4KHAA

Structural basis of histone h2a-h2b recognition by the essential chaperone fact
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
406
structure length
360
Chain Sequence
b'DVVEQDKLIEIRNRRPAVLDNVYIRPALEGKRVPGKVEIHQNGIRYQSPLSTTQRVDVLFSNIRHLFFQPCQNEMIVIIHLHLKDPILFGKKKTKDVQFYREAIQEERRRKAELDRLFKSFAEKIAEAGRNEGIEVDMPIRDLGFNGVPNRSNVVIYPTTECLIQITEPPFLVITLEDVEWAHLERVQFGLKNFDLVFVFKDFTRPVVHINTIPVESLEDVKEFLDSSDIPFSEGPLNLNWSVIMKTVTANPHQFFLDGGWGFLQNDSRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Spt16M-Histone H2B 1.1 chimera
publication title Structural basis of histone H2A-H2B recognition by the essential chaperone FACT.
pubmed doi rcsb
source organism Chaetomium thermophilum var. thermophilum
molecule tags Chaperone/nuclear protein
total genus 99
structure length 360
sequence length 406
ec nomenclature
pdb deposition date 2013-04-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08512 Rtt106 Histone chaperone Rttp106-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 4khaA03
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 4khaA02
2.30.29.150 Mainly Beta Roll PH-domain like PH-domain like 4khaA01
5GOWB 2RNRB 2J0JA 3AZFA 4HAWB 1MIZB 2MFQA 2PZ1A 3KUYA 3AV1D 1F66A 2MWNB 3LZ0A 4AWLC 3RELB 5DI9B 4CYEA 4EJNA 2LKOA 2X18A 3UT9A 5GSUD 1N1JB 3TU4A 5CPIB 2HUEC 2NQBA 3B6FA 1B67A 1XCGA 1AOIB 2FJLA 4ZUXD 3F0WA 5JRGB 4X23C 5B0ZD 5E5AB 4HHVA 1I2HA 2BYMA 1ZVRA 3A6NB 3AN2A 4XZQA 3RELA 3AZLC 3REHC 5DNMB 1FHOA 2PYOA 1KZ7A 3AV2D 1N1JA 5JA4B 5CPIA 4IOYX 4KUDD 1KX5D 3X1VC 1FGZA 2DYQA 1QQGA 2Y8FA 3AFAD 4JJND 2NZDD 5C5BB 3WTPC 4DBBA 1BAKA 2E2XA 5B1MA 4WU8A 1EGXA 5DNMA 4Z5TC 4J8WD 1M19A 2DKPA 2F8NB 5KDMB 5CPJC 5AVBC 3BINA 4CHMA 4R8PD 2J0KA 1DBHA 3WA9D 3N7CA 5C5BA 5CPKD 5F99A 5GT0D 3NQUA 3SYXA 2LOXA 5B40C 3KRXA 2DLWA 2F8NA 2GJYA 1ULYA 3IVFA 1UPRA 2FJ7C 3PP2A 4Z66D 5AV5D 1MPHA 1ID3C 1P3LA 1XD4A 2OTXA 3AZNB 3AJ4A 5B24D 4H9NB 1WGQA 1XODA 3B0DC 2H7EA 1R4VA 4YS3D 5B2JD 2R0DA 5B31B 4E45A 1P3AB 3DXDA 3C1BB 1JFIB 4GN1A 4L6EA 2XQNM 2KUPA 3MGQA 1BTKA 1B55A 3REJA 1AOIC 1P3IB 4F7HA 3LJUX 4LD9B 4WV4B 5BT1C 4H9NA 5E5AC 5D3XA 1H3OB 5BNVA 3A6NC 1UPQA 1P3AA 2KCJA 3C1BA 1U35D 3A8QA 3CXBB 3ODWA 4J8UB 3B0CW 5DNND 1I7AA 3AYWC 1ZLAB 1MK7B 3WYFB 4H9SC 3REIB 4HAYB 3MGSD 5C3IB 3LZ1B 1S32A 5JHGA 3WKJB 2GCJA 5AV8C 3GYPA 4YM6D 3AZGC 4NSWA 2RVQC 5L81A 1Q9CA 4Z2MH 5HE1A 3W97C 2D9ZA 3ZVRA 1E5WA 1U5GA 5B2IA 1P34B 5AV6D 4HGAC 2BYKA 2I1JA 5EFXA 3W96D 3WKJA 1Y5OA 4GZUA 5J3TA 4C0AA 2HIOB 2DN6A 1GG3A 3C1CD 3FM8C 1P3FD 3QBVB 3WAAB 2I1KA 5C79A 4G91B 1UNRA 3UTBD 2YT1A 2DHJA 3OANA 4ZRKA 3MNND 3MVDB 1EF1A 4NE3A 2V76A 3AZHA 4XUJB 3O96A 3A8PA 1KZGA 2N23A 3AZNC 5CP6B 2M14A 2HIOA 5GXQB 2K2UA 5B1LC 1X1GA 4HB4B 1KX3A 3WAAA 1M1AB 4J8VB 4GPTB 4DRBA 1X11A 2ROZB 3MVDA 2UZRA 4WNNB 1V89A 2YF0A 5CLLB 5GSUB 2CV5D 1P3IC 4LD9C 1SGHA 5GXQA 5AVCC 1Z87A 2EMTA 1U5DA 2IFSA 4ZUXB 1W1HA 3KWQD 1P3PD 5B0ZB 5BS7A 3AV1A 3MGRB 4J8UC 3AZIC 3ML4A 4HB2B 3A98B 1V5UA 1ZLAC 5FUGB 3REIC 1BH9A 4WNNA 1HQ3C 3AZKC 3AZJD 5C3IC 5GSUA 3LZ1C 3AZMB 3AV2B 2D9XA 5B33B 3W99D 2Y7BA 3KXBC 4ZUXA 2Q13A 5B0ZA 5BO0B 1N3HA 4WVFB 2NZDB 1P3BD 1J0WA 3MGPD 4HB3B 1M18B 4HAVB 4H9OB 1RRPB 3F5RA 1P34C 4GXBA 1OMWA 3AV2A 3X1SB 2DHIA 2VKIA 3X1TC 4WJ7A 3REKC 3AZHD 4KUDA 1TZYB 1KX5A 2HE7A 4R8PB 3AFAA 4JJNA 3WA9B 3W98D 2NZDA 3LJAC 5CPKB 1UEFA 5GT0B 1P3OD 1WVHA 4KHOA 1EAZA 3KUYB 2L2IA 4WU9D 3LZ0B 4J8WA 1HQ3D 1NU2A 3X1UD 1P3RA 2GS0A 4XUJC 3UT9B 3B6FB 2JP2A 4Z66B 4PNKA 5CP6C 2DFKA 3G9WA 4R8PA 2AROC 5B32D 3WA9A 4J8XD 5CPKA 4DRAA 2Y8GA 5GT0A 5B24B 3BJIA 5JLJB 1M1AC 2BYMB 4J8VC 1KX4D 3AN2B 5B2JB 4XZQB 2N0YA 5AY8D 2PYOB 1P3MD 3FEHA 2UZSA 4Z66A 5AV5A 3X1VA 1FGYA 5B0YD 5HE2A 3UTAD 3O62C 5B24A 1W1DA 1P3KD 2W2XC 4M6BA 3LELD 5GT3D 4HB0B 4UUZA 5B2JA 5B1MB 5AV9D 4WU8B 4YS3A 4H9RA 2G35A 3ODOA 1U35B 4KHAB 1M19B 1EQZD 2YFVA 4EO5B 3AZMC 3AZED 1P3GD 5B32G 5B33C 1WJMA 2ELBA 4QLCC 3VH5W 5F99B 4KGCC 3VIAA 3NQUB 2YT0A 2K2JA 1U35A 1M18C 4KHAA 3B6GC 4D0NB 5DNNA 1KI1B 3X1SC 2D9WA 2RVBB 2EJ8A 3MGSA 2I5FA 1TZYC 4X23D 1P3LB 1V5MA 3T06A 3PVLA 4YM6A 1XX0A 3AZFC 1Y19B 3AZLD 3REHD 4ZRIA 3C1CB 1XR0B 3KUYC 3VH5A 1F66C 3MPXA 3LZ0C 5JHHA 3UTBB 2OQBA 5AV6A 3MGQB 3UT9C 3MNNB 3TU4C 4H9PA 3X1VD 3B6FC 2NQBC 3W96A 3NSUA 5C6RA 3REJB 5HE0A 4DX90 3WTPD 1WWSA 2LYDA 2F8NK 4Y94A 1NI2A 4Z5TD 3C1CA 5BNVB 1P3FA 3AU4A 3AN2C 3B6GD 4K2PA 3RELC 3HK0A 5HE3A 3UTBA 3KZ1A 2PYOC 5CPJD 3MNNA 5AVBD 5CPIC 3UZTA 5JRGC 2COCA 3PG7A 1S32B 2CV5B 4A5KA 3SO6A 2YS1A 5B40D 2DX5A 3KWQB 5B1MC 4WU8C 4TYZA 3W97A 1FB8A 5DNMC 1TAFA 2CODA 1M19C 1TQZA 2FJ7D 5B2IB 1ID3D 1U2BA 2KGXB 2P0DA 1A7WA 2BYKB 4G92B 3B0BA 2CV5A 2GCLA 3D8FA 3ULBA 5CLQB 4A6FA 5F99C 1MK9B 3KWQA 1P3PA 1XKEA 3U7DA 2IYBA 1K5GB 1P3BB 1OY2A 3MGPB 4HAXB 1PFJA 3HW2B 1MIXA 1U5EA 3AZJA 1P3MA 1AOID 1DDWA 3KSYA 5JRGD 4MT7A 5BT1D 5E5AD 1HTAA 3AZHB 3W99A 4HATB 5D3WA 2IO5B 3A6ND 3TCAA 2D4QA 1V88A 1KX3B 2DTCA 1P3BA 3MGPA 2H7DA 3AYWD 2F8NH 4CSRA 3MGQC 3ODXA 1KU5A 4H8SA 3CIKA 3NQJB 5AV8D 3AZGD 2R09A 2RVQD 3RCPA 3W98A 4J8XB 1M7EA 5B31C 1P3AC 3W97D 1P3OA 3C1BC 3DXEA 1QC6A 1TJ6A 4F7UP 3AV1B 4E44A 4WU9A 3P6AA 1HQ3A 2J0MA 3X1UA 4TKNA 5AY8B 5FI0A 1BH9B 2DA0A 3NQJA 3SNHA 1FHWA 1S32C 4Z2MG 5B32A 4J8XA 4IAPA 4ZBJB 3V9RB 1MKEA 1P3KB 3QIJA 2D10A 1KX4A 2D9VA 5AV9B 2YSZA 2I5CA 5AY8A 5B2IC 1BFMA 3ZDTA 3VH6T 4EKUA 3AZND 2DX1A 4KUDB 2YS3A 3WKJC 1W1GA 3QWMA 5B1LD 1KX5B 2RUKB 5B0YA 1Q67A 3KY9A 4GMVA 3UTAA 4EMOA 3V9RA 1BH8B 4HAUB 1P3KA 3AFAB 4JJNB 3LELA 5GT3A 5DHAB 3FSSA 5AV9A 3PSCA 4AWLB 2YFWB 4J8WB 1EQZA 1WG7A 4ZRJA 3WA0A 1P3ID 3AZEA 4LD9D 1P3GA 5AVCD 1FOEA 2CWEA 4X23B 1BH8A 2HIOC 4GMXB 4WSFA 1BTNA 2LG1A 1KX3C 3WAAC 4J8UD 4G91C 3AZID 2P0HA 3REHB 1ZLAD 2YFWA 3VOQA 3REID 3R45A 3AZKD 2COAA 3MVDC 2VRWB 3LZ1D 2HTHB 3KXBD 4X23A 5AV5B 3X1VB 3P7ZA 3V5WA 5GXQC 3WTPB 3X23A 1IRSA 3AZLA 3REHA 1M7RA 4XWXA 4UUZB 5BS7C 4YS3B 1P34D 1PLSA 3AV1C 4H9RB 3X1TD 3REKD 2YFVB 1FAOA 5GSUC 5CPJB 4IFSA 2RLOA 3KRWA 2P8VA 4ZUXC 1ISNA 3WTPA 3LJAD 4KGCA 5B0ZC 5BNXB 2RSGA 4Z5TA 2Z0OA 3MGRC 3B6GA 1DDMA 1AWEA 4HDOA 5DNNB 2D2QA 4XUJD 3AV2C 1ZSQA 5CPJA 5AVBA 5CP6D 2COFA 5DIFB 3MGSB 2AROD 3TVVA 1LW3A 3WTPE 5BNXA 1NTYA 1PMSA 1M1AD 4KVGB 4J8VD 3B0DB 3AFAC 4JJNC 2NZDC 5B40A 4YM6B 1J19A 1H10A 1WI1A 3M1IB 2LULA 4J8WC 2FJ7A 3SUZA 1WWIA 1ID3A 5AV6B 1RJ2A 4H9PB 5G49B 3O62D 3W96B 2W2XD 4R8PC 1ZC3B 3WA9C 5CPKC 5GT0C 3MGRD 2MDXA 5DHFB 3SV1A 1P3FB 4MY6A 4Z2MB 3MDBC 3AZMD 3AYWB 5B33D 1AOIA 5G49A 4Z66C 5JRGA 5AV5C 2CRFA 5E5AA 4QLCD 1WJ1A 5D3VA 4KGCD 5AV8B 3A6NA 2QKLA 3AZGB 5B24C 4K17A 3ULCA 5LONB 1LB1A 1M18D 4YS3C 5B2JC 4XZQC 5LOPB 3W97B 3X1SD 1DYNA 1TAFB 3AYWA 5JA4A 1K5DB 2ROVA 4H9SA 5J3QA 4HGAB 3B0CT 1TZYD 2AL6A 2ELAA 1WGUA 5AV8A 4A6FB 3AZGA 3AZFD 4BBKA 1AQCA 3KUYD 1P3PB 1F66D 5D27A 3LZ0D 4DX8A 1U35C 2J59M 1DROA 5KDMA 5DNNC 3UT9D 3B6FD 4EO5C 3TU4D 2NQBD 1NTVA 3AU5A 5JP4A 3AZJB 1P3MB 3MGSC 4NE5A 3W99B 5B1LB 4YONA 3AN2D 4YM6C 2LY8A 4XZQD 3RELD 1X05A 2CAYA 3GYOA 4DXAB 2PYOD 1OQNA 5CPID 4YL8A 4CSRB 5AV6C 4HAZB 3AZNA 1P3LC 2QKMA 3W96C 5AVCB 5B1LA 5B1MD 4WU8D 5B31A 2VSZA 2NZ8B 5DNMD 1JFIA 3C1CC 3W98B 1P3FC 5KQ4A 1M19D 1P3OB 3AZIB 1U27A 3UTBC 4WU9B 4HDQA 3AZKB 1HQ3B 3MNNC 3X1UB 1P3IA 4LD9A 5AVCA 3REJC 3KXBB 1H3OA 5F99D 3D8DA 2EMSA 5B32B 2M38A 4J8UA 3AZIA 2F8ND 2D9YA 1KX4B 1ZLAA 3REIA 3AZKA 2P0FA 5D3YA 3X1TB 3LZ1A 3REKB 1P3LD 4NFTA 1BWNA 1EVHA 1P5TA 2BCJA 3KXBA 1DDVA 2UVMA 2Z0PA 2K00A 2DYNA 2CV5C 4KHBB 5B0YB 2D11A 3UTAB 4NY0A 3LJAB 3KWQC 4H9QB 1P3PC 2CY4A 1FHXA 2L5AA 5GT3B 3LELB 1P34A 3MGQD 3X1TA 3REKA 1EQZB 4G92C 4PQ0A 3AZJC 3REJD 1P3MC 3AZEB 1P3GB 3W99C 2MKRA 5J3YA 2AROB 4F7GA 3LJAA 5B31D 4H9QA 1P3AD 2F8NG 3C1BD 5FI1A 2L1CA 1P3BC 4CHJA 3MGPC 1P6SA 2YS5A 3TO1A 3TFMA 5C16A 3R45B 4NE6A 3DXCA 2JSSA 4XUJA 4KAXB 1MAIA 2HUEB 1UNQA 1S32D 4WZSB 5CP6A 3AZHC 4A6KA 5KQ1A 2AROA 1GC7A 2ZPYA 2IO5C 3O62B 1SHCA 1M1AA 4J8VA 3PVWA 3W98C 2DKQA 1B6WA 1ZM0A 3AZLB 1P3OC 1U29A 5DH9B 5KCVA 5B2ID 1V5PA 4WU9C 3X1UC 2YVCA 3WKJD 1X86A 1F1EA 5B31G 4A6HA 2ADZA 3O62A 3HQCA 4K2OA 4QLCB 3PEGA 4B6HA 1ZC4B 5B32C 4KGCB 4J8XC 4CAYB 2NMBA 3MGRA 1TXDA 4Z5TB 1H4RA 1KX4C 3B6GB 5FUGA 3VH6W 1V61A 2YRYA 4Z2NA 3AZMA 1UNPA 4MK0A 5AY8C 3TW1A 2AEHA 5B33A 5AVBB 2W2WA 2DHKA 3PZDA 2HIOD 4QLCA 3PVUA 5BO0A 5B0YC 2CY5A 2RGNB 1KX3D 4CAYA 3UTAC 4ZBJC 3WAAD 3AZFB 1P3KC 4P7IA 1U5FA 3VH5T 3LELC 4H9OA 5GT3C 5B40B 1M18A 3U8ZA 5AV9C 1F66B 3MVDD 3X1SA 5CHLB 2EC1A 4K81A 3D8EA 1EQZC 1GC6A 2FJ7B 2Z0QA 1TZYA 3TU4B 3AZEC 3VH6A 1P3GC 5GXQD 1ID3B 4KUDC 2NQBB 1KX5C 1X1FA 2LOZA
chains in the Genus database with same CATH superfamily
2RNRB 3FDDA 2J0JA 1MIZB 5DI9B 1F66A 2MWNB 3RELB 4EJNA 3UT9A 5GSUD 1N1JB 2FJLA 4HHVA 1ZVRA 4XZQA 3RELA 3REHC 5DNMB 1FHOA 2PYOA 1N1JA 1FGZA 2Y8FA 3AFAD 4DBBA 2E2XA 4WU8A 3NWFA 5DNMA 4J8WD 2F8NB 5KDMB 2J0KA 3N7CA 5GT0D 2LOXA 3KRXA 2F8NA 2FJ7C 1MPHA 1ID3C 5B24D 4H9NB 1WGQA 1R4VA 4YS3D 5B31B 1P3AB 3DXDA 4L6EA 2XQNM 1BTKA 1B55A 4F7HA 4H9NA 1H3OB 5BNVA 1UPQA 1P3AA 3ODWA 1U35D 2Z59A 4J8UB 3B0CW 3WYFB 4H9SC 5C3IB 3LZ1B 3GYPA 3AZGC 1Q9CA 3W97C 1U5GA 1P34B 3W96D 1Y5OA 1W2EA 5J3TA 4C0AA 3C1CD 3U12A 5C79A 4G91B 2DHJA 3MVDB 3AZHA 1KZGA 5LG4B 4DRBA 3MVDA 2UZRA 4WNNB 5GSUB 2EMTA 1U5DA 4J8UC 4WNNA 3AZMB 2DHIA 5C3IC 5GSUA 3LZ1C 5B33B 2Y7BA 3KXBC 3MGPD 4H9OB 1P34C 3X1TC 3REKC 3AFAA 1UEFA 5GT0B 1EAZA 4J8WA 3X1UD 1T3UA 3B6FB 2DFKA 5B32D 2Y8GA 5JLJB 5GT0A 5B24B 5AY8D 4HSIA 1FGYA 3UTAD 1W1DA 5B24A 4YS3A 2G35A 1U35B 2ZM5A 1M19B 3AZMC 3AZED 5B33C 2ELBA 4QLCC 1U35A 2EJ8A 2I5FA 4X23D 1P3LB 3AZFC 3C1CB 2OQBA 3B6FC 5C6RA 3W96A 3REJB 1NI2A 4Z5TD 3C1CA 4K2PA 3HK0A 3KZ1A 4L1RA 5CPJD 5JRGC 2YS1A 2DX5A 2CODA 1M19C 5B2IB 1U2BA 2P0DA 2BYKB 3B0BA 3ULBA 3U7DA 2IYBA 1OY2A 3MGPB 1MIXA 1DDWA 3HSAA 3KSYA 4MT7A 5BT1D 3A6ND 3MGPA 2H7DA 1KU5A 4H8SA 3NQJB 2R09A 2RVQD 1M7EA 5I2SA 3AV1B 3X1UA 5AY8B 5FI0A 1BH9B 2DA0A 3NQJA 4Z2MG 5B32A 2D10A 5AY8A 5B2IC 4KHBA 2YS3A 4KUDB 3QWMA 3OHMB 5B1LD 3UTAA 1BH8B 4JJNB 3PSCA 1WG7A 3WA0A 1P3ID 3AZEA 5AVCD 1FOEA 4X23B 1BH8A 2LG1A 3NWDA 1ZLAD 2HTHB 4X23A 4XWXA 5BS7C 4QJ4B 1PLSA 3AV1C 2BG1A 1FAOA 5CPJB 2RLOA 4KGCA 5B0ZC 3EPKA 2RSGA 4Z5TA 1AWEA 4HDOA 1ZSQA 3EPJA 5CPJA 5CP6D 3MGSB 2AROD 3TVVA 4KVGB 4JJNC 1H10A 2NZDC 2W2XD 3WA9C 5CPKC 3MGRD 1P3FB 4MY6A 3MDBC 4Z66C 2CRFA 1WJ1A 3A6NA 1LB1A 3X1SD 1DYNA 4HGAB 1WGUA 5D27A 3LZ0D 2J59M 3A1KA 2Y2PA 4EO5C 3MGSC 4NE5A 3W99B 3H0MC 5B1LB 2LY8A 1X05A 1OQNA 4CSRB 5AVCB 5B1LA 5B1MD 1P3FC 1P3OB 4WU9B 3MNNC 1P3IA 5AVCA 2EMSA 2M38A 1ZLAA 2F2AC 2UVMA 5DHAB 2BCJA 5B0YB 2D11A 3KWQC 3MGQD 1EQZB 3W99C 2AROB 2F8NG 3C1BD 5FI1A 1P3BC 2Y2QA 2YS5A 2DF4C 3R45B 1MAIA 2HUEB 1S32D 4WZSB 5CP6A 2AROA 2KUQA 1B6WA 3AZLB 1P3OC 4WU9C 5B31G 4B6HA 1ZC4B 3EPLA 3MGRA 1TXDA 1H4RA 3B6GB 3VH6W 4Z2NA 1UNPA 3TW1A 5AVBB 2HIOD 5BO0A 5B0YC 2RGNB 4P7IA 4ZBJC 1P3KC 5B40B 4K81A 3X1SA 5CHLB 3D8EA 1EQZC 2Z0QA 5GXQD 4GOUA 5GOWB 4HAWB 2Y2HA 3LZ0A 2HUEC 3F0WA 1B67A 4ZUXD 5E5AB 1I2HA 3AZLC 3AV2D 5JA4B 4IOYX 1KX5D 3X1VC 1BAKA 5B1MA 5AVBC 3BINA 4R8PD 5B40C 1ULYA 1XD4A 3AZNB 2RIQA 2R0DA 4E45A 3C1BB 2GUMA 3MGQA 4WV4B 5E5AC 3C1BA 3A8QA 2J8PA 3KFUG 1MK7B 1S32A 1T77A 5JHGA 2GCJA 4NSWA 5HE1A 5AV6D 2I1JA 2HIOB 2DN6A 3FM8C 3QBVB 1EF1A 3AZNC 2HIOA 5GXQB 4GPTB 5GXQA 4ZUXB 1W1HA 1P3PD 4HB2B 3AZIC 1V5UA 3AZJD 3AV2B 1HQ3C 4ZUXA 1J0WA 1M18B 4GXBA 1OMWA 3AV2A 3AZHD 1TZYB 1KX5A 4OT1A 4R8PB 3W98D 3LJAC 1WVHA 4KHOA 1NU2A 3UT9B 2JP2A 4PNKA 4R8PA 3BJIA 4XZQB 2N0YA 2PYOB 5HE2A 2ZY2A 3HIEA 3LELD 5GT3D 4UUZA 5AV9D 4WU8B 4H9RA 3ODOA 4KHAB 2YFVA 1P3GD 5B32G 1M18C 4KHAA 1KI1B 2D9WA 2Y2OA 1TZYC 1F66C 5JHHA 5AV6A 3AL0C 3UT9C 4DX90 3WTPD 2LYDA 4Y94A 5BNVB 3AU4A 3RELC 5HE3A 2PYOC 2COCA 3PG7A 4A5KA 4WU8C 3W97A 5DNMC 1TQZA 4G92B 3D8FA 4A6FA 2YT2A 1MK9B 3P5JB 1P3PA 3HW2B 3AZJA 1AOID 5JRGD 3AZHB 5D3WA 2IO5B 3TCAA 2D4QA 3AYWD 5AV8D 3RCPA 3W98A 5B31C 1P3AC 3P6AA 2J0MA 3QIJA 5AV9B 3KY9A 4EMOA 2UWXA 3AFAB 2Z14A 3LELA 5GT3A 3FSSA 5AV9A 4AWLB 4J8WB 4LD9D 1P3GA 4GNKB 4GMXB 4G91C 2P0HA 3REID 3AZKD 3MVDC 3P7ZA 3V5WA 3WTPB 4YS3B 5GSUC 1ISNA 3WTPA 2Z0OA 1DDMA 4XUJD 1PMSA 1M1AD 4J8VD 3B0DB 3AFAC 1J19A 4CSQA 4J8WC 5G49B 3O62D 3W96B 5GT0C 5DHFB 3SV1A 3AYWB 1AOIA 5G49A 5JRGA 4KGCD 5AV8B 5B24C 4YS3C 3AYWA 2AL6A 5AV8A 4BBKA 1AQCA 3KUYD 4DX8A 2VQRA 1U35C 3TU4D 2NQBD 3AN2D 5CPID 1P3LC 3W96C 1JFIA 3C1CC 1U27A 3AZKB 3X1UB 2KR0A 4LD9A 3REJC 3D8DA 5F99D 5B32B 3REIA 3AZKA 4NFTA 4KHBB 3UTAB 1FHXA 4PQ0A 3AZEB 3NWAA 2Z4DA 3MGPC 5C16A 4XUJA 4KAXB 2ZPYA 3O62B 4QXAB 1M1AA 4J8VA 3PVWA 2DKQA 3X1UC 3WKJD 1F1EA 2ADZA 3O62A 5B32C 4KGCB 4Z5TB 5FUGA 5AY8C 2W2WA 3PVUA 1KX3D 3UTAC 3WAAD 3VH5T 3TU4B 3AZEC 4KUDC 2NQBB 5HE0A 2PZ1A 3KUYA 4CYEA 2LKOA 3TU4A 2NQBA 5CPIB 4X23C 2BYMA 3A6NB 3AN2A 5CPIA 3H0RC 4Z5TC 2DKPA 5CPJC 4CHMA 3F6TA 1DBHA 5F99A 3NQUA 2DQNC 2GJYA 3PP2A 5AV5D 1XODA 5B2JD 2KUPA 1P3IB 3LJUX 5BT1C 5D3XA 3A1IA 3A6NC 5DNND 1ZLAB 4HAYB 2KIGA 3WKJB 4YM6D 2RVQC 4Z2MH 2D9ZA 1E5WA 4HGAC 3WKJA 4GZUA 3WAAB 3UTBD 2YT1A 4ZRKA 3O96A 5CP6B 2M14A 5B1LC 5IRSA 1KX3A 3WAAA 2ROZB 2JE5A 1P3IC 2CV5D 1Z87A 5AVCC 2IFSA 2XD1A 3MGRB 3ML4A 1ZLAC 1P3MD 1PZRA 5BO0B 1N3HA 4HB3B 4HAVB 3X1SB 4WJ7A 2L2IA 3LZ0B 1HQ3D 1P3RA 2RRFA 2GS0A 5CP6C 3G9WA 2AROC 4J8XD 1KX4D 5B2JB 3FEHA 2UZSA 5AV5A 3X1VA 2W2XC 4M6BA 4HB0B 5B2JA 5B1MB 2K49A 2YT0A 3B6GC 4D0NB 5DNNA 3X1SC 2NBVA 3T06A 3PVLA 4YM6A 1Y19B 3REHD 3VH5A 3LZ0C 3UTBB 2ZY4A 3MGQB 4H9PA 3NSUA 2F8NK 3UTBA 1S32B 2CV5B 3SO6A 5B1MC 4TYZA 1FB8A 1TAFA 2FJ7D 1ID3D 1A7WA 2CV5A 1XKEA 1K5GB 3EG5B 1P3MA 1V88A 2ZY3A 2DTCA 2F8NH 3ODXA 3MGQC 3AZGD 4J8XB 3W97D 3C1BC 3DXEA 1TJ6A 4F7UP 1HQ3A 4TKNA 2Y2JA 3SNHA 1FHWA 1S32C 4J8XA 4IAPA 3V9RB 1MKEA 1KX4A 3ZDTA 2DX1A 1W1GA 4GMVA 1KX5B 3H0LC 3V9RA 5I2MA 4WJ3C 2CWEA 2HIOC 4WSFA 1BTNA 4J8UD 3REHB 3VOQA 2XD5A 2VRWB 3LZ1D 3KXBD 3FVCA 5GXQC 3REHA 1M7RA 4UUZB 1P34D 4H9RB 3X1TD 3REKD 2YFVB 4ZUXC 3AV2C 4QJ5B 2COFA 3WTPE 3X23A 1WI1A 3M1IB 2FJ7A 1ID3A 5AV6B 1RJ2A 4R8PC 1ZC3B 3AZMD 5B33D 4QLCD 2Y2KA 2QKLA 3AZGB 5LONB 4XZQC 5LOPB 3W97B 2ROVA 4H9SA 3B0CT 4A6FB 3AZGA 3AZFD 1P3PB 3NW8A 1DROA 5KDMA 3B6FD 1NTVA 5JP4A 3AZJB 3GYOA 4DXAB 5AV6C 4HAZB 5B31A 3W98B 1M19D 4UPKA 4HDQA 2W8SA 2Y2NA 3KXBB 1H3OA 2ZY5A 4J8UA 5D3YA 3X1TB 3LZ1A 3REKB 1P3LD 1BWNA 2Z0PA 3KXBA 1DDVA 4NY0A 2CY4A 1P3PC 3LELB 5GT3B 1P34A 3X1TA 3REKA 4G92C 3AZJC 3REJD 1P3GB 2MKRA 2G5IC 2L1CA 1Z2CB 3TO1A 2JSSA 4A6KA 3AZHC 5KQ1A 2IO5C 1SHCA 3W98C 1ZM0A 5KCVA 5B2ID 2YVCA 1X86A 3HQCA 4K2OA 4QLCB 3PEGA 4CAYB 3AZMA 2AEHA 5B33A 2DHKA 4QLCA 2CY5A 2G5HC 4CAYA 3AZFB 1U5FA 3LELC 4H9OA 5GT3C 3U8ZA 5AV9C 2EC1A 1P3GC 2LOZA 3AZFA 2MFQA 3AV1D 4AWLC 2X18A 3B6FA 1XCGA 1AOIB 5JRGB 5B0ZD 3B77A 1KZ7A 4KUDD 2DYQA 1QQGA 4JJND 2NZDD 5C5BB 3WTPC 1EGXA 1M19A 2R2YA 4DQYB 3WA9D 5C5BA 5CPKD 3SYXA 5M4YB 2DLWA 3IVFA 1UPRA 4Z66D 2OTXA 1P3LA 3AJ4A 3B0DC 2H7EA 4GN1A 1JFIB 3REJA 1AOIC 2KIEA 4LD9B 2KCJA 2Y2MA 3CXBB 1I7AA 3AYWC 3REIB 3MGSD 2Z13A 5AV8C 5L81A 3ZVRA 5B2IA 1ZYIA 2BYKA 5EFXA 1GG3A 1P3FD 2I1KA 1UNRA 3OANA 3MNND 4NE3A 2V76A 4XUJB 3A8PA 2N23A 2K2UA 1X1GA 4HB4B 2JCHA 1M1AB 4J8VB 1X11A 1V89A 2YF0A 5CLLB 4LD9C 1SGHA 3KWQD 2FJUB 5B0ZB 5BS7A 3AV1A 3A98B 5FUGB 3REIC 1BH9A 3AZKC 1PFJA 2D9XA 3W99D 2Q13A 5B0ZA 4WVFB 2NZDB 1P3BD 1RRPB 3F5RA 2VKIA 4KUDA 2HE7A 2K8EA 4JJNA 3WA9B 2NZDA 5CPKB 1P3OD 3KUYB 4WU9D 4XUJC 4Z66B 3WA9A 5CPKA 4DRAA 1M1AC 2BYMB 4J8VC 3AN2B 4Z66A 4OSNA 5B0YD 3O62C 1P3KD 2ZKMX 1EQZD 4EO5B 1WJMA 3VH5W 5F99B 4KGCC 3VIAA 3NQUB 2K2JA 2RVBB 3MGSA 1V5MA 1XX0A 4ZRIA 3AZLD 1XR0B 3KUYC 3MPXA 3MNNB 3TU4C 3X1VD 2NQBC 1WWSA 1P3FA 3AN2C 3B6GD 3MNNA 5AVBD 5CPIC 3UZTA 5B40D 3KWQB 2KGXB 3IP4C 2GCLA 5CLQB 5F99C 3KWQA 1P3BB 4HAXB 1U5EA 5E5AD 1HTAA 3W99A 4HATB 1KX3B 1P3BA 4CSRA 3CIKA 1P3OA 1QC6A 4D6WA 4E44A 4WU9A 4ZBJB 1P3KB 2D9VA 2YSZA 2I5CA 1BFMA 3VH6T 4EKUA 3AZND 3WKJC 2RUKB 5B0YA 1Q67A 4HAUB 1P3KA 2YFWB 1EQZA 4ZRJA 1KX3C 3WAAC 3AZID 2YFWA 3R45A 2COAA 5AV5B 3X1VB 1IRSA 3AZLA 4DIXA 4IFSA 3KRWA 2P8VA 3LJAD 5BNXB 3MGRC 3B6GA 5DNNB 2D2QA 5AVBA 5DIFB 1LW3A 1NTYA 5BNXA 5B40A 4YM6B 2LULA 3SUZA 1WWIA 4H9PB 2MDXA 4Z2MB 2Y2GA 2Y2IA 5AV5C 5E5AA 5D3VA 4K17A 3ULCA 1M18D 3DCXA 5B2JC 1K5DB 4QJ3B 1TAFB 5JA4A 5J3QA 1TZYD 2ELAA 1F66D 5DNNC 3AU5A 3UT9D 1P3MB 4YONA 4YM6C 4XZQD 3RELD 2CAYA 2PYOD 4YL8A 3AZNA 2QKMA 4WU8D 2VSZA 5KQ4A 2NZ8B 5DNMD 3AZIB 3UTBC 3EPHA 1HQ3B 3A58A 2Y2LA 3AZIA 2F8ND 2D9YA 1KX4B 2P0FA 1P5TA 1EVHA 2K00A 2DYNA 2CV5C 3LJAB 4H9QB 2L5AA 2FFFB 1P3MC 5J3YA 4F7GA 3LJAA 5B31D 4H9QA 1P3AD 4CHJA 1P6SA 3TFMA 4NE6A 3DXCA 1UNQA 1GC7A 1MI1A 1U29A 5DH9B 1V5PA 4A6HA 4J8XC 2NMBA 1KX4C 2YRYA 1V61A 4MK0A 3PZDA 1M18A 1F66B 3MVDD 1GC6A 2FJ7B 1TZYA 1ID3B 3VH6A 1X1FA 1KX5C
chains in the Genus database with same CATH topology
2RNRB 3FDDA 2J0JA 1MIZB 5DI9B 1F66A 2MWNB 3RELB 4EJNA 3UT9A 5GSUD 1N1JB 2FJLA 4HHVA 1ZVRA 4XZQA 3RELA 3REHC 5DNMB 1FHOA 2PYOA 1N1JA 1FGZA 2Y8FA 3AFAD 4DBBA 2E2XA 4WU8A 3NWFA 5DNMA 4J8WD 2F8NB 5KDMB 2J0KA 3N7CA 5GT0D 2LOXA 3KRXA 2F8NA 2FJ7C 1MPHA 1ID3C 5B24D 4H9NB 1WGQA 1R4VA 4YS3D 5B31B 1P3AB 3DXDA 4L6EA 2XQNM 1BTKA 1B55A 4F7HA 4H9NA 1H3OB 5BNVA 1UPQA 1P3AA 3ODWA 1U35D 2Z59A 4J8UB 3B0CW 3WYFB 4H9SC 5C3IB 3LZ1B 3GYPA 3AZGC 1Q9CA 3W97C 1U5GA 1P34B 3W96D 1Y5OA 1W2EA 5J3TA 4C0AA 3C1CD 3U12A 5C79A 4G91B 2DHJA 3MVDB 3AZHA 1KZGA 5LG4B 4DRBA 3MVDA 2UZRA 4WNNB 5GSUB 2EMTA 1U5DA 4J8UC 4WNNA 3AZMB 2DHIA 5C3IC 5GSUA 3LZ1C 5B33B 2Y7BA 3KXBC 3MGPD 4H9OB 1P34C 3X1TC 3REKC 3AFAA 1UEFA 5GT0B 1EAZA 4J8WA 3X1UD 1T3UA 3B6FB 2DFKA 5B32D 2Y8GA 5JLJB 5GT0A 5B24B 5AY8D 4HSIA 1FGYA 3UTAD 1W1DA 5B24A 4YS3A 2G35A 1U35B 2ZM5A 1M19B 3AZMC 3AZED 5B33C 2ELBA 4QLCC 1U35A 2EJ8A 2I5FA 4X23D 1P3LB 3AZFC 3C1CB 2OQBA 3B6FC 5C6RA 3W96A 3REJB 1NI2A 4Z5TD 3C1CA 4K2PA 3HK0A 3KZ1A 4L1RA 5CPJD 5JRGC 2YS1A 2DX5A 2CODA 1M19C 5B2IB 1U2BA 2P0DA 2BYKB 3B0BA 3ULBA 3U7DA 2IYBA 1OY2A 3MGPB 1MIXA 1DDWA 3KSYA 4MT7A 5BT1D 3A6ND 3MGPA 2H7DA 1KU5A 4H8SA 3NQJB 2R09A 2RVQD 1M7EA 5I2SA 3AV1B 3X1UA 5AY8B 5FI0A 1BH9B 2DA0A 3NQJA 4Z2MG 5B32A 2D10A 5AY8A 5B2IC 4KHBA 2YS3A 4KUDB 3QWMA 3OHMB 5B1LD 3UTAA 1BH8B 4JJNB 3PSCA 1WG7A 3WA0A 1P3ID 3AZEA 5AVCD 1FOEA 4X23B 1BH8A 2LG1A 3NWDA 1ZLAD 2HTHB 4X23A 4XWXA 5BS7C 4QJ4B 1PLSA 3AV1C 2BG1A 1FAOA 5CPJB 2RLOA 4KGCA 5B0ZC 3EPKA 2RSGA 4Z5TA 1AWEA 4HDOA 1ZSQA 3EPJA 5CPJA 5CP6D 3MGSB 2AROD 3TVVA 4KVGB 4JJNC 1H10A 2NZDC 2W2XD 3WA9C 5CPKC 3MGRD 1P3FB 4MY6A 3MDBC 4Z66C 2CRFA 1WJ1A 3A6NA 1LB1A 3X1SD 1DYNA 4HGAB 1WGUA 5D27A 3LZ0D 2J59M 3A1KA 2Y2PA 4EO5C 3MGSC 4NE5A 3W99B 3H0MC 5B1LB 2LY8A 1X05A 1OQNA 4CSRB 5AVCB 5B1LA 5B1MD 1P3FC 1P3OB 4WU9B 3MNNC 1P3IA 5AVCA 2EMSA 2M38A 1ZLAA 2F2AC 2UVMA 5DHAB 2BCJA 5B0YB 2D11A 3KWQC 3MGQD 1EQZB 3W99C 2AROB 2F8NG 3C1BD 5FI1A 1P3BC 2Y2QA 2YS5A 2DF4C 3R45B 1MAIA 2HUEB 1S32D 4WZSB 5CP6A 2AROA 2KUQA 1B6WA 3AZLB 1P3OC 4WU9C 5B31G 4B6HA 1ZC4B 3EPLA 3MGRA 1TXDA 1H4RA 3B6GB 3VH6W 4Z2NA 1UNPA 3TW1A 5AVBB 2HIOD 5BO0A 5B0YC 2RGNB 4P7IA 4ZBJC 1P3KC 5B40B 4K81A 3X1SA 5CHLB 3D8EA 1EQZC 2Z0QA 5GXQD 4GOUA 5GOWB 4HAWB 2Y2HA 3LZ0A 2HUEC 3F0WA 1B67A 4ZUXD 5E5AB 1I2HA 3AZLC 3AV2D 5JA4B 4IOYX 1KX5D 3X1VC 1BAKA 5B1MA 5AVBC 3BINA 4R8PD 5B40C 1ULYA 1XD4A 3AZNB 2RIQA 2R0DA 4E45A 3C1BB 2GUMA 3MGQA 4WV4B 5E5AC 3C1BA 3A8QA 2J8PA 3KFUG 1MK7B 1S32A 5JHGA 2GCJA 4NSWA 5HE1A 5AV6D 2I1JA 2HIOB 2DN6A 3FM8C 3QBVB 1EF1A 3AZNC 2HIOA 5GXQB 4GPTB 5GXQA 4ZUXB 1W1HA 1P3PD 4HB2B 3AZIC 1V5UA 3AZJD 3AV2B 1HQ3C 4ZUXA 1J0WA 1M18B 4GXBA 1OMWA 3AV2A 3AZHD 1TZYB 1KX5A 4OT1A 4R8PB 3W98D 3LJAC 1WVHA 4KHOA 1NU2A 3UT9B 2JP2A 4PNKA 4R8PA 3BJIA 4XZQB 2N0YA 2PYOB 5HE2A 2ZY2A 3HIEA 3LELD 5GT3D 4UUZA 5AV9D 4WU8B 4H9RA 3ODOA 4KHAB 2YFVA 1P3GD 5B32G 1M18C 4KHAA 1KI1B 2D9WA 2Y2OA 1TZYC 1F66C 5JHHA 5AV6A 3AL0C 3UT9C 4DX90 3WTPD 2LYDA 4Y94A 5BNVB 3AU4A 3RELC 5HE3A 2PYOC 2COCA 3PG7A 4A5KA 4WU8C 3W97A 5DNMC 1TQZA 4G92B 3D8FA 4A6FA 2YT2A 1MK9B 3P5JB 1P3PA 3HW2B 3AZJA 1AOID 5JRGD 3AZHB 5D3WA 2IO5B 3TCAA 2D4QA 3AYWD 5AV8D 3RCPA 3W98A 5B31C 1P3AC 3P6AA 2J0MA 3QIJA 5AV9B 3KY9A 4EMOA 2UWXA 3AFAB 2Z14A 3LELA 5GT3A 3FSSA 5AV9A 4AWLB 4J8WB 4LD9D 1P3GA 4GNKB 4GMXB 4G91C 2P0HA 3REID 3AZKD 3MVDC 3P7ZA 3V5WA 3WTPB 4YS3B 5GSUC 1ISNA 3WTPA 2Z0OA 1DDMA 4XUJD 1PMSA 1M1AD 4J8VD 3B0DB 3AFAC 1J19A 4CSQA 4J8WC 5G49B 3O62D 3W96B 5GT0C 5DHFB 3SV1A 3AYWB 1AOIA 5G49A 5JRGA 4KGCD 5AV8B 5B24C 4YS3C 3AYWA 2AL6A 5AV8A 4BBKA 1AQCA 3KUYD 4DX8A 2VQRA 1U35C 3TU4D 2NQBD 3AN2D 5CPID 1P3LC 3W96C 1JFIA 3C1CC 1U27A 3AZKB 3X1UB 2KR0A 4LD9A 3REJC 3D8DA 5F99D 5B32B 3REIA 3AZKA 4NFTA 4KHBB 3UTAB 1FHXA 4PQ0A 3AZEB 3NWAA 2Z4DA 3MGPC 5C16A 4XUJA 4KAXB 2ZPYA 3O62B 4QXAB 1M1AA 4J8VA 3PVWA 2DKQA 3X1UC 3WKJD 1F1EA 2ADZA 3O62A 5B32C 4KGCB 4Z5TB 5FUGA 5AY8C 2W2WA 3PVUA 1KX3D 3UTAC 3WAAD 3VH5T 3TU4B 3AZEC 4KUDC 2NQBB 5HE0A 2PZ1A 3KUYA 4CYEA 2LKOA 3TU4A 2NQBA 5CPIB 4X23C 2BYMA 3A6NB 3AN2A 5CPIA 3H0RC 4Z5TC 2DKPA 5CPJC 4CHMA 3F6TA 1DBHA 5F99A 3NQUA 2DQNC 2GJYA 3PP2A 5AV5D 1XODA 5B2JD 2KUPA 1P3IB 3LJUX 5BT1C 5D3XA 3A1IA 3A6NC 5DNND 1ZLAB 4HAYB 2KIGA 3WKJB 4YM6D 2RVQC 4Z2MH 2D9ZA 1E5WA 4HGAC 3WKJA 4GZUA 3WAAB 3UTBD 2YT1A 4ZRKA 3O96A 5CP6B 2M14A 5B1LC 5IRSA 1KX3A 3WAAA 2ROZB 2JE5A 1P3IC 2CV5D 1Z87A 5AVCC 2IFSA 2XD1A 3MGRB 3ML4A 1ZLAC 1P3MD 1PZRA 5BO0B 1N3HA 4HB3B 4HAVB 3X1SB 4WJ7A 2L2IA 3LZ0B 1HQ3D 1P3RA 2RRFA 2GS0A 5CP6C 3G9WA 2AROC 4J8XD 1KX4D 5B2JB 3FEHA 2UZSA 5AV5A 3X1VA 2W2XC 4M6BA 4HB0B 5B2JA 5B1MB 2K49A 2YT0A 3B6GC 4D0NB 5DNNA 3X1SC 2NBVA 3T06A 3PVLA 4YM6A 1Y19B 3REHD 3VH5A 3LZ0C 3UTBB 2ZY4A 3MGQB 4H9PA 3NSUA 2F8NK 3UTBA 1S32B 2CV5B 3SO6A 5B1MC 4TYZA 1FB8A 1TAFA 2FJ7D 1ID3D 1A7WA 2CV5A 1XKEA 1K5GB 3EG5B 1P3MA 1V88A 2ZY3A 2DTCA 2F8NH 3ODXA 3MGQC 3AZGD 4J8XB 3W97D 3C1BC 3DXEA 1TJ6A 4F7UP 1HQ3A 4TKNA 2Y2JA 3SNHA 1FHWA 1S32C 4J8XA 4IAPA 3V9RB 1MKEA 1KX4A 3ZDTA 2DX1A 1W1GA 4GMVA 1KX5B 3H0LC 3V9RA 5I2MA 4WJ3C 2CWEA 2HIOC 4WSFA 1BTNA 4J8UD 3REHB 3VOQA 2XD5A 2VRWB 3LZ1D 3KXBD 3FVCA 5GXQC 3REHA 1M7RA 4UUZB 1P34D 4H9RB 3X1TD 3REKD 2YFVB 4ZUXC 3AV2C 4QJ5B 2COFA 3WTPE 3X23A 1WI1A 3M1IB 2FJ7A 1ID3A 5AV6B 1RJ2A 4R8PC 1ZC3B 3AZMD 5B33D 4QLCD 2Y2KA 2QKLA 3AZGB 5LONB 4XZQC 5LOPB 3W97B 2ROVA 4H9SA 3B0CT 4A6FB 3AZGA 3AZFD 1P3PB 3NW8A 1DROA 5KDMA 3B6FD 1NTVA 5JP4A 3AZJB 3GYOA 4DXAB 5AV6C 4HAZB 5B31A 3W98B 1M19D 4UPKA 4HDQA 2W8SA 2Y2NA 3KXBB 1H3OA 2ZY5A 4J8UA 5D3YA 3X1TB 3LZ1A 3REKB 1P3LD 1BWNA 2Z0PA 3KXBA 1DDVA 4NY0A 2CY4A 1P3PC 3LELB 5GT3B 1P34A 3X1TA 3REKA 4G92C 3AZJC 3REJD 1P3GB 2MKRA 2G5IC 2L1CA 1Z2CB 3TO1A 2JSSA 4A6KA 3AZHC 5KQ1A 2IO5C 1SHCA 3W98C 1ZM0A 5KCVA 5B2ID 2YVCA 1X86A 3HQCA 4K2OA 4QLCB 3PEGA 4CAYB 3AZMA 2AEHA 5B33A 2DHKA 4QLCA 2CY5A 2G5HC 4CAYA 3AZFB 1U5FA 3LELC 4H9OA 5GT3C 3U8ZA 5AV9C 2EC1A 1P3GC 2LOZA 3AZFA 2MFQA 3AV1D 4AWLC 2X18A 3B6FA 1XCGA 1AOIB 5JRGB 5B0ZD 1KZ7A 4KUDD 2DYQA 1QQGA 4JJND 2NZDD 5C5BB 3WTPC 1EGXA 1M19A 2R2YA 4DQYB 3WA9D 5C5BA 5CPKD 3SYXA 5M4YB 2DLWA 3IVFA 1UPRA 4Z66D 2OTXA 1P3LA 3AJ4A 3B0DC 2H7EA 4GN1A 1JFIB 3REJA 1AOIC 2KIEA 4LD9B 2KCJA 2Y2MA 3CXBB 1I7AA 3AYWC 3REIB 3MGSD 2Z13A 5AV8C 5L81A 3ZVRA 5B2IA 1ZYIA 2BYKA 5EFXA 1GG3A 1P3FD 2I1KA 1UNRA 3OANA 3MNND 4NE3A 2V76A 4XUJB 3A8PA 2N23A 2K2UA 1X1GA 4HB4B 2JCHA 1M1AB 4J8VB 1X11A 1V89A 2YF0A 5CLLB 4LD9C 1SGHA 3KWQD 2FJUB 5B0ZB 5BS7A 3AV1A 3A98B 5FUGB 3REIC 1BH9A 3AZKC 1PFJA 2D9XA 3W99D 2Q13A 5B0ZA 4WVFB 2NZDB 1P3BD 1RRPB 3F5RA 2VKIA 4KUDA 2HE7A 2K8EA 4JJNA 3WA9B 2NZDA 5CPKB 1P3OD 3KUYB 4WU9D 4XUJC 4Z66B 3WA9A 5CPKA 4DRAA 1M1AC 2BYMB 4J8VC 3AN2B 4Z66A 4OSNA 5B0YD 3O62C 1P3KD 2ZKMX 1EQZD 4EO5B 1WJMA 3VH5W 5F99B 4KGCC 3VIAA 3NQUB 2K2JA 2RVBB 3MGSA 1V5MA 1XX0A 4ZRIA 3AZLD 1XR0B 3KUYC 3MPXA 3MNNB 3TU4C 3X1VD 2NQBC 1WWSA 1P3FA 3AN2C 3B6GD 3MNNA 5AVBD 5CPIC 3UZTA 5B40D 3KWQB 2KGXB 3IP4C 2GCLA 5CLQB 5F99C 3KWQA 1P3BB 4HAXB 1U5EA 5E5AD 1HTAA 3W99A 4HATB 1KX3B 1P3BA 4CSRA 3CIKA 1P3OA 1QC6A 4D6WA 4E44A 4WU9A 4ZBJB 1P3KB 2D9VA 2YSZA 2I5CA 1BFMA 3VH6T 4EKUA 3AZND 3WKJC 2RUKB 5B0YA 1Q67A 4HAUB 1P3KA 2YFWB 1EQZA 4ZRJA 1KX3C 3WAAC 3AZID 2YFWA 3R45A 2COAA 5AV5B 3X1VB 1IRSA 3AZLA 4DIXA 4IFSA 3KRWA 2P8VA 3LJAD 5BNXB 3MGRC 3B6GA 5DNNB 2D2QA 5AVBA 5DIFB 1LW3A 1NTYA 5BNXA 5B40A 4YM6B 2LULA 3SUZA 1WWIA 4H9PB 2MDXA 4Z2MB 2Y2GA 2Y2IA 5AV5C 5E5AA 5D3VA 4K17A 3ULCA 1M18D 5B2JC 1K5DB 4QJ3B 1TAFB 5JA4A 5J3QA 1TZYD 2ELAA 1F66D 5DNNC 3AU5A 3UT9D 1P3MB 4YONA 4YM6C 4XZQD 3RELD 2CAYA 2PYOD 4YL8A 3AZNA 2QKMA 4WU8D 2VSZA 5KQ4A 2NZ8B 5DNMD 3AZIB 3UTBC 3EPHA 1HQ3B 3A58A 2Y2LA 3AZIA 2F8ND 2D9YA 1KX4B 2P0FA 1P5TA 1EVHA 2K00A 2DYNA 2CV5C 3LJAB 4H9QB 2L5AA 2FFFB 1P3MC 5J3YA 4F7GA 3LJAA 5B31D 4H9QA 1P3AD 4CHJA 1P6SA 3TFMA 4NE6A 3DXCA 1UNQA 1GC7A 1U29A 5DH9B 1V5PA 4A6HA 4J8XC 2NMBA 1KX4C 2YRYA 1V61A 4MK0A 3PZDA 1M18A 1F66B 3MVDD 1GC6A 2FJ7B 1TZYA 1ID3B 3VH6A 1X1FA 1KX5C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5GOW B;  2RNR B;  2J0J A;  3AZF A;  4HAW B;  1MIZ B;  2MFQ A;  2PZ1 A;  3KUY A;  3AV1 D;  1F66 A;  2MWN B;  3LZ0 A;  4AWL C;  3REL B;  5DI9 B;  4CYE A;  4EJN A;  2LKO A;  2X18 A;  3UT9 A;  5GSU D;  1N1J B;  3TU4 A;  5CPI B;  2HUE C;  2NQB A;  3B6F A;  1B67 A;  1XCG A;  1AOI B;  2FJL A;  4ZUX D;  3F0W A;  5JRG B;  4X23 C;  5B0Z D;  5E5A B;  4HHV A;  1I2H A;  2BYM A;  1ZVR A;  3A6N B;  3AN2 A;  4XZQ A;  3REL A;  3AZL C;  3REH C;  5DNM B;  1FHO A;  2PYO A;  1KZ7 A;  3AV2 D;  1N1J A;  5JA4 B;  5CPI A;  4IOY X;  4KUD D;  1KX5 D;  3X1V C;  1FGZ A;  2DYQ A;  1QQG A;  2Y8F A;  3AFA D;  4JJN D;  2NZD D;  5C5B B;  3WTP C;  4DBB A;  1BAK A;  2E2X A;  5B1M A;  4WU8 A;  1EGX A;  5DNM A;  4Z5T C;  4J8W D;  1M19 A;  2DKP A;  2F8N B;  5KDM B;  5CPJ C;  5AVB C;  3BIN A;  4CHM A;  4R8P D;  2J0K A;  1DBH A;  3WA9 D;  3N7C A;  5C5B A;  5CPK D;  5F99 A;  5GT0 D;  3NQU A;  3SYX A;  2LOX A;  5B40 C;  3KRX A;  2DLW A;  2F8N A;  2GJY A;  1ULY A;  3IVF A;  1UPR A;  2FJ7 C;  3PP2 A;  4Z66 D;  5AV5 D;  1MPH A;  1ID3 C;  1P3L A;  1XD4 A;  2OTX A;  3AZN B;  3AJ4 A;  5B24 D;  4H9N B;  1WGQ A;  1XOD A;  3B0D C;  2H7E A;  1R4V A;  4YS3 D;  5B2J D;  2R0D A;  5B31 B;  4E45 A;  1P3A B;  3DXD A;  3C1B B;  1JFI B;  4GN1 A;  4L6E A;  2XQN M;  2KUP A;  3MGQ A;  1BTK A;  1B55 A;  3REJ A;  1AOI C;  1P3I B;  4F7H A;  3LJU X;  4LD9 B;  4WV4 B;  5BT1 C;  4H9N A;  5E5A C;  5D3X A;  1H3O B;  5BNV A;  3A6N C;  1UPQ A;  1P3A A;  2KCJ A;  3C1B A;  1U35 D;  3A8Q A;  3CXB B;  3ODW A;  4J8U B;  3B0C W;  5DNN D;  1I7A A;  3AYW C;  1ZLA B;  1MK7 B;  3WYF B;  4H9S C;  3REI B;  4HAY B;  3MGS D;  5C3I B;  3LZ1 B;  1S32 A;  5JHG A;  3WKJ B;  2GCJ A;  5AV8 C;  3GYP A;  4YM6 D;  3AZG C;  4NSW A;  2RVQ C;  5L81 A;  1Q9C A;  4Z2M H;  5HE1 A;  3W97 C;  2D9Z A;  3ZVR A;  1E5W A;  1U5G A;  5B2I A;  1P34 B;  5AV6 D;  4HGA C;  2BYK A;  2I1J A;  5EFX A;  3W96 D;  3WKJ A;  1Y5O A;  4GZU A;  5J3T A;  4C0A A;  2HIO B;  2DN6 A;  1GG3 A;  3C1C D;  3FM8 C;  1P3F D;  3QBV B;  3WAA B;  2I1K A;  5C79 A;  4G91 B;  1UNR A;  3UTB D;  2YT1 A;  2DHJ A;  3OAN A;  4ZRK A;  3MNN D;  3MVD B;  1EF1 A;  4NE3 A;  2V76 A;  3AZH A;  4XUJ B;  3O96 A;  3A8P A;  1KZG A;  2N23 A;  3AZN C;  5CP6 B;  2M14 A;  2HIO A;  5GXQ B;  2K2U A;  5B1L C;  1X1G A;  4HB4 B;  1KX3 A;  3WAA A;  1M1A B;  4J8V B;  4GPT B;  4DRB A;  1X11 A;  2ROZ B;  3MVD A;  2UZR A;  4WNN B;  1V89 A;  2YF0 A;  5CLL B;  5GSU B;  2CV5 D;  1P3I C;  4LD9 C;  1SGH A;  5GXQ A;  5AVC C;  1Z87 A;  2EMT A;  1U5D A;  2IFS A;  4ZUX B;  1W1H A;  3KWQ D;  1P3P D;  5B0Z B;  5BS7 A;  3AV1 A;  3MGR B;  4J8U C;  3AZI C;  3ML4 A;  4HB2 B;  3A98 B;  1V5U A;  1ZLA C;  5FUG B;  3REI C;  1BH9 A;  4WNN A;  1HQ3 C;  3AZK C;  3AZJ D;  5C3I C;  5GSU A;  3LZ1 C;  3AZM B;  3AV2 B;  2D9X A;  5B33 B;  3W99 D;  2Y7B A;  3KXB C;  4ZUX A;  2Q13 A;  5B0Z A;  5BO0 B;  1N3H A;  4WVF B;  2NZD B;  1P3B D;  1J0W A;  3MGP D;  4HB3 B;  1M18 B;  4HAV B;  4H9O B;  1RRP B;  3F5R A;  1P34 C;  4GXB A;  1OMW A;  3AV2 A;  3X1S B;  2DHI A;  2VKI A;  3X1T C;  4WJ7 A;  3REK C;  3AZH D;  4KUD A;  1TZY B;  1KX5 A;  2HE7 A;  4R8P B;  3AFA A;  4JJN A;  3WA9 B;  3W98 D;  2NZD A;  3LJA C;  5CPK B;  1UEF A;  5GT0 B;  1P3O D;  1WVH A;  4KHO A;  1EAZ A;  3KUY B;  2L2I A;  4WU9 D;  3LZ0 B;  4J8W A;  1HQ3 D;  1NU2 A;  3X1U D;  1P3R A;  2GS0 A;  4XUJ C;  3UT9 B;  3B6F B;  2JP2 A;  4Z66 B;  4PNK A;  5CP6 C;  2DFK A;  3G9W A;  4R8P A;  2ARO C;  5B32 D;  3WA9 A;  4J8X D;  5CPK A;  4DRA A;  2Y8G A;  5GT0 A;  5B24 B;  3BJI A;  5JLJ B;  1M1A C;  2BYM B;  4J8V C;  1KX4 D;  3AN2 B;  5B2J B;  4XZQ B;  2N0Y A;  5AY8 D;  2PYO B;  1P3M D;  3FEH A;  2UZS A;  4Z66 A;  5AV5 A;  3X1V A;  1FGY A;  5B0Y D;  5HE2 A;  3UTA D;  3O62 C;  5B24 A;  1W1D A;  1P3K D;  2W2X C;  4M6B A;  3LEL D;  5GT3 D;  4HB0 B;  4UUZ A;  5B2J A;  5B1M B;  5AV9 D;  4WU8 B;  4YS3 A;  4H9R A;  2G35 A;  3ODO A;  1U35 B;  4KHA B;  1M19 B;  1EQZ D;  2YFV A;  4EO5 B;  3AZM C;  3AZE D;  1P3G D;  5B32 G;  5B33 C;  1WJM A;  2ELB A;  4QLC C;  3VH5 W;  5F99 B;  4KGC C;  3VIA A;  3NQU B;  2YT0 A;  2K2J A;  1U35 A;  1M18 C;  4KHA A;  3B6G C;  4D0N B;  5DNN A;  1KI1 B;  3X1S C;  2D9W A;  2RVB B;  2EJ8 A;  3MGS A;  2I5F A;  1TZY C;  4X23 D;  1P3L B;  1V5M A;  3T06 A;  3PVL A;  4YM6 A;  1XX0 A;  3AZF C;  1Y19 B;  3AZL D;  3REH D;  4ZRI A;  3C1C B;  1XR0 B;  3KUY C;  3VH5 A;  1F66 C;  3MPX A;  3LZ0 C;  5JHH A;  3UTB B;  2OQB A;  5AV6 A;  3MGQ B;  3UT9 C;  3MNN B;  3TU4 C;  4H9P A;  3X1V D;  3B6F C;  2NQB C;  3W96 A;  3NSU A;  5C6R A;  3REJ B;  5HE0 A;  4DX9 0;  3WTP D;  1WWS A;  2LYD A;  2F8N K;  4Y94 A;  1NI2 A;  4Z5T D;  3C1C A;  5BNV B;  1P3F A;  3AU4 A;  3AN2 C;  3B6G D;  4K2P A;  3REL C;  3HK0 A;  5HE3 A;  3UTB A;  3KZ1 A;  2PYO C;  5CPJ D;  3MNN A;  5AVB D;  5CPI C;  3UZT A;  5JRG C;  2COC A;  3PG7 A;  1S32 B;  2CV5 B;  4A5K A;  3SO6 A;  2YS1 A;  5B40 D;  2DX5 A;  3KWQ B;  5B1M C;  4WU8 C;  4TYZ A;  3W97 A;  1FB8 A;  5DNM C;  1TAF A;  2COD A;  1M19 C;  1TQZ A;  2FJ7 D;  5B2I B;  1ID3 D;  1U2B A;  2KGX B;  2P0D A;  1A7W A;  2BYK B;  4G92 B;  3B0B A;  2CV5 A;  2GCL A;  3D8F A;  3ULB A;  5CLQ B;  4A6F A;  5F99 C;  1MK9 B;  3KWQ A;  1P3P A;  1XKE A;  3U7D A;  2IYB A;  1K5G B;  1P3B B;  1OY2 A;  3MGP B;  4HAX B;  1PFJ A;  3HW2 B;  1MIX A;  1U5E A;  3AZJ A;  1P3M A;  1AOI D;  1DDW A;  3KSY A;  5JRG D;  4MT7 A;  5BT1 D;  5E5A D;  1HTA A;  3AZH B;  3W99 A;  4HAT B;  5D3W A;  2IO5 B;  3A6N D;  3TCA A;  2D4Q A;  1V88 A;  1KX3 B;  2DTC A;  1P3B A;  3MGP A;  2H7D A;  3AYW D;  2F8N H;  4CSR A;  3MGQ C;  3ODX A;  1KU5 A;  4H8S A;  3CIK A;  3NQJ B;  5AV8 D;  3AZG D;  2R09 A;  2RVQ D;  3RCP A;  3W98 A;  4J8X B;  1M7E A;  5B31 C;  1P3A C;  3W97 D;  1P3O A;  3C1B C;  3DXE A;  1QC6 A;  1TJ6 A;  4F7U P;  3AV1 B;  4E44 A;  4WU9 A;  3P6A A;  1HQ3 A;  2J0M A;  3X1U A;  4TKN A;  5AY8 B;  5FI0 A;  1BH9 B;  2DA0 A;  3NQJ A;  3SNH A;  1FHW A;  1S32 C;  4Z2M G;  5B32 A;  4J8X A;  4IAP A;  4ZBJ B;  3V9R B;  1MKE A;  1P3K B;  3QIJ A;  2D10 A;  1KX4 A;  2D9V A;  5AV9 B;  2YSZ A;  2I5C A;  5AY8 A;  5B2I C;  1BFM A;  3ZDT A;  3VH6 T;  4EKU A;  3AZN D;  2DX1 A;  4KUD B;  2YS3 A;  3WKJ C;  1W1G A;  3QWM A;  5B1L D;  1KX5 B;  2RUK B;  5B0Y A;  1Q67 A;  3KY9 A;  4GMV A;  3UTA A;  4EMO A;  3V9R A;  1BH8 B;  4HAU B;  1P3K A;  3AFA B;  4JJN B;  3LEL A;  5GT3 A;  5DHA B;  3FSS A;  5AV9 A;  3PSC A;  4AWL B;  2YFW B;  4J8W B;  1EQZ A;  1WG7 A;  4ZRJ A;  3WA0 A;  1P3I D;  3AZE A;  4LD9 D;  1P3G A;  5AVC D;  1FOE A;  2CWE A;  4X23 B;  1BH8 A;  2HIO C;  4GMX B;  4WSF A;  1BTN A;  2LG1 A;  1KX3 C;  3WAA C;  4J8U D;  4G91 C;  3AZI D;  2P0H A;  3REH B;  1ZLA D;  2YFW A;  3VOQ A;  3REI D;  3R45 A;  3AZK D;  2COA A;  3MVD C;  2VRW B;  3LZ1 D;  2HTH B;  3KXB D;  4X23 A;  5AV5 B;  3X1V B;  3P7Z A;  3V5W A;  5GXQ C;  3WTP B;  3X23 A;  1IRS A;  3AZL A;  3REH A;  1M7R A;  4XWX A;  4UUZ B;  5BS7 C;  4YS3 B;  1P34 D;  1PLS A;  3AV1 C;  4H9R B;  3X1T D;  3REK D;  2YFV B;  1FAO A;  5GSU C;  5CPJ B;  4IFS A;  2RLO A;  3KRW A;  2P8V A;  4ZUX C;  1ISN A;  3WTP A;  3LJA D;  4KGC A;  5B0Z C;  5BNX B;  2RSG A;  4Z5T A;  2Z0O A;  3MGR C;  3B6G A;  1DDM A;  1AWE A;  4HDO A;  5DNN B;  2D2Q A;  4XUJ D;  3AV2 C;  1ZSQ A;  5CPJ A;  5AVB A;  5CP6 D;  2COF A;  5DIF B;  3MGS B;  2ARO D;  3TVV A;  1LW3 A;  3WTP E;  5BNX A;  1NTY A;  1PMS A;  1M1A D;  4KVG B;  4J8V D;  3B0D B;  3AFA C;  4JJN C;  2NZD C;  5B40 A;  4YM6 B;  1J19 A;  1H10 A;  1WI1 A;  3M1I B;  2LUL A;  4J8W C;  2FJ7 A;  3SUZ A;  1WWI A;  1ID3 A;  5AV6 B;  1RJ2 A;  4H9P B;  5G49 B;  3O62 D;  3W96 B;  2W2X D;  4R8P C;  1ZC3 B;  3WA9 C;  5CPK C;  5GT0 C;  3MGR D;  2MDX A;  5DHF B;  3SV1 A;  1P3F B;  4MY6 A;  4Z2M B;  3MDB C;  3AZM D;  3AYW B;  5B33 D;  1AOI A;  5G49 A;  4Z66 C;  5JRG A;  5AV5 C;  2CRF A;  5E5A A;  4QLC D;  1WJ1 A;  5D3V A;  4KGC D;  5AV8 B;  3A6N A;  2QKL A;  3AZG B;  5B24 C;  4K17 A;  3ULC A;  5LON B;  1LB1 A;  1M18 D;  4YS3 C;  5B2J C;  4XZQ C;  5LOP B;  3W97 B;  3X1S D;  1DYN A;  1TAF B;  3AYW A;  5JA4 A;  1K5D B;  2ROV A;  4H9S A;  5J3Q A;  4HGA B;  3B0C T;  1TZY D;  2AL6 A;  2ELA A;  1WGU A;  5AV8 A;  4A6F B;  3AZG A;  3AZF D;  4BBK A;  1AQC A;  3KUY D;  1P3P B;  1F66 D;  5D27 A;  3LZ0 D;  4DX8 A;  1U35 C;  2J59 M;  1DRO A;  5KDM A;  5DNN C;  3UT9 D;  3B6F D;  4EO5 C;  3TU4 D;  2NQB D;  1NTV A;  3AU5 A;  5JP4 A;  3AZJ B;  1P3M B;  3MGS C;  4NE5 A;  3W99 B;  5B1L B;  4YON A;  3AN2 D;  4YM6 C;  2LY8 A;  4XZQ D;  3REL D;  1X05 A;  2CAY A;  3GYO A;  4DXA B;  2PYO D;  1OQN A;  5CPI D;  4YL8 A;  4CSR B;  5AV6 C;  4HAZ B;  3AZN A;  1P3L C;  2QKM A;  3W96 C;  5AVC B;  5B1L A;  5B1M D;  4WU8 D;  5B31 A;  2VSZ A;  2NZ8 B;  5DNM D;  1JFI A;  3C1C C;  3W98 B;  1P3F C;  5KQ4 A;  1M19 D;  1P3O B;  3AZI B;  1U27 A;  3UTB C;  4WU9 B;  4HDQ A;  3AZK B;  1HQ3 B;  3MNN C;  3X1U B;  1P3I A;  4LD9 A;  5AVC A;  3REJ C;  3KXB B;  1H3O A;  5F99 D;  3D8D A;  2EMS A;  5B32 B;  2M38 A;  4J8U A;  3AZI A;  2F8N D;  2D9Y A;  1KX4 B;  1ZLA A;  3REI A;  3AZK A;  2P0F A;  5D3Y A;  3X1T B;  3LZ1 A;  3REK B;  1P3L D;  4NFT A;  1BWN A;  1EVH A;  1P5T A;  2BCJ A;  3KXB A;  1DDV A;  2UVM A;  2Z0P A;  2K00 A;  2DYN A;  2CV5 C;  4KHB B;  5B0Y B;  2D11 A;  3UTA B;  4NY0 A;  3LJA B;  3KWQ C;  4H9Q B;  1P3P C;  2CY4 A;  1FHX A;  2L5A A;  5GT3 B;  3LEL B;  1P34 A;  3MGQ D;  3X1T A;  3REK A;  1EQZ B;  4G92 C;  4PQ0 A;  3AZJ C;  3REJ D;  1P3M C;  3AZE B;  1P3G B;  3W99 C;  2MKR A;  5J3Y A;  2ARO B;  4F7G A;  3LJA A;  5B31 D;  4H9Q A;  1P3A D;  2F8N G;  3C1B D;  5FI1 A;  2L1C A;  1P3B C;  4CHJ A;  3MGP C;  1P6S A;  2YS5 A;  3TO1 A;  3TFM A;  5C16 A;  3R45 B;  4NE6 A;  3DXC A;  2JSS A;  4XUJ A;  4KAX B;  1MAI A;  2HUE B;  1UNQ A;  1S32 D;  4WZS B;  5CP6 A;  3AZH C;  4A6K A;  5KQ1 A;  2ARO A;  1GC7 A;  2ZPY A;  2IO5 C;  3O62 B;  1SHC A;  1M1A A;  4J8V A;  3PVW A;  3W98 C;  2DKQ A;  1B6W A;  1ZM0 A;  3AZL B;  1P3O C;  1U29 A;  5DH9 B;  5KCV A;  5B2I D;  1V5P A;  4WU9 C;  3X1U C;  2YVC A;  3WKJ D;  1X86 A;  1F1E A;  5B31 G;  4A6H A;  2ADZ A;  3O62 A;  3HQC A;  4K2O A;  4QLC B;  3PEG A;  4B6H A;  1ZC4 B;  5B32 C;  4KGC B;  4J8X C;  4CAY B;  2NMB A;  3MGR A;  1TXD A;  4Z5T B;  1H4R A;  1KX4 C;  3B6G B;  5FUG A;  3VH6 W;  1V61 A;  2YRY A;  4Z2N A;  3AZM A;  1UNP A;  4MK0 A;  5AY8 C;  3TW1 A;  2AEH A;  5B33 A;  5AVB B;  2W2W A;  2DHK A;  3PZD A;  2HIO D;  4QLC A;  3PVU A;  5BO0 A;  5B0Y C;  2CY5 A;  2RGN B;  1KX3 D;  4CAY A;  3UTA C;  4ZBJ C;  3WAA D;  3AZF B;  1P3K C;  4P7I A;  1U5F A;  3VH5 T;  3LEL C;  4H9O A;  5GT3 C;  5B40 B;  1M18 A;  3U8Z A;  5AV9 C;  1F66 B;  3MVD D;  3X1S A;  5CHL B;  2EC1 A;  4K81 A;  3D8E A;  1EQZ C;  1GC6 A;  2FJ7 B;  2Z0Q A;  1TZY A;  3TU4 B;  3AZE C;  3VH6 A;  1P3G C;  5GXQ D;  1ID3 B;  4KUD C;  2NQB B;  1KX5 C;  1X1F A;  2LOZ A; 
#chains in the Genus database with same CATH topology
 2RNR B;  3FDD A;  2J0J A;  1MIZ B;  5DI9 B;  1F66 A;  2MWN B;  3REL B;  4EJN A;  3UT9 A;  5GSU D;  1N1J B;  2FJL A;  4HHV A;  1ZVR A;  4XZQ A;  3REL A;  3REH C;  5DNM B;  1FHO A;  2PYO A;  1N1J A;  1FGZ A;  2Y8F A;  3AFA D;  4DBB A;  2E2X A;  4WU8 A;  3NWF A;  5DNM A;  4J8W D;  2F8N B;  5KDM B;  2J0K A;  3N7C A;  5GT0 D;  2LOX A;  3KRX A;  2F8N A;  2FJ7 C;  1MPH A;  1ID3 C;  5B24 D;  4H9N B;  1WGQ A;  1R4V A;  4YS3 D;  5B31 B;  1P3A B;  3DXD A;  4L6E A;  2XQN M;  1BTK A;  1B55 A;  4F7H A;  4H9N A;  1H3O B;  5BNV A;  1UPQ A;  1P3A A;  3ODW A;  1U35 D;  2Z59 A;  4J8U B;  3B0C W;  3WYF B;  4H9S C;  5C3I B;  3LZ1 B;  3GYP A;  3AZG C;  1Q9C A;  3W97 C;  1U5G A;  1P34 B;  3W96 D;  1Y5O A;  1W2E A;  5J3T A;  4C0A A;  3C1C D;  3U12 A;  5C79 A;  4G91 B;  2DHJ A;  3MVD B;  3AZH A;  1KZG A;  5LG4 B;  4DRB A;  3MVD A;  2UZR A;  4WNN B;  5GSU B;  2EMT A;  1U5D A;  4J8U C;  4WNN A;  3AZM B;  2DHI A;  5C3I C;  5GSU A;  3LZ1 C;  5B33 B;  2Y7B A;  3KXB C;  3MGP D;  4H9O B;  1P34 C;  3X1T C;  3REK C;  3AFA A;  1UEF A;  5GT0 B;  1EAZ A;  4J8W A;  3X1U D;  1T3U A;  3B6F B;  2DFK A;  5B32 D;  2Y8G A;  5JLJ B;  5GT0 A;  5B24 B;  5AY8 D;  4HSI A;  1FGY A;  3UTA D;  1W1D A;  5B24 A;  4YS3 A;  2G35 A;  1U35 B;  2ZM5 A;  1M19 B;  3AZM C;  3AZE D;  5B33 C;  2ELB A;  4QLC C;  1U35 A;  2EJ8 A;  2I5F A;  4X23 D;  1P3L B;  3AZF C;  3C1C B;  2OQB A;  3B6F C;  5C6R A;  3W96 A;  3REJ B;  1NI2 A;  4Z5T D;  3C1C A;  4K2P A;  3HK0 A;  3KZ1 A;  4L1R A;  5CPJ D;  5JRG C;  2YS1 A;  2DX5 A;  2COD A;  1M19 C;  5B2I B;  1U2B A;  2P0D A;  2BYK B;  3B0B A;  3ULB A;  3U7D A;  2IYB A;  1OY2 A;  3MGP B;  1MIX A;  1DDW A;  3HSA A;  3KSY A;  4MT7 A;  5BT1 D;  3A6N D;  3MGP A;  2H7D A;  1KU5 A;  4H8S A;  3NQJ B;  2R09 A;  2RVQ D;  1M7E A;  5I2S A;  3AV1 B;  3X1U A;  5AY8 B;  5FI0 A;  1BH9 B;  2DA0 A;  3NQJ A;  4Z2M G;  5B32 A;  2D10 A;  5AY8 A;  5B2I C;  4KHB A;  2YS3 A;  4KUD B;  3QWM A;  3OHM B;  5B1L D;  3UTA A;  1BH8 B;  4JJN B;  3PSC A;  1WG7 A;  3WA0 A;  1P3I D;  3AZE A;  5AVC D;  1FOE A;  4X23 B;  1BH8 A;  2LG1 A;  3NWD A;  1ZLA D;  2HTH B;  4X23 A;  4XWX A;  5BS7 C;  4QJ4 B;  1PLS A;  3AV1 C;  2BG1 A;  1FAO A;  5CPJ B;  2RLO A;  4KGC A;  5B0Z C;  3EPK A;  2RSG A;  4Z5T A;  1AWE A;  4HDO A;  1ZSQ A;  3EPJ A;  5CPJ A;  5CP6 D;  3MGS B;  2ARO D;  3TVV A;  4KVG B;  4JJN C;  1H10 A;  2NZD C;  2W2X D;  3WA9 C;  5CPK C;  3MGR D;  1P3F B;  4MY6 A;  3MDB C;  4Z66 C;  2CRF A;  1WJ1 A;  3A6N A;  1LB1 A;  3X1S D;  1DYN A;  4HGA B;  1WGU A;  5D27 A;  3LZ0 D;  2J59 M;  3A1K A;  2Y2P A;  4EO5 C;  3MGS C;  4NE5 A;  3W99 B;  3H0M C;  5B1L B;  2LY8 A;  1X05 A;  1OQN A;  4CSR B;  5AVC B;  5B1L A;  5B1M D;  1P3F C;  1P3O B;  4WU9 B;  3MNN C;  1P3I A;  5AVC A;  2EMS A;  2M38 A;  1ZLA A;  2F2A C;  2UVM A;  5DHA B;  2BCJ A;  5B0Y B;  2D11 A;  3KWQ C;  3MGQ D;  1EQZ B;  3W99 C;  2ARO B;  2F8N G;  3C1B D;  5FI1 A;  1P3B C;  2Y2Q A;  2YS5 A;  2DF4 C;  3R45 B;  1MAI A;  2HUE B;  1S32 D;  4WZS B;  5CP6 A;  2ARO A;  2KUQ A;  1B6W A;  3AZL B;  1P3O C;  4WU9 C;  5B31 G;  4B6H A;  1ZC4 B;  3EPL A;  3MGR A;  1TXD A;  1H4R A;  3B6G B;  3VH6 W;  4Z2N A;  1UNP A;  3TW1 A;  5AVB B;  2HIO D;  5BO0 A;  5B0Y C;  2RGN B;  4P7I A;  4ZBJ C;  1P3K C;  5B40 B;  4K81 A;  3X1S A;  5CHL B;  3D8E A;  1EQZ C;  2Z0Q A;  5GXQ D;  4GOU A;  5GOW B;  4HAW B;  2Y2H A;  3LZ0 A;  2HUE C;  3F0W A;  1B67 A;  4ZUX D;  5E5A B;  1I2H A;  3AZL C;  3AV2 D;  5JA4 B;  4IOY X;  1KX5 D;  3X1V C;  1BAK A;  5B1M A;  5AVB C;  3BIN A;  4R8P D;  5B40 C;  1ULY A;  1XD4 A;  3AZN B;  2RIQ A;  2R0D A;  4E45 A;  3C1B B;  2GUM A;  3MGQ A;  4WV4 B;  5E5A C;  3C1B A;  3A8Q A;  2J8P A;  3KFU G;  1MK7 B;  1S32 A;  1T77 A;  5JHG A;  2GCJ A;  4NSW A;  5HE1 A;  5AV6 D;  2I1J A;  2HIO B;  2DN6 A;  3FM8 C;  3QBV B;  1EF1 A;  3AZN C;  2HIO A;  5GXQ B;  4GPT B;  5GXQ A;  4ZUX B;  1W1H A;  1P3P D;  4HB2 B;  3AZI C;  1V5U A;  3AZJ D;  3AV2 B;  1HQ3 C;  4ZUX A;  1J0W A;  1M18 B;  4GXB A;  1OMW A;  3AV2 A;  3AZH D;  1TZY B;  1KX5 A;  4OT1 A;  4R8P B;  3W98 D;  3LJA C;  1WVH A;  4KHO A;  1NU2 A;  3UT9 B;  2JP2 A;  4PNK A;  4R8P A;  3BJI A;  4XZQ B;  2N0Y A;  2PYO B;  5HE2 A;  2ZY2 A;  3HIE A;  3LEL D;  5GT3 D;  4UUZ A;  5AV9 D;  4WU8 B;  4H9R A;  3ODO A;  4KHA B;  2YFV A;  1P3G D;  5B32 G;  1M18 C;  4KHA A;  1KI1 B;  2D9W A;  2Y2O A;  1TZY C;  1F66 C;  5JHH A;  5AV6 A;  3AL0 C;  3UT9 C;  4DX9 0;  3WTP D;  2LYD A;  4Y94 A;  5BNV B;  3AU4 A;  3REL C;  5HE3 A;  2PYO C;  2COC A;  3PG7 A;  4A5K A;  4WU8 C;  3W97 A;  5DNM C;  1TQZ A;  4G92 B;  3D8F A;  4A6F A;  2YT2 A;  1MK9 B;  3P5J B;  1P3P A;  3HW2 B;  3AZJ A;  1AOI D;  5JRG D;  3AZH B;  5D3W A;  2IO5 B;  3TCA A;  2D4Q A;  3AYW D;  5AV8 D;  3RCP A;  3W98 A;  5B31 C;  1P3A C;  3P6A A;  2J0M A;  3QIJ A;  5AV9 B;  3KY9 A;  4EMO A;  2UWX A;  3AFA B;  2Z14 A;  3LEL A;  5GT3 A;  3FSS A;  5AV9 A;  4AWL B;  4J8W B;  4LD9 D;  1P3G A;  4GNK B;  4GMX B;  4G91 C;  2P0H A;  3REI D;  3AZK D;  3MVD C;  3P7Z A;  3V5W A;  3WTP B;  4YS3 B;  5GSU C;  1ISN A;  3WTP A;  2Z0O A;  1DDM A;  4XUJ D;  1PMS A;  1M1A D;  4J8V D;  3B0D B;  3AFA C;  1J19 A;  4CSQ A;  4J8W C;  5G49 B;  3O62 D;  3W96 B;  5GT0 C;  5DHF B;  3SV1 A;  3AYW B;  1AOI A;  5G49 A;  5JRG A;  4KGC D;  5AV8 B;  5B24 C;  4YS3 C;  3AYW A;  2AL6 A;  5AV8 A;  4BBK A;  1AQC A;  3KUY D;  4DX8 A;  2VQR A;  1U35 C;  3TU4 D;  2NQB D;  3AN2 D;  5CPI D;  1P3L C;  3W96 C;  1JFI A;  3C1C C;  1U27 A;  3AZK B;  3X1U B;  2KR0 A;  4LD9 A;  3REJ C;  3D8D A;  5F99 D;  5B32 B;  3REI A;  3AZK A;  4NFT A;  4KHB B;  3UTA B;  1FHX A;  4PQ0 A;  3AZE B;  3NWA A;  2Z4D A;  3MGP C;  5C16 A;  4XUJ A;  4KAX B;  2ZPY A;  3O62 B;  4QXA B;  1M1A A;  4J8V A;  3PVW A;  2DKQ A;  3X1U C;  3WKJ D;  1F1E A;  2ADZ A;  3O62 A;  5B32 C;  4KGC B;  4Z5T B;  5FUG A;  5AY8 C;  2W2W A;  3PVU A;  1KX3 D;  3UTA C;  3WAA D;  3VH5 T;  3TU4 B;  3AZE C;  4KUD C;  2NQB B;  5HE0 A;  2PZ1 A;  3KUY A;  4CYE A;  2LKO A;  3TU4 A;  2NQB A;  5CPI B;  4X23 C;  2BYM A;  3A6N B;  3AN2 A;  5CPI A;  3H0R C;  4Z5T C;  2DKP A;  5CPJ C;  4CHM A;  3F6T A;  1DBH A;  5F99 A;  3NQU A;  2DQN C;  2GJY A;  3PP2 A;  5AV5 D;  1XOD A;  5B2J D;  2KUP A;  1P3I B;  3LJU X;  5BT1 C;  5D3X A;  3A1I A;  3A6N C;  5DNN D;  1ZLA B;  4HAY B;  2KIG A;  3WKJ B;  4YM6 D;  2RVQ C;  4Z2M H;  2D9Z A;  1E5W A;  4HGA C;  3WKJ A;  4GZU A;  3WAA B;  3UTB D;  2YT1 A;  4ZRK A;  3O96 A;  5CP6 B;  2M14 A;  5B1L C;  5IRS A;  1KX3 A;  3WAA A;  2ROZ B;  2JE5 A;  1P3I C;  2CV5 D;  1Z87 A;  5AVC C;  2IFS A;  2XD1 A;  3MGR B;  3ML4 A;  1ZLA C;  1P3M D;  1PZR A;  5BO0 B;  1N3H A;  4HB3 B;  4HAV B;  3X1S B;  4WJ7 A;  2L2I A;  3LZ0 B;  1HQ3 D;  1P3R A;  2RRF A;  2GS0 A;  5CP6 C;  3G9W A;  2ARO C;  4J8X D;  1KX4 D;  5B2J B;  3FEH A;  2UZS A;  5AV5 A;  3X1V A;  2W2X C;  4M6B A;  4HB0 B;  5B2J A;  5B1M B;  2K49 A;  2YT0 A;  3B6G C;  4D0N B;  5DNN A;  3X1S C;  2NBV A;  3T06 A;  3PVL A;  4YM6 A;  1Y19 B;  3REH D;  3VH5 A;  3LZ0 C;  3UTB B;  2ZY4 A;  3MGQ B;  4H9P A;  3NSU A;  2F8N K;  3UTB A;  1S32 B;  2CV5 B;  3SO6 A;  5B1M C;  4TYZ A;  1FB8 A;  1TAF A;  2FJ7 D;  1ID3 D;  1A7W A;  2CV5 A;  1XKE A;  1K5G B;  3EG5 B;  1P3M A;  1V88 A;  2ZY3 A;  2DTC A;  2F8N H;  3ODX A;  3MGQ C;  3AZG D;  4J8X B;  3W97 D;  3C1B C;  3DXE A;  1TJ6 A;  4F7U P;  1HQ3 A;  4TKN A;  2Y2J A;  3SNH A;  1FHW A;  1S32 C;  4J8X A;  4IAP A;  3V9R B;  1MKE A;  1KX4 A;  3ZDT A;  2DX1 A;  1W1G A;  4GMV A;  1KX5 B;  3H0L C;  3V9R A;  5I2M A;  4WJ3 C;  2CWE A;  2HIO C;  4WSF A;  1BTN A;  4J8U D;  3REH B;  3VOQ A;  2XD5 A;  2VRW B;  3LZ1 D;  3KXB D;  3FVC A;  5GXQ C;  3REH A;  1M7R A;  4UUZ B;  1P34 D;  4H9R B;  3X1T D;  3REK D;  2YFV B;  4ZUX C;  3AV2 C;  4QJ5 B;  2COF A;  3WTP E;  3X23 A;  1WI1 A;  3M1I B;  2FJ7 A;  1ID3 A;  5AV6 B;  1RJ2 A;  4R8P C;  1ZC3 B;  3AZM D;  5B33 D;  4QLC D;  2Y2K A;  2QKL A;  3AZG B;  5LON B;  4XZQ C;  5LOP B;  3W97 B;  2ROV A;  4H9S A;  3B0C T;  4A6F B;  3AZG A;  3AZF D;  1P3P B;  3NW8 A;  1DRO A;  5KDM A;  3B6F D;  1NTV A;  5JP4 A;  3AZJ B;  3GYO A;  4DXA B;  5AV6 C;  4HAZ B;  5B31 A;  3W98 B;  1M19 D;  4UPK A;  4HDQ A;  2W8S A;  2Y2N A;  3KXB B;  1H3O A;  2ZY5 A;  4J8U A;  5D3Y A;  3X1T B;  3LZ1 A;  3REK B;  1P3L D;  1BWN A;  2Z0P A;  3KXB A;  1DDV A;  4NY0 A;  2CY4 A;  1P3P C;  3LEL B;  5GT3 B;  1P34 A;  3X1T A;  3REK A;  4G92 C;  3AZJ C;  3REJ D;  1P3G B;  2MKR A;  2G5I C;  2L1C A;  1Z2C B;  3TO1 A;  2JSS A;  4A6K A;  3AZH C;  5KQ1 A;  2IO5 C;  1SHC A;  3W98 C;  1ZM0 A;  5KCV A;  5B2I D;  2YVC A;  1X86 A;  3HQC A;  4K2O A;  4QLC B;  3PEG A;  4CAY B;  3AZM A;  2AEH A;  5B33 A;  2DHK A;  4QLC A;  2CY5 A;  2G5H C;  4CAY A;  3AZF B;  1U5F A;  3LEL C;  4H9O A;  5GT3 C;  3U8Z A;  5AV9 C;  2EC1 A;  1P3G C;  2LOZ A;  3AZF A;  2MFQ A;  3AV1 D;  4AWL C;  2X18 A;  3B6F A;  1XCG A;  1AOI B;  5JRG B;  5B0Z D;  3B77 A;  1KZ7 A;  4KUD D;  2DYQ A;  1QQG A;  4JJN D;  2NZD D;  5C5B B;  3WTP C;  1EGX A;  1M19 A;  2R2Y A;  4DQY B;  3WA9 D;  5C5B A;  5CPK D;  3SYX A;  5M4Y B;  2DLW A;  3IVF A;  1UPR A;  4Z66 D;  2OTX A;  1P3L A;  3AJ4 A;  3B0D C;  2H7E A;  4GN1 A;  1JFI B;  3REJ A;  1AOI C;  2KIE A;  4LD9 B;  2KCJ A;  2Y2M A;  3CXB B;  1I7A A;  3AYW C;  3REI B;  3MGS D;  2Z13 A;  5AV8 C;  5L81 A;  3ZVR A;  5B2I A;  1ZYI A;  2BYK A;  5EFX A;  1GG3 A;  1P3F D;  2I1K A;  1UNR A;  3OAN A;  3MNN D;  4NE3 A;  2V76 A;  4XUJ B;  3A8P A;  2N23 A;  2K2U A;  1X1G A;  4HB4 B;  2JCH A;  1M1A B;  4J8V B;  1X11 A;  1V89 A;  2YF0 A;  5CLL B;  4LD9 C;  1SGH A;  3KWQ D;  2FJU B;  5B0Z B;  5BS7 A;  3AV1 A;  3A98 B;  5FUG B;  3REI C;  1BH9 A;  3AZK C;  1PFJ A;  2D9X A;  3W99 D;  2Q13 A;  5B0Z A;  4WVF B;  2NZD B;  1P3B D;  1RRP B;  3F5R A;  2VKI A;  4KUD A;  2HE7 A;  2K8E A;  4JJN A;  3WA9 B;  2NZD A;  5CPK B;  1P3O D;  3KUY B;  4WU9 D;  4XUJ C;  4Z66 B;  3WA9 A;  5CPK A;  4DRA A;  1M1A C;  2BYM B;  4J8V C;  3AN2 B;  4Z66 A;  4OSN A;  5B0Y D;  3O62 C;  1P3K D;  2ZKM X;  1EQZ D;  4EO5 B;  1WJM A;  3VH5 W;  5F99 B;  4KGC C;  3VIA A;  3NQU B;  2K2J A;  2RVB B;  3MGS A;  1V5M A;  1XX0 A;  4ZRI A;  3AZL D;  1XR0 B;  3KUY C;  3MPX A;  3MNN B;  3TU4 C;  3X1V D;  2NQB C;  1WWS A;  1P3F A;  3AN2 C;  3B6G D;  3MNN A;  5AVB D;  5CPI C;  3UZT A;  5B40 D;  3KWQ B;  2KGX B;  3IP4 C;  2GCL A;  5CLQ B;  5F99 C;  3KWQ A;  1P3B B;  4HAX B;  1U5E A;  5E5A D;  1HTA A;  3W99 A;  4HAT B;  1KX3 B;  1P3B A;  4CSR A;  3CIK A;  1P3O A;  1QC6 A;  4D6W A;  4E44 A;  4WU9 A;  4ZBJ B;  1P3K B;  2D9V A;  2YSZ A;  2I5C A;  1BFM A;  3VH6 T;  4EKU A;  3AZN D;  3WKJ C;  2RUK B;  5B0Y A;  1Q67 A;  4HAU B;  1P3K A;  2YFW B;  1EQZ A;  4ZRJ A;  1KX3 C;  3WAA C;  3AZI D;  2YFW A;  3R45 A;  2COA A;  5AV5 B;  3X1V B;  1IRS A;  3AZL A;  4DIX A;  4IFS A;  3KRW A;  2P8V A;  3LJA D;  5BNX B;  3MGR C;  3B6G A;  5DNN B;  2D2Q A;  5AVB A;  5DIF B;  1LW3 A;  1NTY A;  5BNX A;  5B40 A;  4YM6 B;  2LUL A;  3SUZ A;  1WWI A;  4H9P B;  2MDX A;  4Z2M B;  2Y2G A;  2Y2I A;  5AV5 C;  5E5A A;  5D3V A;  4K17 A;  3ULC A;  1M18 D;  3DCX A;  5B2J C;  1K5D B;  4QJ3 B;  1TAF B;  5JA4 A;  5J3Q A;  1TZY D;  2ELA A;  1F66 D;  5DNN C;  3AU5 A;  3UT9 D;  1P3M B;  4YON A;  4YM6 C;  4XZQ D;  3REL D;  2CAY A;  2PYO D;  4YL8 A;  3AZN A;  2QKM A;  4WU8 D;  2VSZ A;  5KQ4 A;  2NZ8 B;  5DNM D;  3AZI B;  3UTB C;  3EPH A;  1HQ3 B;  3A58 A;  2Y2L A;  3AZI A;  2F8N D;  2D9Y A;  1KX4 B;  2P0F A;  1P5T A;  1EVH A;  2K00 A;  2DYN A;  2CV5 C;  3LJA B;  4H9Q B;  2L5A A;  2FFF B;  1P3M C;  5J3Y A;  4F7G A;  3LJA A;  5B31 D;  4H9Q A;  1P3A D;  4CHJ A;  1P6S A;  3TFM A;  4NE6 A;  3DXC A;  1UNQ A;  1GC7 A;  1MI1 A;  1U29 A;  5DH9 B;  1V5P A;  4A6H A;  4J8X C;  2NMB A;  1KX4 C;  2YRY A;  1V61 A;  4MK0 A;  3PZD A;  1M18 A;  1F66 B;  3MVD D;  1GC6 A;  2FJ7 B;  1TZY A;  1ID3 B;  3VH6 A;  1X1F A;  1KX5 C; 
#chains in the Genus database with same CATH homology
 2RNR B;  3FDD A;  2J0J A;  1MIZ B;  5DI9 B;  1F66 A;  2MWN B;  3REL B;  4EJN A;  3UT9 A;  5GSU D;  1N1J B;  2FJL A;  4HHV A;  1ZVR A;  4XZQ A;  3REL A;  3REH C;  5DNM B;  1FHO A;  2PYO A;  1N1J A;  1FGZ A;  2Y8F A;  3AFA D;  4DBB A;  2E2X A;  4WU8 A;  3NWF A;  5DNM A;  4J8W D;  2F8N B;  5KDM B;  2J0K A;  3N7C A;  5GT0 D;  2LOX A;  3KRX A;  2F8N A;  2FJ7 C;  1MPH A;  1ID3 C;  5B24 D;  4H9N B;  1WGQ A;  1R4V A;  4YS3 D;  5B31 B;  1P3A B;  3DXD A;  4L6E A;  2XQN M;  1BTK A;  1B55 A;  4F7H A;  4H9N A;  1H3O B;  5BNV A;  1UPQ A;  1P3A A;  3ODW A;  1U35 D;  2Z59 A;  4J8U B;  3B0C W;  3WYF B;  4H9S C;  5C3I B;  3LZ1 B;  3GYP A;  3AZG C;  1Q9C A;  3W97 C;  1U5G A;  1P34 B;  3W96 D;  1Y5O A;  1W2E A;  5J3T A;  4C0A A;  3C1C D;  3U12 A;  5C79 A;  4G91 B;  2DHJ A;  3MVD B;  3AZH A;  1KZG A;  5LG4 B;  4DRB A;  3MVD A;  2UZR A;  4WNN B;  5GSU B;  2EMT A;  1U5D A;  4J8U C;  4WNN A;  3AZM B;  2DHI A;  5C3I C;  5GSU A;  3LZ1 C;  5B33 B;  2Y7B A;  3KXB C;  3MGP D;  4H9O B;  1P34 C;  3X1T C;  3REK C;  3AFA A;  1UEF A;  5GT0 B;  1EAZ A;  4J8W A;  3X1U D;  1T3U A;  3B6F B;  2DFK A;  5B32 D;  2Y8G A;  5JLJ B;  5GT0 A;  5B24 B;  5AY8 D;  4HSI A;  1FGY A;  3UTA D;  1W1D A;  5B24 A;  4YS3 A;  2G35 A;  1U35 B;  2ZM5 A;  1M19 B;  3AZM C;  3AZE D;  5B33 C;  2ELB A;  4QLC C;  1U35 A;  2EJ8 A;  2I5F A;  4X23 D;  1P3L B;  3AZF C;  3C1C B;  2OQB A;  3B6F C;  5C6R A;  3W96 A;  3REJ B;  1NI2 A;  4Z5T D;  3C1C A;  4K2P A;  3HK0 A;  3KZ1 A;  4L1R A;  5CPJ D;  5JRG C;  2YS1 A;  2DX5 A;  2COD A;  1M19 C;  5B2I B;  1U2B A;  2P0D A;  2BYK B;  3B0B A;  3ULB A;  3U7D A;  2IYB A;  1OY2 A;  3MGP B;  1MIX A;  1DDW A;  3KSY A;  4MT7 A;  5BT1 D;  3A6N D;  3MGP A;  2H7D A;  1KU5 A;  4H8S A;  3NQJ B;  2R09 A;  2RVQ D;  1M7E A;  5I2S A;  3AV1 B;  3X1U A;  5AY8 B;  5FI0 A;  1BH9 B;  2DA0 A;  3NQJ A;  4Z2M G;  5B32 A;  2D10 A;  5AY8 A;  5B2I C;  4KHB A;  2YS3 A;  4KUD B;  3QWM A;  3OHM B;  5B1L D;  3UTA A;  1BH8 B;  4JJN B;  3PSC A;  1WG7 A;  3WA0 A;  1P3I D;  3AZE A;  5AVC D;  1FOE A;  4X23 B;  1BH8 A;  2LG1 A;  3NWD A;  1ZLA D;  2HTH B;  4X23 A;  4XWX A;  5BS7 C;  4QJ4 B;  1PLS A;  3AV1 C;  2BG1 A;  1FAO A;  5CPJ B;  2RLO A;  4KGC A;  5B0Z C;  3EPK A;  2RSG A;  4Z5T A;  1AWE A;  4HDO A;  1ZSQ A;  3EPJ A;  5CPJ A;  5CP6 D;  3MGS B;  2ARO D;  3TVV A;  4KVG B;  4JJN C;  1H10 A;  2NZD C;  2W2X D;  3WA9 C;  5CPK C;  3MGR D;  1P3F B;  4MY6 A;  3MDB C;  4Z66 C;  2CRF A;  1WJ1 A;  3A6N A;  1LB1 A;  3X1S D;  1DYN A;  4HGA B;  1WGU A;  5D27 A;  3LZ0 D;  2J59 M;  3A1K A;  2Y2P A;  4EO5 C;  3MGS C;  4NE5 A;  3W99 B;  3H0M C;  5B1L B;  2LY8 A;  1X05 A;  1OQN A;  4CSR B;  5AVC B;  5B1L A;  5B1M D;  1P3F C;  1P3O B;  4WU9 B;  3MNN C;  1P3I A;  5AVC A;  2EMS A;  2M38 A;  1ZLA A;  2F2A C;  2UVM A;  5DHA B;  2BCJ A;  5B0Y B;  2D11 A;  3KWQ C;  3MGQ D;  1EQZ B;  3W99 C;  2ARO B;  2F8N G;  3C1B D;  5FI1 A;  1P3B C;  2Y2Q A;  2YS5 A;  2DF4 C;  3R45 B;  1MAI A;  2HUE B;  1S32 D;  4WZS B;  5CP6 A;  2ARO A;  2KUQ A;  1B6W A;  3AZL B;  1P3O C;  4WU9 C;  5B31 G;  4B6H A;  1ZC4 B;  3EPL A;  3MGR A;  1TXD A;  1H4R A;  3B6G B;  3VH6 W;  4Z2N A;  1UNP A;  3TW1 A;  5AVB B;  2HIO D;  5BO0 A;  5B0Y C;  2RGN B;  4P7I A;  4ZBJ C;  1P3K C;  5B40 B;  4K81 A;  3X1S A;  5CHL B;  3D8E A;  1EQZ C;  2Z0Q A;  5GXQ D;  4GOU A;  5GOW B;  4HAW B;  2Y2H A;  3LZ0 A;  2HUE C;  3F0W A;  1B67 A;  4ZUX D;  5E5A B;  1I2H A;  3AZL C;  3AV2 D;  5JA4 B;  4IOY X;  1KX5 D;  3X1V C;  1BAK A;  5B1M A;  5AVB C;  3BIN A;  4R8P D;  5B40 C;  1ULY A;  1XD4 A;  3AZN B;  2RIQ A;  2R0D A;  4E45 A;  3C1B B;  2GUM A;  3MGQ A;  4WV4 B;  5E5A C;  3C1B A;  3A8Q A;  2J8P A;  3KFU G;  1MK7 B;  1S32 A;  5JHG A;  2GCJ A;  4NSW A;  5HE1 A;  5AV6 D;  2I1J A;  2HIO B;  2DN6 A;  3FM8 C;  3QBV B;  1EF1 A;  3AZN C;  2HIO A;  5GXQ B;  4GPT B;  5GXQ A;  4ZUX B;  1W1H A;  1P3P D;  4HB2 B;  3AZI C;  1V5U A;  3AZJ D;  3AV2 B;  1HQ3 C;  4ZUX A;  1J0W A;  1M18 B;  4GXB A;  1OMW A;  3AV2 A;  3AZH D;  1TZY B;  1KX5 A;  4OT1 A;  4R8P B;  3W98 D;  3LJA C;  1WVH A;  4KHO A;  1NU2 A;  3UT9 B;  2JP2 A;  4PNK A;  4R8P A;  3BJI A;  4XZQ B;  2N0Y A;  2PYO B;  5HE2 A;  2ZY2 A;  3HIE A;  3LEL D;  5GT3 D;  4UUZ A;  5AV9 D;  4WU8 B;  4H9R A;  3ODO A;  4KHA B;  2YFV A;  1P3G D;  5B32 G;  1M18 C;  4KHA A;  1KI1 B;  2D9W A;  2Y2O A;  1TZY C;  1F66 C;  5JHH A;  5AV6 A;  3AL0 C;  3UT9 C;  4DX9 0;  3WTP D;  2LYD A;  4Y94 A;  5BNV B;  3AU4 A;  3REL C;  5HE3 A;  2PYO C;  2COC A;  3PG7 A;  4A5K A;  4WU8 C;  3W97 A;  5DNM C;  1TQZ A;  4G92 B;  3D8F A;  4A6F A;  2YT2 A;  1MK9 B;  3P5J B;  1P3P A;  3HW2 B;  3AZJ A;  1AOI D;  5JRG D;  3AZH B;  5D3W A;  2IO5 B;  3TCA A;  2D4Q A;  3AYW D;  5AV8 D;  3RCP A;  3W98 A;  5B31 C;  1P3A C;  3P6A A;  2J0M A;  3QIJ A;  5AV9 B;  3KY9 A;  4EMO A;  2UWX A;  3AFA B;  2Z14 A;  3LEL A;  5GT3 A;  3FSS A;  5AV9 A;  4AWL B;  4J8W B;  4LD9 D;  1P3G A;  4GNK B;  4GMX B;  4G91 C;  2P0H A;  3REI D;  3AZK D;  3MVD C;  3P7Z A;  3V5W A;  3WTP B;  4YS3 B;  5GSU C;  1ISN A;  3WTP A;  2Z0O A;  1DDM A;  4XUJ D;  1PMS A;  1M1A D;  4J8V D;  3B0D B;  3AFA C;  1J19 A;  4CSQ A;  4J8W C;  5G49 B;  3O62 D;  3W96 B;  5GT0 C;  5DHF B;  3SV1 A;  3AYW B;  1AOI A;  5G49 A;  5JRG A;  4KGC D;  5AV8 B;  5B24 C;  4YS3 C;  3AYW A;  2AL6 A;  5AV8 A;  4BBK A;  1AQC A;  3KUY D;  4DX8 A;  2VQR A;  1U35 C;  3TU4 D;  2NQB D;  3AN2 D;  5CPI D;  1P3L C;  3W96 C;  1JFI A;  3C1C C;  1U27 A;  3AZK B;  3X1U B;  2KR0 A;  4LD9 A;  3REJ C;  3D8D A;  5F99 D;  5B32 B;  3REI A;  3AZK A;  4NFT A;  4KHB B;  3UTA B;  1FHX A;  4PQ0 A;  3AZE B;  3NWA A;  2Z4D A;  3MGP C;  5C16 A;  4XUJ A;  4KAX B;  2ZPY A;  3O62 B;  4QXA B;  1M1A A;  4J8V A;  3PVW A;  2DKQ A;  3X1U C;  3WKJ D;  1F1E A;  2ADZ A;  3O62 A;  5B32 C;  4KGC B;  4Z5T B;  5FUG A;  5AY8 C;  2W2W A;  3PVU A;  1KX3 D;  3UTA C;  3WAA D;  3VH5 T;  3TU4 B;  3AZE C;  4KUD C;  2NQB B;  5HE0 A;  2PZ1 A;  3KUY A;  4CYE A;  2LKO A;  3TU4 A;  2NQB A;  5CPI B;  4X23 C;  2BYM A;  3A6N B;  3AN2 A;  5CPI A;  3H0R C;  4Z5T C;  2DKP A;  5CPJ C;  4CHM A;  3F6T A;  1DBH A;  5F99 A;  3NQU A;  2DQN C;  2GJY A;  3PP2 A;  5AV5 D;  1XOD A;  5B2J D;  2KUP A;  1P3I B;  3LJU X;  5BT1 C;  5D3X A;  3A1I A;  3A6N C;  5DNN D;  1ZLA B;  4HAY B;  2KIG A;  3WKJ B;  4YM6 D;  2RVQ C;  4Z2M H;  2D9Z A;  1E5W A;  4HGA C;  3WKJ A;  4GZU A;  3WAA B;  3UTB D;  2YT1 A;  4ZRK A;  3O96 A;  5CP6 B;  2M14 A;  5B1L C;  5IRS A;  1KX3 A;  3WAA A;  2ROZ B;  2JE5 A;  1P3I C;  2CV5 D;  1Z87 A;  5AVC C;  2IFS A;  2XD1 A;  3MGR B;  3ML4 A;  1ZLA C;  1P3M D;  1PZR A;  5BO0 B;  1N3H A;  4HB3 B;  4HAV B;  3X1S B;  4WJ7 A;  2L2I A;  3LZ0 B;  1HQ3 D;  1P3R A;  2RRF A;  2GS0 A;  5CP6 C;  3G9W A;  2ARO C;  4J8X D;  1KX4 D;  5B2J B;  3FEH A;  2UZS A;  5AV5 A;  3X1V A;  2W2X C;  4M6B A;  4HB0 B;  5B2J A;  5B1M B;  2K49 A;  2YT0 A;  3B6G C;  4D0N B;  5DNN A;  3X1S C;  2NBV A;  3T06 A;  3PVL A;  4YM6 A;  1Y19 B;  3REH D;  3VH5 A;  3LZ0 C;  3UTB B;  2ZY4 A;  3MGQ B;  4H9P A;  3NSU A;  2F8N K;  3UTB A;  1S32 B;  2CV5 B;  3SO6 A;  5B1M C;  4TYZ A;  1FB8 A;  1TAF A;  2FJ7 D;  1ID3 D;  1A7W A;  2CV5 A;  1XKE A;  1K5G B;  3EG5 B;  1P3M A;  1V88 A;  2ZY3 A;  2DTC A;  2F8N H;  3ODX A;  3MGQ C;  3AZG D;  4J8X B;  3W97 D;  3C1B C;  3DXE A;  1TJ6 A;  4F7U P;  1HQ3 A;  4TKN A;  2Y2J A;  3SNH A;  1FHW A;  1S32 C;  4J8X A;  4IAP A;  3V9R B;  1MKE A;  1KX4 A;  3ZDT A;  2DX1 A;  1W1G A;  4GMV A;  1KX5 B;  3H0L C;  3V9R A;  5I2M A;  4WJ3 C;  2CWE A;  2HIO C;  4WSF A;  1BTN A;  4J8U D;  3REH B;  3VOQ A;  2XD5 A;  2VRW B;  3LZ1 D;  3KXB D;  3FVC A;  5GXQ C;  3REH A;  1M7R A;  4UUZ B;  1P34 D;  4H9R B;  3X1T D;  3REK D;  2YFV B;  4ZUX C;  3AV2 C;  4QJ5 B;  2COF A;  3WTP E;  3X23 A;  1WI1 A;  3M1I B;  2FJ7 A;  1ID3 A;  5AV6 B;  1RJ2 A;  4R8P C;  1ZC3 B;  3AZM D;  5B33 D;  4QLC D;  2Y2K A;  2QKL A;  3AZG B;  5LON B;  4XZQ C;  5LOP B;  3W97 B;  2ROV A;  4H9S A;  3B0C T;  4A6F B;  3AZG A;  3AZF D;  1P3P B;  3NW8 A;  1DRO A;  5KDM A;  3B6F D;  1NTV A;  5JP4 A;  3AZJ B;  3GYO A;  4DXA B;  5AV6 C;  4HAZ B;  5B31 A;  3W98 B;  1M19 D;  4UPK A;  4HDQ A;  2W8S A;  2Y2N A;  3KXB B;  1H3O A;  2ZY5 A;  4J8U A;  5D3Y A;  3X1T B;  3LZ1 A;  3REK B;  1P3L D;  1BWN A;  2Z0P A;  3KXB A;  1DDV A;  4NY0 A;  2CY4 A;  1P3P C;  3LEL B;  5GT3 B;  1P34 A;  3X1T A;  3REK A;  4G92 C;  3AZJ C;  3REJ D;  1P3G B;  2MKR A;  2G5I C;  2L1C A;  1Z2C B;  3TO1 A;  2JSS A;  4A6K A;  3AZH C;  5KQ1 A;  2IO5 C;  1SHC A;  3W98 C;  1ZM0 A;  5KCV A;  5B2I D;  2YVC A;  1X86 A;  3HQC A;  4K2O A;  4QLC B;  3PEG A;  4CAY B;  3AZM A;  2AEH A;  5B33 A;  2DHK A;  4QLC A;  2CY5 A;  2G5H C;  4CAY A;  3AZF B;  1U5F A;  3LEL C;  4H9O A;  5GT3 C;  3U8Z A;  5AV9 C;  2EC1 A;  1P3G C;  2LOZ A;  3AZF A;  2MFQ A;  3AV1 D;  4AWL C;  2X18 A;  3B6F A;  1XCG A;  1AOI B;  5JRG B;  5B0Z D;  1KZ7 A;  4KUD D;  2DYQ A;  1QQG A;  4JJN D;  2NZD D;  5C5B B;  3WTP C;  1EGX A;  1M19 A;  2R2Y A;  4DQY B;  3WA9 D;  5C5B A;  5CPK D;  3SYX A;  5M4Y B;  2DLW A;  3IVF A;  1UPR A;  4Z66 D;  2OTX A;  1P3L A;  3AJ4 A;  3B0D C;  2H7E A;  4GN1 A;  1JFI B;  3REJ A;  1AOI C;  2KIE A;  4LD9 B;  2KCJ A;  2Y2M A;  3CXB B;  1I7A A;  3AYW C;  3REI B;  3MGS D;  2Z13 A;  5AV8 C;  5L81 A;  3ZVR A;  5B2I A;  1ZYI A;  2BYK A;  5EFX A;  1GG3 A;  1P3F D;  2I1K A;  1UNR A;  3OAN A;  3MNN D;  4NE3 A;  2V76 A;  4XUJ B;  3A8P A;  2N23 A;  2K2U A;  1X1G A;  4HB4 B;  2JCH A;  1M1A B;  4J8V B;  1X11 A;  1V89 A;  2YF0 A;  5CLL B;  4LD9 C;  1SGH A;  3KWQ D;  2FJU B;  5B0Z B;  5BS7 A;  3AV1 A;  3A98 B;  5FUG B;  3REI C;  1BH9 A;  3AZK C;  1PFJ A;  2D9X A;  3W99 D;  2Q13 A;  5B0Z A;  4WVF B;  2NZD B;  1P3B D;  1RRP B;  3F5R A;  2VKI A;  4KUD A;  2HE7 A;  2K8E A;  4JJN A;  3WA9 B;  2NZD A;  5CPK B;  1P3O D;  3KUY B;  4WU9 D;  4XUJ C;  4Z66 B;  3WA9 A;  5CPK A;  4DRA A;  1M1A C;  2BYM B;  4J8V C;  3AN2 B;  4Z66 A;  4OSN A;  5B0Y D;  3O62 C;  1P3K D;  2ZKM X;  1EQZ D;  4EO5 B;  1WJM A;  3VH5 W;  5F99 B;  4KGC C;  3VIA A;  3NQU B;  2K2J A;  2RVB B;  3MGS A;  1V5M A;  1XX0 A;  4ZRI A;  3AZL D;  1XR0 B;  3KUY C;  3MPX A;  3MNN B;  3TU4 C;  3X1V D;  2NQB C;  1WWS A;  1P3F A;  3AN2 C;  3B6G D;  3MNN A;  5AVB D;  5CPI C;  3UZT A;  5B40 D;  3KWQ B;  2KGX B;  3IP4 C;  2GCL A;  5CLQ B;  5F99 C;  3KWQ A;  1P3B B;  4HAX B;  1U5E A;  5E5A D;  1HTA A;  3W99 A;  4HAT B;  1KX3 B;  1P3B A;  4CSR A;  3CIK A;  1P3O A;  1QC6 A;  4D6W A;  4E44 A;  4WU9 A;  4ZBJ B;  1P3K B;  2D9V A;  2YSZ A;  2I5C A;  1BFM A;  3VH6 T;  4EKU A;  3AZN D;  3WKJ C;  2RUK B;  5B0Y A;  1Q67 A;  4HAU B;  1P3K A;  2YFW B;  1EQZ A;  4ZRJ A;  1KX3 C;  3WAA C;  3AZI D;  2YFW A;  3R45 A;  2COA A;  5AV5 B;  3X1V B;  1IRS A;  3AZL A;  4DIX A;  4IFS A;  3KRW A;  2P8V A;  3LJA D;  5BNX B;  3MGR C;  3B6G A;  5DNN B;  2D2Q A;  5AVB A;  5DIF B;  1LW3 A;  1NTY A;  5BNX A;  5B40 A;  4YM6 B;  2LUL A;  3SUZ A;  1WWI A;  4H9P B;  2MDX A;  4Z2M B;  2Y2G A;  2Y2I A;  5AV5 C;  5E5A A;  5D3V A;  4K17 A;  3ULC A;  1M18 D;  5B2J C;  1K5D B;  4QJ3 B;  1TAF B;  5JA4 A;  5J3Q A;  1TZY D;  2ELA A;  1F66 D;  5DNN C;  3AU5 A;  3UT9 D;  1P3M B;  4YON A;  4YM6 C;  4XZQ D;  3REL D;  2CAY A;  2PYO D;  4YL8 A;  3AZN A;  2QKM A;  4WU8 D;  2VSZ A;  5KQ4 A;  2NZ8 B;  5DNM D;  3AZI B;  3UTB C;  3EPH A;  1HQ3 B;  3A58 A;  2Y2L A;  3AZI A;  2F8N D;  2D9Y A;  1KX4 B;  2P0F A;  1P5T A;  1EVH A;  2K00 A;  2DYN A;  2CV5 C;  3LJA B;  4H9Q B;  2L5A A;  2FFF B;  1P3M C;  5J3Y A;  4F7G A;  3LJA A;  5B31 D;  4H9Q A;  1P3A D;  4CHJ A;  1P6S A;  3TFM A;  4NE6 A;  3DXC A;  1UNQ A;  1GC7 A;  1U29 A;  5DH9 B;  1V5P A;  4A6H A;  4J8X C;  2NMB A;  1KX4 C;  2YRY A;  1V61 A;  4MK0 A;  3PZD A;  1M18 A;  1F66 B;  3MVD D;  1GC6 A;  2FJ7 B;  1TZY A;  1ID3 B;  3VH6 A;  1X1F A;  1KX5 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...