1DDMA 3PVWA 2J59M 1XCGA 2IYBA 1UPRA 2DHKA 2RVBB 3CIKA 3RCPA 2R09A 2EJ8A 2X18A 3ODWA 2UZRA 2ELBA 2HTHB 2Y8GA 4HAVB 1W1GA 3DXEA 5HE2A 1U5EA 1Y5OA 5L81A 4MK0A 1EAZA 1FOEA 1UNPA 1ZSQA 3KRXA 4HAZB 4HB0B 2D9XA 4PQ0A 3WA0A 4K17A 2DA0A 1XD4A 2CY5A 1ZVRA 1BWNA 2N0YA 4Z2MB 2ROVA 4Z2NA 2DLWA 2YS1A 2YVCA 2N23A 4H8SA 1AWEA 5J3YA 3TO1A 1U29A 3LJUX 2M38A 1H4RA 1U5GA 2VRWB 2CODA 4KHOA 1U5DA 1NTYA 1DYNA 3P6AA 1W1HA 1V5UA 2GJYA 3GYPA 3HQCA 4GN1A 2Y7BA 5D3XA 4YONA 5C5BB 3QIJA 3TW1A 1GG3A 1N3HA 3PEGA 2CY4A 1W1DA 1P3RA 2VKIA 3VIAA 2D2QA 5KQ1A 3G9WA 3DXCA 3M1IB 3PVUA 4GPTB 1U27A 4HB3B 3AU5A 5J3TA 4HB4B 4WSFA 1GC6A 1J19A 3CXBB 4BBKA 3D8FA 2XQNM 3NSUA 4KAXB 5FI0A 1EGXA 1KI1B 2MWNB 1M7RA 1ISNA 4HAYB 3PSCA 1SGHA 2GCLA 2P0DA 1DDWA 5D3VA 2R0DA 4HAUB 1LW3A 4HATB 1FHWA 1WJ1A 5D27A 5DH9B 1XODA 5DI9B 1RJ2A 3QBVB 3WYFB 1X05A 1I2HA 4MT7A 1BTNA 2CAYA 2H7DA 3HW2B 1UNRA 1V89A 1NTVA 2RNRB 2YT1A 3PVLA 3ZVRA 1V61A 3A8PA 4WJ7A 1EF1A 1WGUA 2YRYA 3KRWA 3TFMA 2AEHA 1MK9B 4L6EA 2W2XC 3TVVA 1WGQA 2KUPA 4HAWB 5C5BA 4GMVA 1UNQA 1Z87A 4ZRJA 1WG7A 2KCJA 3D8DA 4DBBA 2MFQA 4YL8A 3KZ1A 1H10A 2RGNB 4HB2B 1MIZB 4F7GA 2E2XA 1AQCA 1MK7B 2ADZA 5JHGA 3MDBC 3O96A 3TCAA 1UPQA 5C79A 1LB1A 2YSZA 4K2PA 2LKOA 3F5RA 1MKEA 1KZ7A 2AL6A 2LG1A 3V5WA 1MIXA 3BINA 2GS0A 2RUKB 1TQZA 4P7IA 3ULBA 4IFSA 2J0JA 2BCJA 2D9VA 1SHCA 3ML4A 3SYXA 4EMOA 1X1FA 3N7CA 2YS5A 4NY0A 1TXDA 2Y8FA 2KGXB 2G35A 1EVHA 4K81A 1P5TA 1ZC4B 2DFKA 2UVMA 4Y94A 4WVFB 5KCVA 2DKPA 3F0WA 3DXDA 2HE7A 5D3YA 2DYQA 2DHJA 4DX8A 2DYNA 5C16A 4IAPA 2GCJA 5HE3A 2DX1A 2P8VA 4CHJA 1M7EA 1UEFA 2EC1A 2MDXA 2DTCA 5EFXA 1OY2A 4EJNA 3AU4A 4A6FB 4A6HA 4C0AA 5JHHA 3PZDA 3SO6A 2NMBA 1XR0B 4TKNA 4MY6A 2L1CA 2COCA 4DX90 1FB8A 1BTKA 1GC7A 2Z0QA 2I1KA 2I5FA 5DHAB 2PZ1A 1QQGA 2EMSA 3VOQA 3ODOA 1FHOA 1PMSA 2LULA 4GZUA 2K2UA 5JLJB 2ELAA 2CRFA 1ZC3B 2D9YA 2ZPYA 2Q13A 1PFJA 2D10A 2D11A 2COAA 2D9WA 2OTXA 1IRSA 2QKMA 1B55A 2V76A 3U8ZA 5C6RA 1XX0A 1QC6A 3D8EA 1U2BA 3U7DA 2ROZB 1E5WA 1OQNA 4CYEA 2VSZA 2DX5A 2P0FA 1NI2A 5GOWB 3FM8C 2J0KA 1FAOA 1WJMA 3FSSA 5FI1A 3QWMA 2RLOA 3ULCA 5CLQB 1KZGA 3PP2A 1Q67A 2M14A 2JP2A 2NZ8B 4HDQA 5CLLB 1DDVA 4GMXB 1P6SA 1X86A 2QKLA 1PLSA 2UZSA 4HDOA 2Z0PA 3MPXA 3SNHA 1BAKA 2DHIA 1DROA 4IOYX 3ODXA 1WVHA 4NSWA 5LONB 3T06A 1MAIA 2EMTA 5HE0A 2RSGA 4PNKA 1J0WA 3SV1A 1FHXA 1TJ6A 1V5PA 4HHVA 3UZTA 5J3QA 5HE1A 3PG7A 4K2OA 3IVFA 4A5KA 2D4QA 2Z0OA 4KHBB 2IFSA 4A6KA 2W2XD 3OANA 1WI1A 4A6FA 3FEHA 2DKQA 1K5GB 5DHFB 1I7AA 4XWXA 3X23A 5KQ4A 2YS3A 3KY9A 3A8QA 1DBHA 2J0MA 4TYZA 2I1JA 2MKRA 3KSYA 2W2WA 5D3WA 3ZDTA 2DN6A 4ZRIA
chains in the Genus database with same CATH superfamily
5LOPB 4ZRKA 2LOXA 4EKUA 2OQBA 2YT0A 1X11A 5JP4A 1V88A 4GOUA 2L2IA 3BJIA 1V5MA 2LYDA 2LOZA 1MPHA 2FJLA 4B6HA 1RRPB 4F7UP 4KVGB 1ZM0A 4CHMA 5DIFB 3AJ4A 2D9ZA 3NWDA 1XKEA 1OMWA 2K00A 1X1GA 3P7ZA 4GXBA 4HAXB 3SUZA 2P0HA 4D0NB 2H7EA 1U5FA 3GYOA 2I5CA 2K2JA 4QJ4B 1FGYA 4DXAB 4F7HA 3A98B 2COFA 1FGZA 2YF0A 4KHAA 3DCXA 1K5DB 1NU2A 1Y19B 3HK0A 1DDMA 3PVWA 4CSQA 2J59M 4D6WA 1XCGA 2IYBA 1UPRA 3B77A 2DHKA 2RVBB 3CIKA 3RCPA 2R09A 3U12A 2EJ8A 2X18A 3ODWA 2UZRA 2ELBA 2HTHB 2Y8GA 4HAVB 1W1GA 3NW8A 3DXEA 5HE2A 1T77A 1U5EA 1Y5OA 4GNKB 5L81A 4MK0A 1EAZA 1FOEA 1UNPA 1ZSQA 3KRXA 4HAZB 4HB0B 2D9XA 4PQ0A 3WA0A 4K17A 2DA0A 1XD4A 2CY5A 1ZVRA 1BWNA 2N0YA 4Z2MB 2ROVA 4Z2NA 2DLWA 2YS1A 2YVCA 2N23A 4H8SA 1AWEA 5J3YA 3TO1A 1U29A 3LJUX 2M38A 4QJ3B 1H4RA 1U5GA 2VRWB 2CODA 5IRSA 4KHOA 3A58A 1U5DA 1NTYA 1DYNA 3P6AA 1W1HA 1V5UA 2GJYA 3GYPA 3HQCA 4GN1A 2Y7BA 5D3XA 4YONA 2Z59A 5C5BB 3QIJA 3TW1A 1GG3A 1N3HA 3PEGA 4HSIA 2CY4A 1W1DA 1P3RA 2VKIA 3VIAA 2D2QA 2Z14A 5KQ1A 2FJUB 3G9WA 3DXCA 3M1IB 3PVUA 4GPTB 1U27A 4HB3B 3AU5A 3NWAA 5J3TA 4HB4B 4WSFA 1GC6A 1J19A 3CXBB 4BBKA 3D8FA 2XQNM 3NSUA 4KAXB 5FI0A 1EGXA 1KI1B 2MWNB 1M7RA 5I2MA 1ISNA 4HAYB 3PSCA 1SGHA 2GCLA 2P0DA 1DDWA 5D3VA 2R0DA 4HAUB 1LW3A 4HATB 1FHWA 1WJ1A 5D27A 5DH9B 1XODA 5DI9B 1RJ2A 3QBVB 3WYFB 1X05A 1I2HA 4MT7A 1BTNA 2CAYA 2H7DA 3HW2B 1UNRA 1V89A 1NTVA 2RNRB 2YT1A 3PVLA 3ZVRA 1V61A 3A8PA 4WJ7A 1EF1A 1WGUA 2YRYA 3KRWA 3TFMA 2AEHA 1MK9B 4L6EA 4QXAB 2W2XC 2KR0A 3TVVA 1WGQA 2KUPA 4HAWB 3FVCA 3HIEA 5C5BA 4GMVA 1UNQA 1Z87A 4ZRJA 1WG7A 2KCJA 5LG4B 4ZRIA 3D8DA 4DBBA 2MFQA 4YL8A 3KZ1A 1H10A 2RGNB 4HB2B 1MIZB 4F7GA 2E2XA 1AQCA 1MK7B 2ADZA 5JHGA 3MDBC 3O96A 3TCAA 1UPQA 5C79A 1LB1A 2YSZA 4K2PA 1ZYIA 2LKOA 3F5RA 1MKEA 4OSNA 1KZ7A 2AL6A 2LG1A 3V5WA 1MIXA 3BINA 2GS0A 2RUKB 1TQZA 4P7IA 3ULBA 4IFSA 2J0JA 2BCJA 2D9VA 1SHCA 3HSAA 3ML4A 3SYXA 4EMOA 1X1FA 3N7CA 2YS5A 4NY0A 1TXDA 2Y8FA 2KGXB 2G35A 1EVHA 4K81A 1P5TA 1ZC4B 2DFKA 2UVMA 4Y94A 4WVFB 5KCVA 2DKPA 3F0WA 3DXDA 2HE7A 5D3YA 2DYQA 2DHJA 4DX8A 2K8EA 2DYNA 5C16A 4IAPA 2GCJA 5HE3A 2DX1A 2P8VA 4CHJA 1M7EA 1UEFA 2RRFA 2KIGA 2EC1A 4L1RA 2MDXA 2DTCA 5EFXA 1OY2A 2KIEA 4EJNA 3AU4A 4A6FB 4A6HA 4C0AA 5JHHA 3PZDA 3SO6A 2NMBA 1XR0B 4TKNA 5M4YB 4MY6A 2L1CA 2COCA 4DX90 1FB8A 1BTKA 1GC7A 2Z0QA 2I1KA 2I5FA 5DHAB 2PZ1A 1QQGA 2EMSA 3VOQA 3ODOA 1FHOA 1PMSA 2LULA 4GZUA 2K2UA 5JLJB 2ELAA 2CRFA 4DIXA 1ZC3B 2D9YA 2ZPYA 2Q13A 1PFJA 2D10A 2D11A 5I2SA 2COAA 2D9WA 2NBVA 2OTXA 1IRSA 2QKMA 1B55A 2V76A 3U8ZA 5C6RA 1XX0A 1QC6A 4KHBA 3D8EA 1U2BA 3U7DA 2ROZB 2ZKMX 1E5WA 1OQNA 2GUMA 4CYEA 2VSZA 2DX5A 2P0FA 1NI2A 5GOWB 3FM8C 2J0KA 1FAOA 1WJMA 3FSSA 5FI1A 3QWMA 2RLOA 3ULCA 5CLQB 1KZGA 3PP2A 1Q67A 2M14A 2JP2A 2NZ8B 2R2YA 4HDQA 5CLLB 1DDVA 4GMXB 1P6SA 1X86A 1MI1A 2QKLA 1PLSA 2UZSA 4HDOA 2Z0PA 3MPXA 3SNHA 4QJ5B 2DHIA 1BAKA 1DROA 4IOYX 3ODXA 1WVHA 4NSWA 5LONB 3T06A 1MAIA 2EMTA 5HE0A 3OHMB 2Z13A 2RSGA 4PNKA 3NWFA 1J0WA 2YT2A 3SV1A 1FHXA 1TJ6A 1V5PA 4HHVA 3UZTA 5J3QA 5HE1A 3PG7A 4K2OA 3IVFA 4A5KA 2D4QA 2Z0OA 4KHBB 2IFSA 4A6KA 2W2XD 2Z4DA 3OANA 1WI1A 4A6FA 3FEHA 2DKQA 1K5GB 5DHFB 2K49A 1I7AA 4XWXA 3X23A 5KQ4A 2YS3A 3KY9A 3A8QA 1DBHA 4OT1A 2J0MA 4TYZA 2I1JA 2MKRA 3KSYA 2W2WA 5D3WA 3ZDTA 2DN6A 2KUQA
chains in the Genus database with same CATH topology
5LOPB 4ZRKA 2LOXA 4EKUA 2OQBA 2YT0A 1X11A 5JP4A 1V88A 2L2IA 3BJIA 1V5MA 2LYDA 2LOZA 1MPHA 2FJLA 4B6HA 1RRPB 4F7UP 4KVGB 1ZM0A 4CHMA 5DIFB 3AJ4A 2D9ZA 1XKEA 1OMWA 2K00A 1X1GA 3P7ZA 4GXBA 4HAXB 3SUZA 2P0HA 4D0NB 2H7EA 1U5FA 3GYOA 2I5CA 2K2JA 1FGYA 4DXAB 4F7HA 3A98B 2COFA 1FGZA 2YF0A 4KHAA 1K5DB 1NU2A 1Y19B 3HK0A 1DDMA 3PVWA 2J59M 1XCGA 2IYBA 1UPRA 2DHKA 2RVBB 3CIKA 3RCPA 2R09A 2EJ8A 2X18A 3ODWA 2UZRA 2ELBA 2HTHB 2Y8GA 4HAVB 1W1GA 3DXEA 5HE2A 1U5EA 1Y5OA 5L81A 4MK0A 1EAZA 1FOEA 1UNPA 1ZSQA 3KRXA 4HAZB 4HB0B 2D9XA 4PQ0A 3WA0A 4K17A 2DA0A 1XD4A 2CY5A 1ZVRA 1BWNA 2N0YA 4Z2MB 2ROVA 4Z2NA 2DLWA 2YS1A 2YVCA 2N23A 4H8SA 1AWEA 5J3YA 3TO1A 1U29A 3LJUX 2M38A 1H4RA 1U5GA 2VRWB 2CODA 4KHOA 1U5DA 1NTYA 1DYNA 3P6AA 1W1HA 1V5UA 2GJYA 3GYPA 3HQCA 4GN1A 2Y7BA 5D3XA 4YONA 5C5BB 3QIJA 3TW1A 1GG3A 1N3HA 3PEGA 2CY4A 1W1DA 1P3RA 2VKIA 3VIAA 2D2QA 5KQ1A 3G9WA 3DXCA 3M1IB 3PVUA 4GPTB 1U27A 4HB3B 3AU5A 5J3TA 4HB4B 4WSFA 1GC6A 1J19A 3CXBB 4BBKA 3D8FA 2XQNM 3NSUA 4KAXB 5FI0A 1EGXA 1KI1B 2MWNB 1M7RA 1ISNA 4HAYB 3PSCA 1SGHA 2GCLA 2P0DA 1DDWA 5D3VA 2R0DA 4HAUB 1LW3A 4HATB 1FHWA 1WJ1A 5D27A 5DH9B 1XODA 5DI9B 1RJ2A 3QBVB 3WYFB 1X05A 1I2HA 4MT7A 1BTNA 2CAYA 2H7DA 3HW2B 1UNRA 1V89A 1NTVA 2RNRB 2YT1A 3PVLA 3ZVRA 1V61A 3A8PA 4WJ7A 1EF1A 1WGUA 2YRYA 3KRWA 3TFMA 2AEHA 1MK9B 4L6EA 2W2XC 3TVVA 1WGQA 2KUPA 4HAWB 5C5BA 4GMVA 1UNQA 1Z87A 4ZRJA 1WG7A 2KCJA 3D8DA 4DBBA 2MFQA 4YL8A 3KZ1A 1H10A 2RGNB 4HB2B 1MIZB 4F7GA 2E2XA 1AQCA 1MK7B 2ADZA 5JHGA 3MDBC 3O96A 3TCAA 1UPQA 5C79A 1LB1A 2YSZA 4K2PA 2LKOA 3F5RA 1MKEA 1KZ7A 2AL6A 2LG1A 3V5WA 1MIXA 3BINA 2GS0A 2RUKB 1TQZA 4P7IA 3ULBA 4IFSA 2J0JA 2BCJA 2D9VA 1SHCA 3ML4A 3SYXA 4EMOA 1X1FA 3N7CA 2YS5A 4NY0A 1TXDA 2Y8FA 2KGXB 2G35A 1EVHA 4K81A 1P5TA 1ZC4B 2DFKA 2UVMA 4Y94A 4WVFB 5KCVA 2DKPA 3F0WA 3DXDA 2HE7A 5D3YA 2DYQA 2DHJA 4DX8A 2DYNA 5C16A 4IAPA 2GCJA 5HE3A 2DX1A 2P8VA 4CHJA 1M7EA 1UEFA 2EC1A 2MDXA 2DTCA 5EFXA 1OY2A 4EJNA 3AU4A 4A6FB 4A6HA 4C0AA 5JHHA 3PZDA 3SO6A 2NMBA 1XR0B 4TKNA 4MY6A 2L1CA 2COCA 4DX90 1FB8A 1BTKA 1GC7A 2Z0QA 2I1KA 2I5FA 5DHAB 2PZ1A 1QQGA 2EMSA 3VOQA 3ODOA 1FHOA 1PMSA 2LULA 4GZUA 2K2UA 5JLJB 2ELAA 2CRFA 1ZC3B 2D9YA 2ZPYA 2Q13A 1PFJA 2D10A 2D11A 2COAA 2D9WA 2OTXA 1IRSA 2QKMA 1B55A 2V76A 3U8ZA 5C6RA 1XX0A 1QC6A 3D8EA 1U2BA 3U7DA 2ROZB 1E5WA 1OQNA 4CYEA 2VSZA 2DX5A 2P0FA 1NI2A 5GOWB 3FM8C 2J0KA 1FAOA 1WJMA 3FSSA 5FI1A 3QWMA 2RLOA 3ULCA 5CLQB 1KZGA 3PP2A 1Q67A 2M14A 2JP2A 2NZ8B 4HDQA 5CLLB 1DDVA 4GMXB 1P6SA 1X86A 2QKLA 1PLSA 2UZSA 4HDOA 2Z0PA 3MPXA 3SNHA 1BAKA 2DHIA 1DROA 4IOYX 3ODXA 1WVHA 4NSWA 5LONB 3T06A 1MAIA 2EMTA 5HE0A 2RSGA 4PNKA 1J0WA 3SV1A 1FHXA 1TJ6A 1V5PA 4HHVA 3UZTA 5J3QA 5HE1A 3PG7A 4K2OA 3IVFA 4A5KA 2D4QA 2Z0OA 4KHBB 2IFSA 4A6KA 2W2XD 3OANA 1WI1A 4A6FA 3FEHA 2DKQA 1K5GB 5DHFB 1I7AA 4XWXA 3X23A 5KQ4A 2YS3A 3KY9A 3A8QA 1DBHA 2J0MA 4TYZA 2I1JA 2MKRA 3KSYA 2W2WA 5D3WA 3ZDTA 2DN6A 4ZRIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5LOP B;  4ZRK A;  2LOX A;  4EKU A;  2OQB A;  2YT0 A;  1X11 A;  5JP4 A;  1V88 A;  2L2I A;  3BJI A;  1V5M A;  2LYD A;  2LOZ A;  1MPH A;  2FJL A;  4B6H A;  1RRP B;  4F7U P;  4KVG B;  1ZM0 A;  4CHM A;  5DIF B;  3AJ4 A;  2D9Z A;  1XKE A;  1OMW A;  2K00 A;  1X1G A;  3P7Z A;  4GXB A;  4HAX B;  3SUZ A;  2P0H A;  4D0N B;  2H7E A;  1U5F A;  3GYO A;  2I5C A;  2K2J A;  1FGY A;  4DXA B;  4F7H A;  3A98 B;  2COF A;  1FGZ A;  2YF0 A;  4KHA A;  1K5D B;  1NU2 A;  1Y19 B;  3HK0 A;  1DDM A;  3PVW A;  2J59 M;  1XCG A;  2IYB A;  1UPR A;  2DHK A;  2RVB B;  3CIK A;  3RCP A;  2R09 A;  2EJ8 A;  2X18 A;  3ODW A;  2UZR A;  2ELB A;  2HTH B;  2Y8G A;  4HAV B;  1W1G A;  3DXE A;  5HE2 A;  1U5E A;  1Y5O A;  5L81 A;  4MK0 A;  1EAZ A;  1FOE A;  1UNP A;  1ZSQ A;  3KRX A;  4HAZ B;  4HB0 B;  2D9X A;  4PQ0 A;  3WA0 A;  4K17 A;  2DA0 A;  1XD4 A;  2CY5 A;  1ZVR A;  1BWN A;  2N0Y A;  4Z2M B;  2ROV A;  4Z2N A;  2DLW A;  2YS1 A;  2YVC A;  2N23 A;  4H8S A;  1AWE A;  5J3Y A;  3TO1 A;  1U29 A;  3LJU X;  2M38 A;  1H4R A;  1U5G A;  2VRW B;  2COD A;  4KHO A;  1U5D A;  1NTY A;  1DYN A;  3P6A A;  1W1H A;  1V5U A;  2GJY A;  3GYP A;  3HQC A;  4GN1 A;  2Y7B A;  5D3X A;  4YON A;  5C5B B;  3QIJ A;  3TW1 A;  1GG3 A;  1N3H A;  3PEG A;  2CY4 A;  1W1D A;  1P3R A;  2VKI A;  3VIA A;  2D2Q A;  5KQ1 A;  3G9W A;  3DXC A;  3M1I B;  3PVU A;  4GPT B;  1U27 A;  4HB3 B;  3AU5 A;  5J3T A;  4HB4 B;  4WSF A;  1GC6 A;  1J19 A;  3CXB B;  4BBK A;  3D8F A;  2XQN M;  3NSU A;  4KAX B;  5FI0 A;  1EGX A;  1KI1 B;  2MWN B;  1M7R A;  1ISN A;  4HAY B;  3PSC A;  1SGH A;  2GCL A;  2P0D A;  1DDW A;  5D3V A;  2R0D A;  4HAU B;  1LW3 A;  4HAT B;  1FHW A;  1WJ1 A;  5D27 A;  5DH9 B;  1XOD A;  5DI9 B;  1RJ2 A;  3QBV B;  3WYF B;  1X05 A;  1I2H A;  4MT7 A;  1BTN A;  2CAY A;  2H7D A;  3HW2 B;  1UNR A;  1V89 A;  1NTV A;  2RNR B;  2YT1 A;  3PVL A;  3ZVR A;  1V61 A;  3A8P A;  4WJ7 A;  1EF1 A;  1WGU A;  2YRY A;  3KRW A;  3TFM A;  2AEH A;  1MK9 B;  4L6E A;  2W2X C;  3TVV A;  1WGQ A;  2KUP A;  4HAW B;  5C5B A;  4GMV A;  1UNQ A;  1Z87 A;  4ZRJ A;  1WG7 A;  2KCJ A;  3D8D A;  4DBB A;  2MFQ A;  4YL8 A;  3KZ1 A;  1H10 A;  2RGN B;  4HB2 B;  1MIZ B;  4F7G A;  2E2X A;  1AQC A;  1MK7 B;  2ADZ A;  5JHG A;  3MDB C;  3O96 A;  3TCA A;  1UPQ A;  5C79 A;  1LB1 A;  2YSZ A;  4K2P A;  2LKO A;  3F5R A;  1MKE A;  1KZ7 A;  2AL6 A;  2LG1 A;  3V5W A;  1MIX A;  3BIN A;  2GS0 A;  2RUK B;  1TQZ A;  4P7I A;  3ULB A;  4IFS A;  2J0J A;  2BCJ A;  2D9V A;  1SHC A;  3ML4 A;  3SYX A;  4EMO A;  1X1F A;  3N7C A;  2YS5 A;  4NY0 A;  1TXD A;  2Y8F A;  2KGX B;  2G35 A;  1EVH A;  4K81 A;  1P5T A;  1ZC4 B;  2DFK A;  2UVM A;  4Y94 A;  4WVF B;  5KCV A;  2DKP A;  3F0W A;  3DXD A;  2HE7 A;  5D3Y A;  2DYQ A;  2DHJ A;  4DX8 A;  2DYN A;  5C16 A;  4IAP A;  2GCJ A;  5HE3 A;  2DX1 A;  2P8V A;  4CHJ A;  1M7E A;  1UEF A;  2EC1 A;  2MDX A;  2DTC A;  5EFX A;  1OY2 A;  4EJN A;  3AU4 A;  4A6F B;  4A6H A;  4C0A A;  5JHH A;  3PZD A;  3SO6 A;  2NMB A;  1XR0 B;  4TKN A;  4MY6 A;  2L1C A;  2COC A;  4DX9 0;  1FB8 A;  1BTK A;  1GC7 A;  2Z0Q A;  2I1K A;  2I5F A;  5DHA B;  2PZ1 A;  1QQG A;  2EMS A;  3VOQ A;  3ODO A;  1FHO A;  1PMS A;  2LUL A;  4GZU A;  2K2U A;  5JLJ B;  2ELA A;  2CRF A;  1ZC3 B;  2D9Y A;  2ZPY A;  2Q13 A;  1PFJ A;  2D10 A;  2D11 A;  2COA A;  2D9W A;  2OTX A;  1IRS A;  2QKM A;  1B55 A;  2V76 A;  3U8Z A;  5C6R A;  1XX0 A;  1QC6 A;  3D8E A;  1U2B A;  3U7D A;  2ROZ B;  1E5W A;  1OQN A;  4CYE A;  2VSZ A;  2DX5 A;  2P0F A;  1NI2 A;  5GOW B;  3FM8 C;  2J0K A;  1FAO A;  1WJM A;  3FSS A;  5FI1 A;  3QWM A;  2RLO A;  3ULC A;  5CLQ B;  1KZG A;  3PP2 A;  1Q67 A;  2M14 A;  2JP2 A;  2NZ8 B;  4HDQ A;  5CLL B;  1DDV A;  4GMX B;  1P6S A;  1X86 A;  2QKL A;  1PLS A;  2UZS A;  4HDO A;  2Z0P A;  3MPX A;  3SNH A;  1BAK A;  2DHI A;  1DRO A;  4IOY X;  3ODX A;  1WVH A;  4NSW A;  5LON B;  3T06 A;  1MAI A;  2EMT A;  5HE0 A;  2RSG A;  4PNK A;  1J0W A;  3SV1 A;  1FHX A;  1TJ6 A;  1V5P A;  4HHV A;  3UZT A;  5J3Q A;  5HE1 A;  3PG7 A;  4K2O A;  3IVF A;  4A5K A;  2D4Q A;  2Z0O A;  4KHB B;  2IFS A;  4A6K A;  2W2X D;  3OAN A;  1WI1 A;  4A6F A;  3FEH A;  2DKQ A;  1K5G B;  5DHF B;  1I7A A;  4XWX A;  3X23 A;  5KQ4 A;  2YS3 A;  3KY9 A;  3A8Q A;  1DBH A;  2J0M A;  4TYZ A;  2I1J A;  2MKR A;  3KSY A;  2W2W A;  5D3W A;  3ZDT A;  2DN6 A;  4ZRI A; 
#chains in the Genus database with same CATH topology
 5LOP B;  4ZRK A;  2LOX A;  4EKU A;  2OQB A;  2YT0 A;  1X11 A;  5JP4 A;  1V88 A;  4GOU A;  2L2I A;  3BJI A;  1V5M A;  2LYD A;  2LOZ A;  1MPH A;  2FJL A;  4B6H A;  1RRP B;  4F7U P;  4KVG B;  1ZM0 A;  4CHM A;  5DIF B;  3AJ4 A;  2D9Z A;  3NWD A;  1XKE A;  1OMW A;  2K00 A;  1X1G A;  3P7Z A;  4GXB A;  4HAX B;  3SUZ A;  2P0H A;  4D0N B;  2H7E A;  1U5F A;  3GYO A;  2I5C A;  2K2J A;  4QJ4 B;  1FGY A;  4DXA B;  4F7H A;  3A98 B;  2COF A;  1FGZ A;  2YF0 A;  4KHA A;  3DCX A;  1K5D B;  1NU2 A;  1Y19 B;  3HK0 A;  1DDM A;  3PVW A;  4CSQ A;  2J59 M;  4D6W A;  1XCG A;  2IYB A;  1UPR A;  3B77 A;  2DHK A;  2RVB B;  3CIK A;  3RCP A;  2R09 A;  3U12 A;  2EJ8 A;  2X18 A;  3ODW A;  2UZR A;  2ELB A;  2HTH B;  2Y8G A;  4HAV B;  1W1G A;  3NW8 A;  3DXE A;  5HE2 A;  1T77 A;  1U5E A;  1Y5O A;  4GNK B;  5L81 A;  4MK0 A;  1EAZ A;  1FOE A;  1UNP A;  1ZSQ A;  3KRX A;  4HAZ B;  4HB0 B;  2D9X A;  4PQ0 A;  3WA0 A;  4K17 A;  2DA0 A;  1XD4 A;  2CY5 A;  1ZVR A;  1BWN A;  2N0Y A;  4Z2M B;  2ROV A;  4Z2N A;  2DLW A;  2YS1 A;  2YVC A;  2N23 A;  4H8S A;  1AWE A;  5J3Y A;  3TO1 A;  1U29 A;  3LJU X;  2M38 A;  4QJ3 B;  1H4R A;  1U5G A;  2VRW B;  2COD A;  5IRS A;  4KHO A;  3A58 A;  1U5D A;  1NTY A;  1DYN A;  3P6A A;  1W1H A;  1V5U A;  2GJY A;  3GYP A;  3HQC A;  4GN1 A;  2Y7B A;  5D3X A;  4YON A;  2Z59 A;  5C5B B;  3QIJ A;  3TW1 A;  1GG3 A;  1N3H A;  3PEG A;  4HSI A;  2CY4 A;  1W1D A;  1P3R A;  2VKI A;  3VIA A;  2D2Q A;  2Z14 A;  5KQ1 A;  2FJU B;  3G9W A;  3DXC A;  3M1I B;  3PVU A;  4GPT B;  1U27 A;  4HB3 B;  3AU5 A;  3NWA A;  5J3T A;  4HB4 B;  4WSF A;  1GC6 A;  1J19 A;  3CXB B;  4BBK A;  3D8F A;  2XQN M;  3NSU A;  4KAX B;  5FI0 A;  1EGX A;  1KI1 B;  2MWN B;  1M7R A;  5I2M A;  1ISN A;  4HAY B;  3PSC A;  1SGH A;  2GCL A;  2P0D A;  1DDW A;  5D3V A;  2R0D A;  4HAU B;  1LW3 A;  4HAT B;  1FHW A;  1WJ1 A;  5D27 A;  5DH9 B;  1XOD A;  5DI9 B;  1RJ2 A;  3QBV B;  3WYF B;  1X05 A;  1I2H A;  4MT7 A;  1BTN A;  2CAY A;  2H7D A;  3HW2 B;  1UNR A;  1V89 A;  1NTV A;  2RNR B;  2YT1 A;  3PVL A;  3ZVR A;  1V61 A;  3A8P A;  4WJ7 A;  1EF1 A;  1WGU A;  2YRY A;  3KRW A;  3TFM A;  2AEH A;  1MK9 B;  4L6E A;  4QXA B;  2W2X C;  2KR0 A;  3TVV A;  1WGQ A;  2KUP A;  4HAW B;  3FVC A;  3HIE A;  5C5B A;  4GMV A;  1UNQ A;  1Z87 A;  4ZRJ A;  1WG7 A;  2KCJ A;  5LG4 B;  4ZRI A;  3D8D A;  4DBB A;  2MFQ A;  4YL8 A;  3KZ1 A;  1H10 A;  2RGN B;  4HB2 B;  1MIZ B;  4F7G A;  2E2X A;  1AQC A;  1MK7 B;  2ADZ A;  5JHG A;  3MDB C;  3O96 A;  3TCA A;  1UPQ A;  5C79 A;  1LB1 A;  2YSZ A;  4K2P A;  1ZYI A;  2LKO A;  3F5R A;  1MKE A;  4OSN A;  1KZ7 A;  2AL6 A;  2LG1 A;  3V5W A;  1MIX A;  3BIN A;  2GS0 A;  2RUK B;  1TQZ A;  4P7I A;  3ULB A;  4IFS A;  2J0J A;  2BCJ A;  2D9V A;  1SHC A;  3HSA A;  3ML4 A;  3SYX A;  4EMO A;  1X1F A;  3N7C A;  2YS5 A;  4NY0 A;  1TXD A;  2Y8F A;  2KGX B;  2G35 A;  1EVH A;  4K81 A;  1P5T A;  1ZC4 B;  2DFK A;  2UVM A;  4Y94 A;  4WVF B;  5KCV A;  2DKP A;  3F0W A;  3DXD A;  2HE7 A;  5D3Y A;  2DYQ A;  2DHJ A;  4DX8 A;  2K8E A;  2DYN A;  5C16 A;  4IAP A;  2GCJ A;  5HE3 A;  2DX1 A;  2P8V A;  4CHJ A;  1M7E A;  1UEF A;  2RRF A;  2KIG A;  2EC1 A;  4L1R A;  2MDX A;  2DTC A;  5EFX A;  1OY2 A;  2KIE A;  4EJN A;  3AU4 A;  4A6F B;  4A6H A;  4C0A A;  5JHH A;  3PZD A;  3SO6 A;  2NMB A;  1XR0 B;  4TKN A;  5M4Y B;  4MY6 A;  2L1C A;  2COC A;  4DX9 0;  1FB8 A;  1BTK A;  1GC7 A;  2Z0Q A;  2I1K A;  2I5F A;  5DHA B;  2PZ1 A;  1QQG A;  2EMS A;  3VOQ A;  3ODO A;  1FHO A;  1PMS A;  2LUL A;  4GZU A;  2K2U A;  5JLJ B;  2ELA A;  2CRF A;  4DIX A;  1ZC3 B;  2D9Y A;  2ZPY A;  2Q13 A;  1PFJ A;  2D10 A;  2D11 A;  5I2S A;  2COA A;  2D9W A;  2NBV A;  2OTX A;  1IRS A;  2QKM A;  1B55 A;  2V76 A;  3U8Z A;  5C6R A;  1XX0 A;  1QC6 A;  4KHB A;  3D8E A;  1U2B A;  3U7D A;  2ROZ B;  2ZKM X;  1E5W A;  1OQN A;  2GUM A;  4CYE A;  2VSZ A;  2DX5 A;  2P0F A;  1NI2 A;  5GOW B;  3FM8 C;  2J0K A;  1FAO A;  1WJM A;  3FSS A;  5FI1 A;  3QWM A;  2RLO A;  3ULC A;  5CLQ B;  1KZG A;  3PP2 A;  1Q67 A;  2M14 A;  2JP2 A;  2NZ8 B;  2R2Y A;  4HDQ A;  5CLL B;  1DDV A;  4GMX B;  1P6S A;  1X86 A;  1MI1 A;  2QKL A;  1PLS A;  2UZS A;  4HDO A;  2Z0P A;  3MPX A;  3SNH A;  4QJ5 B;  2DHI A;  1BAK A;  1DRO A;  4IOY X;  3ODX A;  1WVH A;  4NSW A;  5LON B;  3T06 A;  1MAI A;  2EMT A;  5HE0 A;  3OHM B;  2Z13 A;  2RSG A;  4PNK A;  3NWF A;  1J0W A;  2YT2 A;  3SV1 A;  1FHX A;  1TJ6 A;  1V5P A;  4HHV A;  3UZT A;  5J3Q A;  5HE1 A;  3PG7 A;  4K2O A;  3IVF A;  4A5K A;  2D4Q A;  2Z0O A;  4KHB B;  2IFS A;  4A6K A;  2W2X D;  2Z4D A;  3OAN A;  1WI1 A;  4A6F A;  3FEH A;  2DKQ A;  1K5G B;  5DHF B;  2K49 A;  1I7A A;  4XWX A;  3X23 A;  5KQ4 A;  2YS3 A;  3KY9 A;  3A8Q A;  1DBH A;  4OT1 A;  2J0M A;  4TYZ A;  2I1J A;  2MKR A;  3KSY A;  2W2W A;  5D3W A;  3ZDT A;  2DN6 A;  2KUQ A; 
#chains in the Genus database with same CATH homology
 5LOP B;  4ZRK A;  2LOX A;  4EKU A;  2OQB A;  2YT0 A;  1X11 A;  5JP4 A;  1V88 A;  2L2I A;  3BJI A;  1V5M A;  2LYD A;  2LOZ A;  1MPH A;  2FJL A;  4B6H A;  1RRP B;  4F7U P;  4KVG B;  1ZM0 A;  4CHM A;  5DIF B;  3AJ4 A;  2D9Z A;  1XKE A;  1OMW A;  2K00 A;  1X1G A;  3P7Z A;  4GXB A;  4HAX B;  3SUZ A;  2P0H A;  4D0N B;  2H7E A;  1U5F A;  3GYO A;  2I5C A;  2K2J A;  1FGY A;  4DXA B;  4F7H A;  3A98 B;  2COF A;  1FGZ A;  2YF0 A;  4KHA A;  1K5D B;  1NU2 A;  1Y19 B;  3HK0 A;  1DDM A;  3PVW A;  2J59 M;  1XCG A;  2IYB A;  1UPR A;  2DHK A;  2RVB B;  3CIK A;  3RCP A;  2R09 A;  2EJ8 A;  2X18 A;  3ODW A;  2UZR A;  2ELB A;  2HTH B;  2Y8G A;  4HAV B;  1W1G A;  3DXE A;  5HE2 A;  1U5E A;  1Y5O A;  5L81 A;  4MK0 A;  1EAZ A;  1FOE A;  1UNP A;  1ZSQ A;  3KRX A;  4HAZ B;  4HB0 B;  2D9X A;  4PQ0 A;  3WA0 A;  4K17 A;  2DA0 A;  1XD4 A;  2CY5 A;  1ZVR A;  1BWN A;  2N0Y A;  4Z2M B;  2ROV A;  4Z2N A;  2DLW A;  2YS1 A;  2YVC A;  2N23 A;  4H8S A;  1AWE A;  5J3Y A;  3TO1 A;  1U29 A;  3LJU X;  2M38 A;  1H4R A;  1U5G A;  2VRW B;  2COD A;  4KHO A;  1U5D A;  1NTY A;  1DYN A;  3P6A A;  1W1H A;  1V5U A;  2GJY A;  3GYP A;  3HQC A;  4GN1 A;  2Y7B A;  5D3X A;  4YON A;  5C5B B;  3QIJ A;  3TW1 A;  1GG3 A;  1N3H A;  3PEG A;  2CY4 A;  1W1D A;  1P3R A;  2VKI A;  3VIA A;  2D2Q A;  5KQ1 A;  3G9W A;  3DXC A;  3M1I B;  3PVU A;  4GPT B;  1U27 A;  4HB3 B;  3AU5 A;  5J3T A;  4HB4 B;  4WSF A;  1GC6 A;  1J19 A;  3CXB B;  4BBK A;  3D8F A;  2XQN M;  3NSU A;  4KAX B;  5FI0 A;  1EGX A;  1KI1 B;  2MWN B;  1M7R A;  1ISN A;  4HAY B;  3PSC A;  1SGH A;  2GCL A;  2P0D A;  1DDW A;  5D3V A;  2R0D A;  4HAU B;  1LW3 A;  4HAT B;  1FHW A;  1WJ1 A;  5D27 A;  5DH9 B;  1XOD A;  5DI9 B;  1RJ2 A;  3QBV B;  3WYF B;  1X05 A;  1I2H A;  4MT7 A;  1BTN A;  2CAY A;  2H7D A;  3HW2 B;  1UNR A;  1V89 A;  1NTV A;  2RNR B;  2YT1 A;  3PVL A;  3ZVR A;  1V61 A;  3A8P A;  4WJ7 A;  1EF1 A;  1WGU A;  2YRY A;  3KRW A;  3TFM A;  2AEH A;  1MK9 B;  4L6E A;  2W2X C;  3TVV A;  1WGQ A;  2KUP A;  4HAW B;  5C5B A;  4GMV A;  1UNQ A;  1Z87 A;  4ZRJ A;  1WG7 A;  2KCJ A;  3D8D A;  4DBB A;  2MFQ A;  4YL8 A;  3KZ1 A;  1H10 A;  2RGN B;  4HB2 B;  1MIZ B;  4F7G A;  2E2X A;  1AQC A;  1MK7 B;  2ADZ A;  5JHG A;  3MDB C;  3O96 A;  3TCA A;  1UPQ A;  5C79 A;  1LB1 A;  2YSZ A;  4K2P A;  2LKO A;  3F5R A;  1MKE A;  1KZ7 A;  2AL6 A;  2LG1 A;  3V5W A;  1MIX A;  3BIN A;  2GS0 A;  2RUK B;  1TQZ A;  4P7I A;  3ULB A;  4IFS A;  2J0J A;  2BCJ A;  2D9V A;  1SHC A;  3ML4 A;  3SYX A;  4EMO A;  1X1F A;  3N7C A;  2YS5 A;  4NY0 A;  1TXD A;  2Y8F A;  2KGX B;  2G35 A;  1EVH A;  4K81 A;  1P5T A;  1ZC4 B;  2DFK A;  2UVM A;  4Y94 A;  4WVF B;  5KCV A;  2DKP A;  3F0W A;  3DXD A;  2HE7 A;  5D3Y A;  2DYQ A;  2DHJ A;  4DX8 A;  2DYN A;  5C16 A;  4IAP A;  2GCJ A;  5HE3 A;  2DX1 A;  2P8V A;  4CHJ A;  1M7E A;  1UEF A;  2EC1 A;  2MDX A;  2DTC A;  5EFX A;  1OY2 A;  4EJN A;  3AU4 A;  4A6F B;  4A6H A;  4C0A A;  5JHH A;  3PZD A;  3SO6 A;  2NMB A;  1XR0 B;  4TKN A;  4MY6 A;  2L1C A;  2COC A;  4DX9 0;  1FB8 A;  1BTK A;  1GC7 A;  2Z0Q A;  2I1K A;  2I5F A;  5DHA B;  2PZ1 A;  1QQG A;  2EMS A;  3VOQ A;  3ODO A;  1FHO A;  1PMS A;  2LUL A;  4GZU A;  2K2U A;  5JLJ B;  2ELA A;  2CRF A;  1ZC3 B;  2D9Y A;  2ZPY A;  2Q13 A;  1PFJ A;  2D10 A;  2D11 A;  2COA A;  2D9W A;  2OTX A;  1IRS A;  2QKM A;  1B55 A;  2V76 A;  3U8Z A;  5C6R A;  1XX0 A;  1QC6 A;  3D8E A;  1U2B A;  3U7D A;  2ROZ B;  1E5W A;  1OQN A;  4CYE A;  2VSZ A;  2DX5 A;  2P0F A;  1NI2 A;  5GOW B;  3FM8 C;  2J0K A;  1FAO A;  1WJM A;  3FSS A;  5FI1 A;  3QWM A;  2RLO A;  3ULC A;  5CLQ B;  1KZG A;  3PP2 A;  1Q67 A;  2M14 A;  2JP2 A;  2NZ8 B;  4HDQ A;  5CLL B;  1DDV A;  4GMX B;  1P6S A;  1X86 A;  2QKL A;  1PLS A;  2UZS A;  4HDO A;  2Z0P A;  3MPX A;  3SNH A;  1BAK A;  2DHI A;  1DRO A;  4IOY X;  3ODX A;  1WVH A;  4NSW A;  5LON B;  3T06 A;  1MAI A;  2EMT A;  5HE0 A;  2RSG A;  4PNK A;  1J0W A;  3SV1 A;  1FHX A;  1TJ6 A;  1V5P A;  4HHV A;  3UZT A;  5J3Q A;  5HE1 A;  3PG7 A;  4K2O A;  3IVF A;  4A5K A;  2D4Q A;  2Z0O A;  4KHB B;  2IFS A;  4A6K A;  2W2X D;  3OAN A;  1WI1 A;  4A6F A;  3FEH A;  2DKQ A;  1K5G B;  5DHF B;  1I7A A;  4XWX A;  3X23 A;  5KQ4 A;  2YS3 A;  3KY9 A;  3A8Q A;  1DBH A;  2J0M A;  4TYZ A;  2I1J A;  2MKR A;  3KSY A;  2W2W A;  5D3W A;  3ZDT A;  2DN6 A;  4ZRI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...