4KHAA

Structural basis of histone h2a-h2b recognition by the essential chaperone fact
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
406
structure length
360
Chain Sequence
DVVEQDKLIEIRNRRPAVLDNVYIRPALEGKRVPGKVEIHQNGIRYQSPLSTTQRVDVLFSNIRHLFFQPCQNEMIVIIHLHLKDPILFGKKKTKDVQFYREAIQEERRRKAELDRLFKSFAEKIAEAGRNEGIEVDMPIRDLGFNGVPNRSNVVIYPTTECLIQITEPPFLVITLEDVEWAHLERVQFGLKNFDLVFVFKDFTRPVVHINTIPVESLEDVKEFLDSSDIPFSEGPLNLNWSVIMKTVTANPHQFFLDGGWGFLQNDSRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Spt16M-Histone H2B 1.1 chimera
publication title Structural basis of histone H2A-H2B recognition by the essential chaperone FACT.
pubmed doi rcsb
source organism Chaetomium thermophilum var. thermophilum
molecule tags Chaperone/nuclear protein
total genus 99
structure length 360
sequence length 406
ec nomenclature
pdb deposition date 2013-04-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08512 Rtt106 Histone chaperone Rttp106-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 4khaA03
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 4khaA02
2.30.29.150 Mainly Beta Roll PH-domain like PH-domain like 4khaA01
5BNVA 3MNNC 1TXDA 4C0AA 4J8WA 2MWNB 1B6WA 4CAYA 5DNMD 3W98A 3A8PA 5GXQC 2L1CA 3UTAD 4GZUA 5B0ZD 4YS3A 1P3MA 4ZUXB 2CRFA 3KUYB 4ZRIA 3PVWA 3AZMA 3WKJC 4Z66B 4X23C 1P3AD 3MGRC 4KUDA 1P34D 1FAOA 3UT9B 1UNQA 3C1BD 4R8PB 4XUJC 3D8DA 2COFA 3X1UA 1TZYD 3X1SB 2VSZA 4J8UD 5B0YD 3SO6A 3REIB 1QC6A 2EMTA 5AVCC 1XKEA 3DXEA 3VH6A 3RELD 2E2XA 1WWSA 5JA4A 5DNMA 2LOXA 3ULBA 1P3OD 1WJMA 3UTAA 1ZM0A 3LZ0B 3GYOA 1MAIA 1KX4D 2KGXB 5CLQB 4QLCC 1U35B 5B33D 2DHKA 1P3AA 2ADZA 5F99B 2IFSA 2J0KA 1P34A 4J8VC 3HW2B 3REHB 3C1BA 2BYMB 4DRBA 3VH5A 4LD9C 2K2JA 1TZYA 3A8QA 3TVVA 2Y8GA 3KWQB 3AZFB 2YS3A 5B0YA 3WA0A 4CHMA 2RVQC 1ID3B 2FJ7C 3MGPD 3C1CB 1P3PC 1FHWA 2FJLA 4F7UP 3MVDC 5AVBC 5AV8C 2ROZB 5GT3B 3RELA 2PYOD 1V5UA 1JFIA 4ZUXD 3UTBB 1P3OA 3KUYD 5BS7A 5FI1A 1X1GA 3B0DC 1E5WA 4Z66D 1KX4A 2DFKA 4L6EA 3W98C 2RVBB 5DHAB 1DDVA 5D3WA 4R8PD 3SUZA 1X11A 5C5BA 3B0CT 5B40B 3X1SD 4H8SA 2YFVA 3TU4D 1BTKA 1ZVRA 4K2OA 2N0YA 2W2XC 2L5AA 3UZTA 1KU5A 3REID 5AY8B 5D3VA 3AV2B 3MGPA 1S32C 1ZSQA 4KAXB 3AYWB 3AFAC 4BBKA 4K17A 4H9RB 5CPIC 3X1VB 2PYOA 1XD4A 3LZ0D 1BH8B 4ZUXA 3KXBB 5CPKC 1MK7B 3KUYA 2H7EA 5C6RA 3B6FC 5DNNB 2CY4A 3LZ1B 1U35D 2QKLA 4Z66A 3PVLA 5F99D 5J3YA 2DYNA 3HQCA 4XZQD 3REHD 3UTAC 5B0ZC 2HIOD 4G91B 4R8PA 3X1TB 5C3IB 1P3IB 4WV4B 2F8NG 1KZ7A 2M38A 3X1SA 1M1AB 1NTVA 3TU4A 1H10A 3AZFD 1P3AC 1KX5B 5BNXB 5C16A 1P34C 1ZLAC 2MFQA 3REIA 1ID3D 3C1BC 2YT0A 3C1CD 4J8WB 1U27A 1TZYC 1DDMA 4CAYB 1BH9B 5GT3D 1TQZA 3LJAB 4J8UC 4YS3B 3AZEB 5B0YC 1P3MB 1BTNA 3UTBD 2ROVA 4AWLB 3LZ0A 3FSSA 3AZMB 5JHHA 2Z0PA 4NFTA 5FUGB 4KUDB 3RELC 1U35A 4P7IA 5F99A 2Q13A 5B2IC 4XZQA 2YVCA 3X1UB 4H9NB 2HIOA 4KHAA 3AZKC 1IRSA 2COAA 3D8EA 1AOIA 1KX4C 1BFMA 1WWIA 5B33C 3AZFA 5AY8D 3OANA 3V5WA 4PNKA 3MGQA 1ID3A 4H9SA 3C1CA 2QKMA 4KHBB 3AYWD 2DKQA 4H9OA 1XCGA 2RLOA 1WJ1A 5DNMB 2HUEC 5GT3A 3X1VD 4F7GA 1UPQA 3P6AA 1DROA 5J3QA 3KXBD 4HAWB 5DNND 5CP6A 1NU2A 4GPTB 3LZ1D 3A98B 2AROA 2GCLA 3REKB 4CSRA 4Y94A 3X1TD 1P3ID 2AL6A 4ZUXC 1M7RA 3KUYC 2NQBB 1U5DA 4HDQA 4HAYB 4Z66C 2F8NH 2YRYA 1M19B 3UT9C 3WTPE 1MIZB 2I5FA 2R09A 5AY8A 4R8PC 4UUZA 2Z0OA 3LELB 3X1SC 1V89A 3LJAD 1JFIB 3AZED 4H9RA 4KVGB 3X1VA 3AZLA 5GSUA 3REIC 1P3OB 1UPRA 2AEHA 2D4QA 5FI0A 2LULA 5EFXA 4KUDD 5DNNA 4G92B 1P3BA 3WYFB 1M7EA 4WSFA 1MK9B 5L81A 3X1TA 1XR0B 1P3IA 3LZ0C 2YFVB 1WVHA 5KCVA 5KDMB 1FGZA 1X05A 2NMBA 3VOQA 1U35C 4YL8A 5F99C 5BNXA 3REHC 3FEHA 3MGPB 3SV1A 2EJ8A 1BH9A 3AZIA 4A6FB 2PYOB 3KWQC 3LJAA 3AZFC 2GJYA 3AZEA 4NE5A 1ID3C 3GYPA 4H9SC 3C1CC 5HE3A 5FUGA 4B6HA 2Y7BA 5GT3C 3REKD 3AZGB 2CY5A 1I2HA 3UTBC 4H9NA 2NQBD 3NQUB 1H3OB 2JSSA 3TU4B 2NZDD 1U29A 5GOWB 3WA9D 1M19D 3G9WA 2F8NB 3KRXA 3NSUA 2N23A 3TFMA 5B40C 3LELD 3U8ZA 3T06A 5DI9B 1DBHA 1BWNA 4E44A 1QQGA 1LB1A 1W1GA 2RNRB 2W2WA 3F0WA 5AY8C 2K2UA 2YF0A 4HB2B 1R4VA 5JRGA 3AV2C 5HE1A 4HAVB 1J0WA 3AYWC 3REJD 5B1LB 3WTPD 3REKA 3X1VC 3QBVB 4XZQB 3WAAD 1UNRA 2HIOB 4KHAB 3ZVRA 3KXBC 5B24D 1NTYA 1AOIB 2NQBA 5DNNC 4H9PB 3LZ1C 3AU5A 3AV1D 4Z2MG 2NZDA 5DHFB 3WA9A 1M19A 3IVFA 5B32G 3MGQB 4ZBJB 1OMWA 3X1TC 1P3IC 4G91C 3A6NB 1Q67A 5C3IC 4HAZB 4H9OB 3LELA 1M1AC 2PZ1A 4EMOA 1M18B 5BT1D 5B32A 1KX5C 2LKOA 1KI1B 5CP6B 4J8WC 3LJUX 1V88A 2M14A 2ELAA 2AROB 5BO0B 2J0JA 4TYZA 3AZGD 3REJA 4CSRB 3LJAC 4YS3C 3AZEC 3WTPA 1P3MC 1P5TA 3WAAA 4AWLC 2YFWA 3AZMC 5B24A 3SNHA 5KDMA 4KUDC 2F8ND 3AV1A 1RRPB 4K2PA 2GCJA 4UUZB 4WU8B 5B31D 3X1UC 4HAUB 5AV5B 1GC6A 1P6SA 2D9ZA 1HTAA 4A6FA 3AZLB 5GSUB 3CIKA 3VH5T 1WGQA 1NI2A 3W99B 2YS5A 1P3BB 2UZSA 5B1LD 5DNMC 3AZGA 1Y5OA 4DX90 2DHJA 2ZPYA 5LONB 5E5AA 3AN2A 2D9VA 1AOID 4WZSB 3NQUA 5B31G 1H3OA 3AZND 1J19A 3W96A 3MGQD 3REKC 2F8NA 2J0MA 3MGSD 5D3YA 5KQ1A 3QWMA 3A6ND 5B31A 1P3LD 2NQBC 1K5DB 3AZIB 1M18D 1U5EA 4CHJA 4Z5TD 1M19C 1EGXA 4J8XA 1W1DA 5C79A 2JP2A 5CP6D 1PLSA 3LELC 2AROD 1V5MA 2H7DA 1Z87A 5B1LA 1P3OC 1N3HA 2LYDA 3ODXA 3AU4A 5BS7C 2I1KA 1PFJA 3AZNA 4H9PA 4G92C 2LOZA 2CV5B 1WG7A 4WU8D 3MGSA 5AV5D 5CHLB 3A6NA 1P3LA 4HGAB 3NQJB 4NE3A 1M18A 2VKIA 3ODOA 3AZLD 5GSUD 4DBBA 4D0NB 4Z5TA 2YSZA 1P3GA 2BYKA 1B55A 5JRGB 4E45A 3W99D 3MGPC 1DYNA 4HAXB 1P3BD 5B2JB 4Z2NA 4A6HA 5BO0A 3O62B 2KCJA 1N1JA 3D8FA 5B1MB 5BT1C 2PYOC 4HB3B 3B0CW 1P3KB 4CYEA 2Z0QA 2NZDB 3N7CA 3WA9B 3AZGC 1ZC3B 2RGNB 3TCAA 1EAZA 5GXQA 4WU8A 1FHOA 5AV5A 1AQCA 3AZID 4Z2MB 3TU4C 4MY6A 5B32B 1RJ2A 2IYBA 4QLCD 3VH5W 4EO5B 1H4RA 4J8VD 3W99A 4KHOA 5GT0B 1ISNA 2D2QA 5AV6B 3REJB 2P0DA 4ZRJA 4EJNA 3WTPB 3PP2A 2UVMA 2EC1A 1TJ6A 4HHVA 3WAAB 1XX0A 2YFWB 2GS0A 2I5CA 4NY0A 5B24B 3TW1A 4HDOA 3AV1B 1V61A 2CV5D 5B1LC 2HTHB 3M1IB 4XZQC 2HIOC 5CPJB 1AOIC 1HQ3B 2OQBA 1ZC4B 3R45A 3MGQC 4QLCA 1U5FA 4ZBJC 5JRGD 2DKPA 3B0BA 3A6NC 1V5PA 4J8VA 5B2JD 4MT7A 2XQNM 3O62D 1M18C 5B1MD 5AV9B 4LD9A 5E5AB 1P3KD 3AN2B 1LW3A 5D27A 2P0HA 3KSYA 1F1EA 5CP6C 2AROC 1TAFA 4EKUA 3W96B 2DTCA 2F8NK 3AFAD 2CV5A 1FGYA 3MVDA 5AVBA 4WU9B 5CPID 1P3RA 5B31B 4H9QB 4HATB 5B32D 3B6FD 3NQJA 4J8XB 3B6GB 1P3FB 4YM6B 4WU8C 4JJNB 5AV5C 5GT0D 2IO5B 2D9WA 5B2JA 5AV6D 4HB0B 3O62A 1F66B 3V9RA 1KZGA 4K81A 5B1MA 3AZLC 5GSUC 1KX3B 2COCA 1P3KA 2RUKB 3PEGA 3SYXA 2G35A 1ZLAD 3W99C 3P7ZA 3AZNB 1P3BC 3DXCA 1EQZB 1S32A 5KQ4A 3KY9A 5HE0A 3AFAA 3MGSB 1EF1A 5CPIA 5CPJD 1P3LB 1HQ3D 5CPKA 3AZJB 4Z5TB 3B6FA 1P3GB 2ELBA 2BYKB 2I1JA 2CWEA 5B2ID 2YS1A 5B0ZA 1A7WA 3AZKD 1N1JB 5GT0A 3AZIC 5AV9D 5AV6A 4GMVA 5DIFB 5E5AD 5J3TA 3AN2D 4KGCB 2DA0A 2CODA 2X18A 3MDBC 1U2BA 2P8VA 3VH6T 3AZHB 3W97B 5G49A 1ZLAA 3MNNB 3W96D 1MPHA 4WU9D 5GXQB 1OY2A 4J8UA 4WNNB 5CPJA 1DDWA 1HQ3A 3PZDA 4PQ0A 5JLJB 4J8XD 3B6GD 2CV5C 3WKJB 1P3FD 4X23B 1U5GA 3MGRB 4YM6D 2DHIA 4MK0A 4WJ7A 4JJND 2D9YA 4XUJB 1K5GB 5B2IA 1F66D 4HGAC 3AZKA 2DYQA 1I7AA 3TO1A 1KX3D 5AV9A 4IAPA 2D11A 5JP4A 2KUPA 3ULCA 3UT9D 5JRGC 5B33A 3F5RA 1EVHA 1PMSA 5B2JC 5AVCB 3O62C 1EQZD 1X86A 4F7HA 5B1MC 2P0FA 1WGUA 1P3KC 4WU9A 1XODA 4Z2MH 3BJIA 4H9QA 2NZDC 3PSCA 3AZJD 3WA9C 4ZRKA 3R45B 1P3GD 4QLCB 2VRWB 3B6GA 3MPXA 1P3FA 1ULYA 4M6BA 2CAYA 4YM6A 2DN6A 4J8VB 3HK0A 4JJNA 3DXDA 5JHGA 4HB4B 3PVUA 1F66A 5B32C 4LD9B 3QIJA 3ML4A 4KGCD 1KX3A 4EO5C 3AZHD 3W97D 1SGHA 2J59M 3UT9A 3ZDTA 2FJ7B 1TAFB 5GT0C 3MNND 2L2IA 1P3PB 5AV6C 3REJC 4DXAB 1EQZA 3MVDB 4NE6A 5AV8B 5AVBB 3WTPC 5GXQD 1B67A 3WAAC 3KWQD 1MKEA 1UEFA 2K00A 3BINA 1Q9CA 4IFSA 3X23A 5B24C 5BNVB 1WI1A 5HE2A 2D10A 3AV1C 3B0DB 3WKJD 3AZJA 4X23D 2LG1A 3MGRD 3W98B 3U7DA 2UZRA 2NZ8B 4XUJD 4GN1A 5CPJC 1HQ3C 5DH9B 3AJ4A 3V9RB 5CLLB 3O96A 3VH6W 4KGCA 4GXBA 3RCPA 2MDXA 3AZHA 3W97A 5AVCD 3REHA 5B40D 3MNNA 1S32B 2BYMA 5AV9C 3AFAB 5E5AC 3AN2C 5CPIB 4WVFB 3KWQA 2D9XA 1OQNA 2DX5A 4NSWA 4WNNA 5CPKB 3AV2D 3B6FB 3W96C 3KRWA 3WKJA 5JA4B 4X23A 4WU9C 3MGRA 5B31C 3UTAB 5B0ZB 4XUJA 1X1FA 2V76A 3UTBA 4YONA 2HE7A 4LD9D 1FHXA 4J8XC 3B6GC 5LOPB 1P3AB 1P3FC 1BAKA 4YM6C 1P34B 5G49B 1ZLAB 2RVQD 4DX8A 4JJNC 3C1BB 2FJ7D 2IO5C 1P3PD 5AVCA 1UNPA 5B40A 1F66C 1TZYB 3MVDD 5AVBD 5AV8D 1M1AD 1KX3C 2YT1A 3ODWA 3KZ1A 3PG7A 4J8UB 1KX5D 2R0DA 5B0YB 1FOEA 3VIAA 1Y19B 3AZNC 4GMXB 4J8WD 1FB8A 4TKNA 1AWEA 3AV2A 4DRAA 1EQZC 2DX1A 3CXBB 2OTXA 3W98D 3RELB 3AYWA 3MGSC 4IOYX 4YS3D 1P3MD 4A5KA 3FM8C 5B2IB 1P3LC 2DLWA 3AZKB 1BH8A 3KXBA 3AZMD 2RSGA 3AZJC 4Z5TC 1KX4B 1P3GC 1GG3A 2BCJA 3LZ1A 1W1HA 5B33B 2W2XD 2LY8A 2Y8FA 2EMSA 1GC7A 1MIXA 3X1UD 1SHCA 2FJ7A 5C5BB 1S32D 4XWXA 1P3PA 2MKRA 1M1AA 5AV8A 4KGCC 2HUEB 5D3XA 1KX5A 3AZHC 3W97C 5CPKD 4A6KA
chains in the Genus database with same CATH superfamily
1TXDA 2MWNB 4UPKA 3A8PA 5GXQC 4GZUA 1P3MA 3PVWA 4DIXA 4X23C 5I2MA 3C1BD 3D8DA 3X1UA 3X1SB 3REIB 1QC6A 2EMTA 2E2XA 3GYOA 1U35B 1P3AA 2ADZA 5F99B 2IFSA 2J0KA 4DRBA 2K2JA 1TZYA 3KWQB 3WA0A 2FJ7C 2FJLA 5AV8C 2PYOD 1V5UA 1JFIA 2DFKA 2RVBB 5DHAB 3X1SD 2YFVA 3TU4D 2XD5A 1KU5A 3REID 5D3VA 1S32C 4K17A 5CPIC 1XD4A 2UWXA 2H7EA 3KUYA 4CSQA 1U35D 4Z66A 5F99D 5J3YA 2DYNA 2F8NG 2HIOD 4G91B 1P3IB 3VIAA 4WV4B 1M1AB 2R2YA 1KX5B 5BNXB 2YT0A 3C1BC 4CAYB 1BH9B 3LZ0A 2Z0PA 4KUDB 4P7IA 5B2IC 3AZFA 2QKMA 1WJ1A 2HUEC 5GT3A 1P3ID 1U5DA 2YRYA 3WTPE 1MIZB 2R09A 5AY8A 3LELB 3X1SC 2KIGA 2AEHA 3REIC 5FI0A 1UPRA 2D4QA 5EFXA 4KUDD 4G92B 4WSFA 1WVHA 4WJ3C 1X05A 1U35C 5F99C 4DQYB 3FEHA 3MGPB 2EJ8A 3KWQC 3LJAA 3AZEA 4NE5A 4H9SC 4B6HA 2CY5A 2JSSA 2K8EA 3KRXA 3LELD 5DI9B 2RNRB 5HE1A 1J0WA 5B1LB 3AU5A 2NZDA 5DHFB 1OMWA 1P3IC 4G91C 4HAZB 1M1AC 1KX5C 2LKOA 2G5IC 2M14A 2ELAA 4TYZA 3REJA 2YFWA 4KUDC 4GNKB 5B31D 1T77A 1HTAA 4A6FA 1WGQA 5B1LD 1Y5OA 4DX90 4D6WA 5E5AA 3AN2A 2D9VA 4WZSB 3AZND 1H3OA 5KQ1A 3AZIB 4CHJA 5C79A 1PLSA 3LELC 1V5MA 3ODXA 1N3HA 5BS7C 4G92C 2LOZA 3MGSA 3A6NA 1P3LA 2VKIA 4D0NB 3ODOA 2YSZA 3MGPC 4A6HA 1N1JA 3KFUG 3B0CW 1P3KB 4CYEA 4WU8A 1AQCA 3AZID 4MY6A 2DQNC 1RJ2A 4QLCD 5GT0B 4EJNA 1ZYIA 3WAAB 3TW1A 4HDOA 5B1LC 1HQ3B 3R45A 3B0BA 1V5PA 4MT7A 1P3KD 2P0HA 4EKUA 1FGYA 4WU9B 5AVBA 4HATB 3B6FD 5GT0D 5B2JA 3O62A 4MK0A 5B1MA 3DXCA 3KY9A 1HQ3D 4QJ3B 5CPKA 4Z5TB 2I1JA 5B0ZA 1A7WA 3AZIC 5AV6A 4KGCB 2DA0A 3W97B 4WU9D 4PQ0A 2DHIA 4WJ7A 1I7AA 3TO1A 3ULCA 3F5RA 2BG1A 2P0FA 1WGUA 1P3KC 1XODA 3PSCA 2VRWB 2JCHA 2CAYA 4J8VB 1F66A 4LD9B 4KGCD 2J59M 3W97D 1SGHA 5GT0C 3B77A 1EGXA 3MVDB 1MKEA 3WAAC 2LG1A 2NZ8B 1HQ3C 3MNNA 2BYMA 3AFAB 4WVFB 3H0LC 4WU9C 4XUJA 1X1FA 4YONA 2HE7A 4LD9D 1P3AB 5G49B 1ZLAB 5B40A 3ODWA 1TZYB 3MVDD 2YT1A 3KZ1A 4J8UB 3AV2A 3CXBB 1P3MD 3AZKB 1BH8A 4Z5TC 3IVFA 2W2XD 2Y8FA 1W1HA 5B33B 2EMSA 3X1UD 4KGCC 2RIQA 3W97C 4A6KA 4C0AA 3W98A 4YS3A 3KUYB 4ZRIA 3AZMA 4Z66B 1P3AD 3UT9B 1TZYD 4J8UD 3DXEA 5DNMA 1Z2CB 2LOXA 3UTAA 3LZ0B 1MAIA 5B33D 4J8VC 4LD9C 3A8QA 3AZFB 2YS3A 5B0YA 4F7UP 3MVDC 5GT3B 3UTBB 1P3OA 3KUYD 5FI1A 4L6EA 4Z66D 1KX4A 3SUZA 4H8SA 1ZVRA 4K2OA 2W2XC 2KUQA 5AY8B 3AYWB 3AFAC 4BBKA 2ZKMX 3LZ0D 4ZUXA 3LZ1B 2Y2JA 3AZFD 1P3AC 1ZLAC 4J8WB 1TZYC 1DDMA 5GT3D 3LJAB 4J8UC 3AZEB 2ROVA 3UTBD 5JHHA 3EPLA 2Q13A 4XZQA 3AZKC 4KHAA 1IRSA 2COAA 1AOIA 5B33C 5AY8D 4PNKA 1ID3A 3AYWD 2DKQA 4H9OA 2RLOA 4F7GA 5J3QA 4HAWB 3LZ1D 2GCLA 4Y94A 3KUYC 4Z66C 3UT9C 2I5FA 4UUZA 3LJAD 4KVGB 3AZED 4H9RA 5GSUA 2LULA 5DNNA 1P3BA 3WYFB 1MK9B 3LZ0C 2NMBA 3NWFA 3SV1A 4A6FB 2PYOB 3AZFC 2GJYA 5HE3A 2Y7BA 5GT3C 3UTBC 4H9NA 1H3OB 2NZDD 3TU4B 3G9WA 3U8ZA 3T06A 4KHBA 1DBHA 1LB1A 5AY8C 2K2UA 3AYWC 3REJD 3QBVB 1UNRA 2HIOB 3ZVRA 2NQBA 3LZ1C 3WA9A 3MGQB 3A6NB 4EMOA 2Y2KA 5BT1D 1KI1B 5CP6B 4J8WC 2AROB 2W8SA 4CSRB 3LJAC 3AZEC 3WTPA 5B24A 5M4YB 3AV1A 5IRSA 4WU8B 1W2EA 3AZLB 3CIKA 3VH5T 3AZGA 5LONB 2ZPYA 2NBVA 3MGQD 3MGSD 5D3YA 3QWMA 3A6ND 1P3LD 1K5DB 4J8XA 5CP6D 2AROD 1Z87A 4QJ5B 4H9PA 4WU8D 5CHLB 4HGAB 4DBBA 1M18A 3AZLD 1B55A 5JRGB 5B2JB 3O62B 5B1MB 5BT1C 2PYOC 4HB3B 3NWDA 3N7CA 1EAZA 5GXQA 4Z2MB 3TU4C 5B32B 2IYBA 3VH5W 1H4RA 4KHOA 5AV6B 1TJ6A 4NY0A 1V61A 2HIOC 1ZC4B 3MGQC 5JRGD 2DKPA 3A6NC 5B2JD 3O62D 5B1MD 5D27A 4OT1A 3KSYA 1F1EA 5CP6C 2AROC 3W96B 2CV5A 1P3RA 5B31B 5B32D 4WU8C 2D9WA 5AV6D 4HB0B 1F66B 3AZLC 2COCA 3PEGA 3SYXA 2FJUB 3AZNB 3P7ZA 1S32A 5KQ4A 3OHMB 5CPIA 1P3GB 2BYKB 2YS1A 5J3TA 2P8VA 3MNNB 3W96D 1DDWA 2ZY2A 4XUJB 5B2IA 1F66D 4HGAC 2D11A 5JRGC 5B2JC 3O62C 5B1MC 2F2AC 1P3GD 4QLCB 3B6GA 3MPXA 1ULYA 5JHGA 3PVUA 5B32C 3ML4A 3ZDTA 1TAFB 3MNND 3NW8A 5AV6C 1B67A 3H0RC 3BINA 3NWAA 3B0DB 3AZJA 3W98B 2UZRA 4XUJD 4GN1A 2JE5A 3V9RB 4GXBA 5B40D 3KWQA 2D9XA 1OQNA 3AV2D 3B6FB 3W96C 3WKJA 4L1RA 3MGRA 5B31C 3UTAB 2RVQD 5AVCA 1F66C 5JLJB 3PG7A 5B0YB 3AZNC 4TKNA 2DX1A 3W98D 4YS3D 4A5KA 3AZMD 1KX4B 1P3GC 1GC7A 4XWXA 1P3PA 2G5HC 1M1AA 1KX5A 5BNVA 3MNNC 1B6WA 4CAYA 5DNMD 2L1CA 3UTAD 4ZUXB 4KUDA 1FAOA 4XUJC 2VSZA 5B0YD 3SO6A 3VH6A 2VQRA 5JA4A 1P3OD 1ZM0A 1KX4D 5CLQB 4QLCC 2DHKA 1P34A 3REHB 3VH5A 1MI1A 2Y8GA 2RVQC 1ID3B 1FHWA 2ROZB 3RELA 4ZUXD 5BS7A 3B0DC 1E5WA 3W98C 1DDVA 5D3WA 1X11A 5C5BA 3UZTA 1BTKA 3MGPA 1ZSQA 4KAXB 4H9RB 3KXBB 5C6RA 3B6FC 5DNNB 2CY4A 3PVLA 3HQCA 4XZQD 3REHD 3UTAC 4R8PA 5C3IB 5C16A 2Z59A 1ID3D 1U27A 1TQZA 1P3MB 5B0YC 4NFTA 3X1UB 4H9NB 1KX4C 3V5WA 3C1CA 4KHBB 1DROA 1UPQA 3P6AA 3KXBD 5DNND 4GPTB 3A98B 4ZUXC 2NQBB 4HDQA 1JFIB 3X1VA 4QXAB 1M7EA 3X1TA 2Y2GA 2K49A 2YFVB 1FGZA 3VOQA 4YL8A 3REHC 3AZIA 3DCXA 1ID3C 3GYPA 5FUGA 3AZGB 2NQBD 2Y2QA 5GOWB 3WA9D 3NSUA 3EPJA 1BWNA 1QQGA 1W1GA 2W2WA 2YF0A 3WTPD 3REKA 3EG5B 3KXBC 5B24D 1NTYA 5DNNC 4H9PB 3AV1D 4Z2MG 1M19A 5B32G 4ZBJB 5C3IC 1M18B 1V88A 3AZGD 1P3MC 3WAAA 1PZRA 3SNHA 5KDMA 1RRPB 4K2PA 2GCJA 3X1UC 1GC6A 1P6SA 2D9ZA 2YS5A 2DHJA 2Z4DA 3NQUA 5B31G 2F8NA 2NQBC 1M18D 1U5EA 4QJ4B 2JP2A 2H7DA 2ZY4A 3AL0C 2ZY3A 1PFJA 2CV5B 4Z5TA 4E45A 4HAXB 5BO0A 3D8FA 2RRFA 2Z0QA 2NZDB 3AZGC 2RGNB 5AV5A 3W99A 2D2QA 3REJB 4ZRJA 2UVMA 2EC1A 1XX0A 2YFWB 2CV5D 2Y2IA 4ZBJC 4J8VA 2XQNM 1M18C 4LD9A 5E5AB 3AN2B 1LW3A 3MVDA 3A58A 5CPID 3FDDA 3NQJA 3B6GB 2ZM5A 2IO5B 4K81A 2RUKB 3U12A 1T3UA 2ZY5A 3AFAA 3MGSB 1EF1A 1P3LB 3AZJB 5B2ID 1N1JB 5DIFB 5E5AD 3AN2D 2CODA 3MDBC 1U2BA 3VH6T 5G49A 1ZLAA 2Y2OA 1OY2A 4J8UA 5CPJA 3B6GD 2CV5C 3WKJB 1U5GA 3MGRB 2D9YA 3AZKA 5AV9A 4IAPA 2KUPA 5B33A 5AVCB 1X86A 4Z2MH 3BJIA 4H9QA 2NZDC 3AZJD 3R45B 1P3FA 4YM6A 2DN6A 3HK0A 4JJNA 1KX3A 3UT9A 1P3PB 3REJC 1EQZA 5AVBB 2K00A 4IFSA 3KWQD 5BNVB 1WI1A 3WKJD 3U7DA 3MGRD 5CLLB 3O96A 3VH6W 3AZHA 5AVCD 5E5AC 3AN2C 4NSWA 4WNNA 5CPKB 3KRWA 5JA4B 4X23A 3EPHA 5B0ZB 3UTBA 3B6GC 5LOPB 1BAKA 1P34B 4DX8A 2IO5C 1P3PD 1M1AD 5AVBD 1KX5D 2R0DA 4GMXB 1FB8A 1AWEA 3RELB 3AYWA 3MGSC 3FM8C 1P3LC 2DLWA 3TCAA 3AZJC 1GG3A 2BCJA 3LZ1A 2LY8A 1MIXA 5C5BB 2FJ7A 2MKRA 5AV8A 5D3XA 5CPKD 4J8WA 5B0ZD 2CRFA 3WKJC 3MGRC 1P34D 2XD1A 1UNQA 4R8PB 2COFA 2Z13A 5AVCC 1XKEA 3RELD 1WWSA 2GUMA 3ULBA 1WJMA 2KGXB 3HSAA 3HW2B 3C1BA 2BYMB 4CHMA 3MGPD 3C1CB 1P3PC 5AVBC 3A1KA 1X1GA 2Y2LA 4R8PD 3B0CT 5B40B 2N0YA 2L5AA 3AV2B 3X1VB 2PYOA 1BH8B 5CPKC 1MK7B 2Y2HA 2QKLA 3X1TB 5B0ZC 2M38A 1KZ7A 3X1SA 1NTVA 3TU4A 1H10A 1P34C 2MFQA 3REIA 3C1CD 3EPKA 4YS3B 3FVCA 1BTNA 4AWLB 3FSSA 3AZMB 5FUGB 3RELC 1U35A 5F99A 2YVCA 2HIOA 3D8EA 1BFMA 1WWIA 3OANA 2Y2PA 3MGQA 4H9SA 1XCGA 5DNMB 3X1VD 5CP6A 1NU2A 2AROA 3REKB 4CSRA 3X1TD 2AL6A 1M7RA 4HAYB 2F8NH 1M19B 4R8PC 2Z0OA 1V89A 4GOUA 3AZLA 1P3OB 5L81A 1XR0B 1P3IA 5KCVA 5KDMB 5BNXA 2Y2NA 1BH9A 3IP4C 3C1CC 3REKD 1I2HA 3NQUB 1U29A 3F6TA 1M19D 2F8NB 2N23A 3TFMA 5B40C 4E44A 3F0WA 4HB2B 1R4VA 5JRGA 3AV2C 4HAVB 3X1VC 4XZQB 3WAAD 4KHAB 1AOIB 3X1TC 1Q67A 4H9OB 3LELA 2PZ1A 5B32A 3LJUX 5BO0B 2J0JA 4YS3C 1P5TA 4AWLC 3AZMC 2F8ND 4UUZB 4HAUB 5AV5B 5GSUB 3A1IA 1NI2A 3W99B 1P3BB 2UZSA 5DNMC 1AOID 2DF4C 1J19A 3W96A 3REKC 2J0MA 5B31A 4Z5TD 1M19C 1W1DA 5B1LA 1P3OC 2LYDA 3AU4A 2I1KA 3AZNA 1WG7A 5AV5D 4OSNA 4NE3A 3NQJB 5GSUD 1P3GA 2BYKA 3W99D 1DYNA 1P3BD 4Z2NA 2KCJA 3WA9B 1ZC3B 3HIEA 1FHOA 4EO5B 5I2SA 4J8VD 1ISNA 2P0DA 3WTPB 3PP2A 4HHVA 2GS0A 2I5CA 5B24B 3AV1B 2HTHB 3M1IB 4XZQC 5CPJB 1AOIC 2OQBA 1U5FA 4QLCA 5AV9B 2FFFB 4HSIA 1TAFA 2DTCA 2F8NK 3AFAD 3P5JB 4H9QB 2KR0A 4J8XB 1P3FB 4YM6B 4JJNB 5AV5C 3V9RA 1KZGA 1KX3B 5GSUC 1P3KA 2G35A 1ZLAD 3W99C 1P3BC 5LG4B 1EQZB 5HE0A 5CPJD 3B6FA 2ELBA 2CWEA 3AZKD 5GT0A 5AV9D 4GMVA 2X18A 3AZHB 1MPHA 2Y2MA 5GXQB 4WNNB 1HQ3A 3PZDA 4J8XD 1P3FD 4X23B 4YM6D 4JJND 1K5GB 2Z14A 2DYQA 1KX3D 5JP4A 3UT9D 1EVHA 1PMSA 2KIEA 1EQZD 4F7HA 4WU9A 3WA9C 4ZRKA 4M6BA 3DXDA 4HB4B 3QIJA 4EO5C 3AZHD 2FJ7B 4DXAB 2L2IA 4NE6A 5AV8B 3WTPC 1UEFA 5GXQD 3X23A 1Q9CA 5B24C 5HE2A 2D10A 3AV1C 4X23D 5CPJC 5DH9B 3AJ4A 4KGCA 3RCPA 2MDXA 3W97A 3REHA 1S32B 5AV9C 5CPIB 2DX5A 2V76A 2J8PA 1FHXA 4J8XC 1P3FC 4YM6C 4JJNC 3C1BB 2FJ7D 1UNPA 3TVVA 5AV8D 1KX3C 1FOEA 1Y19B 4J8WD 2YT2A 4DRAA 1EQZC 2OTXA 4IOYX 5B2IB 3KXBA 2RSGA 3H0MC 1SHCA 1S32D 2HUEB 3AZHC
chains in the Genus database with same CATH topology
1TXDA 2MWNB 4UPKA 3A8PA 5GXQC 4GZUA 1P3MA 3PVWA 4DIXA 4X23C 5I2MA 3C1BD 3D8DA 3X1UA 3X1SB 3REIB 1QC6A 2EMTA 2E2XA 3GYOA 1U35B 1P3AA 2ADZA 5F99B 2IFSA 2J0KA 4DRBA 2K2JA 1TZYA 3KWQB 3WA0A 2FJ7C 2FJLA 5AV8C 2PYOD 1V5UA 1JFIA 2DFKA 2RVBB 5DHAB 3X1SD 2YFVA 3TU4D 2XD5A 1KU5A 3REID 5D3VA 1S32C 4K17A 5CPIC 1XD4A 2UWXA 2H7EA 3KUYA 4CSQA 1U35D 4Z66A 5F99D 5J3YA 2DYNA 2F8NG 2HIOD 4G91B 1P3IB 3VIAA 4WV4B 1M1AB 2R2YA 1KX5B 5BNXB 2YT0A 3C1BC 4CAYB 1BH9B 3LZ0A 2Z0PA 4KUDB 4P7IA 5B2IC 3AZFA 2QKMA 1WJ1A 2HUEC 5GT3A 1P3ID 1U5DA 2YRYA 3WTPE 1MIZB 2R09A 5AY8A 3LELB 3X1SC 2KIGA 2AEHA 3REIC 5FI0A 1UPRA 2D4QA 5EFXA 4KUDD 4G92B 4WSFA 1WVHA 4WJ3C 1X05A 1U35C 5F99C 4DQYB 3FEHA 3MGPB 2EJ8A 3KWQC 3LJAA 3AZEA 4NE5A 4H9SC 4B6HA 2CY5A 2JSSA 2K8EA 3KRXA 3LELD 5DI9B 2RNRB 5HE1A 1J0WA 5B1LB 3AU5A 2NZDA 5DHFB 1OMWA 1P3IC 4G91C 4HAZB 1M1AC 1KX5C 2LKOA 2G5IC 2M14A 2ELAA 4TYZA 3REJA 2YFWA 4KUDC 4GNKB 5B31D 1HTAA 4A6FA 1WGQA 5B1LD 1Y5OA 4DX90 4D6WA 5E5AA 3AN2A 2D9VA 4WZSB 3AZND 1H3OA 5KQ1A 3AZIB 4CHJA 5C79A 1PLSA 3LELC 1V5MA 3ODXA 1N3HA 5BS7C 4G92C 2LOZA 3MGSA 3A6NA 1P3LA 2VKIA 4D0NB 3ODOA 2YSZA 3MGPC 4A6HA 1N1JA 3KFUG 3B0CW 1P3KB 4CYEA 4WU8A 1AQCA 3AZID 4MY6A 2DQNC 1RJ2A 4QLCD 5GT0B 4EJNA 1ZYIA 3WAAB 3TW1A 4HDOA 5B1LC 1HQ3B 3R45A 3B0BA 1V5PA 4MT7A 1P3KD 2P0HA 4EKUA 1FGYA 4WU9B 5AVBA 4HATB 3B6FD 5GT0D 5B2JA 3O62A 4MK0A 5B1MA 3DXCA 3KY9A 1HQ3D 4QJ3B 5CPKA 4Z5TB 2I1JA 5B0ZA 1A7WA 3AZIC 5AV6A 4KGCB 2DA0A 3W97B 4WU9D 4PQ0A 2DHIA 4WJ7A 1I7AA 3TO1A 3ULCA 3F5RA 2BG1A 2P0FA 1WGUA 1P3KC 1XODA 3PSCA 2VRWB 2JCHA 2CAYA 4J8VB 1F66A 4LD9B 4KGCD 2J59M 3W97D 1SGHA 5GT0C 1EGXA 3MVDB 1MKEA 3WAAC 2LG1A 2NZ8B 1HQ3C 3MNNA 2BYMA 3AFAB 4WVFB 3H0LC 4WU9C 4XUJA 1X1FA 4YONA 2HE7A 4LD9D 1P3AB 5G49B 1ZLAB 5B40A 3ODWA 1TZYB 3MVDD 2YT1A 3KZ1A 4J8UB 3AV2A 3CXBB 1P3MD 3AZKB 1BH8A 4Z5TC 3IVFA 2W2XD 2Y8FA 1W1HA 5B33B 2EMSA 3X1UD 4KGCC 2RIQA 3W97C 4A6KA 4C0AA 3W98A 4YS3A 3KUYB 4ZRIA 3AZMA 4Z66B 1P3AD 3UT9B 1TZYD 4J8UD 3DXEA 5DNMA 1Z2CB 2LOXA 3UTAA 3LZ0B 1MAIA 5B33D 4J8VC 4LD9C 3A8QA 3AZFB 2YS3A 5B0YA 4F7UP 3MVDC 5GT3B 3UTBB 1P3OA 3KUYD 5FI1A 4L6EA 4Z66D 1KX4A 3SUZA 4H8SA 1ZVRA 4K2OA 2W2XC 2KUQA 5AY8B 3AYWB 3AFAC 4BBKA 2ZKMX 3LZ0D 4ZUXA 3LZ1B 2Y2JA 3AZFD 1P3AC 1ZLAC 4J8WB 1TZYC 1DDMA 5GT3D 3LJAB 4J8UC 3AZEB 2ROVA 3UTBD 5JHHA 3EPLA 2Q13A 4XZQA 3AZKC 4KHAA 1IRSA 2COAA 1AOIA 5B33C 5AY8D 4PNKA 1ID3A 3AYWD 2DKQA 4H9OA 2RLOA 4F7GA 5J3QA 4HAWB 3LZ1D 2GCLA 4Y94A 3KUYC 4Z66C 3UT9C 2I5FA 4UUZA 3LJAD 4KVGB 3AZED 4H9RA 5GSUA 2LULA 5DNNA 1P3BA 3WYFB 1MK9B 3LZ0C 2NMBA 3NWFA 3SV1A 4A6FB 2PYOB 3AZFC 2GJYA 5HE3A 2Y7BA 5GT3C 3UTBC 4H9NA 1H3OB 2NZDD 3TU4B 3G9WA 3U8ZA 3T06A 4KHBA 1DBHA 1LB1A 5AY8C 2K2UA 3AYWC 3REJD 3QBVB 1UNRA 2HIOB 3ZVRA 2NQBA 3LZ1C 3WA9A 3MGQB 3A6NB 4EMOA 2Y2KA 5BT1D 1KI1B 5CP6B 4J8WC 2AROB 2W8SA 4CSRB 3LJAC 3AZEC 3WTPA 5B24A 5M4YB 3AV1A 5IRSA 4WU8B 1W2EA 3AZLB 3CIKA 3VH5T 3AZGA 5LONB 2ZPYA 2NBVA 3MGQD 3MGSD 5D3YA 3QWMA 3A6ND 1P3LD 1K5DB 4J8XA 5CP6D 2AROD 1Z87A 4QJ5B 4H9PA 4WU8D 5CHLB 4HGAB 4DBBA 1M18A 3AZLD 1B55A 5JRGB 5B2JB 3O62B 5B1MB 5BT1C 2PYOC 4HB3B 3NWDA 3N7CA 1EAZA 5GXQA 4Z2MB 3TU4C 5B32B 2IYBA 3VH5W 1H4RA 4KHOA 5AV6B 1TJ6A 4NY0A 1V61A 2HIOC 1ZC4B 3MGQC 5JRGD 2DKPA 3A6NC 5B2JD 3O62D 5B1MD 5D27A 4OT1A 3KSYA 1F1EA 5CP6C 2AROC 3W96B 2CV5A 1P3RA 5B31B 5B32D 4WU8C 2D9WA 5AV6D 4HB0B 1F66B 3AZLC 2COCA 3PEGA 3SYXA 3P7ZA 3AZNB 2FJUB 1S32A 5KQ4A 3OHMB 5CPIA 1P3GB 2BYKB 2YS1A 5J3TA 2P8VA 3MNNB 3W96D 1DDWA 2ZY2A 4XUJB 5B2IA 1F66D 4HGAC 2D11A 5JRGC 5B2JC 3O62C 5B1MC 2F2AC 1P3GD 4QLCB 3B6GA 3MPXA 1ULYA 5JHGA 3PVUA 5B32C 3ML4A 3ZDTA 1TAFB 3MNND 3NW8A 5AV6C 1B67A 3H0RC 3BINA 3NWAA 3B0DB 3AZJA 3W98B 2UZRA 4XUJD 4GN1A 2JE5A 3V9RB 4GXBA 5B40D 3KWQA 2D9XA 1OQNA 3AV2D 3B6FB 3W96C 3WKJA 4L1RA 3MGRA 5B31C 3UTAB 2RVQD 5AVCA 1F66C 5JLJB 3PG7A 5B0YB 3AZNC 4TKNA 2DX1A 3W98D 4YS3D 4A5KA 3AZMD 1KX4B 1P3GC 1GC7A 4XWXA 1P3PA 2G5HC 1M1AA 1KX5A 5BNVA 3MNNC 1B6WA 4CAYA 5DNMD 2L1CA 3UTAD 4ZUXB 4KUDA 1FAOA 4XUJC 2VSZA 5B0YD 3SO6A 3VH6A 2VQRA 5JA4A 1P3OD 1ZM0A 1KX4D 5CLQB 4QLCC 2DHKA 1P34A 3REHB 3VH5A 2Y8GA 2RVQC 1ID3B 1FHWA 2ROZB 3RELA 4ZUXD 5BS7A 3B0DC 1E5WA 3W98C 1DDVA 5D3WA 1X11A 5C5BA 3UZTA 1BTKA 3MGPA 1ZSQA 4KAXB 4H9RB 3KXBB 5C6RA 3B6FC 5DNNB 2CY4A 3PVLA 3HQCA 4XZQD 3REHD 3UTAC 4R8PA 5C3IB 5C16A 2Z59A 1ID3D 1U27A 1TQZA 1P3MB 5B0YC 4NFTA 3X1UB 4H9NB 1KX4C 3V5WA 3C1CA 4KHBB 1DROA 1UPQA 3P6AA 3KXBD 5DNND 4GPTB 3A98B 4ZUXC 2NQBB 4HDQA 1JFIB 3X1VA 4QXAB 1M7EA 3X1TA 2Y2GA 2K49A 2YFVB 1FGZA 3VOQA 4YL8A 3REHC 3AZIA 1ID3C 3GYPA 5FUGA 3AZGB 2NQBD 2Y2QA 5GOWB 3WA9D 3NSUA 3EPJA 1BWNA 1QQGA 1W1GA 2W2WA 2YF0A 3WTPD 3REKA 3EG5B 3KXBC 5B24D 1NTYA 5DNNC 4H9PB 3AV1D 4Z2MG 1M19A 5B32G 4ZBJB 5C3IC 1M18B 1V88A 3AZGD 1P3MC 3WAAA 1PZRA 3SNHA 5KDMA 1RRPB 4K2PA 2GCJA 3X1UC 1GC6A 1P6SA 2D9ZA 2YS5A 2DHJA 2Z4DA 3NQUA 5B31G 2F8NA 2NQBC 1M18D 1U5EA 4QJ4B 2JP2A 2H7DA 2ZY4A 3AL0C 2ZY3A 1PFJA 2CV5B 4Z5TA 4E45A 4HAXB 5BO0A 3D8FA 2RRFA 2Z0QA 2NZDB 3AZGC 2RGNB 5AV5A 3W99A 2D2QA 3REJB 4ZRJA 2UVMA 2EC1A 1XX0A 2YFWB 2CV5D 2Y2IA 4ZBJC 4J8VA 2XQNM 1M18C 4LD9A 5E5AB 3AN2B 1LW3A 3MVDA 3A58A 5CPID 3FDDA 3NQJA 3B6GB 2ZM5A 2IO5B 4K81A 2RUKB 3U12A 1T3UA 2ZY5A 3AFAA 3MGSB 1EF1A 1P3LB 3AZJB 5B2ID 1N1JB 5DIFB 5E5AD 3AN2D 2CODA 3MDBC 1U2BA 3VH6T 5G49A 1ZLAA 2Y2OA 1OY2A 4J8UA 5CPJA 3B6GD 2CV5C 3WKJB 1U5GA 3MGRB 2D9YA 3AZKA 5AV9A 4IAPA 2KUPA 5B33A 5AVCB 1X86A 4Z2MH 3BJIA 4H9QA 2NZDC 3AZJD 3R45B 1P3FA 4YM6A 2DN6A 3HK0A 4JJNA 1KX3A 3UT9A 1P3PB 3REJC 1EQZA 5AVBB 2K00A 4IFSA 3KWQD 5BNVB 1WI1A 3WKJD 3U7DA 3MGRD 5CLLB 3O96A 3VH6W 3AZHA 5AVCD 5E5AC 3AN2C 4NSWA 4WNNA 5CPKB 3KRWA 5JA4B 4X23A 3EPHA 5B0ZB 3UTBA 3B6GC 5LOPB 1BAKA 1P34B 4DX8A 2IO5C 1P3PD 1M1AD 5AVBD 1KX5D 2R0DA 4GMXB 1FB8A 1AWEA 3RELB 3AYWA 3MGSC 3FM8C 1P3LC 2DLWA 3TCAA 3AZJC 1GG3A 2BCJA 3LZ1A 2LY8A 1MIXA 5C5BB 2FJ7A 2MKRA 5AV8A 5D3XA 5CPKD 4J8WA 5B0ZD 2CRFA 3WKJC 3MGRC 1P34D 2XD1A 1UNQA 4R8PB 2COFA 2Z13A 5AVCC 1XKEA 3RELD 1WWSA 2GUMA 3ULBA 1WJMA 2KGXB 3HW2B 3C1BA 2BYMB 4CHMA 3MGPD 3C1CB 1P3PC 5AVBC 3A1KA 1X1GA 2Y2LA 4R8PD 3B0CT 5B40B 2N0YA 2L5AA 3AV2B 3X1VB 2PYOA 1BH8B 5CPKC 1MK7B 2Y2HA 2QKLA 3X1TB 5B0ZC 2M38A 1KZ7A 3X1SA 1NTVA 3TU4A 1H10A 1P34C 2MFQA 3REIA 3C1CD 3EPKA 4YS3B 3FVCA 1BTNA 4AWLB 3FSSA 3AZMB 5FUGB 3RELC 1U35A 5F99A 2YVCA 2HIOA 3D8EA 1BFMA 1WWIA 3OANA 2Y2PA 3MGQA 4H9SA 1XCGA 5DNMB 3X1VD 5CP6A 1NU2A 2AROA 3REKB 4CSRA 3X1TD 2AL6A 1M7RA 4HAYB 2F8NH 1M19B 4R8PC 2Z0OA 1V89A 4GOUA 3AZLA 1P3OB 5L81A 1XR0B 1P3IA 5KCVA 5KDMB 5BNXA 2Y2NA 1BH9A 3IP4C 3C1CC 3REKD 1I2HA 3NQUB 1U29A 3F6TA 1M19D 2F8NB 2N23A 3TFMA 5B40C 4E44A 3F0WA 4HB2B 1R4VA 5JRGA 3AV2C 4HAVB 3X1VC 4XZQB 3WAAD 4KHAB 1AOIB 3X1TC 1Q67A 4H9OB 3LELA 2PZ1A 5B32A 3LJUX 5BO0B 2J0JA 4YS3C 1P5TA 4AWLC 3AZMC 2F8ND 4UUZB 4HAUB 5AV5B 5GSUB 3A1IA 1NI2A 3W99B 1P3BB 2UZSA 5DNMC 1AOID 2DF4C 1J19A 3W96A 3REKC 2J0MA 5B31A 4Z5TD 1M19C 1W1DA 5B1LA 1P3OC 2LYDA 3AU4A 2I1KA 3AZNA 1WG7A 5AV5D 4OSNA 4NE3A 3NQJB 5GSUD 1P3GA 2BYKA 3W99D 1DYNA 1P3BD 4Z2NA 2KCJA 3WA9B 1ZC3B 3HIEA 1FHOA 4EO5B 5I2SA 4J8VD 1ISNA 2P0DA 3WTPB 3PP2A 4HHVA 2GS0A 2I5CA 5B24B 3AV1B 2HTHB 3M1IB 4XZQC 5CPJB 1AOIC 2OQBA 1U5FA 4QLCA 5AV9B 2FFFB 4HSIA 1TAFA 2DTCA 2F8NK 3AFAD 3P5JB 4H9QB 2KR0A 4J8XB 1P3FB 4YM6B 4JJNB 5AV5C 3V9RA 1KZGA 1KX3B 5GSUC 1P3KA 2G35A 1ZLAD 3W99C 1P3BC 5LG4B 1EQZB 5HE0A 5CPJD 3B6FA 2ELBA 2CWEA 3AZKD 5GT0A 5AV9D 4GMVA 2X18A 3AZHB 1MPHA 2Y2MA 5GXQB 4WNNB 1HQ3A 3PZDA 4J8XD 1P3FD 4X23B 4YM6D 4JJND 1K5GB 2Z14A 2DYQA 1KX3D 5JP4A 3UT9D 1EVHA 1PMSA 2KIEA 1EQZD 4F7HA 4WU9A 3WA9C 4ZRKA 4M6BA 3DXDA 4HB4B 3QIJA 4EO5C 3AZHD 2FJ7B 4DXAB 2L2IA 4NE6A 5AV8B 3WTPC 1UEFA 5GXQD 3X23A 1Q9CA 5B24C 5HE2A 2D10A 3AV1C 4X23D 5CPJC 5DH9B 3AJ4A 4KGCA 3RCPA 2MDXA 3W97A 3REHA 1S32B 5AV9C 5CPIB 2DX5A 2V76A 2J8PA 1FHXA 4J8XC 1P3FC 4YM6C 4JJNC 3C1BB 2FJ7D 1UNPA 3TVVA 5AV8D 1KX3C 1FOEA 1Y19B 4J8WD 2YT2A 4DRAA 1EQZC 2OTXA 4IOYX 5B2IB 3KXBA 2RSGA 3H0MC 1SHCA 1S32D 2HUEB 3AZHC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5BNV A;  3MNN C;  1TXD A;  4C0A A;  4J8W A;  2MWN B;  1B6W A;  4CAY A;  5DNM D;  3W98 A;  3A8P A;  5GXQ C;  2L1C A;  3UTA D;  4GZU A;  5B0Z D;  4YS3 A;  1P3M A;  4ZUX B;  2CRF A;  3KUY B;  4ZRI A;  3PVW A;  3AZM A;  3WKJ C;  4Z66 B;  4X23 C;  1P3A D;  3MGR C;  4KUD A;  1P34 D;  1FAO A;  3UT9 B;  1UNQ A;  3C1B D;  4R8P B;  4XUJ C;  3D8D A;  2COF A;  3X1U A;  1TZY D;  3X1S B;  2VSZ A;  4J8U D;  5B0Y D;  3SO6 A;  3REI B;  1QC6 A;  2EMT A;  5AVC C;  1XKE A;  3DXE A;  3VH6 A;  3REL D;  2E2X A;  1WWS A;  5JA4 A;  5DNM A;  2LOX A;  3ULB A;  1P3O D;  1WJM A;  3UTA A;  1ZM0 A;  3LZ0 B;  3GYO A;  1MAI A;  1KX4 D;  2KGX B;  5CLQ B;  4QLC C;  1U35 B;  5B33 D;  2DHK A;  1P3A A;  2ADZ A;  5F99 B;  2IFS A;  2J0K A;  1P34 A;  4J8V C;  3HW2 B;  3REH B;  3C1B A;  2BYM B;  4DRB A;  3VH5 A;  4LD9 C;  2K2J A;  1TZY A;  3A8Q A;  3TVV A;  2Y8G A;  3KWQ B;  3AZF B;  2YS3 A;  5B0Y A;  3WA0 A;  4CHM A;  2RVQ C;  1ID3 B;  2FJ7 C;  3MGP D;  3C1C B;  1P3P C;  1FHW A;  2FJL A;  4F7U P;  3MVD C;  5AVB C;  5AV8 C;  2ROZ B;  5GT3 B;  3REL A;  2PYO D;  1V5U A;  1JFI A;  4ZUX D;  3UTB B;  1P3O A;  3KUY D;  5BS7 A;  5FI1 A;  1X1G A;  3B0D C;  1E5W A;  4Z66 D;  1KX4 A;  2DFK A;  4L6E A;  3W98 C;  2RVB B;  5DHA B;  1DDV A;  5D3W A;  4R8P D;  3SUZ A;  1X11 A;  5C5B A;  3B0C T;  5B40 B;  3X1S D;  4H8S A;  2YFV A;  3TU4 D;  1BTK A;  1ZVR A;  4K2O A;  2N0Y A;  2W2X C;  2L5A A;  3UZT A;  1KU5 A;  3REI D;  5AY8 B;  5D3V A;  3AV2 B;  3MGP A;  1S32 C;  1ZSQ A;  4KAX B;  3AYW B;  3AFA C;  4BBK A;  4K17 A;  4H9R B;  5CPI C;  3X1V B;  2PYO A;  1XD4 A;  3LZ0 D;  1BH8 B;  4ZUX A;  3KXB B;  5CPK C;  1MK7 B;  3KUY A;  2H7E A;  5C6R A;  3B6F C;  5DNN B;  2CY4 A;  3LZ1 B;  1U35 D;  2QKL A;  4Z66 A;  3PVL A;  5F99 D;  5J3Y A;  2DYN A;  3HQC A;  4XZQ D;  3REH D;  3UTA C;  5B0Z C;  2HIO D;  4G91 B;  4R8P A;  3X1T B;  5C3I B;  1P3I B;  4WV4 B;  2F8N G;  1KZ7 A;  2M38 A;  3X1S A;  1M1A B;  1NTV A;  3TU4 A;  1H10 A;  3AZF D;  1P3A C;  1KX5 B;  5BNX B;  5C16 A;  1P34 C;  1ZLA C;  2MFQ A;  3REI A;  1ID3 D;  3C1B C;  2YT0 A;  3C1C D;  4J8W B;  1U27 A;  1TZY C;  1DDM A;  4CAY B;  1BH9 B;  5GT3 D;  1TQZ A;  3LJA B;  4J8U C;  4YS3 B;  3AZE B;  5B0Y C;  1P3M B;  1BTN A;  3UTB D;  2ROV A;  4AWL B;  3LZ0 A;  3FSS A;  3AZM B;  5JHH A;  2Z0P A;  4NFT A;  5FUG B;  4KUD B;  3REL C;  1U35 A;  4P7I A;  5F99 A;  2Q13 A;  5B2I C;  4XZQ A;  2YVC A;  3X1U B;  4H9N B;  2HIO A;  4KHA A;  3AZK C;  1IRS A;  2COA A;  3D8E A;  1AOI A;  1KX4 C;  1BFM A;  1WWI A;  5B33 C;  3AZF A;  5AY8 D;  3OAN A;  3V5W A;  4PNK A;  3MGQ A;  1ID3 A;  4H9S A;  3C1C A;  2QKM A;  4KHB B;  3AYW D;  2DKQ A;  4H9O A;  1XCG A;  2RLO A;  1WJ1 A;  5DNM B;  2HUE C;  5GT3 A;  3X1V D;  4F7G A;  1UPQ A;  3P6A A;  1DRO A;  5J3Q A;  3KXB D;  4HAW B;  5DNN D;  5CP6 A;  1NU2 A;  4GPT B;  3LZ1 D;  3A98 B;  2ARO A;  2GCL A;  3REK B;  4CSR A;  4Y94 A;  3X1T D;  1P3I D;  2AL6 A;  4ZUX C;  1M7R A;  3KUY C;  2NQB B;  1U5D A;  4HDQ A;  4HAY B;  4Z66 C;  2F8N H;  2YRY A;  1M19 B;  3UT9 C;  3WTP E;  1MIZ B;  2I5F A;  2R09 A;  5AY8 A;  4R8P C;  4UUZ A;  2Z0O A;  3LEL B;  3X1S C;  1V89 A;  3LJA D;  1JFI B;  3AZE D;  4H9R A;  4KVG B;  3X1V A;  3AZL A;  5GSU A;  3REI C;  1P3O B;  1UPR A;  2AEH A;  2D4Q A;  5FI0 A;  2LUL A;  5EFX A;  4KUD D;  5DNN A;  4G92 B;  1P3B A;  3WYF B;  1M7E A;  4WSF A;  1MK9 B;  5L81 A;  3X1T A;  1XR0 B;  1P3I A;  3LZ0 C;  2YFV B;  1WVH A;  5KCV A;  5KDM B;  1FGZ A;  1X05 A;  2NMB A;  3VOQ A;  1U35 C;  4YL8 A;  5F99 C;  5BNX A;  3REH C;  3FEH A;  3MGP B;  3SV1 A;  2EJ8 A;  1BH9 A;  3AZI A;  4A6F B;  2PYO B;  3KWQ C;  3LJA A;  3AZF C;  2GJY A;  3AZE A;  4NE5 A;  1ID3 C;  3GYP A;  4H9S C;  3C1C C;  5HE3 A;  5FUG A;  4B6H A;  2Y7B A;  5GT3 C;  3REK D;  3AZG B;  2CY5 A;  1I2H A;  3UTB C;  4H9N A;  2NQB D;  3NQU B;  1H3O B;  2JSS A;  3TU4 B;  2NZD D;  1U29 A;  5GOW B;  3WA9 D;  1M19 D;  3G9W A;  2F8N B;  3KRX A;  3NSU A;  2N23 A;  3TFM A;  5B40 C;  3LEL D;  3U8Z A;  3T06 A;  5DI9 B;  1DBH A;  1BWN A;  4E44 A;  1QQG A;  1LB1 A;  1W1G A;  2RNR B;  2W2W A;  3F0W A;  5AY8 C;  2K2U A;  2YF0 A;  4HB2 B;  1R4V A;  5JRG A;  3AV2 C;  5HE1 A;  4HAV B;  1J0W A;  3AYW C;  3REJ D;  5B1L B;  3WTP D;  3REK A;  3X1V C;  3QBV B;  4XZQ B;  3WAA D;  1UNR A;  2HIO B;  4KHA B;  3ZVR A;  3KXB C;  5B24 D;  1NTY A;  1AOI B;  2NQB A;  5DNN C;  4H9P B;  3LZ1 C;  3AU5 A;  3AV1 D;  4Z2M G;  2NZD A;  5DHF B;  3WA9 A;  1M19 A;  3IVF A;  5B32 G;  3MGQ B;  4ZBJ B;  1OMW A;  3X1T C;  1P3I C;  4G91 C;  3A6N B;  1Q67 A;  5C3I C;  4HAZ B;  4H9O B;  3LEL A;  1M1A C;  2PZ1 A;  4EMO A;  1M18 B;  5BT1 D;  5B32 A;  1KX5 C;  2LKO A;  1KI1 B;  5CP6 B;  4J8W C;  3LJU X;  1V88 A;  2M14 A;  2ELA A;  2ARO B;  5BO0 B;  2J0J A;  4TYZ A;  3AZG D;  3REJ A;  4CSR B;  3LJA C;  4YS3 C;  3AZE C;  3WTP A;  1P3M C;  1P5T A;  3WAA A;  4AWL C;  2YFW A;  3AZM C;  5B24 A;  3SNH A;  5KDM A;  4KUD C;  2F8N D;  3AV1 A;  1RRP B;  4K2P A;  2GCJ A;  4UUZ B;  4WU8 B;  5B31 D;  3X1U C;  4HAU B;  5AV5 B;  1GC6 A;  1P6S A;  2D9Z A;  1HTA A;  4A6F A;  3AZL B;  5GSU B;  3CIK A;  3VH5 T;  1WGQ A;  1NI2 A;  3W99 B;  2YS5 A;  1P3B B;  2UZS A;  5B1L D;  5DNM C;  3AZG A;  1Y5O A;  4DX9 0;  2DHJ A;  2ZPY A;  5LON B;  5E5A A;  3AN2 A;  2D9V A;  1AOI D;  4WZS B;  3NQU A;  5B31 G;  1H3O A;  3AZN D;  1J19 A;  3W96 A;  3MGQ D;  3REK C;  2F8N A;  2J0M A;  3MGS D;  5D3Y A;  5KQ1 A;  3QWM A;  3A6N D;  5B31 A;  1P3L D;  2NQB C;  1K5D B;  3AZI B;  1M18 D;  1U5E A;  4CHJ A;  4Z5T D;  1M19 C;  1EGX A;  4J8X A;  1W1D A;  5C79 A;  2JP2 A;  5CP6 D;  1PLS A;  3LEL C;  2ARO D;  1V5M A;  2H7D A;  1Z87 A;  5B1L A;  1P3O C;  1N3H A;  2LYD A;  3ODX A;  3AU4 A;  5BS7 C;  2I1K A;  1PFJ A;  3AZN A;  4H9P A;  4G92 C;  2LOZ A;  2CV5 B;  1WG7 A;  4WU8 D;  3MGS A;  5AV5 D;  5CHL B;  3A6N A;  1P3L A;  4HGA B;  3NQJ B;  4NE3 A;  1M18 A;  2VKI A;  3ODO A;  3AZL D;  5GSU D;  4DBB A;  4D0N B;  4Z5T A;  2YSZ A;  1P3G A;  2BYK A;  1B55 A;  5JRG B;  4E45 A;  3W99 D;  3MGP C;  1DYN A;  4HAX B;  1P3B D;  5B2J B;  4Z2N A;  4A6H A;  5BO0 A;  3O62 B;  2KCJ A;  1N1J A;  3D8F A;  5B1M B;  5BT1 C;  2PYO C;  4HB3 B;  3B0C W;  1P3K B;  4CYE A;  2Z0Q A;  2NZD B;  3N7C A;  3WA9 B;  3AZG C;  1ZC3 B;  2RGN B;  3TCA A;  1EAZ A;  5GXQ A;  4WU8 A;  1FHO A;  5AV5 A;  1AQC A;  3AZI D;  4Z2M B;  3TU4 C;  4MY6 A;  5B32 B;  1RJ2 A;  2IYB A;  4QLC D;  3VH5 W;  4EO5 B;  1H4R A;  4J8V D;  3W99 A;  4KHO A;  5GT0 B;  1ISN A;  2D2Q A;  5AV6 B;  3REJ B;  2P0D A;  4ZRJ A;  4EJN A;  3WTP B;  3PP2 A;  2UVM A;  2EC1 A;  1TJ6 A;  4HHV A;  3WAA B;  1XX0 A;  2YFW B;  2GS0 A;  2I5C A;  4NY0 A;  5B24 B;  3TW1 A;  4HDO A;  3AV1 B;  1V61 A;  2CV5 D;  5B1L C;  2HTH B;  3M1I B;  4XZQ C;  2HIO C;  5CPJ B;  1AOI C;  1HQ3 B;  2OQB A;  1ZC4 B;  3R45 A;  3MGQ C;  4QLC A;  1U5F A;  4ZBJ C;  5JRG D;  2DKP A;  3B0B A;  3A6N C;  1V5P A;  4J8V A;  5B2J D;  4MT7 A;  2XQN M;  3O62 D;  1M18 C;  5B1M D;  5AV9 B;  4LD9 A;  5E5A B;  1P3K D;  3AN2 B;  1LW3 A;  5D27 A;  2P0H A;  3KSY A;  1F1E A;  5CP6 C;  2ARO C;  1TAF A;  4EKU A;  3W96 B;  2DTC A;  2F8N K;  3AFA D;  2CV5 A;  1FGY A;  3MVD A;  5AVB A;  4WU9 B;  5CPI D;  1P3R A;  5B31 B;  4H9Q B;  4HAT B;  5B32 D;  3B6F D;  3NQJ A;  4J8X B;  3B6G B;  1P3F B;  4YM6 B;  4WU8 C;  4JJN B;  5AV5 C;  5GT0 D;  2IO5 B;  2D9W A;  5B2J A;  5AV6 D;  4HB0 B;  3O62 A;  1F66 B;  3V9R A;  1KZG A;  4K81 A;  5B1M A;  3AZL C;  5GSU C;  1KX3 B;  2COC A;  1P3K A;  2RUK B;  3PEG A;  3SYX A;  2G35 A;  1ZLA D;  3W99 C;  3P7Z A;  3AZN B;  1P3B C;  3DXC A;  1EQZ B;  1S32 A;  5KQ4 A;  3KY9 A;  5HE0 A;  3AFA A;  3MGS B;  1EF1 A;  5CPI A;  5CPJ D;  1P3L B;  1HQ3 D;  5CPK A;  3AZJ B;  4Z5T B;  3B6F A;  1P3G B;  2ELB A;  2BYK B;  2I1J A;  2CWE A;  5B2I D;  2YS1 A;  5B0Z A;  1A7W A;  3AZK D;  1N1J B;  5GT0 A;  3AZI C;  5AV9 D;  5AV6 A;  4GMV A;  5DIF B;  5E5A D;  5J3T A;  3AN2 D;  4KGC B;  2DA0 A;  2COD A;  2X18 A;  3MDB C;  1U2B A;  2P8V A;  3VH6 T;  3AZH B;  3W97 B;  5G49 A;  1ZLA A;  3MNN B;  3W96 D;  1MPH A;  4WU9 D;  5GXQ B;  1OY2 A;  4J8U A;  4WNN B;  5CPJ A;  1DDW A;  1HQ3 A;  3PZD A;  4PQ0 A;  5JLJ B;  4J8X D;  3B6G D;  2CV5 C;  3WKJ B;  1P3F D;  4X23 B;  1U5G A;  3MGR B;  4YM6 D;  2DHI A;  4MK0 A;  4WJ7 A;  4JJN D;  2D9Y A;  4XUJ B;  1K5G B;  5B2I A;  1F66 D;  4HGA C;  3AZK A;  2DYQ A;  1I7A A;  3TO1 A;  1KX3 D;  5AV9 A;  4IAP A;  2D11 A;  5JP4 A;  2KUP A;  3ULC A;  3UT9 D;  5JRG C;  5B33 A;  3F5R A;  1EVH A;  1PMS A;  5B2J C;  5AVC B;  3O62 C;  1EQZ D;  1X86 A;  4F7H A;  5B1M C;  2P0F A;  1WGU A;  1P3K C;  4WU9 A;  1XOD A;  4Z2M H;  3BJI A;  4H9Q A;  2NZD C;  3PSC A;  3AZJ D;  3WA9 C;  4ZRK A;  3R45 B;  1P3G D;  4QLC B;  2VRW B;  3B6G A;  3MPX A;  1P3F A;  1ULY A;  4M6B A;  2CAY A;  4YM6 A;  2DN6 A;  4J8V B;  3HK0 A;  4JJN A;  3DXD A;  5JHG A;  4HB4 B;  3PVU A;  1F66 A;  5B32 C;  4LD9 B;  3QIJ A;  3ML4 A;  4KGC D;  1KX3 A;  4EO5 C;  3AZH D;  3W97 D;  1SGH A;  2J59 M;  3UT9 A;  3ZDT A;  2FJ7 B;  1TAF B;  5GT0 C;  3MNN D;  2L2I A;  1P3P B;  5AV6 C;  3REJ C;  4DXA B;  1EQZ A;  3MVD B;  4NE6 A;  5AV8 B;  5AVB B;  3WTP C;  5GXQ D;  1B67 A;  3WAA C;  3KWQ D;  1MKE A;  1UEF A;  2K00 A;  3BIN A;  1Q9C A;  4IFS A;  3X23 A;  5B24 C;  5BNV B;  1WI1 A;  5HE2 A;  2D10 A;  3AV1 C;  3B0D B;  3WKJ D;  3AZJ A;  4X23 D;  2LG1 A;  3MGR D;  3W98 B;  3U7D A;  2UZR A;  2NZ8 B;  4XUJ D;  4GN1 A;  5CPJ C;  1HQ3 C;  5DH9 B;  3AJ4 A;  3V9R B;  5CLL B;  3O96 A;  3VH6 W;  4KGC A;  4GXB A;  3RCP A;  2MDX A;  3AZH A;  3W97 A;  5AVC D;  3REH A;  5B40 D;  3MNN A;  1S32 B;  2BYM A;  5AV9 C;  3AFA B;  5E5A C;  3AN2 C;  5CPI B;  4WVF B;  3KWQ A;  2D9X A;  1OQN A;  2DX5 A;  4NSW A;  4WNN A;  5CPK B;  3AV2 D;  3B6F B;  3W96 C;  3KRW A;  3WKJ A;  5JA4 B;  4X23 A;  4WU9 C;  3MGR A;  5B31 C;  3UTA B;  5B0Z B;  4XUJ A;  1X1F A;  2V76 A;  3UTB A;  4YON A;  2HE7 A;  4LD9 D;  1FHX A;  4J8X C;  3B6G C;  5LOP B;  1P3A B;  1P3F C;  1BAK A;  4YM6 C;  1P34 B;  5G49 B;  1ZLA B;  2RVQ D;  4DX8 A;  4JJN C;  3C1B B;  2FJ7 D;  2IO5 C;  1P3P D;  5AVC A;  1UNP A;  5B40 A;  1F66 C;  1TZY B;  3MVD D;  5AVB D;  5AV8 D;  1M1A D;  1KX3 C;  2YT1 A;  3ODW A;  3KZ1 A;  3PG7 A;  4J8U B;  1KX5 D;  2R0D A;  5B0Y B;  1FOE A;  3VIA A;  1Y19 B;  3AZN C;  4GMX B;  4J8W D;  1FB8 A;  4TKN A;  1AWE A;  3AV2 A;  4DRA A;  1EQZ C;  2DX1 A;  3CXB B;  2OTX A;  3W98 D;  3REL B;  3AYW A;  3MGS C;  4IOY X;  4YS3 D;  1P3M D;  4A5K A;  3FM8 C;  5B2I B;  1P3L C;  2DLW A;  3AZK B;  1BH8 A;  3KXB A;  3AZM D;  2RSG A;  3AZJ C;  4Z5T C;  1KX4 B;  1P3G C;  1GG3 A;  2BCJ A;  3LZ1 A;  1W1H A;  5B33 B;  2W2X D;  2LY8 A;  2Y8F A;  2EMS A;  1GC7 A;  1MIX A;  3X1U D;  1SHC A;  2FJ7 A;  5C5B B;  1S32 D;  4XWX A;  1P3P A;  2MKR A;  1M1A A;  5AV8 A;  4KGC C;  2HUE B;  5D3X A;  1KX5 A;  3AZH C;  3W97 C;  5CPK D;  4A6K A; 
#chains in the Genus database with same CATH topology
 1TXD A;  2MWN B;  4UPK A;  3A8P A;  5GXQ C;  4GZU A;  1P3M A;  3PVW A;  4DIX A;  4X23 C;  5I2M A;  3C1B D;  3D8D A;  3X1U A;  3X1S B;  3REI B;  1QC6 A;  2EMT A;  2E2X A;  3GYO A;  1U35 B;  1P3A A;  2ADZ A;  5F99 B;  2IFS A;  2J0K A;  4DRB A;  2K2J A;  1TZY A;  3KWQ B;  3WA0 A;  2FJ7 C;  2FJL A;  5AV8 C;  2PYO D;  1V5U A;  1JFI A;  2DFK A;  2RVB B;  5DHA B;  3X1S D;  2YFV A;  3TU4 D;  2XD5 A;  1KU5 A;  3REI D;  5D3V A;  1S32 C;  4K17 A;  5CPI C;  1XD4 A;  2UWX A;  2H7E A;  3KUY A;  4CSQ A;  1U35 D;  4Z66 A;  5F99 D;  5J3Y A;  2DYN A;  2F8N G;  2HIO D;  4G91 B;  1P3I B;  3VIA A;  4WV4 B;  1M1A B;  2R2Y A;  1KX5 B;  5BNX B;  2YT0 A;  3C1B C;  4CAY B;  1BH9 B;  3LZ0 A;  2Z0P A;  4KUD B;  4P7I A;  5B2I C;  3AZF A;  2QKM A;  1WJ1 A;  2HUE C;  5GT3 A;  1P3I D;  1U5D A;  2YRY A;  3WTP E;  1MIZ B;  2R09 A;  5AY8 A;  3LEL B;  3X1S C;  2KIG A;  2AEH A;  3REI C;  5FI0 A;  1UPR A;  2D4Q A;  5EFX A;  4KUD D;  4G92 B;  4WSF A;  1WVH A;  4WJ3 C;  1X05 A;  1U35 C;  5F99 C;  4DQY B;  3FEH A;  3MGP B;  2EJ8 A;  3KWQ C;  3LJA A;  3AZE A;  4NE5 A;  4H9S C;  4B6H A;  2CY5 A;  2JSS A;  2K8E A;  3KRX A;  3LEL D;  5DI9 B;  2RNR B;  5HE1 A;  1J0W A;  5B1L B;  3AU5 A;  2NZD A;  5DHF B;  1OMW A;  1P3I C;  4G91 C;  4HAZ B;  1M1A C;  1KX5 C;  2LKO A;  2G5I C;  2M14 A;  2ELA A;  4TYZ A;  3REJ A;  2YFW A;  4KUD C;  4GNK B;  5B31 D;  1T77 A;  1HTA A;  4A6F A;  1WGQ A;  5B1L D;  1Y5O A;  4DX9 0;  4D6W A;  5E5A A;  3AN2 A;  2D9V A;  4WZS B;  3AZN D;  1H3O A;  5KQ1 A;  3AZI B;  4CHJ A;  5C79 A;  1PLS A;  3LEL C;  1V5M A;  3ODX A;  1N3H A;  5BS7 C;  4G92 C;  2LOZ A;  3MGS A;  3A6N A;  1P3L A;  2VKI A;  4D0N B;  3ODO A;  2YSZ A;  3MGP C;  4A6H A;  1N1J A;  3KFU G;  3B0C W;  1P3K B;  4CYE A;  4WU8 A;  1AQC A;  3AZI D;  4MY6 A;  2DQN C;  1RJ2 A;  4QLC D;  5GT0 B;  4EJN A;  1ZYI A;  3WAA B;  3TW1 A;  4HDO A;  5B1L C;  1HQ3 B;  3R45 A;  3B0B A;  1V5P A;  4MT7 A;  1P3K D;  2P0H A;  4EKU A;  1FGY A;  4WU9 B;  5AVB A;  4HAT B;  3B6F D;  5GT0 D;  5B2J A;  3O62 A;  4MK0 A;  5B1M A;  3DXC A;  3KY9 A;  1HQ3 D;  4QJ3 B;  5CPK A;  4Z5T B;  2I1J A;  5B0Z A;  1A7W A;  3AZI C;  5AV6 A;  4KGC B;  2DA0 A;  3W97 B;  4WU9 D;  4PQ0 A;  2DHI A;  4WJ7 A;  1I7A A;  3TO1 A;  3ULC A;  3F5R A;  2BG1 A;  2P0F A;  1WGU A;  1P3K C;  1XOD A;  3PSC A;  2VRW B;  2JCH A;  2CAY A;  4J8V B;  1F66 A;  4LD9 B;  4KGC D;  2J59 M;  3W97 D;  1SGH A;  5GT0 C;  3B77 A;  1EGX A;  3MVD B;  1MKE A;  3WAA C;  2LG1 A;  2NZ8 B;  1HQ3 C;  3MNN A;  2BYM A;  3AFA B;  4WVF B;  3H0L C;  4WU9 C;  4XUJ A;  1X1F A;  4YON A;  2HE7 A;  4LD9 D;  1P3A B;  5G49 B;  1ZLA B;  5B40 A;  3ODW A;  1TZY B;  3MVD D;  2YT1 A;  3KZ1 A;  4J8U B;  3AV2 A;  3CXB B;  1P3M D;  3AZK B;  1BH8 A;  4Z5T C;  3IVF A;  2W2X D;  2Y8F A;  1W1H A;  5B33 B;  2EMS A;  3X1U D;  4KGC C;  2RIQ A;  3W97 C;  4A6K A;  4C0A A;  3W98 A;  4YS3 A;  3KUY B;  4ZRI A;  3AZM A;  4Z66 B;  1P3A D;  3UT9 B;  1TZY D;  4J8U D;  3DXE A;  5DNM A;  1Z2C B;  2LOX A;  3UTA A;  3LZ0 B;  1MAI A;  5B33 D;  4J8V C;  4LD9 C;  3A8Q A;  3AZF B;  2YS3 A;  5B0Y A;  4F7U P;  3MVD C;  5GT3 B;  3UTB B;  1P3O A;  3KUY D;  5FI1 A;  4L6E A;  4Z66 D;  1KX4 A;  3SUZ A;  4H8S A;  1ZVR A;  4K2O A;  2W2X C;  2KUQ A;  5AY8 B;  3AYW B;  3AFA C;  4BBK A;  2ZKM X;  3LZ0 D;  4ZUX A;  3LZ1 B;  2Y2J A;  3AZF D;  1P3A C;  1ZLA C;  4J8W B;  1TZY C;  1DDM A;  5GT3 D;  3LJA B;  4J8U C;  3AZE B;  2ROV A;  3UTB D;  5JHH A;  3EPL A;  2Q13 A;  4XZQ A;  3AZK C;  4KHA A;  1IRS A;  2COA A;  1AOI A;  5B33 C;  5AY8 D;  4PNK A;  1ID3 A;  3AYW D;  2DKQ A;  4H9O A;  2RLO A;  4F7G A;  5J3Q A;  4HAW B;  3LZ1 D;  2GCL A;  4Y94 A;  3KUY C;  4Z66 C;  3UT9 C;  2I5F A;  4UUZ A;  3LJA D;  4KVG B;  3AZE D;  4H9R A;  5GSU A;  2LUL A;  5DNN A;  1P3B A;  3WYF B;  1MK9 B;  3LZ0 C;  2NMB A;  3NWF A;  3SV1 A;  4A6F B;  2PYO B;  3AZF C;  2GJY A;  5HE3 A;  2Y7B A;  5GT3 C;  3UTB C;  4H9N A;  1H3O B;  2NZD D;  3TU4 B;  3G9W A;  3U8Z A;  3T06 A;  4KHB A;  1DBH A;  1LB1 A;  5AY8 C;  2K2U A;  3AYW C;  3REJ D;  3QBV B;  1UNR A;  2HIO B;  3ZVR A;  2NQB A;  3LZ1 C;  3WA9 A;  3MGQ B;  3A6N B;  4EMO A;  2Y2K A;  5BT1 D;  1KI1 B;  5CP6 B;  4J8W C;  2ARO B;  2W8S A;  4CSR B;  3LJA C;  3AZE C;  3WTP A;  5B24 A;  5M4Y B;  3AV1 A;  5IRS A;  4WU8 B;  1W2E A;  3AZL B;  3CIK A;  3VH5 T;  3AZG A;  5LON B;  2ZPY A;  2NBV A;  3MGQ D;  3MGS D;  5D3Y A;  3QWM A;  3A6N D;  1P3L D;  1K5D B;  4J8X A;  5CP6 D;  2ARO D;  1Z87 A;  4QJ5 B;  4H9P A;  4WU8 D;  5CHL B;  4HGA B;  4DBB A;  1M18 A;  3AZL D;  1B55 A;  5JRG B;  5B2J B;  3O62 B;  5B1M B;  5BT1 C;  2PYO C;  4HB3 B;  3NWD A;  3N7C A;  1EAZ A;  5GXQ A;  4Z2M B;  3TU4 C;  5B32 B;  2IYB A;  3VH5 W;  1H4R A;  4KHO A;  5AV6 B;  1TJ6 A;  4NY0 A;  1V61 A;  2HIO C;  1ZC4 B;  3MGQ C;  5JRG D;  2DKP A;  3A6N C;  5B2J D;  3O62 D;  5B1M D;  5D27 A;  4OT1 A;  3KSY A;  1F1E A;  5CP6 C;  2ARO C;  3W96 B;  2CV5 A;  1P3R A;  5B31 B;  5B32 D;  4WU8 C;  2D9W A;  5AV6 D;  4HB0 B;  1F66 B;  3AZL C;  2COC A;  3PEG A;  3SYX A;  2FJU B;  3AZN B;  3P7Z A;  1S32 A;  5KQ4 A;  3OHM B;  5CPI A;  1P3G B;  2BYK B;  2YS1 A;  5J3T A;  2P8V A;  3MNN B;  3W96 D;  1DDW A;  2ZY2 A;  4XUJ B;  5B2I A;  1F66 D;  4HGA C;  2D11 A;  5JRG C;  5B2J C;  3O62 C;  5B1M C;  2F2A C;  1P3G D;  4QLC B;  3B6G A;  3MPX A;  1ULY A;  5JHG A;  3PVU A;  5B32 C;  3ML4 A;  3ZDT A;  1TAF B;  3MNN D;  3NW8 A;  5AV6 C;  1B67 A;  3H0R C;  3BIN A;  3NWA A;  3B0D B;  3AZJ A;  3W98 B;  2UZR A;  4XUJ D;  4GN1 A;  2JE5 A;  3V9R B;  4GXB A;  5B40 D;  3KWQ A;  2D9X A;  1OQN A;  3AV2 D;  3B6F B;  3W96 C;  3WKJ A;  4L1R A;  3MGR A;  5B31 C;  3UTA B;  2RVQ D;  5AVC A;  1F66 C;  5JLJ B;  3PG7 A;  5B0Y B;  3AZN C;  4TKN A;  2DX1 A;  3W98 D;  4YS3 D;  4A5K A;  3AZM D;  1KX4 B;  1P3G C;  1GC7 A;  4XWX A;  1P3P A;  2G5H C;  1M1A A;  1KX5 A;  5BNV A;  3MNN C;  1B6W A;  4CAY A;  5DNM D;  2L1C A;  3UTA D;  4ZUX B;  4KUD A;  1FAO A;  4XUJ C;  2VSZ A;  5B0Y D;  3SO6 A;  3VH6 A;  2VQR A;  5JA4 A;  1P3O D;  1ZM0 A;  1KX4 D;  5CLQ B;  4QLC C;  2DHK A;  1P34 A;  3REH B;  3VH5 A;  1MI1 A;  2Y8G A;  2RVQ C;  1ID3 B;  1FHW A;  2ROZ B;  3REL A;  4ZUX D;  5BS7 A;  3B0D C;  1E5W A;  3W98 C;  1DDV A;  5D3W A;  1X11 A;  5C5B A;  3UZT A;  1BTK A;  3MGP A;  1ZSQ A;  4KAX B;  4H9R B;  3KXB B;  5C6R A;  3B6F C;  5DNN B;  2CY4 A;  3PVL A;  3HQC A;  4XZQ D;  3REH D;  3UTA C;  4R8P A;  5C3I B;  5C16 A;  2Z59 A;  1ID3 D;  1U27 A;  1TQZ A;  1P3M B;  5B0Y C;  4NFT A;  3X1U B;  4H9N B;  1KX4 C;  3V5W A;  3C1C A;  4KHB B;  1DRO A;  1UPQ A;  3P6A A;  3KXB D;  5DNN D;  4GPT B;  3A98 B;  4ZUX C;  2NQB B;  4HDQ A;  1JFI B;  3X1V A;  4QXA B;  1M7E A;  3X1T A;  2Y2G A;  2K49 A;  2YFV B;  1FGZ A;  3VOQ A;  4YL8 A;  3REH C;  3AZI A;  3DCX A;  1ID3 C;  3GYP A;  5FUG A;  3AZG B;  2NQB D;  2Y2Q A;  5GOW B;  3WA9 D;  3NSU A;  3EPJ A;  1BWN A;  1QQG A;  1W1G A;  2W2W A;  2YF0 A;  3WTP D;  3REK A;  3EG5 B;  3KXB C;  5B24 D;  1NTY A;  5DNN C;  4H9P B;  3AV1 D;  4Z2M G;  1M19 A;  5B32 G;  4ZBJ B;  5C3I C;  1M18 B;  1V88 A;  3AZG D;  1P3M C;  3WAA A;  1PZR A;  3SNH A;  5KDM A;  1RRP B;  4K2P A;  2GCJ A;  3X1U C;  1GC6 A;  1P6S A;  2D9Z A;  2YS5 A;  2DHJ A;  2Z4D A;  3NQU A;  5B31 G;  2F8N A;  2NQB C;  1M18 D;  1U5E A;  4QJ4 B;  2JP2 A;  2H7D A;  2ZY4 A;  3AL0 C;  2ZY3 A;  1PFJ A;  2CV5 B;  4Z5T A;  4E45 A;  4HAX B;  5BO0 A;  3D8F A;  2RRF A;  2Z0Q A;  2NZD B;  3AZG C;  2RGN B;  5AV5 A;  3W99 A;  2D2Q A;  3REJ B;  4ZRJ A;  2UVM A;  2EC1 A;  1XX0 A;  2YFW B;  2CV5 D;  2Y2I A;  4ZBJ C;  4J8V A;  2XQN M;  1M18 C;  4LD9 A;  5E5A B;  3AN2 B;  1LW3 A;  3MVD A;  3A58 A;  5CPI D;  3FDD A;  3NQJ A;  3B6G B;  2ZM5 A;  2IO5 B;  4K81 A;  2RUK B;  3U12 A;  1T3U A;  2ZY5 A;  3AFA A;  3MGS B;  1EF1 A;  1P3L B;  3AZJ B;  5B2I D;  1N1J B;  5DIF B;  5E5A D;  3AN2 D;  2COD A;  3MDB C;  1U2B A;  3VH6 T;  5G49 A;  1ZLA A;  2Y2O A;  1OY2 A;  4J8U A;  5CPJ A;  3B6G D;  2CV5 C;  3WKJ B;  1U5G A;  3MGR B;  2D9Y A;  3AZK A;  5AV9 A;  4IAP A;  2KUP A;  5B33 A;  5AVC B;  1X86 A;  4Z2M H;  3BJI A;  4H9Q A;  2NZD C;  3AZJ D;  3R45 B;  1P3F A;  4YM6 A;  2DN6 A;  3HK0 A;  4JJN A;  1KX3 A;  3UT9 A;  1P3P B;  3REJ C;  1EQZ A;  5AVB B;  2K00 A;  4IFS A;  3KWQ D;  5BNV B;  1WI1 A;  3WKJ D;  3U7D A;  3MGR D;  5CLL B;  3O96 A;  3VH6 W;  3AZH A;  5AVC D;  5E5A C;  3AN2 C;  4NSW A;  4WNN A;  5CPK B;  3KRW A;  5JA4 B;  4X23 A;  3EPH A;  5B0Z B;  3UTB A;  3B6G C;  5LOP B;  1BAK A;  1P34 B;  4DX8 A;  2IO5 C;  1P3P D;  1M1A D;  5AVB D;  1KX5 D;  2R0D A;  4GMX B;  1FB8 A;  1AWE A;  3REL B;  3AYW A;  3MGS C;  3FM8 C;  1P3L C;  2DLW A;  3TCA A;  3AZJ C;  1GG3 A;  2BCJ A;  3LZ1 A;  2LY8 A;  1MIX A;  5C5B B;  2FJ7 A;  2MKR A;  5AV8 A;  5D3X A;  5CPK D;  4J8W A;  5B0Z D;  2CRF A;  3WKJ C;  3MGR C;  1P34 D;  2XD1 A;  1UNQ A;  4R8P B;  2COF A;  2Z13 A;  5AVC C;  1XKE A;  3REL D;  1WWS A;  2GUM A;  3ULB A;  1WJM A;  2KGX B;  3HSA A;  3HW2 B;  3C1B A;  2BYM B;  4CHM A;  3MGP D;  3C1C B;  1P3P C;  5AVB C;  3A1K A;  1X1G A;  2Y2L A;  4R8P D;  3B0C T;  5B40 B;  2N0Y A;  2L5A A;  3AV2 B;  3X1V B;  2PYO A;  1BH8 B;  5CPK C;  1MK7 B;  2Y2H A;  2QKL A;  3X1T B;  5B0Z C;  2M38 A;  1KZ7 A;  3X1S A;  1NTV A;  3TU4 A;  1H10 A;  1P34 C;  2MFQ A;  3REI A;  3C1C D;  3EPK A;  4YS3 B;  3FVC A;  1BTN A;  4AWL B;  3FSS A;  3AZM B;  5FUG B;  3REL C;  1U35 A;  5F99 A;  2YVC A;  2HIO A;  3D8E A;  1BFM A;  1WWI A;  3OAN A;  2Y2P A;  3MGQ A;  4H9S A;  1XCG A;  5DNM B;  3X1V D;  5CP6 A;  1NU2 A;  2ARO A;  3REK B;  4CSR A;  3X1T D;  2AL6 A;  1M7R A;  4HAY B;  2F8N H;  1M19 B;  4R8P C;  2Z0O A;  1V89 A;  4GOU A;  3AZL A;  1P3O B;  5L81 A;  1XR0 B;  1P3I A;  5KCV A;  5KDM B;  5BNX A;  2Y2N A;  1BH9 A;  3IP4 C;  3C1C C;  3REK D;  1I2H A;  3NQU B;  1U29 A;  3F6T A;  1M19 D;  2F8N B;  2N23 A;  3TFM A;  5B40 C;  4E44 A;  3F0W A;  4HB2 B;  1R4V A;  5JRG A;  3AV2 C;  4HAV B;  3X1V C;  4XZQ B;  3WAA D;  4KHA B;  1AOI B;  3X1T C;  1Q67 A;  4H9O B;  3LEL A;  2PZ1 A;  5B32 A;  3LJU X;  5BO0 B;  2J0J A;  4YS3 C;  1P5T A;  4AWL C;  3AZM C;  2F8N D;  4UUZ B;  4HAU B;  5AV5 B;  5GSU B;  3A1I A;  1NI2 A;  3W99 B;  1P3B B;  2UZS A;  5DNM C;  1AOI D;  2DF4 C;  1J19 A;  3W96 A;  3REK C;  2J0M A;  5B31 A;  4Z5T D;  1M19 C;  1W1D A;  5B1L A;  1P3O C;  2LYD A;  3AU4 A;  2I1K A;  3AZN A;  1WG7 A;  5AV5 D;  4OSN A;  4NE3 A;  3NQJ B;  5GSU D;  1P3G A;  2BYK A;  3W99 D;  1DYN A;  1P3B D;  4Z2N A;  2KCJ A;  3WA9 B;  1ZC3 B;  3HIE A;  1FHO A;  4EO5 B;  5I2S A;  4J8V D;  1ISN A;  2P0D A;  3WTP B;  3PP2 A;  4HHV A;  2GS0 A;  2I5C A;  5B24 B;  3AV1 B;  2HTH B;  3M1I B;  4XZQ C;  5CPJ B;  1AOI C;  2OQB A;  1U5F A;  4QLC A;  5AV9 B;  2FFF B;  4HSI A;  1TAF A;  2DTC A;  2F8N K;  3AFA D;  3P5J B;  4H9Q B;  2KR0 A;  4J8X B;  1P3F B;  4YM6 B;  4JJN B;  5AV5 C;  3V9R A;  1KZG A;  1KX3 B;  5GSU C;  1P3K A;  2G35 A;  1ZLA D;  3W99 C;  1P3B C;  5LG4 B;  1EQZ B;  5HE0 A;  5CPJ D;  3B6F A;  2ELB A;  2CWE A;  3AZK D;  5GT0 A;  5AV9 D;  4GMV A;  2X18 A;  3AZH B;  1MPH A;  2Y2M A;  5GXQ B;  4WNN B;  1HQ3 A;  3PZD A;  4J8X D;  1P3F D;  4X23 B;  4YM6 D;  4JJN D;  1K5G B;  2Z14 A;  2DYQ A;  1KX3 D;  5JP4 A;  3UT9 D;  1EVH A;  1PMS A;  2KIE A;  1EQZ D;  4F7H A;  4WU9 A;  3WA9 C;  4ZRK A;  4M6B A;  3DXD A;  4HB4 B;  3QIJ A;  4EO5 C;  3AZH D;  2FJ7 B;  4DXA B;  2L2I A;  4NE6 A;  5AV8 B;  3WTP C;  1UEF A;  5GXQ D;  3X23 A;  1Q9C A;  5B24 C;  5HE2 A;  2D10 A;  3AV1 C;  4X23 D;  5CPJ C;  5DH9 B;  3AJ4 A;  4KGC A;  3RCP A;  2MDX A;  3W97 A;  3REH A;  1S32 B;  5AV9 C;  5CPI B;  2DX5 A;  2V76 A;  2J8P A;  1FHX A;  4J8X C;  1P3F C;  4YM6 C;  4JJN C;  3C1B B;  2FJ7 D;  1UNP A;  3TVV A;  5AV8 D;  1KX3 C;  1FOE A;  1Y19 B;  4J8W D;  2YT2 A;  4DRA A;  1EQZ C;  2OTX A;  4IOY X;  5B2I B;  3KXB A;  2RSG A;  3H0M C;  1SHC A;  1S32 D;  2HUE B;  3AZH C; 
#chains in the Genus database with same CATH homology
 1TXD A;  2MWN B;  4UPK A;  3A8P A;  5GXQ C;  4GZU A;  1P3M A;  3PVW A;  4DIX A;  4X23 C;  5I2M A;  3C1B D;  3D8D A;  3X1U A;  3X1S B;  3REI B;  1QC6 A;  2EMT A;  2E2X A;  3GYO A;  1U35 B;  1P3A A;  2ADZ A;  5F99 B;  2IFS A;  2J0K A;  4DRB A;  2K2J A;  1TZY A;  3KWQ B;  3WA0 A;  2FJ7 C;  2FJL A;  5AV8 C;  2PYO D;  1V5U A;  1JFI A;  2DFK A;  2RVB B;  5DHA B;  3X1S D;  2YFV A;  3TU4 D;  2XD5 A;  1KU5 A;  3REI D;  5D3V A;  1S32 C;  4K17 A;  5CPI C;  1XD4 A;  2UWX A;  2H7E A;  3KUY A;  4CSQ A;  1U35 D;  4Z66 A;  5F99 D;  5J3Y A;  2DYN A;  2F8N G;  2HIO D;  4G91 B;  1P3I B;  3VIA A;  4WV4 B;  1M1A B;  2R2Y A;  1KX5 B;  5BNX B;  2YT0 A;  3C1B C;  4CAY B;  1BH9 B;  3LZ0 A;  2Z0P A;  4KUD B;  4P7I A;  5B2I C;  3AZF A;  2QKM A;  1WJ1 A;  2HUE C;  5GT3 A;  1P3I D;  1U5D A;  2YRY A;  3WTP E;  1MIZ B;  2R09 A;  5AY8 A;  3LEL B;  3X1S C;  2KIG A;  2AEH A;  3REI C;  5FI0 A;  1UPR A;  2D4Q A;  5EFX A;  4KUD D;  4G92 B;  4WSF A;  1WVH A;  4WJ3 C;  1X05 A;  1U35 C;  5F99 C;  4DQY B;  3FEH A;  3MGP B;  2EJ8 A;  3KWQ C;  3LJA A;  3AZE A;  4NE5 A;  4H9S C;  4B6H A;  2CY5 A;  2JSS A;  2K8E A;  3KRX A;  3LEL D;  5DI9 B;  2RNR B;  5HE1 A;  1J0W A;  5B1L B;  3AU5 A;  2NZD A;  5DHF B;  1OMW A;  1P3I C;  4G91 C;  4HAZ B;  1M1A C;  1KX5 C;  2LKO A;  2G5I C;  2M14 A;  2ELA A;  4TYZ A;  3REJ A;  2YFW A;  4KUD C;  4GNK B;  5B31 D;  1HTA A;  4A6F A;  1WGQ A;  5B1L D;  1Y5O A;  4DX9 0;  4D6W A;  5E5A A;  3AN2 A;  2D9V A;  4WZS B;  3AZN D;  1H3O A;  5KQ1 A;  3AZI B;  4CHJ A;  5C79 A;  1PLS A;  3LEL C;  1V5M A;  3ODX A;  1N3H A;  5BS7 C;  4G92 C;  2LOZ A;  3MGS A;  3A6N A;  1P3L A;  2VKI A;  4D0N B;  3ODO A;  2YSZ A;  3MGP C;  4A6H A;  1N1J A;  3KFU G;  3B0C W;  1P3K B;  4CYE A;  4WU8 A;  1AQC A;  3AZI D;  4MY6 A;  2DQN C;  1RJ2 A;  4QLC D;  5GT0 B;  4EJN A;  1ZYI A;  3WAA B;  3TW1 A;  4HDO A;  5B1L C;  1HQ3 B;  3R45 A;  3B0B A;  1V5P A;  4MT7 A;  1P3K D;  2P0H A;  4EKU A;  1FGY A;  4WU9 B;  5AVB A;  4HAT B;  3B6F D;  5GT0 D;  5B2J A;  3O62 A;  4MK0 A;  5B1M A;  3DXC A;  3KY9 A;  1HQ3 D;  4QJ3 B;  5CPK A;  4Z5T B;  2I1J A;  5B0Z A;  1A7W A;  3AZI C;  5AV6 A;  4KGC B;  2DA0 A;  3W97 B;  4WU9 D;  4PQ0 A;  2DHI A;  4WJ7 A;  1I7A A;  3TO1 A;  3ULC A;  3F5R A;  2BG1 A;  2P0F A;  1WGU A;  1P3K C;  1XOD A;  3PSC A;  2VRW B;  2JCH A;  2CAY A;  4J8V B;  1F66 A;  4LD9 B;  4KGC D;  2J59 M;  3W97 D;  1SGH A;  5GT0 C;  1EGX A;  3MVD B;  1MKE A;  3WAA C;  2LG1 A;  2NZ8 B;  1HQ3 C;  3MNN A;  2BYM A;  3AFA B;  4WVF B;  3H0L C;  4WU9 C;  4XUJ A;  1X1F A;  4YON A;  2HE7 A;  4LD9 D;  1P3A B;  5G49 B;  1ZLA B;  5B40 A;  3ODW A;  1TZY B;  3MVD D;  2YT1 A;  3KZ1 A;  4J8U B;  3AV2 A;  3CXB B;  1P3M D;  3AZK B;  1BH8 A;  4Z5T C;  3IVF A;  2W2X D;  2Y8F A;  1W1H A;  5B33 B;  2EMS A;  3X1U D;  4KGC C;  2RIQ A;  3W97 C;  4A6K A;  4C0A A;  3W98 A;  4YS3 A;  3KUY B;  4ZRI A;  3AZM A;  4Z66 B;  1P3A D;  3UT9 B;  1TZY D;  4J8U D;  3DXE A;  5DNM A;  1Z2C B;  2LOX A;  3UTA A;  3LZ0 B;  1MAI A;  5B33 D;  4J8V C;  4LD9 C;  3A8Q A;  3AZF B;  2YS3 A;  5B0Y A;  4F7U P;  3MVD C;  5GT3 B;  3UTB B;  1P3O A;  3KUY D;  5FI1 A;  4L6E A;  4Z66 D;  1KX4 A;  3SUZ A;  4H8S A;  1ZVR A;  4K2O A;  2W2X C;  2KUQ A;  5AY8 B;  3AYW B;  3AFA C;  4BBK A;  2ZKM X;  3LZ0 D;  4ZUX A;  3LZ1 B;  2Y2J A;  3AZF D;  1P3A C;  1ZLA C;  4J8W B;  1TZY C;  1DDM A;  5GT3 D;  3LJA B;  4J8U C;  3AZE B;  2ROV A;  3UTB D;  5JHH A;  3EPL A;  2Q13 A;  4XZQ A;  3AZK C;  4KHA A;  1IRS A;  2COA A;  1AOI A;  5B33 C;  5AY8 D;  4PNK A;  1ID3 A;  3AYW D;  2DKQ A;  4H9O A;  2RLO A;  4F7G A;  5J3Q A;  4HAW B;  3LZ1 D;  2GCL A;  4Y94 A;  3KUY C;  4Z66 C;  3UT9 C;  2I5F A;  4UUZ A;  3LJA D;  4KVG B;  3AZE D;  4H9R A;  5GSU A;  2LUL A;  5DNN A;  1P3B A;  3WYF B;  1MK9 B;  3LZ0 C;  2NMB A;  3NWF A;  3SV1 A;  4A6F B;  2PYO B;  3AZF C;  2GJY A;  5HE3 A;  2Y7B A;  5GT3 C;  3UTB C;  4H9N A;  1H3O B;  2NZD D;  3TU4 B;  3G9W A;  3U8Z A;  3T06 A;  4KHB A;  1DBH A;  1LB1 A;  5AY8 C;  2K2U A;  3AYW C;  3REJ D;  3QBV B;  1UNR A;  2HIO B;  3ZVR A;  2NQB A;  3LZ1 C;  3WA9 A;  3MGQ B;  3A6N B;  4EMO A;  2Y2K A;  5BT1 D;  1KI1 B;  5CP6 B;  4J8W C;  2ARO B;  2W8S A;  4CSR B;  3LJA C;  3AZE C;  3WTP A;  5B24 A;  5M4Y B;  3AV1 A;  5IRS A;  4WU8 B;  1W2E A;  3AZL B;  3CIK A;  3VH5 T;  3AZG A;  5LON B;  2ZPY A;  2NBV A;  3MGQ D;  3MGS D;  5D3Y A;  3QWM A;  3A6N D;  1P3L D;  1K5D B;  4J8X A;  5CP6 D;  2ARO D;  1Z87 A;  4QJ5 B;  4H9P A;  4WU8 D;  5CHL B;  4HGA B;  4DBB A;  1M18 A;  3AZL D;  1B55 A;  5JRG B;  5B2J B;  3O62 B;  5B1M B;  5BT1 C;  2PYO C;  4HB3 B;  3NWD A;  3N7C A;  1EAZ A;  5GXQ A;  4Z2M B;  3TU4 C;  5B32 B;  2IYB A;  3VH5 W;  1H4R A;  4KHO A;  5AV6 B;  1TJ6 A;  4NY0 A;  1V61 A;  2HIO C;  1ZC4 B;  3MGQ C;  5JRG D;  2DKP A;  3A6N C;  5B2J D;  3O62 D;  5B1M D;  5D27 A;  4OT1 A;  3KSY A;  1F1E A;  5CP6 C;  2ARO C;  3W96 B;  2CV5 A;  1P3R A;  5B31 B;  5B32 D;  4WU8 C;  2D9W A;  5AV6 D;  4HB0 B;  1F66 B;  3AZL C;  2COC A;  3PEG A;  3SYX A;  3P7Z A;  3AZN B;  2FJU B;  1S32 A;  5KQ4 A;  3OHM B;  5CPI A;  1P3G B;  2BYK B;  2YS1 A;  5J3T A;  2P8V A;  3MNN B;  3W96 D;  1DDW A;  2ZY2 A;  4XUJ B;  5B2I A;  1F66 D;  4HGA C;  2D11 A;  5JRG C;  5B2J C;  3O62 C;  5B1M C;  2F2A C;  1P3G D;  4QLC B;  3B6G A;  3MPX A;  1ULY A;  5JHG A;  3PVU A;  5B32 C;  3ML4 A;  3ZDT A;  1TAF B;  3MNN D;  3NW8 A;  5AV6 C;  1B67 A;  3H0R C;  3BIN A;  3NWA A;  3B0D B;  3AZJ A;  3W98 B;  2UZR A;  4XUJ D;  4GN1 A;  2JE5 A;  3V9R B;  4GXB A;  5B40 D;  3KWQ A;  2D9X A;  1OQN A;  3AV2 D;  3B6F B;  3W96 C;  3WKJ A;  4L1R A;  3MGR A;  5B31 C;  3UTA B;  2RVQ D;  5AVC A;  1F66 C;  5JLJ B;  3PG7 A;  5B0Y B;  3AZN C;  4TKN A;  2DX1 A;  3W98 D;  4YS3 D;  4A5K A;  3AZM D;  1KX4 B;  1P3G C;  1GC7 A;  4XWX A;  1P3P A;  2G5H C;  1M1A A;  1KX5 A;  5BNV A;  3MNN C;  1B6W A;  4CAY A;  5DNM D;  2L1C A;  3UTA D;  4ZUX B;  4KUD A;  1FAO A;  4XUJ C;  2VSZ A;  5B0Y D;  3SO6 A;  3VH6 A;  2VQR A;  5JA4 A;  1P3O D;  1ZM0 A;  1KX4 D;  5CLQ B;  4QLC C;  2DHK A;  1P34 A;  3REH B;  3VH5 A;  2Y8G A;  2RVQ C;  1ID3 B;  1FHW A;  2ROZ B;  3REL A;  4ZUX D;  5BS7 A;  3B0D C;  1E5W A;  3W98 C;  1DDV A;  5D3W A;  1X11 A;  5C5B A;  3UZT A;  1BTK A;  3MGP A;  1ZSQ A;  4KAX B;  4H9R B;  3KXB B;  5C6R A;  3B6F C;  5DNN B;  2CY4 A;  3PVL A;  3HQC A;  4XZQ D;  3REH D;  3UTA C;  4R8P A;  5C3I B;  5C16 A;  2Z59 A;  1ID3 D;  1U27 A;  1TQZ A;  1P3M B;  5B0Y C;  4NFT A;  3X1U B;  4H9N B;  1KX4 C;  3V5W A;  3C1C A;  4KHB B;  1DRO A;  1UPQ A;  3P6A A;  3KXB D;  5DNN D;  4GPT B;  3A98 B;  4ZUX C;  2NQB B;  4HDQ A;  1JFI B;  3X1V A;  4QXA B;  1M7E A;  3X1T A;  2Y2G A;  2K49 A;  2YFV B;  1FGZ A;  3VOQ A;  4YL8 A;  3REH C;  3AZI A;  1ID3 C;  3GYP A;  5FUG A;  3AZG B;  2NQB D;  2Y2Q A;  5GOW B;  3WA9 D;  3NSU A;  3EPJ A;  1BWN A;  1QQG A;  1W1G A;  2W2W A;  2YF0 A;  3WTP D;  3REK A;  3EG5 B;  3KXB C;  5B24 D;  1NTY A;  5DNN C;  4H9P B;  3AV1 D;  4Z2M G;  1M19 A;  5B32 G;  4ZBJ B;  5C3I C;  1M18 B;  1V88 A;  3AZG D;  1P3M C;  3WAA A;  1PZR A;  3SNH A;  5KDM A;  1RRP B;  4K2P A;  2GCJ A;  3X1U C;  1GC6 A;  1P6S A;  2D9Z A;  2YS5 A;  2DHJ A;  2Z4D A;  3NQU A;  5B31 G;  2F8N A;  2NQB C;  1M18 D;  1U5E A;  4QJ4 B;  2JP2 A;  2H7D A;  2ZY4 A;  3AL0 C;  2ZY3 A;  1PFJ A;  2CV5 B;  4Z5T A;  4E45 A;  4HAX B;  5BO0 A;  3D8F A;  2RRF A;  2Z0Q A;  2NZD B;  3AZG C;  2RGN B;  5AV5 A;  3W99 A;  2D2Q A;  3REJ B;  4ZRJ A;  2UVM A;  2EC1 A;  1XX0 A;  2YFW B;  2CV5 D;  2Y2I A;  4ZBJ C;  4J8V A;  2XQN M;  1M18 C;  4LD9 A;  5E5A B;  3AN2 B;  1LW3 A;  3MVD A;  3A58 A;  5CPI D;  3FDD A;  3NQJ A;  3B6G B;  2ZM5 A;  2IO5 B;  4K81 A;  2RUK B;  3U12 A;  1T3U A;  2ZY5 A;  3AFA A;  3MGS B;  1EF1 A;  1P3L B;  3AZJ B;  5B2I D;  1N1J B;  5DIF B;  5E5A D;  3AN2 D;  2COD A;  3MDB C;  1U2B A;  3VH6 T;  5G49 A;  1ZLA A;  2Y2O A;  1OY2 A;  4J8U A;  5CPJ A;  3B6G D;  2CV5 C;  3WKJ B;  1U5G A;  3MGR B;  2D9Y A;  3AZK A;  5AV9 A;  4IAP A;  2KUP A;  5B33 A;  5AVC B;  1X86 A;  4Z2M H;  3BJI A;  4H9Q A;  2NZD C;  3AZJ D;  3R45 B;  1P3F A;  4YM6 A;  2DN6 A;  3HK0 A;  4JJN A;  1KX3 A;  3UT9 A;  1P3P B;  3REJ C;  1EQZ A;  5AVB B;  2K00 A;  4IFS A;  3KWQ D;  5BNV B;  1WI1 A;  3WKJ D;  3U7D A;  3MGR D;  5CLL B;  3O96 A;  3VH6 W;  3AZH A;  5AVC D;  5E5A C;  3AN2 C;  4NSW A;  4WNN A;  5CPK B;  3KRW A;  5JA4 B;  4X23 A;  3EPH A;  5B0Z B;  3UTB A;  3B6G C;  5LOP B;  1BAK A;  1P34 B;  4DX8 A;  2IO5 C;  1P3P D;  1M1A D;  5AVB D;  1KX5 D;  2R0D A;  4GMX B;  1FB8 A;  1AWE A;  3REL B;  3AYW A;  3MGS C;  3FM8 C;  1P3L C;  2DLW A;  3TCA A;  3AZJ C;  1GG3 A;  2BCJ A;  3LZ1 A;  2LY8 A;  1MIX A;  5C5B B;  2FJ7 A;  2MKR A;  5AV8 A;  5D3X A;  5CPK D;  4J8W A;  5B0Z D;  2CRF A;  3WKJ C;  3MGR C;  1P34 D;  2XD1 A;  1UNQ A;  4R8P B;  2COF A;  2Z13 A;  5AVC C;  1XKE A;  3REL D;  1WWS A;  2GUM A;  3ULB A;  1WJM A;  2KGX B;  3HW2 B;  3C1B A;  2BYM B;  4CHM A;  3MGP D;  3C1C B;  1P3P C;  5AVB C;  3A1K A;  1X1G A;  2Y2L A;  4R8P D;  3B0C T;  5B40 B;  2N0Y A;  2L5A A;  3AV2 B;  3X1V B;  2PYO A;  1BH8 B;  5CPK C;  1MK7 B;  2Y2H A;  2QKL A;  3X1T B;  5B0Z C;  2M38 A;  1KZ7 A;  3X1S A;  1NTV A;  3TU4 A;  1H10 A;  1P34 C;  2MFQ A;  3REI A;  3C1C D;  3EPK A;  4YS3 B;  3FVC A;  1BTN A;  4AWL B;  3FSS A;  3AZM B;  5FUG B;  3REL C;  1U35 A;  5F99 A;  2YVC A;  2HIO A;  3D8E A;  1BFM A;  1WWI A;  3OAN A;  2Y2P A;  3MGQ A;  4H9S A;  1XCG A;  5DNM B;  3X1V D;  5CP6 A;  1NU2 A;  2ARO A;  3REK B;  4CSR A;  3X1T D;  2AL6 A;  1M7R A;  4HAY B;  2F8N H;  1M19 B;  4R8P C;  2Z0O A;  1V89 A;  4GOU A;  3AZL A;  1P3O B;  5L81 A;  1XR0 B;  1P3I A;  5KCV A;  5KDM B;  5BNX A;  2Y2N A;  1BH9 A;  3IP4 C;  3C1C C;  3REK D;  1I2H A;  3NQU B;  1U29 A;  3F6T A;  1M19 D;  2F8N B;  2N23 A;  3TFM A;  5B40 C;  4E44 A;  3F0W A;  4HB2 B;  1R4V A;  5JRG A;  3AV2 C;  4HAV B;  3X1V C;  4XZQ B;  3WAA D;  4KHA B;  1AOI B;  3X1T C;  1Q67 A;  4H9O B;  3LEL A;  2PZ1 A;  5B32 A;  3LJU X;  5BO0 B;  2J0J A;  4YS3 C;  1P5T A;  4AWL C;  3AZM C;  2F8N D;  4UUZ B;  4HAU B;  5AV5 B;  5GSU B;  3A1I A;  1NI2 A;  3W99 B;  1P3B B;  2UZS A;  5DNM C;  1AOI D;  2DF4 C;  1J19 A;  3W96 A;  3REK C;  2J0M A;  5B31 A;  4Z5T D;  1M19 C;  1W1D A;  5B1L A;  1P3O C;  2LYD A;  3AU4 A;  2I1K A;  3AZN A;  1WG7 A;  5AV5 D;  4OSN A;  4NE3 A;  3NQJ B;  5GSU D;  1P3G A;  2BYK A;  3W99 D;  1DYN A;  1P3B D;  4Z2N A;  2KCJ A;  3WA9 B;  1ZC3 B;  3HIE A;  1FHO A;  4EO5 B;  5I2S A;  4J8V D;  1ISN A;  2P0D A;  3WTP B;  3PP2 A;  4HHV A;  2GS0 A;  2I5C A;  5B24 B;  3AV1 B;  2HTH B;  3M1I B;  4XZQ C;  5CPJ B;  1AOI C;  2OQB A;  1U5F A;  4QLC A;  5AV9 B;  2FFF B;  4HSI A;  1TAF A;  2DTC A;  2F8N K;  3AFA D;  3P5J B;  4H9Q B;  2KR0 A;  4J8X B;  1P3F B;  4YM6 B;  4JJN B;  5AV5 C;  3V9R A;  1KZG A;  1KX3 B;  5GSU C;  1P3K A;  2G35 A;  1ZLA D;  3W99 C;  1P3B C;  5LG4 B;  1EQZ B;  5HE0 A;  5CPJ D;  3B6F A;  2ELB A;  2CWE A;  3AZK D;  5GT0 A;  5AV9 D;  4GMV A;  2X18 A;  3AZH B;  1MPH A;  2Y2M A;  5GXQ B;  4WNN B;  1HQ3 A;  3PZD A;  4J8X D;  1P3F D;  4X23 B;  4YM6 D;  4JJN D;  1K5G B;  2Z14 A;  2DYQ A;  1KX3 D;  5JP4 A;  3UT9 D;  1EVH A;  1PMS A;  2KIE A;  1EQZ D;  4F7H A;  4WU9 A;  3WA9 C;  4ZRK A;  4M6B A;  3DXD A;  4HB4 B;  3QIJ A;  4EO5 C;  3AZH D;  2FJ7 B;  4DXA B;  2L2I A;  4NE6 A;  5AV8 B;  3WTP C;  1UEF A;  5GXQ D;  3X23 A;  1Q9C A;  5B24 C;  5HE2 A;  2D10 A;  3AV1 C;  4X23 D;  5CPJ C;  5DH9 B;  3AJ4 A;  4KGC A;  3RCP A;  2MDX A;  3W97 A;  3REH A;  1S32 B;  5AV9 C;  5CPI B;  2DX5 A;  2V76 A;  2J8P A;  1FHX A;  4J8X C;  1P3F C;  4YM6 C;  4JJN C;  3C1B B;  2FJ7 D;  1UNP A;  3TVV A;  5AV8 D;  1KX3 C;  1FOE A;  1Y19 B;  4J8W D;  2YT2 A;  4DRA A;  1EQZ C;  2OTX A;  4IOY X;  5B2I B;  3KXB A;  2RSG A;  3H0M C;  1SHC A;  1S32 D;  2HUE B;  3AZH C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...