4KHAA

Structural basis of histone h2a-h2b recognition by the essential chaperone fact
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
406
structure length
360
Chain Sequence
DVVEQDKLIEIRNRRPAVLDNVYIRPALEGKRVPGKVEIHQNGIRYQSPLSTTQRVDVLFSNIRHLFFQPCQNEMIVIIHLHLKDPILFGKKKTKDVQFYREAIQEERRRKAELDRLFKSFAEKIAEAGRNEGIEVDMPIRDLGFNGVPNRSNVVIYPTTECLIQITEPPFLVITLEDVEWAHLERVQFGLKNFDLVFVFKDFTRPVVHINTIPVESLEDVKEFLDSSDIPFSEGPLNLNWSVIMKTVTANPHQFFLDGGWGFLQNDSRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural basis of histone H2A-H2B recognition by the essential chaperone FACT.
pubmed doi rcsb
source organism Chaetomium thermophilum var. thermophilum
molecule tags Chaperone/nuclear protein
molecule keywords Spt16M-Histone H2B 1.1 chimera
total genus 99
structure length 360
sequence length 406
ec nomenclature
pdb deposition date 2013-04-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08512 Rtt106 Histone chaperone Rttp106-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 4khaA03
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 4khaA02
2.30.29.150 Mainly Beta Roll PH-domain like PH-domain like 4khaA01
5DH9B 2YVCA 1P3MB 5D3XA 5CPIA 1KX5A 5AV6A 3GYOA 3AZIC 3X1SC 2L5AA 3X1VA 1RRPB 5B0ZA 5D27A 3ZVRA 3REKD 3PP2A 5B24D 3C1CD 3MPXA 3SO6A 2DFKA 1N1JA 3W96A 1ZC4B 4Z5TB 1P3KD 3O96A 3AZKA 4WZSB 4KUDC 2COFA 3KWQA 3SYXA 2NZDB 1EQZA 2FJ7A 2M14A 3W96C 3AZLB 3ODXA 3AZKC 2COAA 3LJAC 4JJNB 3AZMA 3LZ0D 5CPJA 1V5PA 2D11A 4XZQC 2DYNA 2RLOA 3KWQC 2DKQA 5FI1A 2HIOB 4J8UD 3KUYB 1U2BA 4C0AA 5D3YA 1KX4A 4J8XB 5KDMA 3LZ1B 2AROD 3MVDB 1U27A 3LJAA 3VH6T 4J8WD 5F99C 5CPJC 2I1KA 4KHOA 4XZQA 2P0FA 3AU5A 3D8EA 3B6FC 5B32A 1KX3A 3UTBA 1ID3B 3MGQD 2LOXA 4KGCB 2LG1A 3REHD 2KGXB 1V89A 3MVDA 4G92C 4WU9A 1P3FB 2YS5A 1XX0A 4GMXB 1P3PC 3KXBD 1EVHA 3W98D 4R8PA 3AN2B 1BAKA 3TFMA 3AN2D 1UEFA 1BWNA 2F8ND 2FJLA 2F8NB 4WU9C 5CHLB 5KCVA 1HQ3D 2UZRA 2BYKB 1F66B 2W2XC 4WSFA 3REHB 2K00A 1P3BC 1P3LA 2NZDC 2EMSA 3AZND 5BNXA 2Y8GA 4NSWA 3MGRB 2AROB 4MT7A 5DNND 2PYOB 5DHAB 4JJNC 3A98B 3F0WA 3W99A 4YONA 4Z66B 1P3LB 2HIOD 4J8UB 4D0NB 5DNMA 5CP6D 3MGPC 2JSSA 4YS3A 2M38A 5AV9C 3UZTA 3MNNA 5CPJB 4JJNA 3AZMB 2EJ8A 1XODA 5BT1C 1GC6A 2KCJA 3SV1A 3C1BC 2VRWB 4WV4B 1KX4C 2BCJA 2Z0PA 3HW2B 4YS3C 3AV1B 4EO5C 4Z5TD 4H9QB 1U5EA 4YM6A 3A6ND 1P3PB 2J0KA 1TJ6A 1DDWA 5JLJB 2RGNB 2G35A 2I5FA 3RELD 1WI1A 3LJUX 5DIFB 3W98B 1X1GA 1F66C 4YM6C 1MAIA 4QLCC 3DXDA 4R8PB 1S32C 4A5KA 5J3YA 3CXBB 1P3GC 1PMSA 2DX5A 5JA4A 1Q9CA 4LD9A 3QBVB 5AV6C 4Z66C 3X1SA 3X1VC 3AZIA 3ODOA 4Z2MH 1AOID 3W97A 5B0ZC 1ZC3B 1ZM0A 1P3FD 3X23A 2RUKB 4NE3A 5CPKA 4HB2B 4WU8A 2UZSA 3N7CA 3WA9C 5E5AC 3MGPA 4E44A 3AFAC 4J8WB 3W97C 3WAAC 3AV1C 4YS3B 4Z2NA 4KUDA 1FB8A 5CLQB 1U5GA 2YFVA 2YF0A 3X1UC 1X86A 3C1BA 2VKIA 2K2JA 4EJNA 4X23D 3WAAA 5B24B 3C1CB 5DNNB 3AYWC 5B33B 4ZRIA 3NQJB 3AZGB 5JRGD 2Q13A 5AV8C 4QLCB 4ZBJC 1DYNA 2NZ8B 2P0DA 2DX1A 1P3AC 4J8VC 3AYWD 2LKOA 2DYQA 3TO1A 3AYWA 1P34D 1K5GB 3B6FA 4XUJA 5B32C 4X23C 3RELB 1KX3C 1M18A 5GT0D 3KZ1A 3PVLA 2DLWA 1JFIA 3REJB 1HTAA 5AVCB 2D9XA 1MPHA 2DKPA 4UUZA 4KAXB 5HE0A 3LELB 2NMBA 4XUJC 4X23A 1ZVRA 1BTKA 1P3MD 2LY8A 1M18C 1RJ2A 2D9VA 3PVUA 4HB0B 3KY9A 1WWIA 5GOWB 3AZFA 3PSCA 3HK0A 5JHHA 3LELA 1V5UA 5B1MD 2NQBB 5C3IC 5B1LD 4ZUXB 4WU8C 2D9YA 4M6BA 3WA9A 1P3BA 4DX8A 3M1IB 1P3RA 3KUYD 3AZFC 1LB1A 5B1LC 4WU8D 5B2JD 4GZUA 1P3GD 3AZJD 4MK0A 1AOIA 3ODWA 3B6GD 4CHJA 3X1UA 3AZLD 1V88A 1WGUA 2RNRB 2ADZA 5AV8B 3R45A 1BH9A 1F66D 5AV9A 5AVCD 4HAXB 3LJAB 1AOIB 5AVBC 3UTAA 1P3OB 3BINA 4YL8A 4CAYA 1P3KB 1EF1A 1KU5A 2YFWA 5B32B 5AY8B 5AV8A 1KX3B 1ZLAC 1ZLAD 1FHXA 4J8VA 4EMOA 3VOQA 4CYEA 4HAVB 1Y19B 4XUJB 3RELA 3MGSA 2L2IA 3UTAD 3WKJD 2DHJA 4L6EA 1IRSA 4TKNA 2HUEC 5BNVB 1WWSA 1P6SA 4DRBA 1PFJA 5C5BA 3MGSC 5B31G 3AZFB 3O62D 3KUYA 4HB3B 4Z2MB 3AFAD 2GJYA 2NZDD 1P3BB 1TAFA 5G49A 5B1MA 3KRWA 2IO5B 5B2IB 3O62C 2L1CA 5FI0A 1N3HA 3V5WA 5B2JC 1U5DA 1AOIC 1NTVA 1Y5OA 1P3MA 1P3LD 2HTHB 1P3LC 5E5AA 2NZDA 4WNNA 5GSUA 3AFAA 3AV1A 5BO0A 3KXBC 2DN6A 5AV9B 4F7HA 3PVWA 3KSYA 2F8NA 5DI9B 1P34A 1WJ1A 5GSUC 1KX4B 3KXBA 2YRYA 5CPIB 2OQBA 3T06A 5GT3C 1W1DA 5GT3D 1P34B 1W1HA 1EQZB 5GT0C 2FJ7B 2OTXA 5AVBD 4HHVA 1UPRA 5J3QA 3F5RA 3WAAD 3W99B 2CAYA 1H4RA 3LJAD 4EKUA 5FUGA 5JRGB 5AV5A 4DXAB 3AZLC 3W96B 3B6GC 5GXQB 2GCLA 3DXEA 3AZKB 1V5MA 5HE3A 2Y7BA 4HAUB 1P3GB 3KUYC 2BYKA 1F66A 2DTCA 5AV5C 4Z66D 1XCGA 4DRAA 5F99B 1FGYA 4CSRA 1P3GA 5G49B 1P3FA 3VH5W 1MKEA 5B2JA 4LD9C 1SHCA 4WJ7A 4Z66A 3B0DC 3VH6W 1NU2A 2D2QA 4LD9D 5B1LA 4WNNB 5GSUB 1BH8A 1R4VA 3LELD 3WAAB 4BBKA 5BO0B 4CHMA 5B0ZD 3AZFD 5JP4A 5AV5D 1MIXA 5GT3B 5AV6D 2ELAA 1P34C 4HGAB 5GT0B 3REKB 3D8FA 2V76A 4H9NB 3B0CT 2VSZA 5AVBA 3UTAC 2RSGA 4KVGB 3WYFB 2R09A 5GT3A 5JRGC 5GT0A 4QLCD 1EAZA 1I2HA 4XUJD 1WJMA 1B6WA 5J3TA 1V61A 1WG7A 2LYDA 1UNPA 4X23B 2HIOC 3B0BA 3RELC 3GYPA 1U35B 1M1AB 4JJND 3A6NC 3AV1D 5AVCC 1P3IC 5CLLB 2MKRA 5GSUD 2RVBB 1P3AD 5E5AD 2QKLA 3C1BB 4MY6A 2HIOA 3C1BD 1OY2A 2HE7A 3B0DB 2F8NK 4KHBB 1P3FC 3NQJA 2DHIA 3AZNA 2N23A 4GMVA 4NFTA 3KRXA 3TU4A 4GN1A 3W98C 5B1MC 3O62A 4H9QA 2DHKA 4WU9B 2J0JA 3U8ZA 3AZNB 3CIKA 4AWLB 3TU4B 1FGZA 3REHC 1AQCA 2Z0OA 1BFMA 1J0WA 3PG7A 1HQ3B 2MFQA 5L81A 2AROC 3WKJA 4H9NA 5CPKB 5AV6B 2J59M 3SUZA 5B40B 3MGSD 2AEHA 1TZYB 5B32D 1KX3D 1ZLAB 4XZQD 1GG3A 3MGPB 1NTYA 2EMTA 2YS1A 4J8VD 4ZUXA 5D3VA 3MGRA 2AROA 3WKJC 4P7IA 1KX4D 3MGQB 5AV8D 1ZLAA 2R0DA 5BT1D 1XKEA 3OANA 3A6NA 3LZ0A 5AVCA 5AV9D 2CODA 5KQ1A 4A6HA 4A6KA 3X1UB 1U29A 3X1UD 3AZLA 3WTPB 3B6GA 5HE1A 3AZJA 3PEGA 3ZDTA 2D9WA 2IFSA 4CAYB 1P3KA 4B6HA 4AWLC 1P3BD 5DNMD 5CP6A 3WA9D 3FSSA 3AZJC 5JHGA 1S32B 2J0MA 5B24A 3C1CA 3W99D 4XZQB 4H8SA 4H9SA 3X1VD 3TW1A 3SNHA 1KX5D 5CP6C 1GC7A 1KX5B 2F8NG 1TZYD 1X1FA 1X05A 4HAYB 4PQ0A 1WGQA 4IAPA 3KXBB 4GPTB 3U7DA 2NQBA 1S32D 1P3MC 4G92B 2CV5B 1M18D 2YFWB 2PZ1A 3B6FD 5B0YA 1M19A 3AZEA 1MK7B 4R8PD 1SGHA 2MDXA 2D9ZA 2H7DA 4J8WC 3W97B 1QC6A 2W2XD 3AU4A 4WU9D 2Z0QA 3MVDD 5FUGB 5B0YB 5JRGA 1M19B 3WTPD 5B31C 1J19A 2CRFA 2UVMA 4Z5TC 3AJ4A 5B2ID 1FOEA 3V9RB 3G9WA 4H9PB 5B33C 4HB4B 2W2WA 1MIZB 2YS3A 4KUDD 4IFSA 3AZJB 3AZHA 3V9RA 5BS7A 4J8VB 1P3KC 5CPJD 3MGPD 5AY8C 2LOZA 5B33A 1E5WA 5KQ4A 2IYBA 1UNRA 3REIA 1P5TA 5CP6B 4ZRKA 5CPKD 3KWQD 3D8DA 3VH5A 3W97D 4H9SC 3AZKD 3X1SD 4H9OB 3AZID 1N1JB 4NE6A 1BTNA 1U5FA 2ELBA 1M18B 4Y94A 3QIJA 5EFXA 1W1GA 2CY4A 1FAOA 4HAWB 4E45A 3REKA 4H9OA 1UPQA 5C3IB 1XR0B 3AN2C 1B67A 3TVVA 1Z87A 3MDBC 1M19C 2LULA 1DDMA 5B31B 1ULYA 3WTPE 1P3PD 3IVFA 5BNVA 3REKC 2PYOA 1TXDA 4HAZB 4NY0A 4Z2MG 5C5BB 1DDVA 4J8XA 3LZ1A 5KDMB 1QQGA 5B31A 4YM6D 4Z5TA 5B2JB 5F99D 3NQUA 3MGRC 1FHOA 3UT9D 2PYOC 2QKMA 4G91C 2AL6A 3X1TD 1TAFB 4J8XD 4J8UC 3MNND 2N0YA 5LONB 4YS3D 5GXQD 1P3IB 3NSUA 2I5CA 5E5AB 3AFAB 4KHAA 3DXCA 4F7GA 5DNNA 2GCJA 1P3IA 4EO5B 5C6RA 4WVFB 1TQZA 3VH6A 1DBHA 3FM8C 5DHFB 5B32G 5B40D 3MGSB 5B24C 5AY8D 3C1CC 5DNNC 1HQ3A 2XQNM 1BH8B 3AZNC 1KZGA 5DNMB 3ULBA 3TU4C 3AN2A 1U35A 1M1AA 3W98A 1ID3D 1HQ3C 3KWQB 1K5DB 1OQNA 5AV5B 3AZHD 1WVHA 4IOYX 3REHA 4K81A 4G91B 2RVQC 3LZ1C 3MGQA 3UTBD 3MVDC 1UNQA 4LD9B 3AV2D 4J8WA 2CY5A 2P0HA 5B2IA 2YT1A 3QWMA 1ID3C 3FEHA 3NQUB 4KGCC 2BYMB 2H7EA 3MGQC 3ULCA 4J8UA 4CSRB 2ZPYA 3VH5T 1DROA 3AZMD 4ZUXC 4WU8B 2ROZB 3ML4A 3UTBB 1ID3A 5LOPB 2COCA 3AZED 5CPIC 5B0YD 1U35D 3AZGA 1M1AD 1EQZD 2FJ7D 2GS0A 1BH9B 1NI2A 2NQBD 2K2UA 1X11A 3LZ0C 4KHAB 1M7EA 2YFVB 5B40A 3W99C 5D3WA 3W96D 3AYWB 4H9RA 1TZYA 1MK9B 3AZGC 2EC1A 3REIC 5DNMC 4PNKA 4NE5A 5GXQC 2X18A 3B0CW 4TYZA 3RCPA 3REJA 2E2XA 1EGXA 3REJD 4H9RB 1I7AA 4XWXA 5BNXB 5CPID 1U35C 1M1AC 3A6NB 3P7ZA 5C79A 5GXQA 1Q67A 3AZMC 3REJC 4HATB 2JP2A 1B55A 4DBBA 5JA4B 1JFIB 2MWNB 4KGCD 3AZGD 3TCAA 4GXBA 3UT9A 2CV5C 3MNNB 1KZ7A 1M7RA 5F99A 1AWEA 2HUEB 2KUPA 2D4QA 2NQBC 3LZ1D 3UTBC 4HDQA 4DX90 4H9PA 4HDOA 3UT9B 2BYMA 4K17A 3X1TC 2Y8FA 5B0YC 3AZEC 2DA0A 4HGAC 3MGRD 4YM6B 5B1LB 4ZUXD 3LZ0B 3AV2A 2CV5D 1P3PA 4R8PC 3UTAB 1P3OA 2IO5C 3O62B 3REIB 1PLSA 4UUZB 1ISNA 5CPKC 1KI1B 3AV2C 5B40C 2F8NH 2D10A 2I1JA 5AVBB 1TZYC 3X1VB 1P3OC 4A6FA 2RVQD 5B0ZB 3HQCA 1XD4A 2YSZA 3AZHC 3WKJB 5BS7C 1OMWA 3WA9B 5AY8A 4A6FB 4F7UP 3REID 4K2OA 1A7WA 3X1SB 3AZIB 4K2PA 5B33D 3TU4D 3MNNC 2YT0A 1FHWA 1P3ID 2CWEA 5HE2A 3WTPC 1EQZC 2FJ7C 1P3OD 2ROVA 3A8PA 3UT9C 2CV5A 3X1TB 1P3AA 4KUDB 3AZEB 5B1MB 3WTPA 3B6GB 3PZDA 4ZBJB 3WA0A 3X1TA 1P3AB 1H3OB 2P8VA 3VIAA 1H10A 1LW3A 5B2IC 3P6AA 5C16A 1M19D 1F1EA 4KGCA 3AV2B 4QLCA 1KX5C 5B31D 1ZSQA 1H3OA 4J8XC 1S32A 3A8QA 3BJIA 4ZRJA 2PYOD 3R45B 3LELC 3B6FB 3AZHB
chains in the Genus database with same CATH superfamily
5DH9B 2YVCA 5LG4B 1P3MB 5D3XA 5CPIA 4D6WA 1KX5A 5AV6A 3GYOA 3H0RC 3AZIC 3X1SC 2L5AA 3X1VA 1RRPB 5B0ZA 5D27A 3ZVRA 3REKD 3PP2A 5B24D 3C1CD 5I2SA 1PZRA 3MPXA 3SO6A 2DFKA 1N1JA 3W96A 1ZC4B 4Z5TB 2G5IC 1P3KD 3O96A 3AZKA 4WZSB 4KUDC 2COFA 3KWQA 3SYXA 2NZDB 1EQZA 2FJ7A 2M14A 3W96C 3AZLB 3ODXA 3AZKC 2COAA 3LJAC 4JJNB 3AZMA 3LZ0D 5CPJA 1V5PA 2D11A 4XZQC 2DYNA 2RLOA 3KWQC 2DKQA 3OHMB 2HIOB 4J8UD 3KUYB 1U2BA 5FI1A 4C0AA 2W8SA 5D3YA 1KX4A 4J8XB 5KDMA 3LZ1B 2AROD 3MVDB 1U27A 3LJAA 3VH6T 4J8WD 5F99C 5CPJC 2I1KA 4KHOA 4XZQA 2P0FA 3AU5A 3A58A 3B6FC 3D8EA 5B32A 1KX3A 3UTBA 1ID3B 3MGQD 2UWXA 4KGCB 2LG1A 3REHD 2KGXB 1V89A 3MVDA 4G92C 4WU9A 1P3FB 2YS5A 1XX0A 4GMXB 1P3PC 3KXBD 3H0LC 1EVHA 3W98D 4R8PA 3AN2B 1BAKA 3TFMA 3AN2D 1UEFA 1BWNA 2F8ND 2ZY2A 2FJLA 2F8NB 4WU9C 5CHLB 3NWDA 5KCVA 1HQ3D 2UZRA 2BYKB 1F66B 2W2XC 4WSFA 3REHB 2K00A 1P3BC 2KUQA 1P3LA 2NZDC 2EMSA 3AZND 5BNXA 2Y8GA 4NSWA 3MGRB 2AROB 4MT7A 5DNND 2PYOB 5DHAB 4JJNC 3A98B 3F0WA 3W99A 4YONA 2BG1A 4Z66B 1P3LB 2HIOD 4J8UB 4D0NB 5DNMA 5CP6D 3MGPC 2JSSA 4YS3A 2M38A 5AV9C 4QJ3B 3MNNA 3UZTA 5CPJB 4JJNA 3AZMB 2EJ8A 1XODA 5BT1C 1GC6A 2KCJA 3SV1A 3C1BC 2VRWB 4WV4B 1KX4C 2BCJA 2Z0PA 3HW2B 4YS3C 3AV1B 4EO5C 4Z5TD 4H9QB 1U5EA 4YM6A 3A6ND 1P3PB 2J0KA 1TJ6A 1DDWA 5JLJB 2RGNB 2G35A 2ZY4A 3RELD 1WI1A 2I5FA 3LJUX 5DIFB 3W98B 1X1GA 1F66C 4YM6C 1MAIA 4QLCC 3DXDA 4R8PB 1S32C 4A5KA 5J3YA 3CXBB 1P3GC 1PMSA 2DX5A 5JA4A 1Q9CA 4LD9A 3QBVB 5AV6C 4Z66C 3X1SA 3X1VC 3AZIA 3ODOA 4Z2MH 1AOID 3W97A 5B0ZC 1ZC3B 1ZM0A 1P3FD 3X23A 2RUKB 4NE3A 5CPKA 2Y2GA 4HB2B 4WU8A 3FVCA 2UZSA 3N7CA 3WA9C 5E5AC 3MGPA 4E44A 3AFAC 4J8WB 3W97C 3WAAC 3AV1C 4YS3B 4Z2NA 4KUDA 1FB8A 5CLQB 1U5GA 2YFVA 2Z4DA 2YF0A 2ZY3A 3X1UC 1X86A 3C1BA 2VKIA 2K2JA 4EJNA 4X23D 3WAAA 5B24B 3C1CB 5DNNB 3AYWC 5B33B 4OT1A 3NQJB 3AZGB 4ZRIA 5JRGD 2Q13A 5AV8C 4QLCB 4ZBJC 1DYNA 2NZ8B 2P0DA 2DX1A 1P3AC 4J8VC 3AYWD 2LKOA 2DYQA 3TO1A 3AYWA 1P34D 1K5GB 3B6FA 4XUJA 5B32C 4X23C 3RELB 1KX3C 1M18A 5GT0D 3KZ1A 3PVLA 2DLWA 1JFIA 3REJB 1HTAA 5AVCB 2D9XA 1MPHA 2DKPA 4UUZA 4KAXB 5HE0A 3LELB 2NMBA 4XUJC 4X23A 1ZVRA 1BTKA 1P3MD 2LY8A 1M18C 1RJ2A 2F2AC 2D9VA 3PVUA 3KY9A 1WWIA 4HB0B 5GOWB 3AZFA 3PSCA 3HK0A 5JHHA 2XD5A 3LELA 1V5UA 5B1MD 2NQBB 5C3IC 5B1LD 4ZUXB 4WU8C 1FHXA 4M6BA 3WA9A 2D9YA 1P3BA 4DX8A 3M1IB 1P3RA 3KUYD 3AZFC 1ZYIA 2ZKMX 1LB1A 5B1LC 4WU8D 5B2JD 4GZUA 1P3GD 3AZJD 4MK0A 1AOIA 3ODWA 3B6GD 4CHJA 3X1UA 3AZLD 1V88A 1WGUA 2RNRB 2ADZA 5AV8B 3R45A 3HSAA 1BH9A 1F66D 5AV9A 5AVCD 4HAXB 3LJAB 1AOIB 5AVBC 3UTAA 1P3OB 3BINA 4YL8A 4CAYA 1P3KB 1EF1A 1KU5A 2YFWA 5B32B 5AY8B 5AV8A 1KX3B 1ZLAC 2Y2IA 1ZLAD 5M4YB 4J8VA 4EMOA 3VOQA 2R2YA 4CYEA 4HAVB 1Y19B 4XUJB 3RELA 3MGSA 2L2IA 3UTAD 3WKJD 2DHJA 4L6EA 4HSIA 1IRSA 1W2EA 4TKNA 2HUEC 5BNVB 1DDMA 1WWSA 1P6SA 4DRBA 1PFJA 5C5BA 3MGSC 5B31G 2JE5A 3AZFB 2VQRA 3O62D 2Z14A 3KUYA 4HB3B 4Z2MB 3AFAD 2GJYA 2NZDD 2K8EA 1P3BB 1TAFA 5G49A 3P5JB 5B1MA 2IO5B 5B2IB 3O62C 2L1CA 3DCXA 1N3HA 3KRWA 5B2JC 5FI0A 3V5WA 1U5DA 1AOIC 1NTVA 1Y5OA 1P3MA 2RIQA 1P3LD 1P3LC 5E5AA 2NZDA 2HTHB 4WNNA 5GSUA 3AFAA 3AV1A 5BO0A 3KXBC 2DN6A 5AV9B 4F7HA 3PVWA 3KSYA 2F8NA 5DI9B 1P34A 1WJ1A 5GSUC 1KX4B 4QJ5B 2Y2QA 3KXBA 2YRYA 1T3UA 5CPIB 2OQBA 3T06A 5GT3C 1W1DA 5GT3D 4OSNA 1P34B 1W1HA 1EQZB 5GT0C 2FJ7B 2OTXA 5AVBD 4HHVA 1UPRA 5J3QA 4DQYB 3F5RA 2YT2A 3WAAD 3W99B 2CAYA 1H4RA 3LJAD 4EKUA 5FUGA 5JRGB 5AV5A 4DXAB 3AZLC 3W96B 3B6GC 5GXQB 2GCLA 3DXEA 3AZKB 1V5MA 5HE3A 2Y7BA 4HAUB 1P3GB 3KUYC 2BYKA 1F66A 2DTCA 2DQNC 5AV5C 4Z66D 1XCGA 4DRAA 5F99B 1FGYA 4CSRA 1P3GA 5G49B 1P3FA 3VH5W 1MKEA 5B2JA 4LD9C 1SHCA 4WJ7A 3EPKA 4Z66A 3B0DC 3VH6W 1NU2A 2D2QA 4LD9D 3A1KA 5B1LA 4WNNB 5GSUB 1BH8A 1R4VA 3LELD 3WAAB 1MI1A 5BO0B 4BBKA 5B0ZD 4CHMA 3AZFD 5JP4A 5AV5D 1MIXA 5GT3B 5AV6D 2ELAA 1P34C 4HGAB 5GT0B 3REKB 2XD1A 3D8FA 2V76A 4H9NB 3B0CT 2VSZA 3HIEA 5AVBA 3UTAC 2RSGA 4KVGB 3WYFB 2R09A 5GT3A 5JRGC 4UPKA 5GT0A 4QLCD 1EAZA 1I2HA 4XUJD 1WJMA 1B6WA 5J3TA 1V61A 1WG7A 2LYDA 1UNPA 4X23B 2HIOC 3B0BA 3RELC 3GYPA 1U35B 1M1AB 4JJND 3A6NC 3EPLA 3AV1D 5AVCC 1P3IC 5CLLB 2MKRA 2ZY5A 5GSUD 2RVBB 1P3AD 5E5AD 2QKLA 3A1IA 3C1BB 4MY6A 2HIOA 3C1BD 1OY2A 2HE7A 1T77A 3B0DB 2F8NK 4KHBB 1P3FC 3NQJA 2DHIA 3AZNA 2N23A 4GMVA 4NFTA 3KRXA 3TU4A 4GN1A 3W98C 5B1MC 3O62A 4H9QA 2DHKA 4WU9B 2J0JA 3U8ZA 3AZNB 3CIKA 4AWLB 3TU4B 1FGZA 3REHC 1AQCA 2Z13A 3NW8A 3EPHA 2Z0OA 1BFMA 1J0WA 3PG7A 1HQ3B 2MFQA 5L81A 2Y2KA 2AROC 3WKJA 4H9NA 5CPKB 5AV6B 2J59M 3SUZA 5B40B 3MGSD 2AEHA 1Z2CB 1TZYB 5B32D 1KX3D 1ZLAB 3NWFA 4XZQD 1GG3A 3MGPB 1NTYA 2EMTA 2YS1A 4J8VD 4ZUXA 2K49A 3MGRA 2AROA 3WKJC 4P7IA 1KX4D 3MGQB 5AV8D 1ZLAA 2R0DA 5BT1D 1XKEA 2Z59A 3OANA 3A6NA 3LZ0A 5AVCA 5AV9D 2CODA 5KQ1A 4A6HA 4A6KA 3X1UB 1U29A 3X1UD 2Y2OA 3WTPB 3AZLA 3B6GA 5HE1A 3AZJA 3PEGA 3ZDTA 2D9WA 2IFSA 4CAYB 1P3KA 4B6HA 4AWLC 1P3BD 5DNMD 5CP6A 3WA9D 3FSSA 3AZJC 5JHGA 1S32B 2J0MA 5B24A 2Y2JA 3C1CA 3W99D 2Y2PA 4XZQB 3U12A 4H8SA 4H9SA 2G5HC 3X1VD 3TW1A 3SNHA 3NWAA 4WJ3C 1KX5D 5CP6C 1GC7A 5I2MA 1KX5B 2F8NG 1TZYD 1X1FA 1X05A 4HAYB 4PQ0A 1WGQA 4IAPA 3KXBB 4GPTB 3U7DA 2NQBA 1S32D 1P3MC 4G92B 2CV5B 1M18D 2YFWB 2PZ1A 3B6FD 5B0YA 1M19A 3AZEA 1MK7B 4R8PD 1SGHA 2MDXA 2D9ZA 2H7DA 4J8WC 3W97B 1QC6A 2W2XD 3AU4A 4WU9D 2Z0QA 3MVDD 5FUGB 5B0YB 5JRGA 3EPJA 3WTPD 5B31C 1M19B 1J19A 2CRFA 2UVMA 4Z5TC 3AJ4A 5B2ID 1FOEA 3V9RB 3G9WA 4H9PB 5B33C 4HB4B 2W2WA 1MIZB 2YS3A 4KUDD 4IFSA 3AZJB 3AZHA 3V9RA 5BS7A 4J8VB 1P3KC 5CPJD 3MGPD 5AY8C 2LOZA 5B33A 1E5WA 5KQ4A 2IYBA 1UNRA 3REIA 1P5TA 4CSQA 5CP6B 4ZRKA 5CPKD 3KWQD 3D8DA 3VH5A 3AL0C 3W97D 4H9SC 3H0MC 3X1SD 4H9OB 3AZID 1N1JB 4NE6A 3AZKD 1BTNA 2DF4C 1U5FA 2ELBA 1M18B 4Y94A 3QIJA 5EFXA 1W1GA 2CY4A 1FAOA 4HAWB 4E45A 3REKA 4H9OA 1UPQA 2GUMA 5C3IB 5IRSA 1XR0B 3AN2C 1B67A 3TVVA 1Z87A 3MDBC 1M19C 2LULA 5D3VA 5B31B 1ULYA 3WTPE 1P3PD 3IVFA 2J8PA 5BNVA 3REKC 2PYOA 1TXDA 4HAZB 4NY0A 4Z2MG 5C5BB 1DDVA 4J8XA 5KDMB 3LZ1A 1QQGA 5B31A 4YM6D 4Z5TA 5B2JB 5F99D 3NQUA 3MGRC 1FHOA 3UT9D 2PYOC 2QKMA 4GNKB 4G91C 2AL6A 2LOXA 3X1TD 2Y2HA 1TAFB 4J8XD 4J8UC 3MNND 2N0YA 5LONB 4YS3D 5GXQD 1P3IB 3NSUA 3IP4C 2I5CA 5E5AB 2FJUB 3AFAB 4KHAA 3DXCA 4F7GA 5DNNA 2GCJA 1P3IA 4EO5B 5C6RA 4WVFB 1TQZA 3VH6A 1DBHA 3FM8C 5DHFB 5B32G 5B40D 3MGSB 5B24C 5AY8D 3C1CC 5DNNC 1HQ3A 2XQNM 1BH8B 3AZNC 2JCHA 1KZGA 5DNMB 3ULBA 3TU4C 3AN2A 3FDDA 1U35A 1M1AA 3KFUG 3W98A 1ID3D 1HQ3C 3KWQB 1K5DB 1OQNA 4QXAB 5AV5B 3AZHD 1WVHA 2KIGA 4IOYX 3REHA 4K81A 4G91B 2RVQC 3LZ1C 3MGQA 3UTBD 3MVDC 1UNQA 4LD9B 3AV2D 4J8WA 2CY5A 2P0HA 5B2IA 2YT1A 3QWMA 1ID3C 3FEHA 3NQUB 4KGCC 2BYMB 2H7EA 3MGQC 2NBVA 3ULCA 4J8UA 4CSRB 2ZPYA 3VH5T 1DROA 3AZMD 4ZUXC 4WU8B 2ROZB 3ML4A 3UTBB 1ID3A 5LOPB 2COCA 3AZED 5CPIC 5B0YD 1U35D 3AZGA 1M1AD 1EQZD 2FJ7D 2GS0A 1BH9B 1NI2A 2NQBD 2K2UA 1X11A 3LZ0C 4KHAB 1M7EA 2YFVB 2KR0A 5B40A 3W99C 5D3WA 4QJ4B 3W96D 3AYWB 4H9RA 1TZYA 1MK9B 3AZGC 2EC1A 4DX90 3REIC 5DNMC 4PNKA 4NE5A 5GXQC 2X18A 3B0CW 4TYZA 3RCPA 3REJA 2E2XA 1EGXA 3REJD 4H9RB 1I7AA 3B77A 4XWXA 5BNXB 5CPID 1U35C 1M1AC 3A6NB 3P7ZA 5C79A 5GXQA 1Q67A 3AZMC 3REJC 4HATB 2JP2A 1B55A 4DBBA 5JA4B 1JFIB 3EG5B 4KGCD 3AZGD 2MWNB 4GXBA 3UT9A 2CV5C 3MNNB 1KZ7A 1M7RA 3TCAA 5F99A 1AWEA 2HUEB 2KUPA 2D4QA 2NQBC 3LZ1D 3UTBC 4HDQA 2Y2MA 4H9PA 2ZM5A 3UT9B 2BYMA 4HDOA 3X1TC 2Y8FA 5B0YC 4K17A 3AZEC 2DA0A 4HGAC 3MGRD 4YM6B 5B1LB 4ZUXD 3LZ0B 3AV2A 2CV5D 1P3PA 4R8PC 3UTAB 1P3OA 4GOUA 2IO5C 3O62B 3REIB 1PLSA 4UUZB 1ISNA 5CPKC 1KI1B 3AV2C 5B40C 2F8NH 2D10A 2I1JA 5AVBB 1TZYC 3X1VB 1P3OC 3F6TA 4A6FA 2RVQD 5B0ZB 3HQCA 2Y2LA 1XD4A 2YSZA 3AZHC 3WKJB 5BS7C 1OMWA 2KIEA 2Y2NA 3WA9B 5AY8A 4A6FB 4F7UP 3REID 4K2OA 1A7WA 3X1SB 3AZIB 4K2PA 5B33D 3TU4D 3MNNC 2YT0A 1FHWA 1P3ID 2CWEA 5HE2A 2FFFB 3WTPC 1EQZC 2FJ7C 1P3OD 2ROVA 3A8PA 4DIXA 3UT9C 2CV5A 3X1TB 1P3AA 4KUDB 3AZEB 5B1MB 4KHBA 3WTPA 3B6GB 3PZDA 4L1RA 4ZBJB 3WA0A 3X1TA 1P3AB 1H3OB 2P8VA 3VIAA 1H10A 1LW3A 5B2IC 3P6AA 5C16A 1M19D 1F1EA 4KGCA 3AV2B 4QLCA 1KX5C 5B31D 1ZSQA 1H3OA 4J8XC 1S32A 3A8QA 3BJIA 4ZRJA 2PYOD 3R45B 2RRFA 3LELC 3B6FB 3AZHB
chains in the Genus database with same CATH topology
5DH9B 2YVCA 5LG4B 1P3MB 5D3XA 5CPIA 4D6WA 1KX5A 5AV6A 3GYOA 3H0RC 3AZIC 3X1SC 2L5AA 3X1VA 1RRPB 5B0ZA 5D27A 3ZVRA 3REKD 3PP2A 5B24D 3C1CD 5I2SA 1PZRA 3MPXA 3SO6A 2DFKA 1N1JA 3W96A 1ZC4B 4Z5TB 2G5IC 1P3KD 3O96A 3AZKA 4WZSB 4KUDC 2COFA 3KWQA 3SYXA 2NZDB 1EQZA 2FJ7A 2M14A 3W96C 3AZLB 3ODXA 3AZKC 2COAA 3LJAC 4JJNB 3AZMA 3LZ0D 5CPJA 1V5PA 2D11A 4XZQC 2DYNA 2RLOA 3KWQC 2DKQA 5FI1A 2HIOB 4J8UD 3KUYB 1U2BA 4C0AA 2W8SA 5D3YA 1KX4A 4J8XB 5KDMA 3LZ1B 2AROD 3MVDB 1U27A 3LJAA 3VH6T 4J8WD 5F99C 5CPJC 2I1KA 4KHOA 4XZQA 2P0FA 3AU5A 3D8EA 3B6FC 3A58A 5B32A 1KX3A 3UTBA 1ID3B 3MGQD 2UWXA 4KGCB 2LG1A 3REHD 2KGXB 1V89A 3MVDA 4G92C 4WU9A 1P3FB 2YS5A 1XX0A 4GMXB 1P3PC 3KXBD 3H0LC 1EVHA 3W98D 4R8PA 3AN2B 1BAKA 3TFMA 3AN2D 1UEFA 1BWNA 2F8ND 2ZY2A 2FJLA 2F8NB 4WU9C 5CHLB 5KCVA 3NWDA 1HQ3D 2UZRA 2BYKB 1F66B 2W2XC 4WSFA 3REHB 2K00A 1P3BC 2KUQA 1P3LA 2NZDC 2EMSA 3AZND 5BNXA 2Y8GA 4NSWA 3MGRB 2AROB 4MT7A 5DNND 2PYOB 5DHAB 4JJNC 3A98B 3F0WA 3W99A 4YONA 2BG1A 4Z66B 1P3LB 2HIOD 4J8UB 4D0NB 5DNMA 5CP6D 3MGPC 2JSSA 4YS3A 2M38A 5AV9C 3UZTA 3MNNA 4QJ3B 5CPJB 4JJNA 3AZMB 2EJ8A 1XODA 5BT1C 1GC6A 2KCJA 3SV1A 3C1BC 2VRWB 4WV4B 1KX4C 2BCJA 2Z0PA 3HW2B 4YS3C 3AV1B 4EO5C 4Z5TD 4H9QB 1U5EA 4YM6A 3A6ND 1P3PB 2J0KA 1TJ6A 1DDWA 5JLJB 2RGNB 2G35A 2ZY4A 3RELD 1WI1A 2I5FA 3LJUX 5DIFB 3W98B 1X1GA 1F66C 4YM6C 1MAIA 4QLCC 3DXDA 4R8PB 1S32C 4A5KA 5J3YA 3CXBB 1P3GC 1PMSA 2DX5A 5JA4A 1Q9CA 4LD9A 3QBVB 5AV6C 4Z66C 3X1SA 3X1VC 3AZIA 3ODOA 4Z2MH 1AOID 3W97A 5B0ZC 1ZC3B 1ZM0A 1P3FD 3X23A 2RUKB 4NE3A 5CPKA 2Y2GA 4HB2B 4WU8A 3FVCA 2UZSA 3N7CA 3WA9C 5E5AC 3MGPA 4E44A 3AFAC 4J8WB 3W97C 3WAAC 3AV1C 4YS3B 4Z2NA 4KUDA 1FB8A 5CLQB 1U5GA 2YFVA 2Z4DA 2YF0A 2ZY3A 3X1UC 1X86A 3C1BA 2VKIA 2K2JA 4EJNA 4X23D 3WAAA 5B24B 3C1CB 5DNNB 3AYWC 5B33B 4ZRIA 3NQJB 3AZGB 4OT1A 5JRGD 2Q13A 5AV8C 4QLCB 4ZBJC 1DYNA 2NZ8B 2P0DA 2DX1A 1P3AC 4J8VC 3AYWD 2LKOA 2DYQA 3TO1A 3AYWA 1P34D 1K5GB 3B6FA 4XUJA 5B32C 4X23C 3RELB 1KX3C 1M18A 5GT0D 3KZ1A 3PVLA 2DLWA 1JFIA 3REJB 1HTAA 5AVCB 2D9XA 1MPHA 2DKPA 4UUZA 4KAXB 5HE0A 3LELB 2NMBA 4XUJC 4X23A 1ZVRA 1BTKA 1P3MD 2LY8A 1M18C 1RJ2A 2F2AC 2D9VA 3PVUA 3KY9A 1WWIA 4HB0B 5GOWB 3AZFA 3PSCA 3HK0A 5JHHA 2XD5A 3LELA 1V5UA 5B1MD 2NQBB 5C3IC 5B1LD 4ZUXB 4WU8C 1FHXA 4M6BA 3WA9A 2D9YA 1P3BA 4DX8A 3M1IB 1P3RA 3KUYD 3AZFC 1ZYIA 2ZKMX 1LB1A 5B1LC 4WU8D 5B2JD 4GZUA 1P3GD 3AZJD 4MK0A 1AOIA 3ODWA 3B6GD 4CHJA 3X1UA 3AZLD 1V88A 1WGUA 2RNRB 2ADZA 5AV8B 3R45A 1BH9A 1F66D 5AV9A 5AVCD 4HAXB 3LJAB 1AOIB 5AVBC 3UTAA 1P3OB 3BINA 4YL8A 4CAYA 1P3KB 1EF1A 1KU5A 2YFWA 5B32B 5AY8B 5AV8A 1KX3B 1ZLAC 2Y2IA 1ZLAD 5M4YB 4J8VA 4EMOA 3VOQA 2R2YA 4CYEA 4HAVB 1Y19B 4XUJB 3RELA 3MGSA 2L2IA 3UTAD 3WKJD 2DHJA 4L6EA 4HSIA 1IRSA 1W2EA 4TKNA 2HUEC 5BNVB 1WWSA 1P6SA 4DRBA 1PFJA 5C5BA 3MGSC 5B31G 2JE5A 3AZFB 2VQRA 3O62D 2Z14A 3KUYA 4HB3B 4Z2MB 3AFAD 2GJYA 2NZDD 2K8EA 1P3BB 1TAFA 5G49A 3P5JB 5B1MA 2IO5B 5B2IB 3O62C 2L1CA 3KRWA 1N3HA 5FI0A 5B2JC 3V5WA 1U5DA 1AOIC 1NTVA 1Y5OA 1P3MA 2RIQA 1P3LD 1P3LC 5E5AA 2NZDA 2HTHB 4WNNA 5GSUA 3AFAA 3AV1A 5BO0A 3KXBC 2DN6A 5AV9B 4F7HA 3PVWA 3KSYA 2F8NA 5DI9B 1P34A 1WJ1A 5GSUC 1KX4B 4QJ5B 2Y2QA 3KXBA 2YRYA 1T3UA 5CPIB 2OQBA 3T06A 5GT3C 1W1DA 5GT3D 4OSNA 1P34B 1W1HA 1EQZB 5GT0C 2FJ7B 2OTXA 5AVBD 4HHVA 1UPRA 5J3QA 4DQYB 3F5RA 2YT2A 3WAAD 3W99B 2CAYA 1H4RA 3LJAD 4EKUA 5FUGA 5JRGB 5AV5A 4DXAB 3AZLC 3W96B 3B6GC 5GXQB 2GCLA 3DXEA 3AZKB 1V5MA 5HE3A 2Y7BA 4HAUB 1P3GB 3KUYC 2BYKA 1F66A 2DTCA 2DQNC 5AV5C 4Z66D 1XCGA 4DRAA 5F99B 1FGYA 4CSRA 1P3GA 5G49B 1P3FA 3VH5W 1MKEA 5B2JA 4LD9C 1SHCA 4WJ7A 3EPKA 4Z66A 3B0DC 3VH6W 1NU2A 2D2QA 4LD9D 3A1KA 5B1LA 4WNNB 5GSUB 1BH8A 1R4VA 3LELD 3WAAB 4BBKA 5BO0B 4CHMA 5B0ZD 3AZFD 5JP4A 5AV5D 1MIXA 5GT3B 5AV6D 2ELAA 1P34C 4HGAB 5GT0B 3REKB 2XD1A 3D8FA 2V76A 4H9NB 3B0CT 2VSZA 3HIEA 5AVBA 3UTAC 2RSGA 4KVGB 3WYFB 2R09A 5GT3A 5JRGC 4UPKA 5GT0A 4QLCD 1EAZA 1I2HA 4XUJD 1WJMA 1B6WA 5J3TA 1V61A 1WG7A 2LYDA 1UNPA 4X23B 2HIOC 3B0BA 3RELC 3GYPA 1U35B 1M1AB 4JJND 3A6NC 3EPLA 3AV1D 5AVCC 1P3IC 5CLLB 2MKRA 2ZY5A 5GSUD 2RVBB 1P3AD 5E5AD 2QKLA 3A1IA 3C1BB 4MY6A 2HIOA 3C1BD 1OY2A 2HE7A 3B0DB 2F8NK 4KHBB 1P3FC 3NQJA 2DHIA 3AZNA 2N23A 4GMVA 4NFTA 3KRXA 3TU4A 4GN1A 3W98C 5B1MC 3O62A 4H9QA 2DHKA 4WU9B 2J0JA 3U8ZA 3AZNB 3CIKA 4AWLB 3TU4B 1FGZA 3REHC 1AQCA 2Z13A 3NW8A 3EPHA 2Z0OA 1BFMA 1J0WA 3PG7A 1HQ3B 2MFQA 5L81A 2Y2KA 2AROC 3WKJA 4H9NA 5CPKB 5AV6B 2J59M 3SUZA 5B40B 3MGSD 2AEHA 1Z2CB 1TZYB 5B32D 1KX3D 1ZLAB 3NWFA 4XZQD 1GG3A 3MGPB 1NTYA 2EMTA 2YS1A 4J8VD 4ZUXA 5D3VA 3MGRA 2AROA 3WKJC 4P7IA 2K49A 1KX4D 3MGQB 5AV8D 1ZLAA 2R0DA 5BT1D 1XKEA 2Z59A 3OANA 3A6NA 3LZ0A 5AVCA 5AV9D 2CODA 5KQ1A 4A6HA 4A6KA 3X1UB 1U29A 3X1UD 2Y2OA 3WTPB 3AZLA 3B6GA 5HE1A 3AZJA 3PEGA 3ZDTA 2D9WA 2IFSA 4CAYB 1P3KA 4B6HA 4AWLC 1P3BD 5DNMD 5CP6A 3WA9D 3FSSA 3AZJC 5JHGA 1S32B 2J0MA 5B24A 2Y2JA 3C1CA 3W99D 2Y2PA 4XZQB 3OHMB 3U12A 4H8SA 4H9SA 2G5HC 3X1VD 3TW1A 3SNHA 3NWAA 4WJ3C 1KX5D 5CP6C 1GC7A 5I2MA 1KX5B 2F8NG 1TZYD 1X1FA 1X05A 4HAYB 4PQ0A 1WGQA 4IAPA 3KXBB 4GPTB 3U7DA 2NQBA 1S32D 1P3MC 4G92B 2CV5B 1M18D 2YFWB 2PZ1A 3B6FD 5B0YA 1M19A 3AZEA 1MK7B 4R8PD 1SGHA 2MDXA 2D9ZA 2H7DA 4J8WC 3W97B 1QC6A 2W2XD 3AU4A 4WU9D 2Z0QA 3MVDD 5FUGB 5B0YB 5JRGA 3EPJA 3WTPD 5B31C 1M19B 1J19A 2CRFA 2UVMA 4Z5TC 3AJ4A 5B2ID 1FOEA 3V9RB 3G9WA 4H9PB 5B33C 4HB4B 2W2WA 1MIZB 2YS3A 4KUDD 4IFSA 3AZJB 3AZHA 3V9RA 5BS7A 4J8VB 1P3KC 5CPJD 3MGPD 5AY8C 2LOZA 5B33A 1E5WA 5KQ4A 2IYBA 1UNRA 3REIA 1P5TA 4CSQA 5CP6B 4ZRKA 5CPKD 3KWQD 3D8DA 3VH5A 3AL0C 3W97D 4H9SC 3H0MC 3X1SD 4H9OB 3AZID 1N1JB 4NE6A 3AZKD 1BTNA 2DF4C 1U5FA 2ELBA 1M18B 4Y94A 3QIJA 5EFXA 1W1GA 2CY4A 1FAOA 4HAWB 4E45A 3REKA 4H9OA 1UPQA 2GUMA 5C3IB 5IRSA 1XR0B 3AN2C 1B67A 3TVVA 1Z87A 3MDBC 1M19C 2LULA 1DDMA 5B31B 1ULYA 3WTPE 1P3PD 3IVFA 2J8PA 5BNVA 3REKC 2PYOA 1TXDA 4HAZB 4NY0A 4Z2MG 5C5BB 1DDVA 4J8XA 5KDMB 3LZ1A 1QQGA 5B31A 4YM6D 4Z5TA 5B2JB 5F99D 3NQUA 3MGRC 1FHOA 3UT9D 2PYOC 2QKMA 4GNKB 4G91C 2AL6A 2LOXA 3X1TD 2Y2HA 1TAFB 4J8XD 4J8UC 3MNND 2N0YA 5LONB 4YS3D 5GXQD 1P3IB 3NSUA 3IP4C 2I5CA 5E5AB 2FJUB 3AFAB 4KHAA 3DXCA 4F7GA 5DNNA 2GCJA 1P3IA 4EO5B 5C6RA 4WVFB 1TQZA 3VH6A 1DBHA 3FM8C 5DHFB 5B32G 5B40D 3MGSB 5B24C 5AY8D 3C1CC 5DNNC 1HQ3A 2XQNM 1BH8B 3AZNC 2JCHA 1KZGA 5DNMB 3ULBA 3TU4C 3AN2A 3FDDA 1U35A 1M1AA 3KFUG 3W98A 1ID3D 1HQ3C 3KWQB 1K5DB 1OQNA 4QXAB 5AV5B 3AZHD 1WVHA 2KIGA 4IOYX 3REHA 4K81A 4G91B 2RVQC 3LZ1C 3MGQA 3UTBD 3MVDC 1UNQA 4LD9B 3AV2D 4J8WA 2CY5A 2P0HA 5B2IA 2YT1A 3QWMA 1ID3C 3FEHA 3NQUB 4KGCC 2BYMB 2H7EA 3MGQC 3ULCA 2NBVA 4J8UA 4CSRB 2ZPYA 3VH5T 1DROA 3AZMD 4ZUXC 4WU8B 2ROZB 3ML4A 3UTBB 1ID3A 5LOPB 2COCA 3AZED 5CPIC 5B0YD 1U35D 3AZGA 1M1AD 1EQZD 2FJ7D 2GS0A 1BH9B 1NI2A 2NQBD 2K2UA 1X11A 3LZ0C 4KHAB 1M7EA 2YFVB 2KR0A 5B40A 3W99C 5D3WA 4QJ4B 3W96D 3AYWB 4H9RA 1TZYA 1MK9B 3AZGC 2EC1A 4DX90 3REIC 5DNMC 4PNKA 4NE5A 5GXQC 2X18A 3B0CW 4TYZA 3RCPA 3REJA 2E2XA 1EGXA 3REJD 4H9RB 1I7AA 4XWXA 5BNXB 5CPID 1U35C 1M1AC 3A6NB 3P7ZA 5C79A 5GXQA 1Q67A 3AZMC 3REJC 4HATB 2JP2A 1B55A 4DBBA 5JA4B 1JFIB 3EG5B 4KGCD 3AZGD 2MWNB 4GXBA 3UT9A 2CV5C 3MNNB 1KZ7A 1M7RA 3TCAA 5F99A 1AWEA 2HUEB 2KUPA 2D4QA 2NQBC 3LZ1D 3UTBC 4HDQA 2Y2MA 4H9PA 2ZM5A 3UT9B 2BYMA 4HDOA 3X1TC 2Y8FA 5B0YC 4K17A 3AZEC 2DA0A 4HGAC 3MGRD 4YM6B 5B1LB 4ZUXD 3LZ0B 3AV2A 2CV5D 1P3PA 4R8PC 3UTAB 1P3OA 4GOUA 2IO5C 3O62B 3REIB 1PLSA 4UUZB 1ISNA 5CPKC 1KI1B 3AV2C 5B40C 2F8NH 2D10A 2I1JA 5AVBB 1TZYC 3X1VB 1P3OC 3F6TA 4A6FA 2RVQD 5B0ZB 3HQCA 2Y2LA 1XD4A 2YSZA 3AZHC 3WKJB 5BS7C 1OMWA 2KIEA 2Y2NA 3WA9B 5AY8A 4A6FB 4F7UP 3REID 4K2OA 1A7WA 3X1SB 3AZIB 4K2PA 5B33D 3TU4D 3MNNC 2YT0A 1FHWA 1P3ID 2CWEA 5HE2A 2FFFB 3WTPC 1EQZC 2FJ7C 1P3OD 2ROVA 3A8PA 4DIXA 3UT9C 2CV5A 3X1TB 1P3AA 4KUDB 3AZEB 5B1MB 4KHBA 3WTPA 3B6GB 3PZDA 4L1RA 4ZBJB 3WA0A 3X1TA 1P3AB 1H3OB 2P8VA 3VIAA 1H10A 1LW3A 5B2IC 3P6AA 5C16A 1M19D 1F1EA 4KGCA 3AV2B 4QLCA 1KX5C 5B31D 1ZSQA 1H3OA 4J8XC 1S32A 3A8QA 3BJIA 4ZRJA 2PYOD 3R45B 2RRFA 3LELC 3B6FB 3AZHB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5DH9 B;  2YVC A;  1P3M B;  5D3X A;  5CPI A;  1KX5 A;  5AV6 A;  3GYO A;  3AZI C;  3X1S C;  2L5A A;  3X1V A;  1RRP B;  5B0Z A;  5D27 A;  3ZVR A;  3REK D;  3PP2 A;  5B24 D;  3C1C D;  3MPX A;  3SO6 A;  2DFK A;  1N1J A;  3W96 A;  1ZC4 B;  4Z5T B;  1P3K D;  3O96 A;  3AZK A;  4WZS B;  4KUD C;  2COF A;  3KWQ A;  3SYX A;  2NZD B;  1EQZ A;  2FJ7 A;  2M14 A;  3W96 C;  3AZL B;  3ODX A;  3AZK C;  2COA A;  3LJA C;  4JJN B;  3AZM A;  3LZ0 D;  5CPJ A;  1V5P A;  2D11 A;  4XZQ C;  2DYN A;  2RLO A;  3KWQ C;  2DKQ A;  5FI1 A;  2HIO B;  4J8U D;  3KUY B;  1U2B A;  4C0A A;  5D3Y A;  1KX4 A;  4J8X B;  5KDM A;  3LZ1 B;  2ARO D;  3MVD B;  1U27 A;  3LJA A;  3VH6 T;  4J8W D;  5F99 C;  5CPJ C;  2I1K A;  4KHO A;  4XZQ A;  2P0F A;  3AU5 A;  3D8E A;  3B6F C;  5B32 A;  1KX3 A;  3UTB A;  1ID3 B;  3MGQ D;  2LOX A;  4KGC B;  2LG1 A;  3REH D;  2KGX B;  1V89 A;  3MVD A;  4G92 C;  4WU9 A;  1P3F B;  2YS5 A;  1XX0 A;  4GMX B;  1P3P C;  3KXB D;  1EVH A;  3W98 D;  4R8P A;  3AN2 B;  1BAK A;  3TFM A;  3AN2 D;  1UEF A;  1BWN A;  2F8N D;  2FJL A;  2F8N B;  4WU9 C;  5CHL B;  5KCV A;  1HQ3 D;  2UZR A;  2BYK B;  1F66 B;  2W2X C;  4WSF A;  3REH B;  2K00 A;  1P3B C;  1P3L A;  2NZD C;  2EMS A;  3AZN D;  5BNX A;  2Y8G A;  4NSW A;  3MGR B;  2ARO B;  4MT7 A;  5DNN D;  2PYO B;  5DHA B;  4JJN C;  3A98 B;  3F0W A;  3W99 A;  4YON A;  4Z66 B;  1P3L B;  2HIO D;  4J8U B;  4D0N B;  5DNM A;  5CP6 D;  3MGP C;  2JSS A;  4YS3 A;  2M38 A;  5AV9 C;  3UZT A;  3MNN A;  5CPJ B;  4JJN A;  3AZM B;  2EJ8 A;  1XOD A;  5BT1 C;  1GC6 A;  2KCJ A;  3SV1 A;  3C1B C;  2VRW B;  4WV4 B;  1KX4 C;  2BCJ A;  2Z0P A;  3HW2 B;  4YS3 C;  3AV1 B;  4EO5 C;  4Z5T D;  4H9Q B;  1U5E A;  4YM6 A;  3A6N D;  1P3P B;  2J0K A;  1TJ6 A;  1DDW A;  5JLJ B;  2RGN B;  2G35 A;  2I5F A;  3REL D;  1WI1 A;  3LJU X;  5DIF B;  3W98 B;  1X1G A;  1F66 C;  4YM6 C;  1MAI A;  4QLC C;  3DXD A;  4R8P B;  1S32 C;  4A5K A;  5J3Y A;  3CXB B;  1P3G C;  1PMS A;  2DX5 A;  5JA4 A;  1Q9C A;  4LD9 A;  3QBV B;  5AV6 C;  4Z66 C;  3X1S A;  3X1V C;  3AZI A;  3ODO A;  4Z2M H;  1AOI D;  3W97 A;  5B0Z C;  1ZC3 B;  1ZM0 A;  1P3F D;  3X23 A;  2RUK B;  4NE3 A;  5CPK A;  4HB2 B;  4WU8 A;  2UZS A;  3N7C A;  3WA9 C;  5E5A C;  3MGP A;  4E44 A;  3AFA C;  4J8W B;  3W97 C;  3WAA C;  3AV1 C;  4YS3 B;  4Z2N A;  4KUD A;  1FB8 A;  5CLQ B;  1U5G A;  2YFV A;  2YF0 A;  3X1U C;  1X86 A;  3C1B A;  2VKI A;  2K2J A;  4EJN A;  4X23 D;  3WAA A;  5B24 B;  3C1C B;  5DNN B;  3AYW C;  5B33 B;  4ZRI A;  3NQJ B;  3AZG B;  5JRG D;  2Q13 A;  5AV8 C;  4QLC B;  4ZBJ C;  1DYN A;  2NZ8 B;  2P0D A;  2DX1 A;  1P3A C;  4J8V C;  3AYW D;  2LKO A;  2DYQ A;  3TO1 A;  3AYW A;  1P34 D;  1K5G B;  3B6F A;  4XUJ A;  5B32 C;  4X23 C;  3REL B;  1KX3 C;  1M18 A;  5GT0 D;  3KZ1 A;  3PVL A;  2DLW A;  1JFI A;  3REJ B;  1HTA A;  5AVC B;  2D9X A;  1MPH A;  2DKP A;  4UUZ A;  4KAX B;  5HE0 A;  3LEL B;  2NMB A;  4XUJ C;  4X23 A;  1ZVR A;  1BTK A;  1P3M D;  2LY8 A;  1M18 C;  1RJ2 A;  2D9V A;  3PVU A;  4HB0 B;  3KY9 A;  1WWI A;  5GOW B;  3AZF A;  3PSC A;  3HK0 A;  5JHH A;  3LEL A;  1V5U A;  5B1M D;  2NQB B;  5C3I C;  5B1L D;  4ZUX B;  4WU8 C;  2D9Y A;  4M6B A;  3WA9 A;  1P3B A;  4DX8 A;  3M1I B;  1P3R A;  3KUY D;  3AZF C;  1LB1 A;  5B1L C;  4WU8 D;  5B2J D;  4GZU A;  1P3G D;  3AZJ D;  4MK0 A;  1AOI A;  3ODW A;  3B6G D;  4CHJ A;  3X1U A;  3AZL D;  1V88 A;  1WGU A;  2RNR B;  2ADZ A;  5AV8 B;  3R45 A;  1BH9 A;  1F66 D;  5AV9 A;  5AVC D;  4HAX B;  3LJA B;  1AOI B;  5AVB C;  3UTA A;  1P3O B;  3BIN A;  4YL8 A;  4CAY A;  1P3K B;  1EF1 A;  1KU5 A;  2YFW A;  5B32 B;  5AY8 B;  5AV8 A;  1KX3 B;  1ZLA C;  1ZLA D;  1FHX A;  4J8V A;  4EMO A;  3VOQ A;  4CYE A;  4HAV B;  1Y19 B;  4XUJ B;  3REL A;  3MGS A;  2L2I A;  3UTA D;  3WKJ D;  2DHJ A;  4L6E A;  1IRS A;  4TKN A;  2HUE C;  5BNV B;  1WWS A;  1P6S A;  4DRB A;  1PFJ A;  5C5B A;  3MGS C;  5B31 G;  3AZF B;  3O62 D;  3KUY A;  4HB3 B;  4Z2M B;  3AFA D;  2GJY A;  2NZD D;  1P3B B;  1TAF A;  5G49 A;  5B1M A;  3KRW A;  2IO5 B;  5B2I B;  3O62 C;  2L1C A;  5FI0 A;  1N3H A;  3V5W A;  5B2J C;  1U5D A;  1AOI C;  1NTV A;  1Y5O A;  1P3M A;  1P3L D;  2HTH B;  1P3L C;  5E5A A;  2NZD A;  4WNN A;  5GSU A;  3AFA A;  3AV1 A;  5BO0 A;  3KXB C;  2DN6 A;  5AV9 B;  4F7H A;  3PVW A;  3KSY A;  2F8N A;  5DI9 B;  1P34 A;  1WJ1 A;  5GSU C;  1KX4 B;  3KXB A;  2YRY A;  5CPI B;  2OQB A;  3T06 A;  5GT3 C;  1W1D A;  5GT3 D;  1P34 B;  1W1H A;  1EQZ B;  5GT0 C;  2FJ7 B;  2OTX A;  5AVB D;  4HHV A;  1UPR A;  5J3Q A;  3F5R A;  3WAA D;  3W99 B;  2CAY A;  1H4R A;  3LJA D;  4EKU A;  5FUG A;  5JRG B;  5AV5 A;  4DXA B;  3AZL C;  3W96 B;  3B6G C;  5GXQ B;  2GCL A;  3DXE A;  3AZK B;  1V5M A;  5HE3 A;  2Y7B A;  4HAU B;  1P3G B;  3KUY C;  2BYK A;  1F66 A;  2DTC A;  5AV5 C;  4Z66 D;  1XCG A;  4DRA A;  5F99 B;  1FGY A;  4CSR A;  1P3G A;  5G49 B;  1P3F A;  3VH5 W;  1MKE A;  5B2J A;  4LD9 C;  1SHC A;  4WJ7 A;  4Z66 A;  3B0D C;  3VH6 W;  1NU2 A;  2D2Q A;  4LD9 D;  5B1L A;  4WNN B;  5GSU B;  1BH8 A;  1R4V A;  3LEL D;  3WAA B;  4BBK A;  5BO0 B;  4CHM A;  5B0Z D;  3AZF D;  5JP4 A;  5AV5 D;  1MIX A;  5GT3 B;  5AV6 D;  2ELA A;  1P34 C;  4HGA B;  5GT0 B;  3REK B;  3D8F A;  2V76 A;  4H9N B;  3B0C T;  2VSZ A;  5AVB A;  3UTA C;  2RSG A;  4KVG B;  3WYF B;  2R09 A;  5GT3 A;  5JRG C;  5GT0 A;  4QLC D;  1EAZ A;  1I2H A;  4XUJ D;  1WJM A;  1B6W A;  5J3T A;  1V61 A;  1WG7 A;  2LYD A;  1UNP A;  4X23 B;  2HIO C;  3B0B A;  3REL C;  3GYP A;  1U35 B;  1M1A B;  4JJN D;  3A6N C;  3AV1 D;  5AVC C;  1P3I C;  5CLL B;  2MKR A;  5GSU D;  2RVB B;  1P3A D;  5E5A D;  2QKL A;  3C1B B;  4MY6 A;  2HIO A;  3C1B D;  1OY2 A;  2HE7 A;  3B0D B;  2F8N K;  4KHB B;  1P3F C;  3NQJ A;  2DHI A;  3AZN A;  2N23 A;  4GMV A;  4NFT A;  3KRX A;  3TU4 A;  4GN1 A;  3W98 C;  5B1M C;  3O62 A;  4H9Q A;  2DHK A;  4WU9 B;  2J0J A;  3U8Z A;  3AZN B;  3CIK A;  4AWL B;  3TU4 B;  1FGZ A;  3REH C;  1AQC A;  2Z0O A;  1BFM A;  1J0W A;  3PG7 A;  1HQ3 B;  2MFQ A;  5L81 A;  2ARO C;  3WKJ A;  4H9N A;  5CPK B;  5AV6 B;  2J59 M;  3SUZ A;  5B40 B;  3MGS D;  2AEH A;  1TZY B;  5B32 D;  1KX3 D;  1ZLA B;  4XZQ D;  1GG3 A;  3MGP B;  1NTY A;  2EMT A;  2YS1 A;  4J8V D;  4ZUX A;  5D3V A;  3MGR A;  2ARO A;  3WKJ C;  4P7I A;  1KX4 D;  3MGQ B;  5AV8 D;  1ZLA A;  2R0D A;  5BT1 D;  1XKE A;  3OAN A;  3A6N A;  3LZ0 A;  5AVC A;  5AV9 D;  2COD A;  5KQ1 A;  4A6H A;  4A6K A;  3X1U B;  1U29 A;  3X1U D;  3AZL A;  3WTP B;  3B6G A;  5HE1 A;  3AZJ A;  3PEG A;  3ZDT A;  2D9W A;  2IFS A;  4CAY B;  1P3K A;  4B6H A;  4AWL C;  1P3B D;  5DNM D;  5CP6 A;  3WA9 D;  3FSS A;  3AZJ C;  5JHG A;  1S32 B;  2J0M A;  5B24 A;  3C1C A;  3W99 D;  4XZQ B;  4H8S A;  4H9S A;  3X1V D;  3TW1 A;  3SNH A;  1KX5 D;  5CP6 C;  1GC7 A;  1KX5 B;  2F8N G;  1TZY D;  1X1F A;  1X05 A;  4HAY B;  4PQ0 A;  1WGQ A;  4IAP A;  3KXB B;  4GPT B;  3U7D A;  2NQB A;  1S32 D;  1P3M C;  4G92 B;  2CV5 B;  1M18 D;  2YFW B;  2PZ1 A;  3B6F D;  5B0Y A;  1M19 A;  3AZE A;  1MK7 B;  4R8P D;  1SGH A;  2MDX A;  2D9Z A;  2H7D A;  4J8W C;  3W97 B;  1QC6 A;  2W2X D;  3AU4 A;  4WU9 D;  2Z0Q A;  3MVD D;  5FUG B;  5B0Y B;  5JRG A;  1M19 B;  3WTP D;  5B31 C;  1J19 A;  2CRF A;  2UVM A;  4Z5T C;  3AJ4 A;  5B2I D;  1FOE A;  3V9R B;  3G9W A;  4H9P B;  5B33 C;  4HB4 B;  2W2W A;  1MIZ B;  2YS3 A;  4KUD D;  4IFS A;  3AZJ B;  3AZH A;  3V9R A;  5BS7 A;  4J8V B;  1P3K C;  5CPJ D;  3MGP D;  5AY8 C;  2LOZ A;  5B33 A;  1E5W A;  5KQ4 A;  2IYB A;  1UNR A;  3REI A;  1P5T A;  5CP6 B;  4ZRK A;  5CPK D;  3KWQ D;  3D8D A;  3VH5 A;  3W97 D;  4H9S C;  3AZK D;  3X1S D;  4H9O B;  3AZI D;  1N1J B;  4NE6 A;  1BTN A;  1U5F A;  2ELB A;  1M18 B;  4Y94 A;  3QIJ A;  5EFX A;  1W1G A;  2CY4 A;  1FAO A;  4HAW B;  4E45 A;  3REK A;  4H9O A;  1UPQ A;  5C3I B;  1XR0 B;  3AN2 C;  1B67 A;  3TVV A;  1Z87 A;  3MDB C;  1M19 C;  2LUL A;  1DDM A;  5B31 B;  1ULY A;  3WTP E;  1P3P D;  3IVF A;  5BNV A;  3REK C;  2PYO A;  1TXD A;  4HAZ B;  4NY0 A;  4Z2M G;  5C5B B;  1DDV A;  4J8X A;  3LZ1 A;  5KDM B;  1QQG A;  5B31 A;  4YM6 D;  4Z5T A;  5B2J B;  5F99 D;  3NQU A;  3MGR C;  1FHO A;  3UT9 D;  2PYO C;  2QKM A;  4G91 C;  2AL6 A;  3X1T D;  1TAF B;  4J8X D;  4J8U C;  3MNN D;  2N0Y A;  5LON B;  4YS3 D;  5GXQ D;  1P3I B;  3NSU A;  2I5C A;  5E5A B;  3AFA B;  4KHA A;  3DXC A;  4F7G A;  5DNN A;  2GCJ A;  1P3I A;  4EO5 B;  5C6R A;  4WVF B;  1TQZ A;  3VH6 A;  1DBH A;  3FM8 C;  5DHF B;  5B32 G;  5B40 D;  3MGS B;  5B24 C;  5AY8 D;  3C1C C;  5DNN C;  1HQ3 A;  2XQN M;  1BH8 B;  3AZN C;  1KZG A;  5DNM B;  3ULB A;  3TU4 C;  3AN2 A;  1U35 A;  1M1A A;  3W98 A;  1ID3 D;  1HQ3 C;  3KWQ B;  1K5D B;  1OQN A;  5AV5 B;  3AZH D;  1WVH A;  4IOY X;  3REH A;  4K81 A;  4G91 B;  2RVQ C;  3LZ1 C;  3MGQ A;  3UTB D;  3MVD C;  1UNQ A;  4LD9 B;  3AV2 D;  4J8W A;  2CY5 A;  2P0H A;  5B2I A;  2YT1 A;  3QWM A;  1ID3 C;  3FEH A;  3NQU B;  4KGC C;  2BYM B;  2H7E A;  3MGQ C;  3ULC A;  4J8U A;  4CSR B;  2ZPY A;  3VH5 T;  1DRO A;  3AZM D;  4ZUX C;  4WU8 B;  2ROZ B;  3ML4 A;  3UTB B;  1ID3 A;  5LOP B;  2COC A;  3AZE D;  5CPI C;  5B0Y D;  1U35 D;  3AZG A;  1M1A D;  1EQZ D;  2FJ7 D;  2GS0 A;  1BH9 B;  1NI2 A;  2NQB D;  2K2U A;  1X11 A;  3LZ0 C;  4KHA B;  1M7E A;  2YFV B;  5B40 A;  3W99 C;  5D3W A;  3W96 D;  3AYW B;  4H9R A;  1TZY A;  1MK9 B;  3AZG C;  2EC1 A;  3REI C;  5DNM C;  4PNK A;  4NE5 A;  5GXQ C;  2X18 A;  3B0C W;  4TYZ A;  3RCP A;  3REJ A;  2E2X A;  1EGX A;  3REJ D;  4H9R B;  1I7A A;  4XWX A;  5BNX B;  5CPI D;  1U35 C;  1M1A C;  3A6N B;  3P7Z A;  5C79 A;  5GXQ A;  1Q67 A;  3AZM C;  3REJ C;  4HAT B;  2JP2 A;  1B55 A;  4DBB A;  5JA4 B;  1JFI B;  2MWN B;  4KGC D;  3AZG D;  3TCA A;  4GXB A;  3UT9 A;  2CV5 C;  3MNN B;  1KZ7 A;  1M7R A;  5F99 A;  1AWE A;  2HUE B;  2KUP A;  2D4Q A;  2NQB C;  3LZ1 D;  3UTB C;  4HDQ A;  4DX9 0;  4H9P A;  4HDO A;  3UT9 B;  2BYM A;  4K17 A;  3X1T C;  2Y8F A;  5B0Y C;  3AZE C;  2DA0 A;  4HGA C;  3MGR D;  4YM6 B;  5B1L B;  4ZUX D;  3LZ0 B;  3AV2 A;  2CV5 D;  1P3P A;  4R8P C;  3UTA B;  1P3O A;  2IO5 C;  3O62 B;  3REI B;  1PLS A;  4UUZ B;  1ISN A;  5CPK C;  1KI1 B;  3AV2 C;  5B40 C;  2F8N H;  2D10 A;  2I1J A;  5AVB B;  1TZY C;  3X1V B;  1P3O C;  4A6F A;  2RVQ D;  5B0Z B;  3HQC A;  1XD4 A;  2YSZ A;  3AZH C;  3WKJ B;  5BS7 C;  1OMW A;  3WA9 B;  5AY8 A;  4A6F B;  4F7U P;  3REI D;  4K2O A;  1A7W A;  3X1S B;  3AZI B;  4K2P A;  5B33 D;  3TU4 D;  3MNN C;  2YT0 A;  1FHW A;  1P3I D;  2CWE A;  5HE2 A;  3WTP C;  1EQZ C;  2FJ7 C;  1P3O D;  2ROV A;  3A8P A;  3UT9 C;  2CV5 A;  3X1T B;  1P3A A;  4KUD B;  3AZE B;  5B1M B;  3WTP A;  3B6G B;  3PZD A;  4ZBJ B;  3WA0 A;  3X1T A;  1P3A B;  1H3O B;  2P8V A;  3VIA A;  1H10 A;  1LW3 A;  5B2I C;  3P6A A;  5C16 A;  1M19 D;  1F1E A;  4KGC A;  3AV2 B;  4QLC A;  1KX5 C;  5B31 D;  1ZSQ A;  1H3O A;  4J8X C;  1S32 A;  3A8Q A;  3BJI A;  4ZRJ A;  2PYO D;  3R45 B;  3LEL C;  3B6F B;  3AZH B; 
#chains in the Genus database with same CATH topology
 5DH9 B;  2YVC A;  5LG4 B;  1P3M B;  5D3X A;  5CPI A;  4D6W A;  1KX5 A;  5AV6 A;  3GYO A;  3H0R C;  3AZI C;  3X1S C;  2L5A A;  3X1V A;  1RRP B;  5B0Z A;  5D27 A;  3ZVR A;  3REK D;  3PP2 A;  5B24 D;  3C1C D;  5I2S A;  1PZR A;  3MPX A;  3SO6 A;  2DFK A;  1N1J A;  3W96 A;  1ZC4 B;  4Z5T B;  2G5I C;  1P3K D;  3O96 A;  3AZK A;  4WZS B;  4KUD C;  2COF A;  3KWQ A;  3SYX A;  2NZD B;  1EQZ A;  2FJ7 A;  2M14 A;  3W96 C;  3AZL B;  3ODX A;  3AZK C;  2COA A;  3LJA C;  4JJN B;  3AZM A;  3LZ0 D;  5CPJ A;  1V5P A;  2D11 A;  4XZQ C;  2DYN A;  2RLO A;  3KWQ C;  2DKQ A;  3OHM B;  2HIO B;  4J8U D;  3KUY B;  1U2B A;  5FI1 A;  4C0A A;  2W8S A;  5D3Y A;  1KX4 A;  4J8X B;  5KDM A;  3LZ1 B;  2ARO D;  3MVD B;  1U27 A;  3LJA A;  3VH6 T;  4J8W D;  5F99 C;  5CPJ C;  2I1K A;  4KHO A;  4XZQ A;  2P0F A;  3AU5 A;  3A58 A;  3B6F C;  3D8E A;  5B32 A;  1KX3 A;  3UTB A;  1ID3 B;  3MGQ D;  2UWX A;  4KGC B;  2LG1 A;  3REH D;  2KGX B;  1V89 A;  3MVD A;  4G92 C;  4WU9 A;  1P3F B;  2YS5 A;  1XX0 A;  4GMX B;  1P3P C;  3KXB D;  3H0L C;  1EVH A;  3W98 D;  4R8P A;  3AN2 B;  1BAK A;  3TFM A;  3AN2 D;  1UEF A;  1BWN A;  2F8N D;  2ZY2 A;  2FJL A;  2F8N B;  4WU9 C;  5CHL B;  3NWD A;  5KCV A;  1HQ3 D;  2UZR A;  2BYK B;  1F66 B;  2W2X C;  4WSF A;  3REH B;  2K00 A;  1P3B C;  2KUQ A;  1P3L A;  2NZD C;  2EMS A;  3AZN D;  5BNX A;  2Y8G A;  4NSW A;  3MGR B;  2ARO B;  4MT7 A;  5DNN D;  2PYO B;  5DHA B;  4JJN C;  3A98 B;  3F0W A;  3W99 A;  4YON A;  2BG1 A;  4Z66 B;  1P3L B;  2HIO D;  4J8U B;  4D0N B;  5DNM A;  5CP6 D;  3MGP C;  2JSS A;  4YS3 A;  2M38 A;  5AV9 C;  4QJ3 B;  3MNN A;  3UZT A;  5CPJ B;  4JJN A;  3AZM B;  2EJ8 A;  1XOD A;  5BT1 C;  1GC6 A;  2KCJ A;  3SV1 A;  3C1B C;  2VRW B;  4WV4 B;  1KX4 C;  2BCJ A;  2Z0P A;  3HW2 B;  4YS3 C;  3AV1 B;  4EO5 C;  4Z5T D;  4H9Q B;  1U5E A;  4YM6 A;  3A6N D;  1P3P B;  2J0K A;  1TJ6 A;  1DDW A;  5JLJ B;  2RGN B;  2G35 A;  2ZY4 A;  3REL D;  1WI1 A;  2I5F A;  3LJU X;  5DIF B;  3W98 B;  1X1G A;  1F66 C;  4YM6 C;  1MAI A;  4QLC C;  3DXD A;  4R8P B;  1S32 C;  4A5K A;  5J3Y A;  3CXB B;  1P3G C;  1PMS A;  2DX5 A;  5JA4 A;  1Q9C A;  4LD9 A;  3QBV B;  5AV6 C;  4Z66 C;  3X1S A;  3X1V C;  3AZI A;  3ODO A;  4Z2M H;  1AOI D;  3W97 A;  5B0Z C;  1ZC3 B;  1ZM0 A;  1P3F D;  3X23 A;  2RUK B;  4NE3 A;  5CPK A;  2Y2G A;  4HB2 B;  4WU8 A;  3FVC A;  2UZS A;  3N7C A;  3WA9 C;  5E5A C;  3MGP A;  4E44 A;  3AFA C;  4J8W B;  3W97 C;  3WAA C;  3AV1 C;  4YS3 B;  4Z2N A;  4KUD A;  1FB8 A;  5CLQ B;  1U5G A;  2YFV A;  2Z4D A;  2YF0 A;  2ZY3 A;  3X1U C;  1X86 A;  3C1B A;  2VKI A;  2K2J A;  4EJN A;  4X23 D;  3WAA A;  5B24 B;  3C1C B;  5DNN B;  3AYW C;  5B33 B;  4OT1 A;  3NQJ B;  3AZG B;  4ZRI A;  5JRG D;  2Q13 A;  5AV8 C;  4QLC B;  4ZBJ C;  1DYN A;  2NZ8 B;  2P0D A;  2DX1 A;  1P3A C;  4J8V C;  3AYW D;  2LKO A;  2DYQ A;  3TO1 A;  3AYW A;  1P34 D;  1K5G B;  3B6F A;  4XUJ A;  5B32 C;  4X23 C;  3REL B;  1KX3 C;  1M18 A;  5GT0 D;  3KZ1 A;  3PVL A;  2DLW A;  1JFI A;  3REJ B;  1HTA A;  5AVC B;  2D9X A;  1MPH A;  2DKP A;  4UUZ A;  4KAX B;  5HE0 A;  3LEL B;  2NMB A;  4XUJ C;  4X23 A;  1ZVR A;  1BTK A;  1P3M D;  2LY8 A;  1M18 C;  1RJ2 A;  2F2A C;  2D9V A;  3PVU A;  3KY9 A;  1WWI A;  4HB0 B;  5GOW B;  3AZF A;  3PSC A;  3HK0 A;  5JHH A;  2XD5 A;  3LEL A;  1V5U A;  5B1M D;  2NQB B;  5C3I C;  5B1L D;  4ZUX B;  4WU8 C;  1FHX A;  4M6B A;  3WA9 A;  2D9Y A;  1P3B A;  4DX8 A;  3M1I B;  1P3R A;  3KUY D;  3AZF C;  1ZYI A;  2ZKM X;  1LB1 A;  5B1L C;  4WU8 D;  5B2J D;  4GZU A;  1P3G D;  3AZJ D;  4MK0 A;  1AOI A;  3ODW A;  3B6G D;  4CHJ A;  3X1U A;  3AZL D;  1V88 A;  1WGU A;  2RNR B;  2ADZ A;  5AV8 B;  3R45 A;  3HSA A;  1BH9 A;  1F66 D;  5AV9 A;  5AVC D;  4HAX B;  3LJA B;  1AOI B;  5AVB C;  3UTA A;  1P3O B;  3BIN A;  4YL8 A;  4CAY A;  1P3K B;  1EF1 A;  1KU5 A;  2YFW A;  5B32 B;  5AY8 B;  5AV8 A;  1KX3 B;  1ZLA C;  2Y2I A;  1ZLA D;  5M4Y B;  4J8V A;  4EMO A;  3VOQ A;  2R2Y A;  4CYE A;  4HAV B;  1Y19 B;  4XUJ B;  3REL A;  3MGS A;  2L2I A;  3UTA D;  3WKJ D;  2DHJ A;  4L6E A;  4HSI A;  1IRS A;  1W2E A;  4TKN A;  2HUE C;  5BNV B;  1DDM A;  1WWS A;  1P6S A;  4DRB A;  1PFJ A;  5C5B A;  3MGS C;  5B31 G;  2JE5 A;  3AZF B;  2VQR A;  3O62 D;  2Z14 A;  3KUY A;  4HB3 B;  4Z2M B;  3AFA D;  2GJY A;  2NZD D;  2K8E A;  1P3B B;  1TAF A;  5G49 A;  3P5J B;  5B1M A;  2IO5 B;  5B2I B;  3O62 C;  2L1C A;  3DCX A;  1N3H A;  3KRW A;  5B2J C;  5FI0 A;  3V5W A;  1U5D A;  1AOI C;  1NTV A;  1Y5O A;  1P3M A;  2RIQ A;  1P3L D;  1P3L C;  5E5A A;  2NZD A;  2HTH B;  4WNN A;  5GSU A;  3AFA A;  3AV1 A;  5BO0 A;  3KXB C;  2DN6 A;  5AV9 B;  4F7H A;  3PVW A;  3KSY A;  2F8N A;  5DI9 B;  1P34 A;  1WJ1 A;  5GSU C;  1KX4 B;  4QJ5 B;  2Y2Q A;  3KXB A;  2YRY A;  1T3U A;  5CPI B;  2OQB A;  3T06 A;  5GT3 C;  1W1D A;  5GT3 D;  4OSN A;  1P34 B;  1W1H A;  1EQZ B;  5GT0 C;  2FJ7 B;  2OTX A;  5AVB D;  4HHV A;  1UPR A;  5J3Q A;  4DQY B;  3F5R A;  2YT2 A;  3WAA D;  3W99 B;  2CAY A;  1H4R A;  3LJA D;  4EKU A;  5FUG A;  5JRG B;  5AV5 A;  4DXA B;  3AZL C;  3W96 B;  3B6G C;  5GXQ B;  2GCL A;  3DXE A;  3AZK B;  1V5M A;  5HE3 A;  2Y7B A;  4HAU B;  1P3G B;  3KUY C;  2BYK A;  1F66 A;  2DTC A;  2DQN C;  5AV5 C;  4Z66 D;  1XCG A;  4DRA A;  5F99 B;  1FGY A;  4CSR A;  1P3G A;  5G49 B;  1P3F A;  3VH5 W;  1MKE A;  5B2J A;  4LD9 C;  1SHC A;  4WJ7 A;  3EPK A;  4Z66 A;  3B0D C;  3VH6 W;  1NU2 A;  2D2Q A;  4LD9 D;  3A1K A;  5B1L A;  4WNN B;  5GSU B;  1BH8 A;  1R4V A;  3LEL D;  3WAA B;  1MI1 A;  5BO0 B;  4BBK A;  5B0Z D;  4CHM A;  3AZF D;  5JP4 A;  5AV5 D;  1MIX A;  5GT3 B;  5AV6 D;  2ELA A;  1P34 C;  4HGA B;  5GT0 B;  3REK B;  2XD1 A;  3D8F A;  2V76 A;  4H9N B;  3B0C T;  2VSZ A;  3HIE A;  5AVB A;  3UTA C;  2RSG A;  4KVG B;  3WYF B;  2R09 A;  5GT3 A;  5JRG C;  4UPK A;  5GT0 A;  4QLC D;  1EAZ A;  1I2H A;  4XUJ D;  1WJM A;  1B6W A;  5J3T A;  1V61 A;  1WG7 A;  2LYD A;  1UNP A;  4X23 B;  2HIO C;  3B0B A;  3REL C;  3GYP A;  1U35 B;  1M1A B;  4JJN D;  3A6N C;  3EPL A;  3AV1 D;  5AVC C;  1P3I C;  5CLL B;  2MKR A;  2ZY5 A;  5GSU D;  2RVB B;  1P3A D;  5E5A D;  2QKL A;  3A1I A;  3C1B B;  4MY6 A;  2HIO A;  3C1B D;  1OY2 A;  2HE7 A;  1T77 A;  3B0D B;  2F8N K;  4KHB B;  1P3F C;  3NQJ A;  2DHI A;  3AZN A;  2N23 A;  4GMV A;  4NFT A;  3KRX A;  3TU4 A;  4GN1 A;  3W98 C;  5B1M C;  3O62 A;  4H9Q A;  2DHK A;  4WU9 B;  2J0J A;  3U8Z A;  3AZN B;  3CIK A;  4AWL B;  3TU4 B;  1FGZ A;  3REH C;  1AQC A;  2Z13 A;  3NW8 A;  3EPH A;  2Z0O A;  1BFM A;  1J0W A;  3PG7 A;  1HQ3 B;  2MFQ A;  5L81 A;  2Y2K A;  2ARO C;  3WKJ A;  4H9N A;  5CPK B;  5AV6 B;  2J59 M;  3SUZ A;  5B40 B;  3MGS D;  2AEH A;  1Z2C B;  1TZY B;  5B32 D;  1KX3 D;  1ZLA B;  3NWF A;  4XZQ D;  1GG3 A;  3MGP B;  1NTY A;  2EMT A;  2YS1 A;  4J8V D;  4ZUX A;  2K49 A;  3MGR A;  2ARO A;  3WKJ C;  4P7I A;  1KX4 D;  3MGQ B;  5AV8 D;  1ZLA A;  2R0D A;  5BT1 D;  1XKE A;  2Z59 A;  3OAN A;  3A6N A;  3LZ0 A;  5AVC A;  5AV9 D;  2COD A;  5KQ1 A;  4A6H A;  4A6K A;  3X1U B;  1U29 A;  3X1U D;  2Y2O A;  3WTP B;  3AZL A;  3B6G A;  5HE1 A;  3AZJ A;  3PEG A;  3ZDT A;  2D9W A;  2IFS A;  4CAY B;  1P3K A;  4B6H A;  4AWL C;  1P3B D;  5DNM D;  5CP6 A;  3WA9 D;  3FSS A;  3AZJ C;  5JHG A;  1S32 B;  2J0M A;  5B24 A;  2Y2J A;  3C1C A;  3W99 D;  2Y2P A;  4XZQ B;  3U12 A;  4H8S A;  4H9S A;  2G5H C;  3X1V D;  3TW1 A;  3SNH A;  3NWA A;  4WJ3 C;  1KX5 D;  5CP6 C;  1GC7 A;  5I2M A;  1KX5 B;  2F8N G;  1TZY D;  1X1F A;  1X05 A;  4HAY B;  4PQ0 A;  1WGQ A;  4IAP A;  3KXB B;  4GPT B;  3U7D A;  2NQB A;  1S32 D;  1P3M C;  4G92 B;  2CV5 B;  1M18 D;  2YFW B;  2PZ1 A;  3B6F D;  5B0Y A;  1M19 A;  3AZE A;  1MK7 B;  4R8P D;  1SGH A;  2MDX A;  2D9Z A;  2H7D A;  4J8W C;  3W97 B;  1QC6 A;  2W2X D;  3AU4 A;  4WU9 D;  2Z0Q A;  3MVD D;  5FUG B;  5B0Y B;  5JRG A;  3EPJ A;  3WTP D;  5B31 C;  1M19 B;  1J19 A;  2CRF A;  2UVM A;  4Z5T C;  3AJ4 A;  5B2I D;  1FOE A;  3V9R B;  3G9W A;  4H9P B;  5B33 C;  4HB4 B;  2W2W A;  1MIZ B;  2YS3 A;  4KUD D;  4IFS A;  3AZJ B;  3AZH A;  3V9R A;  5BS7 A;  4J8V B;  1P3K C;  5CPJ D;  3MGP D;  5AY8 C;  2LOZ A;  5B33 A;  1E5W A;  5KQ4 A;  2IYB A;  1UNR A;  3REI A;  1P5T A;  4CSQ A;  5CP6 B;  4ZRK A;  5CPK D;  3KWQ D;  3D8D A;  3VH5 A;  3AL0 C;  3W97 D;  4H9S C;  3H0M C;  3X1S D;  4H9O B;  3AZI D;  1N1J B;  4NE6 A;  3AZK D;  1BTN A;  2DF4 C;  1U5F A;  2ELB A;  1M18 B;  4Y94 A;  3QIJ A;  5EFX A;  1W1G A;  2CY4 A;  1FAO A;  4HAW B;  4E45 A;  3REK A;  4H9O A;  1UPQ A;  2GUM A;  5C3I B;  5IRS A;  1XR0 B;  3AN2 C;  1B67 A;  3TVV A;  1Z87 A;  3MDB C;  1M19 C;  2LUL A;  5D3V A;  5B31 B;  1ULY A;  3WTP E;  1P3P D;  3IVF A;  2J8P A;  5BNV A;  3REK C;  2PYO A;  1TXD A;  4HAZ B;  4NY0 A;  4Z2M G;  5C5B B;  1DDV A;  4J8X A;  5KDM B;  3LZ1 A;  1QQG A;  5B31 A;  4YM6 D;  4Z5T A;  5B2J B;  5F99 D;  3NQU A;  3MGR C;  1FHO A;  3UT9 D;  2PYO C;  2QKM A;  4GNK B;  4G91 C;  2AL6 A;  2LOX A;  3X1T D;  2Y2H A;  1TAF B;  4J8X D;  4J8U C;  3MNN D;  2N0Y A;  5LON B;  4YS3 D;  5GXQ D;  1P3I B;  3NSU A;  3IP4 C;  2I5C A;  5E5A B;  2FJU B;  3AFA B;  4KHA A;  3DXC A;  4F7G A;  5DNN A;  2GCJ A;  1P3I A;  4EO5 B;  5C6R A;  4WVF B;  1TQZ A;  3VH6 A;  1DBH A;  3FM8 C;  5DHF B;  5B32 G;  5B40 D;  3MGS B;  5B24 C;  5AY8 D;  3C1C C;  5DNN C;  1HQ3 A;  2XQN M;  1BH8 B;  3AZN C;  2JCH A;  1KZG A;  5DNM B;  3ULB A;  3TU4 C;  3AN2 A;  3FDD A;  1U35 A;  1M1A A;  3KFU G;  3W98 A;  1ID3 D;  1HQ3 C;  3KWQ B;  1K5D B;  1OQN A;  4QXA B;  5AV5 B;  3AZH D;  1WVH A;  2KIG A;  4IOY X;  3REH A;  4K81 A;  4G91 B;  2RVQ C;  3LZ1 C;  3MGQ A;  3UTB D;  3MVD C;  1UNQ A;  4LD9 B;  3AV2 D;  4J8W A;  2CY5 A;  2P0H A;  5B2I A;  2YT1 A;  3QWM A;  1ID3 C;  3FEH A;  3NQU B;  4KGC C;  2BYM B;  2H7E A;  3MGQ C;  2NBV A;  3ULC A;  4J8U A;  4CSR B;  2ZPY A;  3VH5 T;  1DRO A;  3AZM D;  4ZUX C;  4WU8 B;  2ROZ B;  3ML4 A;  3UTB B;  1ID3 A;  5LOP B;  2COC A;  3AZE D;  5CPI C;  5B0Y D;  1U35 D;  3AZG A;  1M1A D;  1EQZ D;  2FJ7 D;  2GS0 A;  1BH9 B;  1NI2 A;  2NQB D;  2K2U A;  1X11 A;  3LZ0 C;  4KHA B;  1M7E A;  2YFV B;  2KR0 A;  5B40 A;  3W99 C;  5D3W A;  4QJ4 B;  3W96 D;  3AYW B;  4H9R A;  1TZY A;  1MK9 B;  3AZG C;  2EC1 A;  4DX9 0;  3REI C;  5DNM C;  4PNK A;  4NE5 A;  5GXQ C;  2X18 A;  3B0C W;  4TYZ A;  3RCP A;  3REJ A;  2E2X A;  1EGX A;  3REJ D;  4H9R B;  1I7A A;  3B77 A;  4XWX A;  5BNX B;  5CPI D;  1U35 C;  1M1A C;  3A6N B;  3P7Z A;  5C79 A;  5GXQ A;  1Q67 A;  3AZM C;  3REJ C;  4HAT B;  2JP2 A;  1B55 A;  4DBB A;  5JA4 B;  1JFI B;  3EG5 B;  4KGC D;  3AZG D;  2MWN B;  4GXB A;  3UT9 A;  2CV5 C;  3MNN B;  1KZ7 A;  1M7R A;  3TCA A;  5F99 A;  1AWE A;  2HUE B;  2KUP A;  2D4Q A;  2NQB C;  3LZ1 D;  3UTB C;  4HDQ A;  2Y2M A;  4H9P A;  2ZM5 A;  3UT9 B;  2BYM A;  4HDO A;  3X1T C;  2Y8F A;  5B0Y C;  4K17 A;  3AZE C;  2DA0 A;  4HGA C;  3MGR D;  4YM6 B;  5B1L B;  4ZUX D;  3LZ0 B;  3AV2 A;  2CV5 D;  1P3P A;  4R8P C;  3UTA B;  1P3O A;  4GOU A;  2IO5 C;  3O62 B;  3REI B;  1PLS A;  4UUZ B;  1ISN A;  5CPK C;  1KI1 B;  3AV2 C;  5B40 C;  2F8N H;  2D10 A;  2I1J A;  5AVB B;  1TZY C;  3X1V B;  1P3O C;  3F6T A;  4A6F A;  2RVQ D;  5B0Z B;  3HQC A;  2Y2L A;  1XD4 A;  2YSZ A;  3AZH C;  3WKJ B;  5BS7 C;  1OMW A;  2KIE A;  2Y2N A;  3WA9 B;  5AY8 A;  4A6F B;  4F7U P;  3REI D;  4K2O A;  1A7W A;  3X1S B;  3AZI B;  4K2P A;  5B33 D;  3TU4 D;  3MNN C;  2YT0 A;  1FHW A;  1P3I D;  2CWE A;  5HE2 A;  2FFF B;  3WTP C;  1EQZ C;  2FJ7 C;  1P3O D;  2ROV A;  3A8P A;  4DIX A;  3UT9 C;  2CV5 A;  3X1T B;  1P3A A;  4KUD B;  3AZE B;  5B1M B;  4KHB A;  3WTP A;  3B6G B;  3PZD A;  4L1R A;  4ZBJ B;  3WA0 A;  3X1T A;  1P3A B;  1H3O B;  2P8V A;  3VIA A;  1H10 A;  1LW3 A;  5B2I C;  3P6A A;  5C16 A;  1M19 D;  1F1E A;  4KGC A;  3AV2 B;  4QLC A;  1KX5 C;  5B31 D;  1ZSQ A;  1H3O A;  4J8X C;  1S32 A;  3A8Q A;  3BJI A;  4ZRJ A;  2PYO D;  3R45 B;  2RRF A;  3LEL C;  3B6F B;  3AZH B; 
#chains in the Genus database with same CATH homology
 5DH9 B;  2YVC A;  5LG4 B;  1P3M B;  5D3X A;  5CPI A;  4D6W A;  1KX5 A;  5AV6 A;  3GYO A;  3H0R C;  3AZI C;  3X1S C;  2L5A A;  3X1V A;  1RRP B;  5B0Z A;  5D27 A;  3ZVR A;  3REK D;  3PP2 A;  5B24 D;  3C1C D;  5I2S A;  1PZR A;  3MPX A;  3SO6 A;  2DFK A;  1N1J A;  3W96 A;  1ZC4 B;  4Z5T B;  2G5I C;  1P3K D;  3O96 A;  3AZK A;  4WZS B;  4KUD C;  2COF A;  3KWQ A;  3SYX A;  2NZD B;  1EQZ A;  2FJ7 A;  2M14 A;  3W96 C;  3AZL B;  3ODX A;  3AZK C;  2COA A;  3LJA C;  4JJN B;  3AZM A;  3LZ0 D;  5CPJ A;  1V5P A;  2D11 A;  4XZQ C;  2DYN A;  2RLO A;  3KWQ C;  2DKQ A;  5FI1 A;  2HIO B;  4J8U D;  3KUY B;  1U2B A;  4C0A A;  2W8S A;  5D3Y A;  1KX4 A;  4J8X B;  5KDM A;  3LZ1 B;  2ARO D;  3MVD B;  1U27 A;  3LJA A;  3VH6 T;  4J8W D;  5F99 C;  5CPJ C;  2I1K A;  4KHO A;  4XZQ A;  2P0F A;  3AU5 A;  3D8E A;  3B6F C;  3A58 A;  5B32 A;  1KX3 A;  3UTB A;  1ID3 B;  3MGQ D;  2UWX A;  4KGC B;  2LG1 A;  3REH D;  2KGX B;  1V89 A;  3MVD A;  4G92 C;  4WU9 A;  1P3F B;  2YS5 A;  1XX0 A;  4GMX B;  1P3P C;  3KXB D;  3H0L C;  1EVH A;  3W98 D;  4R8P A;  3AN2 B;  1BAK A;  3TFM A;  3AN2 D;  1UEF A;  1BWN A;  2F8N D;  2ZY2 A;  2FJL A;  2F8N B;  4WU9 C;  5CHL B;  5KCV A;  3NWD A;  1HQ3 D;  2UZR A;  2BYK B;  1F66 B;  2W2X C;  4WSF A;  3REH B;  2K00 A;  1P3B C;  2KUQ A;  1P3L A;  2NZD C;  2EMS A;  3AZN D;  5BNX A;  2Y8G A;  4NSW A;  3MGR B;  2ARO B;  4MT7 A;  5DNN D;  2PYO B;  5DHA B;  4JJN C;  3A98 B;  3F0W A;  3W99 A;  4YON A;  2BG1 A;  4Z66 B;  1P3L B;  2HIO D;  4J8U B;  4D0N B;  5DNM A;  5CP6 D;  3MGP C;  2JSS A;  4YS3 A;  2M38 A;  5AV9 C;  3UZT A;  3MNN A;  4QJ3 B;  5CPJ B;  4JJN A;  3AZM B;  2EJ8 A;  1XOD A;  5BT1 C;  1GC6 A;  2KCJ A;  3SV1 A;  3C1B C;  2VRW B;  4WV4 B;  1KX4 C;  2BCJ A;  2Z0P A;  3HW2 B;  4YS3 C;  3AV1 B;  4EO5 C;  4Z5T D;  4H9Q B;  1U5E A;  4YM6 A;  3A6N D;  1P3P B;  2J0K A;  1TJ6 A;  1DDW A;  5JLJ B;  2RGN B;  2G35 A;  2ZY4 A;  3REL D;  1WI1 A;  2I5F A;  3LJU X;  5DIF B;  3W98 B;  1X1G A;  1F66 C;  4YM6 C;  1MAI A;  4QLC C;  3DXD A;  4R8P B;  1S32 C;  4A5K A;  5J3Y A;  3CXB B;  1P3G C;  1PMS A;  2DX5 A;  5JA4 A;  1Q9C A;  4LD9 A;  3QBV B;  5AV6 C;  4Z66 C;  3X1S A;  3X1V C;  3AZI A;  3ODO A;  4Z2M H;  1AOI D;  3W97 A;  5B0Z C;  1ZC3 B;  1ZM0 A;  1P3F D;  3X23 A;  2RUK B;  4NE3 A;  5CPK A;  2Y2G A;  4HB2 B;  4WU8 A;  3FVC A;  2UZS A;  3N7C A;  3WA9 C;  5E5A C;  3MGP A;  4E44 A;  3AFA C;  4J8W B;  3W97 C;  3WAA C;  3AV1 C;  4YS3 B;  4Z2N A;  4KUD A;  1FB8 A;  5CLQ B;  1U5G A;  2YFV A;  2Z4D A;  2YF0 A;  2ZY3 A;  3X1U C;  1X86 A;  3C1B A;  2VKI A;  2K2J A;  4EJN A;  4X23 D;  3WAA A;  5B24 B;  3C1C B;  5DNN B;  3AYW C;  5B33 B;  4ZRI A;  3NQJ B;  3AZG B;  4OT1 A;  5JRG D;  2Q13 A;  5AV8 C;  4QLC B;  4ZBJ C;  1DYN A;  2NZ8 B;  2P0D A;  2DX1 A;  1P3A C;  4J8V C;  3AYW D;  2LKO A;  2DYQ A;  3TO1 A;  3AYW A;  1P34 D;  1K5G B;  3B6F A;  4XUJ A;  5B32 C;  4X23 C;  3REL B;  1KX3 C;  1M18 A;  5GT0 D;  3KZ1 A;  3PVL A;  2DLW A;  1JFI A;  3REJ B;  1HTA A;  5AVC B;  2D9X A;  1MPH A;  2DKP A;  4UUZ A;  4KAX B;  5HE0 A;  3LEL B;  2NMB A;  4XUJ C;  4X23 A;  1ZVR A;  1BTK A;  1P3M D;  2LY8 A;  1M18 C;  1RJ2 A;  2F2A C;  2D9V A;  3PVU A;  3KY9 A;  1WWI A;  4HB0 B;  5GOW B;  3AZF A;  3PSC A;  3HK0 A;  5JHH A;  2XD5 A;  3LEL A;  1V5U A;  5B1M D;  2NQB B;  5C3I C;  5B1L D;  4ZUX B;  4WU8 C;  1FHX A;  4M6B A;  3WA9 A;  2D9Y A;  1P3B A;  4DX8 A;  3M1I B;  1P3R A;  3KUY D;  3AZF C;  1ZYI A;  2ZKM X;  1LB1 A;  5B1L C;  4WU8 D;  5B2J D;  4GZU A;  1P3G D;  3AZJ D;  4MK0 A;  1AOI A;  3ODW A;  3B6G D;  4CHJ A;  3X1U A;  3AZL D;  1V88 A;  1WGU A;  2RNR B;  2ADZ A;  5AV8 B;  3R45 A;  1BH9 A;  1F66 D;  5AV9 A;  5AVC D;  4HAX B;  3LJA B;  1AOI B;  5AVB C;  3UTA A;  1P3O B;  3BIN A;  4YL8 A;  4CAY A;  1P3K B;  1EF1 A;  1KU5 A;  2YFW A;  5B32 B;  5AY8 B;  5AV8 A;  1KX3 B;  1ZLA C;  2Y2I A;  1ZLA D;  5M4Y B;  4J8V A;  4EMO A;  3VOQ A;  2R2Y A;  4CYE A;  4HAV B;  1Y19 B;  4XUJ B;  3REL A;  3MGS A;  2L2I A;  3UTA D;  3WKJ D;  2DHJ A;  4L6E A;  4HSI A;  1IRS A;  1W2E A;  4TKN A;  2HUE C;  5BNV B;  1WWS A;  1P6S A;  4DRB A;  1PFJ A;  5C5B A;  3MGS C;  5B31 G;  2JE5 A;  3AZF B;  2VQR A;  3O62 D;  2Z14 A;  3KUY A;  4HB3 B;  4Z2M B;  3AFA D;  2GJY A;  2NZD D;  2K8E A;  1P3B B;  1TAF A;  5G49 A;  3P5J B;  5B1M A;  2IO5 B;  5B2I B;  3O62 C;  2L1C A;  3KRW A;  1N3H A;  5FI0 A;  5B2J C;  3V5W A;  1U5D A;  1AOI C;  1NTV A;  1Y5O A;  1P3M A;  2RIQ A;  1P3L D;  1P3L C;  5E5A A;  2NZD A;  2HTH B;  4WNN A;  5GSU A;  3AFA A;  3AV1 A;  5BO0 A;  3KXB C;  2DN6 A;  5AV9 B;  4F7H A;  3PVW A;  3KSY A;  2F8N A;  5DI9 B;  1P34 A;  1WJ1 A;  5GSU C;  1KX4 B;  4QJ5 B;  2Y2Q A;  3KXB A;  2YRY A;  1T3U A;  5CPI B;  2OQB A;  3T06 A;  5GT3 C;  1W1D A;  5GT3 D;  4OSN A;  1P34 B;  1W1H A;  1EQZ B;  5GT0 C;  2FJ7 B;  2OTX A;  5AVB D;  4HHV A;  1UPR A;  5J3Q A;  4DQY B;  3F5R A;  2YT2 A;  3WAA D;  3W99 B;  2CAY A;  1H4R A;  3LJA D;  4EKU A;  5FUG A;  5JRG B;  5AV5 A;  4DXA B;  3AZL C;  3W96 B;  3B6G C;  5GXQ B;  2GCL A;  3DXE A;  3AZK B;  1V5M A;  5HE3 A;  2Y7B A;  4HAU B;  1P3G B;  3KUY C;  2BYK A;  1F66 A;  2DTC A;  2DQN C;  5AV5 C;  4Z66 D;  1XCG A;  4DRA A;  5F99 B;  1FGY A;  4CSR A;  1P3G A;  5G49 B;  1P3F A;  3VH5 W;  1MKE A;  5B2J A;  4LD9 C;  1SHC A;  4WJ7 A;  3EPK A;  4Z66 A;  3B0D C;  3VH6 W;  1NU2 A;  2D2Q A;  4LD9 D;  3A1K A;  5B1L A;  4WNN B;  5GSU B;  1BH8 A;  1R4V A;  3LEL D;  3WAA B;  4BBK A;  5BO0 B;  4CHM A;  5B0Z D;  3AZF D;  5JP4 A;  5AV5 D;  1MIX A;  5GT3 B;  5AV6 D;  2ELA A;  1P34 C;  4HGA B;  5GT0 B;  3REK B;  2XD1 A;  3D8F A;  2V76 A;  4H9N B;  3B0C T;  2VSZ A;  3HIE A;  5AVB A;  3UTA C;  2RSG A;  4KVG B;  3WYF B;  2R09 A;  5GT3 A;  5JRG C;  4UPK A;  5GT0 A;  4QLC D;  1EAZ A;  1I2H A;  4XUJ D;  1WJM A;  1B6W A;  5J3T A;  1V61 A;  1WG7 A;  2LYD A;  1UNP A;  4X23 B;  2HIO C;  3B0B A;  3REL C;  3GYP A;  1U35 B;  1M1A B;  4JJN D;  3A6N C;  3EPL A;  3AV1 D;  5AVC C;  1P3I C;  5CLL B;  2MKR A;  2ZY5 A;  5GSU D;  2RVB B;  1P3A D;  5E5A D;  2QKL A;  3A1I A;  3C1B B;  4MY6 A;  2HIO A;  3C1B D;  1OY2 A;  2HE7 A;  3B0D B;  2F8N K;  4KHB B;  1P3F C;  3NQJ A;  2DHI A;  3AZN A;  2N23 A;  4GMV A;  4NFT A;  3KRX A;  3TU4 A;  4GN1 A;  3W98 C;  5B1M C;  3O62 A;  4H9Q A;  2DHK A;  4WU9 B;  2J0J A;  3U8Z A;  3AZN B;  3CIK A;  4AWL B;  3TU4 B;  1FGZ A;  3REH C;  1AQC A;  2Z13 A;  3NW8 A;  3EPH A;  2Z0O A;  1BFM A;  1J0W A;  3PG7 A;  1HQ3 B;  2MFQ A;  5L81 A;  2Y2K A;  2ARO C;  3WKJ A;  4H9N A;  5CPK B;  5AV6 B;  2J59 M;  3SUZ A;  5B40 B;  3MGS D;  2AEH A;  1Z2C B;  1TZY B;  5B32 D;  1KX3 D;  1ZLA B;  3NWF A;  4XZQ D;  1GG3 A;  3MGP B;  1NTY A;  2EMT A;  2YS1 A;  4J8V D;  4ZUX A;  5D3V A;  3MGR A;  2ARO A;  3WKJ C;  4P7I A;  2K49 A;  1KX4 D;  3MGQ B;  5AV8 D;  1ZLA A;  2R0D A;  5BT1 D;  1XKE A;  2Z59 A;  3OAN A;  3A6N A;  3LZ0 A;  5AVC A;  5AV9 D;  2COD A;  5KQ1 A;  4A6H A;  4A6K A;  3X1U B;  1U29 A;  3X1U D;  2Y2O A;  3WTP B;  3AZL A;  3B6G A;  5HE1 A;  3AZJ A;  3PEG A;  3ZDT A;  2D9W A;  2IFS A;  4CAY B;  1P3K A;  4B6H A;  4AWL C;  1P3B D;  5DNM D;  5CP6 A;  3WA9 D;  3FSS A;  3AZJ C;  5JHG A;  1S32 B;  2J0M A;  5B24 A;  2Y2J A;  3C1C A;  3W99 D;  2Y2P A;  4XZQ B;  3OHM B;  3U12 A;  4H8S A;  4H9S A;  2G5H C;  3X1V D;  3TW1 A;  3SNH A;  3NWA A;  4WJ3 C;  1KX5 D;  5CP6 C;  1GC7 A;  5I2M A;  1KX5 B;  2F8N G;  1TZY D;  1X1F A;  1X05 A;  4HAY B;  4PQ0 A;  1WGQ A;  4IAP A;  3KXB B;  4GPT B;  3U7D A;  2NQB A;  1S32 D;  1P3M C;  4G92 B;  2CV5 B;  1M18 D;  2YFW B;  2PZ1 A;  3B6F D;  5B0Y A;  1M19 A;  3AZE A;  1MK7 B;  4R8P D;  1SGH A;  2MDX A;  2D9Z A;  2H7D A;  4J8W C;  3W97 B;  1QC6 A;  2W2X D;  3AU4 A;  4WU9 D;  2Z0Q A;  3MVD D;  5FUG B;  5B0Y B;  5JRG A;  3EPJ A;  3WTP D;  5B31 C;  1M19 B;  1J19 A;  2CRF A;  2UVM A;  4Z5T C;  3AJ4 A;  5B2I D;  1FOE A;  3V9R B;  3G9W A;  4H9P B;  5B33 C;  4HB4 B;  2W2W A;  1MIZ B;  2YS3 A;  4KUD D;  4IFS A;  3AZJ B;  3AZH A;  3V9R A;  5BS7 A;  4J8V B;  1P3K C;  5CPJ D;  3MGP D;  5AY8 C;  2LOZ A;  5B33 A;  1E5W A;  5KQ4 A;  2IYB A;  1UNR A;  3REI A;  1P5T A;  4CSQ A;  5CP6 B;  4ZRK A;  5CPK D;  3KWQ D;  3D8D A;  3VH5 A;  3AL0 C;  3W97 D;  4H9S C;  3H0M C;  3X1S D;  4H9O B;  3AZI D;  1N1J B;  4NE6 A;  3AZK D;  1BTN A;  2DF4 C;  1U5F A;  2ELB A;  1M18 B;  4Y94 A;  3QIJ A;  5EFX A;  1W1G A;  2CY4 A;  1FAO A;  4HAW B;  4E45 A;  3REK A;  4H9O A;  1UPQ A;  2GUM A;  5C3I B;  5IRS A;  1XR0 B;  3AN2 C;  1B67 A;  3TVV A;  1Z87 A;  3MDB C;  1M19 C;  2LUL A;  1DDM A;  5B31 B;  1ULY A;  3WTP E;  1P3P D;  3IVF A;  2J8P A;  5BNV A;  3REK C;  2PYO A;  1TXD A;  4HAZ B;  4NY0 A;  4Z2M G;  5C5B B;  1DDV A;  4J8X A;  5KDM B;  3LZ1 A;  1QQG A;  5B31 A;  4YM6 D;  4Z5T A;  5B2J B;  5F99 D;  3NQU A;  3MGR C;  1FHO A;  3UT9 D;  2PYO C;  2QKM A;  4GNK B;  4G91 C;  2AL6 A;  2LOX A;  3X1T D;  2Y2H A;  1TAF B;  4J8X D;  4J8U C;  3MNN D;  2N0Y A;  5LON B;  4YS3 D;  5GXQ D;  1P3I B;  3NSU A;  3IP4 C;  2I5C A;  5E5A B;  2FJU B;  3AFA B;  4KHA A;  3DXC A;  4F7G A;  5DNN A;  2GCJ A;  1P3I A;  4EO5 B;  5C6R A;  4WVF B;  1TQZ A;  3VH6 A;  1DBH A;  3FM8 C;  5DHF B;  5B32 G;  5B40 D;  3MGS B;  5B24 C;  5AY8 D;  3C1C C;  5DNN C;  1HQ3 A;  2XQN M;  1BH8 B;  3AZN C;  2JCH A;  1KZG A;  5DNM B;  3ULB A;  3TU4 C;  3AN2 A;  3FDD A;  1U35 A;  1M1A A;  3KFU G;  3W98 A;  1ID3 D;  1HQ3 C;  3KWQ B;  1K5D B;  1OQN A;  4QXA B;  5AV5 B;  3AZH D;  1WVH A;  2KIG A;  4IOY X;  3REH A;  4K81 A;  4G91 B;  2RVQ C;  3LZ1 C;  3MGQ A;  3UTB D;  3MVD C;  1UNQ A;  4LD9 B;  3AV2 D;  4J8W A;  2CY5 A;  2P0H A;  5B2I A;  2YT1 A;  3QWM A;  1ID3 C;  3FEH A;  3NQU B;  4KGC C;  2BYM B;  2H7E A;  3MGQ C;  3ULC A;  2NBV A;  4J8U A;  4CSR B;  2ZPY A;  3VH5 T;  1DRO A;  3AZM D;  4ZUX C;  4WU8 B;  2ROZ B;  3ML4 A;  3UTB B;  1ID3 A;  5LOP B;  2COC A;  3AZE D;  5CPI C;  5B0Y D;  1U35 D;  3AZG A;  1M1A D;  1EQZ D;  2FJ7 D;  2GS0 A;  1BH9 B;  1NI2 A;  2NQB D;  2K2U A;  1X11 A;  3LZ0 C;  4KHA B;  1M7E A;  2YFV B;  2KR0 A;  5B40 A;  3W99 C;  5D3W A;  4QJ4 B;  3W96 D;  3AYW B;  4H9R A;  1TZY A;  1MK9 B;  3AZG C;  2EC1 A;  4DX9 0;  3REI C;  5DNM C;  4PNK A;  4NE5 A;  5GXQ C;  2X18 A;  3B0C W;  4TYZ A;  3RCP A;  3REJ A;  2E2X A;  1EGX A;  3REJ D;  4H9R B;  1I7A A;  4XWX A;  5BNX B;  5CPI D;  1U35 C;  1M1A C;  3A6N B;  3P7Z A;  5C79 A;  5GXQ A;  1Q67 A;  3AZM C;  3REJ C;  4HAT B;  2JP2 A;  1B55 A;  4DBB A;  5JA4 B;  1JFI B;  3EG5 B;  4KGC D;  3AZG D;  2MWN B;  4GXB A;  3UT9 A;  2CV5 C;  3MNN B;  1KZ7 A;  1M7R A;  3TCA A;  5F99 A;  1AWE A;  2HUE B;  2KUP A;  2D4Q A;  2NQB C;  3LZ1 D;  3UTB C;  4HDQ A;  2Y2M A;  4H9P A;  2ZM5 A;  3UT9 B;  2BYM A;  4HDO A;  3X1T C;  2Y8F A;  5B0Y C;  4K17 A;  3AZE C;  2DA0 A;  4HGA C;  3MGR D;  4YM6 B;  5B1L B;  4ZUX D;  3LZ0 B;  3AV2 A;  2CV5 D;  1P3P A;  4R8P C;  3UTA B;  1P3O A;  4GOU A;  2IO5 C;  3O62 B;  3REI B;  1PLS A;  4UUZ B;  1ISN A;  5CPK C;  1KI1 B;  3AV2 C;  5B40 C;  2F8N H;  2D10 A;  2I1J A;  5AVB B;  1TZY C;  3X1V B;  1P3O C;  3F6T A;  4A6F A;  2RVQ D;  5B0Z B;  3HQC A;  2Y2L A;  1XD4 A;  2YSZ A;  3AZH C;  3WKJ B;  5BS7 C;  1OMW A;  2KIE A;  2Y2N A;  3WA9 B;  5AY8 A;  4A6F B;  4F7U P;  3REI D;  4K2O A;  1A7W A;  3X1S B;  3AZI B;  4K2P A;  5B33 D;  3TU4 D;  3MNN C;  2YT0 A;  1FHW A;  1P3I D;  2CWE A;  5HE2 A;  2FFF B;  3WTP C;  1EQZ C;  2FJ7 C;  1P3O D;  2ROV A;  3A8P A;  4DIX A;  3UT9 C;  2CV5 A;  3X1T B;  1P3A A;  4KUD B;  3AZE B;  5B1M B;  4KHB A;  3WTP A;  3B6G B;  3PZD A;  4L1R A;  4ZBJ B;  3WA0 A;  3X1T A;  1P3A B;  1H3O B;  2P8V A;  3VIA A;  1H10 A;  1LW3 A;  5B2I C;  3P6A A;  5C16 A;  1M19 D;  1F1E A;  4KGC A;  3AV2 B;  4QLC A;  1KX5 C;  5B31 D;  1ZSQ A;  1H3O A;  4J8X C;  1S32 A;  3A8Q A;  3BJI A;  4ZRJ A;  2PYO D;  3R45 B;  2RRF A;  3LEL C;  3B6F B;  3AZH B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...