4KHAA

Structural basis of histone h2a-h2b recognition by the essential chaperone fact
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
406
structure length
360
Chain Sequence
b'DVVEQDKLIEIRNRRPAVLDNVYIRPALEGKRVPGKVEIHQNGIRYQSPLSTTQRVDVLFSNIRHLFFQPCQNEMIVIIHLHLKDPILFGKKKTKDVQFYREAIQEERRRKAELDRLFKSFAEKIAEAGRNEGIEVDMPIRDLGFNGVPNRSNVVIYPTTECLIQITEPPFLVITLEDVEWAHLERVQFGLKNFDLVFVFKDFTRPVVHINTIPVESLEDVKEFLDSSDIPFSEGPLNLNWSVIMKTVTANPHQFFLDGGWGFLQNDSRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Spt16M-Histone H2B 1.1 chimera
molecule tags Chaperone/nuclear protein
source organism Chaetomium thermophilum var. thermophilum
publication title Structural basis of histone H2A-H2B recognition by the essential chaperone FACT.
pubmed doi rcsb
total genus 99
structure length 360
sequence length 406
ec nomenclature
pdb deposition date 2013-04-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08512 Rtt106 Histone chaperone Rttp106-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 4khaA03
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 4khaA02
2.30.29.150 Mainly Beta Roll PH-domain like PH-domain like 4khaA01
3AZFC 3ODOA 3AV1B 1ID3A 1XR0B 3FSSA 1FGYA 1P3FA 2RVQC 4Y94A 4WZSB 4J8WD 4JJND 5CPJC 2K2UA 2Y8GA 1HTAA 2M14A 3B6FB 3AZFD 5B1MB 3B6GA 4K2OA 1M1AC 2DFKA 5KDMA 5BT1C 2NZDB 3MNNA 4MY6A 3W98C 5FUGB 1N3HA 2P0HA 5AVBB 4X23A 3W96A 3C1CC 3AZNA 2CV5B 4NE5A 1P3GA 2PYOA 5F99B 1UNQA 1HQ3D 4UUZB 1JFIB 1MK9B 4HDQA 1KZ7A 1EQZD 5CLLB 5AY8C 3ULCA 4WU8D 4XUJA 3MGRB 3AZJA 2JSSA 5DNMD 1P3BA 1P3PB 2IO5C 3BINA 3RELD 1XODA 1N1JB 4LD9C 1FAOA 3A8PA 3MGPA 1P34A 2YFWB 5B33C 4Z5TC 5B0YA 3AZID 3WAAD 1V5MA 2LYDA 2FJ7C 4XZQB 2D11A 5B2ID 2DKQA 4KAXB 4PQ0A 4J8WB 4JJNB 5BT1D 1ZLAA 3REID 4AWLC 2VSZA 3A8QA 3W97B 1MKEA 3F0WA 2NQBB 4G91C 1FOEA 5CPJD 2NZ8B 4YS3B 1XKEA 4J8VA 4R8PA 3KZ1A 5GXQC 5B2JA 2CV5D 5JA4B 2R09A 4XZQA 3LJAC 1J0WA 1EQZB 3AZLC 1KX3D 1P3RA 3REJD 4H9NA 3LELC 2YS3A 5AV5A 2I5CA 2N23A 2VRWB 4KGCA 1U29A 5AV6D 2XQNM 4F7GA 3C1BD 3AZIB 5B40B 3REHB 1GC7A 5G49B 5JRGD 2PYOB 3SV1A 1H10A 3W96B 3TO1A 1M18B 5F99A 3MVDD 3REKA 3AYWC 3REIB 2COAA 3SUZA 4H9OB 1DDMA 2AROA 5BO0A 3MNNB 2P8VA 2J59M 3AZGA 1W1HA 1P3IC 3WA9C 4YS3D 2AEHA 4XWXA 2Z0OA 3X1VA 4DRAA 5GSUC 3ML4A 3PVLA 3MDBC 1BTKA 5CPJA 1J19A 5B24C 1XX0A 4HAXB 1U5DA 2L5AA 4QLCC 3WA9D 3MGSD 5GSUD 1Q9CA 1S32D 4J8XA 4IFSA 3X23A 5CPIB 1TJ6A 2X18A 5DNNC 1U35A 5L81A 4XZQC 3GYOA 5DHAB 1K5GB 1TZYB 1KX4D 3X1SA 3TCAA 1P3GC 2OQBA 2F8NG 5B0YD 5AV9C 5B1LB 3VH5T 3C1BA 3AU5A 5B40D 3REHD 3AZMA 1M18A 4LD9D 2RVBB 4WU8A 5JRGB 2PYOD 1U5EA 2UZRA 4H8SA 3W96D 1FHWA 3MVDB 1AOIC 1DYNA 5AVCC 5J3YA 1Y19B 5C6RA 1BFMA 1FHXA 2YT0A 5B31C 1EQZC 3FEHA 3KUYC 4WU9C 2FJ7A 2I1JA 5CP6A 4A6FA 3LELB 5AV8D 1V88A 1QC6A 4Z2MB 5BNVB 3QWMA 3UTAB 5D3YA 5JA4A 2BCJA 3PG7A 4EMOA 1ID3C 3MGSA 4G92C 5B32D 3X1VC 4KUDB 4KHBB 5CPID 3UT9C 5J3QA 1R4VA 4HAZB 4GN1A 2NQBA 1TZYD 1P3AC 1X11A 3AFAA 3REIC 4DXAB 3AZLA 4LD9B 2Q13A 4JJNA 1ZLAB 3MNNC 4H9QB 4YM6A 5FI1A 1P3IB 1OY2A 3QBVB 1ZC4B 2D4QA 4J8VC 4Z5TB 1P3LB 3TU4C 5CLQB 3TFMA 5BNXB 4HDOA 4YONA 2UVMA 5AV6A 1PFJA 5HE1A 3TU4D 3A98B 1TAFB 2CODA 3REKC 3ZVRA 2MWNB 5KCVA 1ULYA 1JFIA 3ULBA 2BYKB 1P3GB 1P3LA 1S32A 2L2IA 5AV9B 3N7CA 2J0JA 1P3IA 4NFTA 3X1TA 2HIOD 5KDMB 2NZDA 3LJAB 3W99A 2ELAA 2H7DA 3AV2C 2LKOA 1KX4A 1WVHA 1RRPB 3B0CT 5B1MA 3V9RB 3AZLB 3AN2C 3B6GB 1P3MC 3GYPA 3AFAB 5B32C 3X1VD 3BJIA 2M38A 3UT9D 1ZLAD 1ZC3B 1P3FB 4F7UP 1AQCA 1M1AB 4DRBA 1WI1A 3TVVA 3R45B 3KRXA 2AL6A 3X1SC 3AZIC 1DDWA 5AV8C 4Z66A 2KCJA 3X1UC 3MGQA 3DXCA 5GT3D 3AZKD 3UTAC 1ZM0A 1M18C 3LELA 3UZTA 3T06A 1P3BC 1P3PC 5AVBD 1NI2A 4J8UD 4H9SA 2JP2A 5B31D 4ZRKA 2DX5A 1I7AA 1U5GA 5HE0A 5C79A 5B33A 3VH6A 5B33B 5DNMB 5AV9D 3RELB 2D10A 2F8NH 2HIOB 3VIAA 5D3WA 5LOPB 4YL8A 3LZ1A 4X23D 3AZND 1BH9A 3B6GD 2AROC 5DH9B 1P3LC 1S32C 4HB4B 4Z2MG 2D9XA 5DNNB 3X1UD 3PSCA 4F7HA 5B2IB 1M1AD 1TZYC 3UT9A 3O62C 5CPIA 1UEFA 3R45A 4M6BA 4R8PC 2YSZA 4QLCA 5B24D 3AV1C 3HW2B 2E2XA 2RVQD 1LB1A 3AZKB 2CY4A 3F5RA 5CPJB 3WA0A 1NTVA 4J8UB 3SO6A 2DLWA 5B31B 3AV2B 1PMSA 1V5UA 3VOQA 3AN2B 3B6GC 5JLJB 5B33D 3REIA 5DNMA 3WYFB 4HB0B 1EAZA 5LONB 5C5BA 4HATB 4ZUXC 2PZ1A 3W96C 3C1CA 2F8NB 2I5FA 5AY8B 5B40A 3REHA 4WNNA 5AV6B 4Z2NA 5GOWB 3C1BB 2IO5B 5B1LA 3KXBA 4EO5C 2QKLA 4NSWA 3X1UB 1I2HA 1KX5A 1M18D 1U35B 3MGPC 1P34C 5B24B 1FB8A 2BYMA 3MNND 4ZRJA 1F66A 4CSRA 4QLCD 3UTBB 4J8WC 1E5WA 1V61A 4J8VB 4AWLB 2W2WA 2P0DA 1P3AA 4EJNA 3W99C 5GT0A 1Q67A 2DA0A 2Z0QA 3AV2D 3AZEC 4KUDA 4Z66C 5AV8A 3AN2D 2GS0A 2P0FA 3MGSB 2AROB 5BO0B 3PP2A 5AV9A 1QQGA 1S32B 4H9OA 3UTAA 2W2XD 3PVUA 1M7EA 2OTXA 3REKB 4TYZA 4BBKA 4E44A 5B2IC 2RSGA 3LZ1D 3NQUB 2F8ND 5CP6B 4GMXB 4A6FB 1TAFA 3MVDC 5G49A 5B0YB 1NU2A 3AZIA 3AZGD 1ZSQA 3V5WA 2YFWA 4CHJA 3WTPA 2DHKA 4A5KA 4GXBA 3B0DC 3WTPB 5AV5C 3KUYB 2DYNA 2LY8A 5C3IC 1U35D 1P3OC 1P3PA 4Z5TA 3QIJA 1NTYA 1DDVA 1TXDA 4J8UC 3G9WA 1DROA 1HQ3C 4ZBJB 2IFSA 1P5TA 2HUEC 3AZMD 2CV5A 4LD9A 1Y5OA 2EC1A 5FUGA 4J8VD 2RGNB 3X1SB 1MPHA 5AV8B 2RNRB 2KUPA 4H9RA 2LULA 4J8XB 3RCPA 1P3AD 1M19B 1BWNA 5HE2A 3DXEA 4KUDD 2Y8FA 4B6HA 5DI9B 1KU5A 1ZLAC 4YM6C 2YS1A 3P7ZA 4WSFA 5CP6D 5B24A 3HK0A 3AZGB 5HE3A 2K00A 2HIOC 1B55A 5DHFB 3WTPD 3KUYD 5GXQA 5B2JC 3OANA 5DIFB 4H9SC 1KZGA 5CPKA 1A7WA 3NQJA 1KI1B 2CY5A 2YFVB 5KQ1A 2YFVA 3KWQB 3AZMB 3VH5A 4WU8C 1X1FA 5FI0A 1AOID 3SNHA 1XD4A 1AWEA 4C0AA 1DBHA 4KGCC 2LG1A 4K81A 3AV2A 4ZUXA 5B0ZB 1HQ3A 5D3XA 4HHVA 3AZKC 4H9NB 4J8XD 1P3GD 1B6WA 4HAYB 2COCA 4XUJD 5B0YC 3AZHC 5E5AD 1EQZA 3B6FA 2LOXA 3LJAD 3PZDA 2CAYA 3ODWA 3AZED 1BTNA 3IVFA 3AV1A 4YS3A 4G92B 4R8PD 3AFAD 3X1VB 1ID3B 4KUDC 3D8FA 3UT9B 1P3FD 1WG7A 2HUEB 4H9RB 5GT0D 2HTHB 2ROZB 5E5AA 1U27A 4EO5B 2GJYA 2FJ7D 3WTPE 2YT1A 3AZEA 5GT3B 2MKRA 4DBBA 4J8XC 3X1TD 3WKJA 2Z0PA 1U35C 1P3OD 4HAWB 1AOIA 3A6NC 3MGPB 1P34B 3RELC 1TQZA 2DHJA 5EFXA 5B0ZD 4ZUXD 4P7IA 2DTCA 4GPTB 3MGRA 3AZJB 4XUJB 1P3BD 2EMTA 3AZGC 3KRWA 3NQUA 3C1CD 1W1GA 2CRFA 3WKJB 3DXDA 4WVFB 2J0MA 5GT3A 3AZEB 1GC6A 1LW3A 2RLOA 4X23B 4Z66B 5AVBA 3AZNB 5B2JB 1FGZA 3FM8C 3PVWA 3REJC 4R8PB 1MIXA 1V89A 1UNRA 5DNND 3AV1D 3P6AA 1X1GA 4GZUA 4YM6D 2CWEA 4KHOA 5CP6C 3SYXA 5GT0B 3MPXA 4HAVB 5GSUA 2R0DA 3AFAC 2NMBA 3TW1A 2GCLA 4CSRB 3UTBA 3AZFB 3V9RA 1PLSA 1P3MA 5CHLB 1W1DA 2YRYA 2VKIA 4MK0A 3X1TB 3O62D 3VH5W 2BYMB 1B67A 1P3OB 2K2JA 4KVGB 5E5AC 3MGPD 1P34D 1KX5B 1EF1A 2I1KA 4GMVA 1HQ3B 4ZBJC 4ZUXB 4Z2MH 3KXBB 3VH6T 5B0ZA 1X86A 4D0NB 4KHAB 1N1JA 3X1UA 3MGQC 2YVCA 3MGRD 1P3BB 3W98A 1OMWA 3C1BC 2YS5A 4DX8A 3C1CB 4WU9A 2F8NA 3KSYA 3KWQA 4WNNB 5F99C 2PYOC 4NY0A 5J3TA 3NQJB 1IRSA 5BNXA 5AY8D 3D8DA 5B2JD 1UPRA 3AYWB 5C5BB 3MGRC 1V5PA 2N0YA 4K17A 3WAAB 2ROVA 4NE3A 4XZQD 4YM6B 4HGAC 4H9QA 5GT3C 1F66C 1KX4C 1K5DB 3LZ0B 3W98D 3REJA 2LOZA 1WJMA 2J0KA 1KX3A 3W97D 2NQBD 2D9VA 3AZKA 4QLCB 3UTBD 1ISNA 2D9WA 4JJNC 3O62B 3KY9A 3MGSC 1WJ1A 2MFQA 1KX5D 5CPIC 3O62A 3W97C 5BS7A 1M19A 2RUKB 5D27A 2NQBC 3KXBD 4G91B 1OQNA 3U8ZA 1KX3B 3AZMC 4YS3C 2AROD 4IOYX 3REJB 3LZ0A 1P3KB 1MAIA 2ZPYA 3REKD 1ZVRA 4IAPA 5JRGC 4CHMA 1F66D 3LZ1B 3RELA 3CXBB 5AVCA 2MDXA 4NE6A 5B32G 3WAAA 4CYEA 3AYWD 3O96A 3AZHB 1BAKA 1H3OB 3TU4A 3KUYA 3X1TC 2NZDC 4WU9B 1UNPA 4H9PA 5AV6C 1GG3A 3LZ0D 3A6NA 3W98B 5AVBC 1P3KA 4KHAA 3REHC 5B40C 1RJ2A 3B0CW 2KGXB 3KXBC 2DYQA 4A6HA 3MGQB 1U2BA 2ELBA 2W2XC 3X1SD 3D8EA 3UTBC 1M1AA 1SHCA 4HB3B 1P3AB 3AZFA 1BH8A 1WWSA 1M19D 1P3MD 3WA9B 2DKPA 5B32A 5GSUB 2D9ZA 1P3KD 2IYBA 4PNKA 1FHOA 3W99B 4HGAB 1F66B 5C16A 1KX4B 3AU4A 2D9YA 4CAYA 3LJAA 2QKMA 4XUJC 3AZHD 5CPKC 5B1LD 5D3VA 2BYKA 3WKJC 1XCGA 1MK7B 4X23C 3AZNC 3KWQC 4WU9D 1SGHA 4E45A 2YF0A 4HB2B 4H9PB 1H4RA 4K2PA 3A6ND 4DX90 1Z87A 1EVHA 2FJLA 2L1CA 4KGCB 5AY8A 5B0ZC 3B0DB 5AV5B 3WTPC 3KWQD 3MGQD 3AZHA 2ADZA 5C3IB 1AOIB 3CIKA 4HAUB 3B6FC 5AVCB 1X05A 4TKNA 3LELD 4CAYB 5B1MC 3AN2A 1P3OA 2COFA 5B31A 1F1EA 3LZ1C 1P6SA 3UTAD 2DX1A 4J8UA 2HE7A 3B0BA 1U5FA 1P3MB 5CPKD 3PEGA 5E5AB 5B32B 2G35A 3AJ4A 3ZDTA 1KX5C 5GXQD 1BH8B 2CV5C 3WA9A 5JP4A 3W99D 2Y7BA 1P3FC 3W97A 5BS7C 1M19C 1WGUA 1ID3D 5BNVA 4J8WA 3U7DA 1WGQA 5JHGA 1MIZB 5B2IA 3VH6W 5DNNA 1P3ID 2H7EA 4Z5TD 1P3LD 3A6NB 3B6FD 3NSUA 1UPQA 3WAAC 2GCJA 4KGCD 1BH9B 5B1MD 3ODXA 2FJ7B 5KQ4A 5JHHA 1EGXA 5AV5D 2HIOA 2NZDD 5B31G 2F8NK 3AZJC 3AYWA 3LZ0C 5DNMC 2DN6A 1H3OA 3TU4B 5AVCD 2EMSA 4MT7A 1M7RA 3LJUX 5JRGA 5F99D 3MVDA 4UUZA 4WJ7A 4ZRIA 4WV4B 4WU8B 3AZJD 5CPKB 1P3PD 5B1LC 2D2QA 4L6EA 1TZYA 5GXQB 2DHIA 2EJ8A 3WKJD 3M1IB 4A6KA 4EKUA 3HQCA 4Z66D 3AZLD 1KX3C 5GT0C 2UZSA 2V76A 1WWIA 1P3KC
chains in the Genus database with same CATH superfamily
3AZFC 3ODOA 3HSAA 3AV1B 1ID3A 1XR0B 3FSSA 1FGYA 1P3FA 2RVQC 4Y94A 4WZSB 4J8WD 4JJND 5CPJC 2K2UA 2Y8GA 1HTAA 2Y2LA 3IP4C 3B6FB 2M14A 3AZFD 5B1MB 3B6GA 4K2OA 1M1AC 2DFKA 5KDMA 5BT1C 2NZDB 3MNNA 4MY6A 3W98C 5FUGB 1N3HA 2P0HA 5AVBB 4X23A 3W96A 3C1CC 3AZNA 2CV5B 4NE5A 1P3GA 2PYOA 5F99B 1UNQA 5I2SA 1HQ3D 4UUZB 1JFIB 1MK9B 4HDQA 1KZ7A 1EQZD 5CLLB 5AY8C 3ULCA 4WU8D 4XUJA 3MGRB 3AZJA 2JSSA 5DNMD 1P3BA 1P3PB 2IO5C 2FJUB 3RELD 1XODA 1N1JB 4LD9C 1FAOA 3F6TA 3A8PA 3MGPA 1P34A 1MI1A 2YFWB 3H0MC 5B33C 3A1IA 4Z5TC 5B0YA 3AZID 3WAAD 1V5MA 2LYDA 2FJ7C 4XZQB 2D11A 5B2ID 2DKQA 4KAXB 4PQ0A 2FFFB 3NWDA 4J8WB 4JJNB 5BT1D 2ZY4A 1ZLAA 3EPHA 3NWFA 3REID 4AWLC 2VSZA 3A8QA 3W97B 1MKEA 3F0WA 2NQBB 4G91C 1FOEA 5CPJD 2NZ8B 4YS3B 1XKEA 4J8VA 4R8PA 3KZ1A 5GXQC 5B2JA 2CV5D 5JA4B 2R09A 4XZQA 3LJAC 1J0WA 1EQZB 3B77A 3AZLC 1KX3D 2Y2KA 2J8PA 1P3RA 3REJD 4H9NA 3LELC 2YS3A 5AV5A 2I5CA 2N23A 2VRWB 4KGCA 1U29A 5AV6D 2XQNM 2Y2NA 3FVCA 3C1BD 4F7GA 3AZIB 5B40B 3REHB 1GC7A 5G49B 5JRGD 2PYOB 3SV1A 1H10A 3W96B 3TO1A 1M18B 5F99A 3MVDD 3REKA 3AYWC 3REIB 2COAA 3SUZA 4H9OB 1DDMA 2AROA 5BO0A 3MNNB 2P8VA 2J59M 3AZGA 1W1HA 1P3IC 3WA9C 4YS3D 2AEHA 4XWXA 2Z0OA 3X1VA 4DRAA 5GSUC 3ML4A 4UPKA 3MDBC 1BTKA 5CPJA 1J19A 5B24C 1XX0A 3PVLA 4HAXB 1U5DA 2L5AA 4QLCC 2G5HC 4GOUA 3WA9D 3MGSD 5GSUD 1Q9CA 1S32D 4J8XA 4IFSA 3X23A 5CPIB 1TJ6A 2X18A 5DNNC 1U35A 2XD5A 5L81A 4XZQC 3GYOA 5DHAB 1K5GB 1TZYB 2Y2HA 3X1SA 1KX4D 1P3GC 3TCAA 2OQBA 2F8NG 5B0YD 5AV9C 5B1LB 3VH5T 3C1BA 3AU5A 5B40D 3REHD 3AZMA 1M18A 4LD9D 2RVBB 4WU8A 5JRGB 2PYOD 2JE5A 1U5EA 2UZRA 4H8SA 3W96D 3U12A 1FHWA 3MVDB 1AOIC 1DYNA 5AVCC 5J3YA 1Y19B 2Z4DA 5C6RA 2ZY2A 1BFMA 1FHXA 2YT0A 5B31C 1EQZC 3FEHA 3KUYC 4WU9C 2VQRA 2FJ7A 2I1JA 5CP6A 4A6FA 2Y2OA 3LELB 3H0LC 5AV8D 1V88A 1QC6A 4Z2MB 5BNVB 3QWMA 3UTAB 5D3YA 5JA4A 2BG1A 2BCJA 3PG7A 4EMOA 1ID3C 3MGSA 4G92C 5B32D 3X1VC 4KUDB 4KHBB 5CPID 3UT9C 5J3QA 1R4VA 4HAZB 4GN1A 2NQBA 1TZYD 1P3AC 1X11A 3AFAA 3REIC 4DXAB 3AZLA 4LD9B 2Q13A 4JJNA 1ZLAB 3MNNC 4H9QB 4YM6A 3EG5B 5FI1A 1P3IB 1OY2A 3QBVB 1ZC4B 2D4QA 4J8VC 4Z5TB 1Z2CB 3TU4C 1P3LB 5CLQB 3TFMA 5BNXB 4DIXA 4HDOA 4QJ4B 4YONA 2UVMA 5AV6A 1PFJA 5HE1A 3TU4D 3A98B 1TAFB 2CODA 3REKC 3ZVRA 2MWNB 5KCVA 1ULYA 1JFIA 3ULBA 2BYKB 1P3GB 3NW8A 1P3LA 1S32A 4WJ3C 5AV9B 2L2IA 3N7CA 2J0JA 1P3IA 4NFTA 3X1TA 2HIOD 5KDMB 2NZDA 3LJAB 3W99A 2ELAA 2H7DA 3AV2C 2LKOA 1KX4A 1WVHA 1RRPB 3B0CT 5B1MA 3V9RB 3AZLB 3AN2C 3B6GB 1P3MC 3GYPA 2K49A 4QJ5B 3AFAB 5B32C 3X1VD 3BJIA 2M38A 3UT9D 1ZLAD 1ZC3B 1P3FB 4F7UP 1AQCA 1M1AB 1T77A 2KIEA 4DRBA 1WI1A 3TVVA 3R45B 3KRXA 2AL6A 3X1SC 3AZIC 1DDWA 5AV8C 4Z66A 2DQNC 3X1UC 3MGQA 2KCJA 3DXCA 5GT3D 3AZKD 3UTAC 1ZM0A 1M18C 3LELA 3UZTA 3EPLA 3T06A 1P3BC 1P3PC 5AVBD 1NI2A 4J8UD 4H9SA 2JP2A 5B31D 4ZRKA 2DX5A 1I7AA 1U5GA 3AL0C 5HE0A 5C79A 5B33A 3VH6A 5B33B 5DNMB 5AV9D 4L1RA 3RELB 2D10A 2F8NH 2HIOB 3VIAA 5D3WA 5LOPB 4YL8A 5M4YB 3LZ1A 4X23D 3AZND 1BH9A 3B6GD 2Y2QA 2AROC 5DH9B 1P3LC 1S32C 4HB4B 4Z2MG 2D9XA 5DNNB 3X1UD 3PSCA 4F7HA 5B2IB 1M1AD 1TZYC 3UT9A 2G5IC 3O62C 5CPIA 1UEFA 3R45A 4M6BA 3DCXA 4R8PC 2YSZA 4QLCA 5B24D 3AV1C 3HW2B 2E2XA 2RVQD 1LB1A 3AZKB 2CY4A 3F5RA 5CPJB 4GNKB 3WA0A 1NTVA 4J8UB 3SO6A 2DLWA 5B31B 3AV2B 1PMSA 1V5UA 3VOQA 3AN2B 3B6GC 5JLJB 5B33D 3REIA 5DNMA 3WYFB 4HB0B 1EAZA 5LONB 5C5BA 4HATB 4ZUXC 2PZ1A 3W96C 3C1CA 2F8NB 2I5FA 5AY8B 5B40A 3REHA 4WNNA 5AV6B 4Z2NA 5GOWB 3C1BB 2IO5B 5B1LA 3KXBA 4EO5C 2K8EA 2QKLA 4NSWA 3X1UB 1I2HA 1KX5A 1M18D 1U35B 2Y2IA 3MGPC 1P34C 2NBVA 5B24B 1FB8A 2BYMA 3MNND 4ZRJA 1F66A 4CSRA 4QLCD 3UTBB 4J8WC 1E5WA 1V61A 4J8VB 4AWLB 2W2WA 2P0DA 1P3AA 4EJNA 3W99C 5GT0A 1Q67A 2DA0A 2KUQA 3AV2D 3AZEC 2Z0QA 4KUDA 5AV8A 4Z66C 3AN2D 2GS0A 2P0FA 3MGSB 2AROB 5BO0B 3PP2A 5AV9A 1QQGA 1S32B 4H9OA 3UTAA 2W2XD 3PVUA 1M7EA 2OTXA 3REKB 4TYZA 4BBKA 4E44A 5B2IC 2RSGA 3LZ1D 3NQUB 4DQYB 5CP6B 2F8ND 4GMXB 4A6FB 1TAFA 3MVDC 5G49A 5B0YB 1NU2A 3AZIA 3AZGD 1ZSQA 3V5WA 2YFWA 4CHJA 3WTPA 2DHKA 4A5KA 4GXBA 3B0DC 3WTPB 5AV5C 3KUYB 2DYNA 2LY8A 5C3IC 1U35D 1P3OC 1P3PA 4Z5TA 3QIJA 1NTYA 1DDVA 1TXDA 4J8UC 3G9WA 1DROA 1HQ3C 4ZBJB 2IFSA 1P5TA 2HUEC 3AZMD 2CV5A 4LD9A 1Y5OA 2EC1A 5FUGA 4J8VD 2RGNB 3X1SB 1MPHA 5AV8B 2RNRB 2KUPA 4H9RA 2LULA 4J8XB 3RCPA 1P3AD 1M19B 1BWNA 5HE2A 3DXEA 4KHBA 3H0RC 4KUDD 2Y8FA 4B6HA 3EPJA 5DI9B 1KU5A 1ZLAC 4YM6C 2YS1A 3P7ZA 4WSFA 5CP6D 5B24A 2XD1A 3BINA 3HK0A 3AZGB 5HE3A 2K00A 2HIOC 1B55A 1PZRA 5DHFB 3EPKA 3WTPD 3KUYD 5GXQA 5B2JC 3OANA 5DIFB 4H9SC 1KZGA 5CPKA 1A7WA 3NQJA 1KI1B 2CY5A 2YFVB 5KQ1A 2YFVA 3KWQB 3AZMB 3VH5A 4WU8C 1X1FA 5FI0A 1AOID 3SNHA 1XD4A 1AWEA 4OSNA 4C0AA 1DBHA 4KGCC 2LG1A 4K81A 3AV2A 4ZUXA 5B0ZB 1HQ3A 5D3XA 4HHVA 3AZKC 4H9NB 4J8XD 1P3GD 1B6WA 4HAYB 2COCA 4XUJD 5B0YC 3AZHC 5E5AD 1T3UA 1EQZA 3B6FA 2LOXA 3LJAD 3PZDA 2CAYA 3ODWA 3AZED 1BTNA 3IVFA 3AV1A 4YS3A 4G92B 4R8PD 3AFAD 3X1VB 1ID3B 4KUDC 3D8FA 3UT9B 1ZYIA 1P3FD 2KR0A 2DF4C 1WG7A 2HUEB 4H9RB 5GT0D 2HTHB 2ROZB 5E5AA 1U27A 4EO5B 2GJYA 2FJ7D 3WTPE 2YT1A 3AZEA 5GT3B 2MKRA 4DBBA 4J8XC 3X1TD 3WKJA 2Z14A 2Z0PA 1U35C 1P3OD 4HAWB 1AOIA 3A6NC 3FDDA 3MGPB 3RELC 1P34B 1TQZA 2DHJA 5EFXA 5B0ZD 4ZUXD 4P7IA 2DTCA 4GPTB 3MGRA 3AZJB 4XUJB 1P3BD 2EMTA 3OHMB 3AZGC 3KRWA 3NQUA 3C1CD 1W1GA 2CRFA 3WKJB 2JCHA 3DXDA 3HIEA 2J0MA 4WVFB 5GT3A 3AZEB 1GC6A 1LW3A 2RLOA 5AVBA 4Z66B 4X23B 3AZNB 5B2JB 1FGZA 3FM8C 3PVWA 4CSQA 3REJC 4R8PB 1MIXA 1V89A 1UNRA 5DNND 3AV1D 3P6AA 1X1GA 4GZUA 4YM6D 4D6WA 2CWEA 4KHOA 5CP6C 3SYXA 5GT0B 3MPXA 4HAVB 5GSUA 2R0DA 3AFAC 2NMBA 3TW1A 5IRSA 2GCLA 4CSRB 3UTBA 3AZFB 3V9RA 1PLSA 1P3MA 2Y2JA 3A1KA 5CHLB 1W1DA 2VKIA 2YRYA 4MK0A 5LG4B 3X1TB 3O62D 2RIQA 2BYMB 1B67A 3VH5W 1P3OB 2K2JA 4KVGB 5E5AC 3MGPD 1P34D 1KX5B 1EF1A 2I1KA 4GMVA 1HQ3B 4ZBJC 4ZUXB 4Z2MH 5B0ZA 3VH6T 3KXBB 1X86A 4D0NB 4KHAB 1N1JA 3X1UA 3MGQC 2YVCA 3MGRD 1P3BB 3W98A 1OMWA 3C1BC 2YS5A 4DX8A 3C1CB 4WU9A 2F8NA 2ZKMX 3KSYA 3KWQA 4WNNB 5F99C 2PYOC 2ZM5A 4NY0A 3NQJB 5J3TA 1IRSA 5BNXA 5AY8D 3D8DA 5B2JD 1UPRA 3AYWB 5C5BB 3MGRC 1V5PA 2N0YA 4K17A 3WAAB 2ROVA 2Z13A 4NE3A 4XZQD 4YM6B 4HGAC 4H9QA 5GT3C 1F66C 2RRFA 1KX4C 1K5DB 2Z59A 3LZ0B 3W98D 3REJA 2LOZA 1WJMA 2J0KA 2YT2A 1KX3A 3W97D 2NQBD 2D9VA 3AZKA 4QLCB 3UTBD 1ISNA 2D9WA 4JJNC 3O62B 3KY9A 3MGSC 1WJ1A 2MFQA 1KX5D 5CPIC 3O62A 3W97C 5BS7A 1M19A 2RUKB 5D27A 2NQBC 3KXBD 4G91B 1OQNA 3U8ZA 1KX3B 3AZMC 2Y2PA 4YS3C 2AROD 4IOYX 3REJB 3LZ0A 1P3KB 1MAIA 2ZPYA 3REKD 1ZVRA 4IAPA 5JRGC 4CHMA 1F66D 3A58A 3LZ1B 3RELA 3CXBB 5AVCA 2MDXA 4NE6A 5B32G 3WAAA 4CYEA 3AYWD 3O96A 3AZHB 1BAKA 1H3OB 3TU4A 3KUYA 3NWAA 3X1TC 2NZDC 4WU9B 1UNPA 4H9PA 5AV6C 1GG3A 3LZ0D 3A6NA 3W98B 5AVBC 1P3KA 4KHAA 3REHC 5B40C 1RJ2A 3B0CW 1W2EA 2KGXB 3KXBC 2DYQA 4A6HA 3MGQB 1U2BA 4HSIA 2ELBA 2W2XC 3X1SD 3D8EA 3UTBC 1M1AA 1SHCA 4HB3B 1P3AB 3AZFA 1BH8A 1WWSA 1M19D 1P3MD 3WA9B 2DKPA 5B32A 5GSUB 2D9ZA 1P3KD 2IYBA 4PNKA 1FHOA 3W99B 4HGAB 1F66B 5C16A 1KX4B 2GUMA 3AU4A 2D9YA 4CAYA 3LJAA 2QKMA 4XUJC 3AZHD 5CPKC 4OT1A 5B1LD 5D3VA 2BYKA 3WKJC 1XCGA 2KIGA 1MK7B 4X23C 3AZNC 3KWQC 4WU9D 1SGHA 4E45A 2YF0A 4HB2B 4H9PB 1H4RA 4K2PA 3A6ND 4DX90 1Z87A 1EVHA 2FJLA 2L1CA 4KGCB 5AY8A 4QXAB 5B0ZC 3B0DB 4QJ3B 5AV5B 3WTPC 3KWQD 2ZY3A 3MGQD 3AZHA 5C3IB 1AOIB 2ADZA 2R2YA 3CIKA 3B6FC 2Y2GA 5AVCB 1X05A 3LELD 4CAYB 4HAUB 5B1MC 3AN2A 1P3OA 4TKNA 2COFA 5B31A 1F1EA 3LZ1C 1P6SA 3UTAD 2DX1A 4J8UA 2HE7A 3B0BA 1U5FA 1P3MB 5CPKD 3PEGA 5E5AB 5B32B 2G35A 3AJ4A 3ZDTA 1KX5C 3P5JB 1BH8B 5GXQD 2CV5C 3WA9A 3W99D 5JP4A 2Y7BA 1P3FC 3W97A 5BS7C 1M19C 1WGUA 2W8SA 1ID3D 2UWXA 5BNVA 4J8WA 3U7DA 1WGQA 5JHGA 1MIZB 5B2IA 3VH6W 2F2AC 5DNNA 1P3ID 5I2MA 2H7EA 4Z5TD 1P3LD 3A6NB 3B6FD 3NSUA 1UPQA 3WAAC 2GCJA 4KGCD 1BH9B 5B1MD 3ODXA 2FJ7B 5KQ4A 5JHHA 2ZY5A 1EGXA 5AV5D 2HIOA 2NZDD 5B31G 2F8NK 3AZJC 2Y2MA 3LZ0C 5DNMC 3AYWA 1H3OA 3TU4B 5AVCD 2DN6A 2EMSA 4MT7A 1M7RA 3LJUX 5JRGA 5F99D 3MVDA 4UUZA 4WJ7A 4ZRIA 4WV4B 4WU8B 3AZJD 5CPKB 1P3PD 5B1LC 2D2QA 4L6EA 1TZYA 5GXQB 2DHIA 2EJ8A 3WKJD 3M1IB 4A6KA 4EKUA 3HQCA 4Z66D 3AZLD 1KX3C 5GT0C 3KFUG 2UZSA 2V76A 1WWIA 1P3KC
chains in the Genus database with same CATH topology
3AZFC 3ODOA 3AV1B 1ID3A 1XR0B 3FSSA 1FGYA 1P3FA 2RVQC 4Y94A 4WZSB 4J8WD 4JJND 5CPJC 2K2UA 2Y8GA 1HTAA 2Y2LA 3IP4C 3B6FB 2M14A 3AZFD 5B1MB 3B6GA 4K2OA 1M1AC 2DFKA 5KDMA 5BT1C 2NZDB 3MNNA 4MY6A 3W98C 5FUGB 1N3HA 2P0HA 5AVBB 4X23A 3W96A 3C1CC 3AZNA 2CV5B 4NE5A 1P3GA 2PYOA 5F99B 1UNQA 5I2SA 1HQ3D 4UUZB 1JFIB 1MK9B 4HDQA 1KZ7A 1EQZD 5CLLB 5AY8C 3ULCA 4WU8D 4XUJA 3MGRB 3AZJA 2JSSA 5DNMD 1P3BA 1P3PB 2IO5C 3BINA 3RELD 1XODA 1N1JB 4LD9C 1FAOA 3F6TA 3A8PA 3MGPA 1P34A 2YFWB 3H0MC 5B33C 3A1IA 4Z5TC 5B0YA 3AZID 3WAAD 1V5MA 2LYDA 2FJ7C 4XZQB 2D11A 5B2ID 2DKQA 4KAXB 4PQ0A 2FFFB 3NWDA 4J8WB 4JJNB 5BT1D 2ZY4A 1ZLAA 3EPHA 3NWFA 3REID 4AWLC 2VSZA 3A8QA 3W97B 1MKEA 3F0WA 2NQBB 4G91C 1FOEA 5CPJD 2NZ8B 4YS3B 1XKEA 4J8VA 4R8PA 3KZ1A 5GXQC 5B2JA 2CV5D 5JA4B 2R09A 4XZQA 3LJAC 1J0WA 1EQZB 3AZLC 1KX3D 2Y2KA 2J8PA 1P3RA 3REJD 4H9NA 3LELC 2YS3A 5AV5A 2I5CA 2N23A 2VRWB 4KGCA 1U29A 5AV6D 2XQNM 2Y2NA 4F7GA 3C1BD 3FVCA 3AZIB 5B40B 3REHB 1GC7A 5G49B 5JRGD 2PYOB 3SV1A 1H10A 3W96B 3TO1A 1M18B 5F99A 3MVDD 3REKA 3AYWC 3REIB 2COAA 3SUZA 4H9OB 1DDMA 2AROA 5BO0A 3MNNB 2P8VA 2J59M 3AZGA 1W1HA 1P3IC 3WA9C 4YS3D 2AEHA 4XWXA 2Z0OA 3X1VA 4DRAA 5GSUC 3ML4A 4UPKA 3MDBC 1BTKA 5CPJA 1J19A 5B24C 1XX0A 3PVLA 4HAXB 1U5DA 2L5AA 4QLCC 2G5HC 4GOUA 3WA9D 3MGSD 5GSUD 1Q9CA 1S32D 4J8XA 4IFSA 3X23A 5CPIB 1TJ6A 2X18A 5DNNC 1U35A 2XD5A 5L81A 4XZQC 3GYOA 5DHAB 1K5GB 1TZYB 2Y2HA 3X1SA 1KX4D 1P3GC 3TCAA 2OQBA 2F8NG 5B0YD 5AV9C 5B1LB 3VH5T 3C1BA 3AU5A 5B40D 3REHD 3AZMA 1M18A 4LD9D 2RVBB 4WU8A 5JRGB 2PYOD 2JE5A 1U5EA 2UZRA 4H8SA 3W96D 3U12A 1FHWA 3MVDB 1AOIC 1DYNA 5AVCC 5J3YA 1Y19B 5C6RA 2Z4DA 2ZY2A 1BFMA 1FHXA 2YT0A 5B31C 1EQZC 3FEHA 3KUYC 4WU9C 2VQRA 2FJ7A 2I1JA 5CP6A 4A6FA 2Y2OA 3LELB 3H0LC 5AV8D 1V88A 1QC6A 4Z2MB 5BNVB 3QWMA 3UTAB 5D3YA 5JA4A 2BG1A 2BCJA 3PG7A 4EMOA 1ID3C 3MGSA 4G92C 5B32D 3X1VC 4KUDB 4KHBB 5CPID 3UT9C 5J3QA 1R4VA 4HAZB 4GN1A 2NQBA 1TZYD 1P3AC 1X11A 3AFAA 3REIC 4DXAB 3AZLA 4LD9B 2Q13A 4JJNA 1ZLAB 3MNNC 4H9QB 4YM6A 3EG5B 5FI1A 1P3IB 1OY2A 3QBVB 1ZC4B 2D4QA 4J8VC 4Z5TB 1Z2CB 3TU4C 1P3LB 5CLQB 3TFMA 5BNXB 4DIXA 4HDOA 4QJ4B 4YONA 2UVMA 5AV6A 1PFJA 5HE1A 3TU4D 3A98B 1TAFB 2CODA 3REKC 3ZVRA 2MWNB 5KCVA 1ULYA 1JFIA 3ULBA 2BYKB 1P3GB 3NW8A 1P3LA 1S32A 4WJ3C 5AV9B 2L2IA 3N7CA 2J0JA 1P3IA 4NFTA 3X1TA 2HIOD 5KDMB 2NZDA 3LJAB 3W99A 2ELAA 2H7DA 3AV2C 2LKOA 1KX4A 1WVHA 1RRPB 3B0CT 5B1MA 3V9RB 3AZLB 3AN2C 3B6GB 1P3MC 3GYPA 2K49A 4QJ5B 3AFAB 5B32C 3X1VD 3BJIA 2M38A 3UT9D 1ZLAD 1ZC3B 1P3FB 4F7UP 1AQCA 1M1AB 2KIEA 4DRBA 1WI1A 3TVVA 3R45B 3KRXA 2AL6A 3X1SC 3AZIC 1DDWA 5AV8C 4Z66A 2DQNC 3X1UC 3MGQA 2KCJA 3DXCA 5GT3D 3AZKD 3UTAC 1ZM0A 1M18C 3LELA 3UZTA 3EPLA 3T06A 1P3BC 1P3PC 5AVBD 1NI2A 4J8UD 4H9SA 2JP2A 5B31D 4ZRKA 2DX5A 1I7AA 1U5GA 3AL0C 5HE0A 5C79A 5B33A 3VH6A 5B33B 5DNMB 5AV9D 4L1RA 3RELB 2D10A 2F8NH 2HIOB 3VIAA 5D3WA 5LOPB 4YL8A 5M4YB 3LZ1A 4X23D 3AZND 1BH9A 3B6GD 2Y2QA 2AROC 5DH9B 1P3LC 1S32C 4HB4B 4Z2MG 2D9XA 5DNNB 3X1UD 3PSCA 4F7HA 5B2IB 1M1AD 1TZYC 3UT9A 2G5IC 3O62C 5CPIA 1UEFA 3R45A 4M6BA 4R8PC 2YSZA 4QLCA 5B24D 3AV1C 3HW2B 2E2XA 2RVQD 1LB1A 3AZKB 2CY4A 3F5RA 5CPJB 4GNKB 3WA0A 1NTVA 4J8UB 3SO6A 2DLWA 5B31B 3AV2B 1PMSA 1V5UA 3VOQA 3AN2B 3B6GC 5JLJB 5B33D 3REIA 5DNMA 3WYFB 4HB0B 1EAZA 5LONB 5C5BA 4HATB 4ZUXC 2PZ1A 3W96C 3C1CA 2F8NB 2I5FA 5AY8B 5B40A 3REHA 4WNNA 5AV6B 4Z2NA 5GOWB 3C1BB 2IO5B 5B1LA 3KXBA 4EO5C 2QKLA 4NSWA 2K8EA 3X1UB 1I2HA 1KX5A 1M18D 1U35B 2Y2IA 3MGPC 1P34C 2NBVA 5B24B 1FB8A 2BYMA 3MNND 4ZRJA 1F66A 4CSRA 4QLCD 3UTBB 4J8WC 1E5WA 1V61A 4J8VB 4AWLB 2W2WA 2P0DA 1P3AA 4EJNA 3W99C 5GT0A 1Q67A 2DA0A 2Z0QA 3AV2D 3AZEC 2KUQA 4KUDA 5AV8A 4Z66C 3AN2D 2GS0A 2P0FA 3MGSB 2AROB 5BO0B 3PP2A 5AV9A 1QQGA 1S32B 4H9OA 3UTAA 2W2XD 3PVUA 1M7EA 2OTXA 3REKB 4TYZA 4BBKA 4E44A 5B2IC 2RSGA 3LZ1D 3NQUB 4DQYB 5CP6B 2F8ND 4GMXB 4A6FB 1TAFA 3MVDC 5G49A 5B0YB 1NU2A 3AZIA 3AZGD 1ZSQA 3V5WA 2YFWA 4CHJA 3WTPA 2DHKA 4A5KA 4GXBA 3B0DC 3WTPB 5AV5C 3KUYB 2DYNA 2LY8A 5C3IC 1U35D 1P3OC 1P3PA 4Z5TA 3QIJA 1NTYA 1DDVA 1TXDA 4J8UC 3G9WA 1DROA 1HQ3C 4ZBJB 2IFSA 1P5TA 2HUEC 3AZMD 2CV5A 4LD9A 1Y5OA 2EC1A 5FUGA 4J8VD 2RGNB 3X1SB 1MPHA 5AV8B 2RNRB 2KUPA 4H9RA 2LULA 4J8XB 3RCPA 1P3AD 1M19B 2FJUB 1BWNA 5HE2A 3DXEA 4KHBA 3H0RC 4KUDD 2Y8FA 4B6HA 3EPJA 5DI9B 1KU5A 1ZLAC 4YM6C 2YS1A 3P7ZA 4WSFA 5CP6D 5B24A 2XD1A 3HK0A 3AZGB 5HE3A 2K00A 2HIOC 1B55A 1PZRA 5DHFB 3EPKA 3WTPD 3KUYD 5GXQA 5B2JC 3OANA 5DIFB 4H9SC 1KZGA 5CPKA 1A7WA 3NQJA 1KI1B 2CY5A 2YFVB 5KQ1A 2YFVA 3KWQB 3AZMB 3VH5A 4WU8C 1X1FA 5FI0A 1AOID 3SNHA 1XD4A 1AWEA 4OSNA 4C0AA 1DBHA 4KGCC 2LG1A 4K81A 3AV2A 4ZUXA 5B0ZB 1HQ3A 5D3XA 4HHVA 3AZKC 4H9NB 4J8XD 1P3GD 1B6WA 4HAYB 2COCA 4XUJD 5B0YC 3AZHC 5E5AD 1T3UA 1EQZA 3B6FA 2LOXA 3LJAD 3PZDA 2CAYA 3ODWA 3AZED 1BTNA 3IVFA 3AV1A 4YS3A 4G92B 4R8PD 3AFAD 3X1VB 1ID3B 4KUDC 3D8FA 3UT9B 1ZYIA 1P3FD 2KR0A 2DF4C 1WG7A 2HUEB 4H9RB 5GT0D 2HTHB 2ROZB 5E5AA 1U27A 4EO5B 2GJYA 2FJ7D 3WTPE 2YT1A 3AZEA 5GT3B 2MKRA 4DBBA 4J8XC 3X1TD 3WKJA 2Z0PA 2Z14A 1U35C 1P3OD 4HAWB 1AOIA 3A6NC 3FDDA 3MGPB 3RELC 1P34B 1TQZA 2DHJA 5EFXA 5B0ZD 4ZUXD 4P7IA 2DTCA 4GPTB 3MGRA 3AZJB 4XUJB 1P3BD 2EMTA 3OHMB 3AZGC 3KRWA 3NQUA 3C1CD 1W1GA 2CRFA 3WKJB 2JCHA 3DXDA 4WVFB 2J0MA 3HIEA 5GT3A 3AZEB 1GC6A 1LW3A 2RLOA 5AVBA 4Z66B 4X23B 3AZNB 5B2JB 1FGZA 3FM8C 3PVWA 4CSQA 3REJC 4R8PB 1MIXA 1V89A 1UNRA 5DNND 3AV1D 3P6AA 1X1GA 4GZUA 4YM6D 4D6WA 2CWEA 4KHOA 5CP6C 3SYXA 5GT0B 3MPXA 4HAVB 5GSUA 2R0DA 3AFAC 2NMBA 3TW1A 5IRSA 2GCLA 4CSRB 3UTBA 3AZFB 3V9RA 1PLSA 1P3MA 2Y2JA 3A1KA 5CHLB 1W1DA 2VKIA 2YRYA 4MK0A 5LG4B 3X1TB 3O62D 2RIQA 2BYMB 1B67A 3VH5W 1P3OB 2K2JA 4KVGB 5E5AC 3MGPD 1P34D 1KX5B 1EF1A 2I1KA 4GMVA 1HQ3B 4ZBJC 4ZUXB 4Z2MH 5B0ZA 3VH6T 3KXBB 1X86A 4D0NB 4KHAB 1N1JA 3X1UA 3MGQC 2YVCA 3MGRD 1P3BB 3W98A 1OMWA 3C1BC 2YS5A 4DX8A 3C1CB 4WU9A 2F8NA 2ZKMX 3KSYA 3KWQA 4WNNB 5F99C 2PYOC 2ZM5A 4NY0A 3NQJB 5J3TA 1IRSA 5BNXA 5AY8D 3D8DA 5B2JD 1UPRA 3AYWB 5C5BB 3MGRC 1V5PA 2N0YA 4K17A 3WAAB 2ROVA 2Z13A 4NE3A 4XZQD 4YM6B 4HGAC 4H9QA 5GT3C 1F66C 2RRFA 1KX4C 1K5DB 2Z59A 3LZ0B 3W98D 3REJA 2LOZA 1WJMA 2J0KA 2R2YA 2YT2A 1KX3A 3W97D 2NQBD 2D9VA 3AZKA 4QLCB 3UTBD 1ISNA 2D9WA 4JJNC 3O62B 3KY9A 3MGSC 1WJ1A 2MFQA 1KX5D 5CPIC 3O62A 3W97C 5BS7A 1M19A 2RUKB 5D27A 2NQBC 3KXBD 4G91B 1OQNA 3U8ZA 1KX3B 3AZMC 2Y2PA 4YS3C 2AROD 4IOYX 3REJB 3LZ0A 1P3KB 1MAIA 2ZPYA 3REKD 1ZVRA 4IAPA 5JRGC 4CHMA 1F66D 3A58A 3LZ1B 3RELA 3CXBB 5AVCA 2MDXA 4NE6A 5B32G 3WAAA 4CYEA 3AYWD 3O96A 3AZHB 1BAKA 1H3OB 3TU4A 3KUYA 3NWAA 3X1TC 2NZDC 4WU9B 1UNPA 4H9PA 5AV6C 1GG3A 3LZ0D 3A6NA 3W98B 5AVBC 1P3KA 4KHAA 3REHC 5B40C 1RJ2A 3B0CW 1W2EA 2KGXB 3KXBC 2DYQA 4A6HA 3MGQB 1U2BA 4HSIA 2ELBA 2W2XC 3X1SD 3D8EA 3UTBC 1M1AA 1SHCA 4HB3B 1P3AB 3AZFA 1BH8A 1WWSA 1M19D 1P3MD 3WA9B 2DKPA 5B32A 5GSUB 2D9ZA 1P3KD 2IYBA 4PNKA 1FHOA 3W99B 4HGAB 1F66B 5C16A 1KX4B 3AU4A 2GUMA 2D9YA 4CAYA 3LJAA 2QKMA 4XUJC 3AZHD 5CPKC 4OT1A 5B1LD 5D3VA 2BYKA 3WKJC 1XCGA 2KIGA 1MK7B 4X23C 3AZNC 3KWQC 4WU9D 1SGHA 4E45A 2YF0A 4HB2B 4H9PB 1H4RA 4K2PA 3A6ND 4DX90 1Z87A 1EVHA 2FJLA 2L1CA 4KGCB 5AY8A 4QXAB 5B0ZC 3B0DB 4QJ3B 5AV5B 3WTPC 3KWQD 2ZY3A 3MGQD 3AZHA 5C3IB 1AOIB 2ADZA 3CIKA 4HAUB 3B6FC 2Y2GA 5AVCB 1X05A 3LELD 4CAYB 4TKNA 5B1MC 3AN2A 1P3OA 2COFA 5B31A 1F1EA 3LZ1C 1P6SA 3UTAD 2DX1A 4J8UA 2HE7A 3B0BA 1U5FA 1P3MB 5CPKD 3PEGA 5E5AB 5B32B 2G35A 3AJ4A 3ZDTA 1KX5C 3P5JB 1BH8B 5GXQD 2CV5C 3WA9A 3W99D 5JP4A 2Y7BA 1P3FC 3W97A 5BS7C 1M19C 1WGUA 2W8SA 1ID3D 2UWXA 5BNVA 4J8WA 3U7DA 1WGQA 5JHGA 1MIZB 5B2IA 3VH6W 2F2AC 5DNNA 1P3ID 5I2MA 2H7EA 4Z5TD 1P3LD 3A6NB 3B6FD 3NSUA 1UPQA 3WAAC 2GCJA 4KGCD 1BH9B 5B1MD 3ODXA 2FJ7B 5KQ4A 5JHHA 2ZY5A 1EGXA 5AV5D 2HIOA 2NZDD 5B31G 2F8NK 3AZJC 2Y2MA 3LZ0C 5DNMC 3AYWA 1H3OA 3TU4B 5AVCD 2DN6A 2EMSA 4MT7A 1M7RA 3LJUX 5JRGA 5F99D 3MVDA 4UUZA 4WJ7A 4ZRIA 4WV4B 4WU8B 3AZJD 5CPKB 1P3PD 5B1LC 2D2QA 4L6EA 1TZYA 5GXQB 2DHIA 2EJ8A 3WKJD 3M1IB 4A6KA 4EKUA 3HQCA 4Z66D 3AZLD 1KX3C 5GT0C 3KFUG 2UZSA 2V76A 1WWIA 1P3KC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AZF C;  3ODO A;  3AV1 B;  1ID3 A;  1XR0 B;  3FSS A;  1FGY A;  1P3F A;  2RVQ C;  4Y94 A;  4WZS B;  4J8W D;  4JJN D;  5CPJ C;  2K2U A;  2Y8G A;  1HTA A;  2M14 A;  3B6F B;  3AZF D;  5B1M B;  3B6G A;  4K2O A;  1M1A C;  2DFK A;  5KDM A;  5BT1 C;  2NZD B;  3MNN A;  4MY6 A;  3W98 C;  5FUG B;  1N3H A;  2P0H A;  5AVB B;  4X23 A;  3W96 A;  3C1C C;  3AZN A;  2CV5 B;  4NE5 A;  1P3G A;  2PYO A;  5F99 B;  1UNQ A;  1HQ3 D;  4UUZ B;  1JFI B;  1MK9 B;  4HDQ A;  1KZ7 A;  1EQZ D;  5CLL B;  5AY8 C;  3ULC A;  4WU8 D;  4XUJ A;  3MGR B;  3AZJ A;  2JSS A;  5DNM D;  1P3B A;  1P3P B;  2IO5 C;  3BIN A;  3REL D;  1XOD A;  1N1J B;  4LD9 C;  1FAO A;  3A8P A;  3MGP A;  1P34 A;  2YFW B;  5B33 C;  4Z5T C;  5B0Y A;  3AZI D;  3WAA D;  1V5M A;  2LYD A;  2FJ7 C;  4XZQ B;  2D11 A;  5B2I D;  2DKQ A;  4KAX B;  4PQ0 A;  4J8W B;  4JJN B;  5BT1 D;  1ZLA A;  3REI D;  4AWL C;  2VSZ A;  3A8Q A;  3W97 B;  1MKE A;  3F0W A;  2NQB B;  4G91 C;  1FOE A;  5CPJ D;  2NZ8 B;  4YS3 B;  1XKE A;  4J8V A;  4R8P A;  3KZ1 A;  5GXQ C;  5B2J A;  2CV5 D;  5JA4 B;  2R09 A;  4XZQ A;  3LJA C;  1J0W A;  1EQZ B;  3AZL C;  1KX3 D;  1P3R A;  3REJ D;  4H9N A;  3LEL C;  2YS3 A;  5AV5 A;  2I5C A;  2N23 A;  2VRW B;  4KGC A;  1U29 A;  5AV6 D;  2XQN M;  4F7G A;  3C1B D;  3AZI B;  5B40 B;  3REH B;  1GC7 A;  5G49 B;  5JRG D;  2PYO B;  3SV1 A;  1H10 A;  3W96 B;  3TO1 A;  1M18 B;  5F99 A;  3MVD D;  3REK A;  3AYW C;  3REI B;  2COA A;  3SUZ A;  4H9O B;  1DDM A;  2ARO A;  5BO0 A;  3MNN B;  2P8V A;  2J59 M;  3AZG A;  1W1H A;  1P3I C;  3WA9 C;  4YS3 D;  2AEH A;  4XWX A;  2Z0O A;  3X1V A;  4DRA A;  5GSU C;  3ML4 A;  3PVL A;  3MDB C;  1BTK A;  5CPJ A;  1J19 A;  5B24 C;  1XX0 A;  4HAX B;  1U5D A;  2L5A A;  4QLC C;  3WA9 D;  3MGS D;  5GSU D;  1Q9C A;  1S32 D;  4J8X A;  4IFS A;  3X23 A;  5CPI B;  1TJ6 A;  2X18 A;  5DNN C;  1U35 A;  5L81 A;  4XZQ C;  3GYO A;  5DHA B;  1K5G B;  1TZY B;  1KX4 D;  3X1S A;  3TCA A;  1P3G C;  2OQB A;  2F8N G;  5B0Y D;  5AV9 C;  5B1L B;  3VH5 T;  3C1B A;  3AU5 A;  5B40 D;  3REH D;  3AZM A;  1M18 A;  4LD9 D;  2RVB B;  4WU8 A;  5JRG B;  2PYO D;  1U5E A;  2UZR A;  4H8S A;  3W96 D;  1FHW A;  3MVD B;  1AOI C;  1DYN A;  5AVC C;  5J3Y A;  1Y19 B;  5C6R A;  1BFM A;  1FHX A;  2YT0 A;  5B31 C;  1EQZ C;  3FEH A;  3KUY C;  4WU9 C;  2FJ7 A;  2I1J A;  5CP6 A;  4A6F A;  3LEL B;  5AV8 D;  1V88 A;  1QC6 A;  4Z2M B;  5BNV B;  3QWM A;  3UTA B;  5D3Y A;  5JA4 A;  2BCJ A;  3PG7 A;  4EMO A;  1ID3 C;  3MGS A;  4G92 C;  5B32 D;  3X1V C;  4KUD B;  4KHB B;  5CPI D;  3UT9 C;  5J3Q A;  1R4V A;  4HAZ B;  4GN1 A;  2NQB A;  1TZY D;  1P3A C;  1X11 A;  3AFA A;  3REI C;  4DXA B;  3AZL A;  4LD9 B;  2Q13 A;  4JJN A;  1ZLA B;  3MNN C;  4H9Q B;  4YM6 A;  5FI1 A;  1P3I B;  1OY2 A;  3QBV B;  1ZC4 B;  2D4Q A;  4J8V C;  4Z5T B;  1P3L B;  3TU4 C;  5CLQ B;  3TFM A;  5BNX B;  4HDO A;  4YON A;  2UVM A;  5AV6 A;  1PFJ A;  5HE1 A;  3TU4 D;  3A98 B;  1TAF B;  2COD A;  3REK C;  3ZVR A;  2MWN B;  5KCV A;  1ULY A;  1JFI A;  3ULB A;  2BYK B;  1P3G B;  1P3L A;  1S32 A;  2L2I A;  5AV9 B;  3N7C A;  2J0J A;  1P3I A;  4NFT A;  3X1T A;  2HIO D;  5KDM B;  2NZD A;  3LJA B;  3W99 A;  2ELA A;  2H7D A;  3AV2 C;  2LKO A;  1KX4 A;  1WVH A;  1RRP B;  3B0C T;  5B1M A;  3V9R B;  3AZL B;  3AN2 C;  3B6G B;  1P3M C;  3GYP A;  3AFA B;  5B32 C;  3X1V D;  3BJI A;  2M38 A;  3UT9 D;  1ZLA D;  1ZC3 B;  1P3F B;  4F7U P;  1AQC A;  1M1A B;  4DRB A;  1WI1 A;  3TVV A;  3R45 B;  3KRX A;  2AL6 A;  3X1S C;  3AZI C;  1DDW A;  5AV8 C;  4Z66 A;  2KCJ A;  3X1U C;  3MGQ A;  3DXC A;  5GT3 D;  3AZK D;  3UTA C;  1ZM0 A;  1M18 C;  3LEL A;  3UZT A;  3T06 A;  1P3B C;  1P3P C;  5AVB D;  1NI2 A;  4J8U D;  4H9S A;  2JP2 A;  5B31 D;  4ZRK A;  2DX5 A;  1I7A A;  1U5G A;  5HE0 A;  5C79 A;  5B33 A;  3VH6 A;  5B33 B;  5DNM B;  5AV9 D;  3REL B;  2D10 A;  2F8N H;  2HIO B;  3VIA A;  5D3W A;  5LOP B;  4YL8 A;  3LZ1 A;  4X23 D;  3AZN D;  1BH9 A;  3B6G D;  2ARO C;  5DH9 B;  1P3L C;  1S32 C;  4HB4 B;  4Z2M G;  2D9X A;  5DNN B;  3X1U D;  3PSC A;  4F7H A;  5B2I B;  1M1A D;  1TZY C;  3UT9 A;  3O62 C;  5CPI A;  1UEF A;  3R45 A;  4M6B A;  4R8P C;  2YSZ A;  4QLC A;  5B24 D;  3AV1 C;  3HW2 B;  2E2X A;  2RVQ D;  1LB1 A;  3AZK B;  2CY4 A;  3F5R A;  5CPJ B;  3WA0 A;  1NTV A;  4J8U B;  3SO6 A;  2DLW A;  5B31 B;  3AV2 B;  1PMS A;  1V5U A;  3VOQ A;  3AN2 B;  3B6G C;  5JLJ B;  5B33 D;  3REI A;  5DNM A;  3WYF B;  4HB0 B;  1EAZ A;  5LON B;  5C5B A;  4HAT B;  4ZUX C;  2PZ1 A;  3W96 C;  3C1C A;  2F8N B;  2I5F A;  5AY8 B;  5B40 A;  3REH A;  4WNN A;  5AV6 B;  4Z2N A;  5GOW B;  3C1B B;  2IO5 B;  5B1L A;  3KXB A;  4EO5 C;  2QKL A;  4NSW A;  3X1U B;  1I2H A;  1KX5 A;  1M18 D;  1U35 B;  3MGP C;  1P34 C;  5B24 B;  1FB8 A;  2BYM A;  3MNN D;  4ZRJ A;  1F66 A;  4CSR A;  4QLC D;  3UTB B;  4J8W C;  1E5W A;  1V61 A;  4J8V B;  4AWL B;  2W2W A;  2P0D A;  1P3A A;  4EJN A;  3W99 C;  5GT0 A;  1Q67 A;  2DA0 A;  2Z0Q A;  3AV2 D;  3AZE C;  4KUD A;  4Z66 C;  5AV8 A;  3AN2 D;  2GS0 A;  2P0F A;  3MGS B;  2ARO B;  5BO0 B;  3PP2 A;  5AV9 A;  1QQG A;  1S32 B;  4H9O A;  3UTA A;  2W2X D;  3PVU A;  1M7E A;  2OTX A;  3REK B;  4TYZ A;  4BBK A;  4E44 A;  5B2I C;  2RSG A;  3LZ1 D;  3NQU B;  2F8N D;  5CP6 B;  4GMX B;  4A6F B;  1TAF A;  3MVD C;  5G49 A;  5B0Y B;  1NU2 A;  3AZI A;  3AZG D;  1ZSQ A;  3V5W A;  2YFW A;  4CHJ A;  3WTP A;  2DHK A;  4A5K A;  4GXB A;  3B0D C;  3WTP B;  5AV5 C;  3KUY B;  2DYN A;  2LY8 A;  5C3I C;  1U35 D;  1P3O C;  1P3P A;  4Z5T A;  3QIJ A;  1NTY A;  1DDV A;  1TXD A;  4J8U C;  3G9W A;  1DRO A;  1HQ3 C;  4ZBJ B;  2IFS A;  1P5T A;  2HUE C;  3AZM D;  2CV5 A;  4LD9 A;  1Y5O A;  2EC1 A;  5FUG A;  4J8V D;  2RGN B;  3X1S B;  1MPH A;  5AV8 B;  2RNR B;  2KUP A;  4H9R A;  2LUL A;  4J8X B;  3RCP A;  1P3A D;  1M19 B;  1BWN A;  5HE2 A;  3DXE A;  4KUD D;  2Y8F A;  4B6H A;  5DI9 B;  1KU5 A;  1ZLA C;  4YM6 C;  2YS1 A;  3P7Z A;  4WSF A;  5CP6 D;  5B24 A;  3HK0 A;  3AZG B;  5HE3 A;  2K00 A;  2HIO C;  1B55 A;  5DHF B;  3WTP D;  3KUY D;  5GXQ A;  5B2J C;  3OAN A;  5DIF B;  4H9S C;  1KZG A;  5CPK A;  1A7W A;  3NQJ A;  1KI1 B;  2CY5 A;  2YFV B;  5KQ1 A;  2YFV A;  3KWQ B;  3AZM B;  3VH5 A;  4WU8 C;  1X1F A;  5FI0 A;  1AOI D;  3SNH A;  1XD4 A;  1AWE A;  4C0A A;  1DBH A;  4KGC C;  2LG1 A;  4K81 A;  3AV2 A;  4ZUX A;  5B0Z B;  1HQ3 A;  5D3X A;  4HHV A;  3AZK C;  4H9N B;  4J8X D;  1P3G D;  1B6W A;  4HAY B;  2COC A;  4XUJ D;  5B0Y C;  3AZH C;  5E5A D;  1EQZ A;  3B6F A;  2LOX A;  3LJA D;  3PZD A;  2CAY A;  3ODW A;  3AZE D;  1BTN A;  3IVF A;  3AV1 A;  4YS3 A;  4G92 B;  4R8P D;  3AFA D;  3X1V B;  1ID3 B;  4KUD C;  3D8F A;  3UT9 B;  1P3F D;  1WG7 A;  2HUE B;  4H9R B;  5GT0 D;  2HTH B;  2ROZ B;  5E5A A;  1U27 A;  4EO5 B;  2GJY A;  2FJ7 D;  3WTP E;  2YT1 A;  3AZE A;  5GT3 B;  2MKR A;  4DBB A;  4J8X C;  3X1T D;  3WKJ A;  2Z0P A;  1U35 C;  1P3O D;  4HAW B;  1AOI A;  3A6N C;  3MGP B;  1P34 B;  3REL C;  1TQZ A;  2DHJ A;  5EFX A;  5B0Z D;  4ZUX D;  4P7I A;  2DTC A;  4GPT B;  3MGR A;  3AZJ B;  4XUJ B;  1P3B D;  2EMT A;  3AZG C;  3KRW A;  3NQU A;  3C1C D;  1W1G A;  2CRF A;  3WKJ B;  3DXD A;  4WVF B;  2J0M A;  5GT3 A;  3AZE B;  1GC6 A;  1LW3 A;  2RLO A;  4X23 B;  4Z66 B;  5AVB A;  3AZN B;  5B2J B;  1FGZ A;  3FM8 C;  3PVW A;  3REJ C;  4R8P B;  1MIX A;  1V89 A;  1UNR A;  5DNN D;  3AV1 D;  3P6A A;  1X1G A;  4GZU A;  4YM6 D;  2CWE A;  4KHO A;  5CP6 C;  3SYX A;  5GT0 B;  3MPX A;  4HAV B;  5GSU A;  2R0D A;  3AFA C;  2NMB A;  3TW1 A;  2GCL A;  4CSR B;  3UTB A;  3AZF B;  3V9R A;  1PLS A;  1P3M A;  5CHL B;  1W1D A;  2YRY A;  2VKI A;  4MK0 A;  3X1T B;  3O62 D;  3VH5 W;  2BYM B;  1B67 A;  1P3O B;  2K2J A;  4KVG B;  5E5A C;  3MGP D;  1P34 D;  1KX5 B;  1EF1 A;  2I1K A;  4GMV A;  1HQ3 B;  4ZBJ C;  4ZUX B;  4Z2M H;  3KXB B;  3VH6 T;  5B0Z A;  1X86 A;  4D0N B;  4KHA B;  1N1J A;  3X1U A;  3MGQ C;  2YVC A;  3MGR D;  1P3B B;  3W98 A;  1OMW A;  3C1B C;  2YS5 A;  4DX8 A;  3C1C B;  4WU9 A;  2F8N A;  3KSY A;  3KWQ A;  4WNN B;  5F99 C;  2PYO C;  4NY0 A;  5J3T A;  3NQJ B;  1IRS A;  5BNX A;  5AY8 D;  3D8D A;  5B2J D;  1UPR A;  3AYW B;  5C5B B;  3MGR C;  1V5P A;  2N0Y A;  4K17 A;  3WAA B;  2ROV A;  4NE3 A;  4XZQ D;  4YM6 B;  4HGA C;  4H9Q A;  5GT3 C;  1F66 C;  1KX4 C;  1K5D B;  3LZ0 B;  3W98 D;  3REJ A;  2LOZ A;  1WJM A;  2J0K A;  1KX3 A;  3W97 D;  2NQB D;  2D9V A;  3AZK A;  4QLC B;  3UTB D;  1ISN A;  2D9W A;  4JJN C;  3O62 B;  3KY9 A;  3MGS C;  1WJ1 A;  2MFQ A;  1KX5 D;  5CPI C;  3O62 A;  3W97 C;  5BS7 A;  1M19 A;  2RUK B;  5D27 A;  2NQB C;  3KXB D;  4G91 B;  1OQN A;  3U8Z A;  1KX3 B;  3AZM C;  4YS3 C;  2ARO D;  4IOY X;  3REJ B;  3LZ0 A;  1P3K B;  1MAI A;  2ZPY A;  3REK D;  1ZVR A;  4IAP A;  5JRG C;  4CHM A;  1F66 D;  3LZ1 B;  3REL A;  3CXB B;  5AVC A;  2MDX A;  4NE6 A;  5B32 G;  3WAA A;  4CYE A;  3AYW D;  3O96 A;  3AZH B;  1BAK A;  1H3O B;  3TU4 A;  3KUY A;  3X1T C;  2NZD C;  4WU9 B;  1UNP A;  4H9P A;  5AV6 C;  1GG3 A;  3LZ0 D;  3A6N A;  3W98 B;  5AVB C;  1P3K A;  4KHA A;  3REH C;  5B40 C;  1RJ2 A;  3B0C W;  2KGX B;  3KXB C;  2DYQ A;  4A6H A;  3MGQ B;  1U2B A;  2ELB A;  2W2X C;  3X1S D;  3D8E A;  3UTB C;  1M1A A;  1SHC A;  4HB3 B;  1P3A B;  3AZF A;  1BH8 A;  1WWS A;  1M19 D;  1P3M D;  3WA9 B;  2DKP A;  5B32 A;  5GSU B;  2D9Z A;  1P3K D;  2IYB A;  4PNK A;  1FHO A;  3W99 B;  4HGA B;  1F66 B;  5C16 A;  1KX4 B;  3AU4 A;  2D9Y A;  4CAY A;  3LJA A;  2QKM A;  4XUJ C;  3AZH D;  5CPK C;  5B1L D;  5D3V A;  2BYK A;  3WKJ C;  1XCG A;  1MK7 B;  4X23 C;  3AZN C;  3KWQ C;  4WU9 D;  1SGH A;  4E45 A;  2YF0 A;  4HB2 B;  4H9P B;  1H4R A;  4K2P A;  3A6N D;  4DX9 0;  1Z87 A;  1EVH A;  2FJL A;  2L1C A;  4KGC B;  5AY8 A;  5B0Z C;  3B0D B;  5AV5 B;  3WTP C;  3KWQ D;  3MGQ D;  3AZH A;  2ADZ A;  5C3I B;  1AOI B;  3CIK A;  4HAU B;  3B6F C;  5AVC B;  1X05 A;  4TKN A;  3LEL D;  4CAY B;  5B1M C;  3AN2 A;  1P3O A;  2COF A;  5B31 A;  1F1E A;  3LZ1 C;  1P6S A;  3UTA D;  2DX1 A;  4J8U A;  2HE7 A;  3B0B A;  1U5F A;  1P3M B;  5CPK D;  3PEG A;  5E5A B;  5B32 B;  2G35 A;  3AJ4 A;  3ZDT A;  1KX5 C;  5GXQ D;  1BH8 B;  2CV5 C;  3WA9 A;  5JP4 A;  3W99 D;  2Y7B A;  1P3F C;  3W97 A;  5BS7 C;  1M19 C;  1WGU A;  1ID3 D;  5BNV A;  4J8W A;  3U7D A;  1WGQ A;  5JHG A;  1MIZ B;  5B2I A;  3VH6 W;  5DNN A;  1P3I D;  2H7E A;  4Z5T D;  1P3L D;  3A6N B;  3B6F D;  3NSU A;  1UPQ A;  3WAA C;  2GCJ A;  4KGC D;  1BH9 B;  5B1M D;  3ODX A;  2FJ7 B;  5KQ4 A;  5JHH A;  1EGX A;  5AV5 D;  2HIO A;  2NZD D;  5B31 G;  2F8N K;  3AZJ C;  3AYW A;  3LZ0 C;  5DNM C;  2DN6 A;  1H3O A;  3TU4 B;  5AVC D;  2EMS A;  4MT7 A;  1M7R A;  3LJU X;  5JRG A;  5F99 D;  3MVD A;  4UUZ A;  4WJ7 A;  4ZRI A;  4WV4 B;  4WU8 B;  3AZJ D;  5CPK B;  1P3P D;  5B1L C;  2D2Q A;  4L6E A;  1TZY A;  5GXQ B;  2DHI A;  2EJ8 A;  3WKJ D;  3M1I B;  4A6K A;  4EKU A;  3HQC A;  4Z66 D;  3AZL D;  1KX3 C;  5GT0 C;  2UZS A;  2V76 A;  1WWI A;  1P3K C; 
#chains in the Genus database with same CATH topology
 3AZF C;  3ODO A;  3HSA A;  3AV1 B;  1ID3 A;  1XR0 B;  3FSS A;  1FGY A;  1P3F A;  2RVQ C;  4Y94 A;  4WZS B;  4J8W D;  4JJN D;  5CPJ C;  2K2U A;  2Y8G A;  1HTA A;  2Y2L A;  3IP4 C;  3B6F B;  2M14 A;  3AZF D;  5B1M B;  3B6G A;  4K2O A;  1M1A C;  2DFK A;  5KDM A;  5BT1 C;  2NZD B;  3MNN A;  4MY6 A;  3W98 C;  5FUG B;  1N3H A;  2P0H A;  5AVB B;  4X23 A;  3W96 A;  3C1C C;  3AZN A;  2CV5 B;  4NE5 A;  1P3G A;  2PYO A;  5F99 B;  1UNQ A;  5I2S A;  1HQ3 D;  4UUZ B;  1JFI B;  1MK9 B;  4HDQ A;  1KZ7 A;  1EQZ D;  5CLL B;  5AY8 C;  3ULC A;  4WU8 D;  4XUJ A;  3MGR B;  3AZJ A;  2JSS A;  5DNM D;  1P3B A;  1P3P B;  2IO5 C;  2FJU B;  3REL D;  1XOD A;  1N1J B;  4LD9 C;  1FAO A;  3F6T A;  3A8P A;  3MGP A;  1P34 A;  1MI1 A;  2YFW B;  3H0M C;  5B33 C;  3A1I A;  4Z5T C;  5B0Y A;  3AZI D;  3WAA D;  1V5M A;  2LYD A;  2FJ7 C;  4XZQ B;  2D11 A;  5B2I D;  2DKQ A;  4KAX B;  4PQ0 A;  2FFF B;  3NWD A;  4J8W B;  4JJN B;  5BT1 D;  2ZY4 A;  1ZLA A;  3EPH A;  3NWF A;  3REI D;  4AWL C;  2VSZ A;  3A8Q A;  3W97 B;  1MKE A;  3F0W A;  2NQB B;  4G91 C;  1FOE A;  5CPJ D;  2NZ8 B;  4YS3 B;  1XKE A;  4J8V A;  4R8P A;  3KZ1 A;  5GXQ C;  5B2J A;  2CV5 D;  5JA4 B;  2R09 A;  4XZQ A;  3LJA C;  1J0W A;  1EQZ B;  3B77 A;  3AZL C;  1KX3 D;  2Y2K A;  2J8P A;  1P3R A;  3REJ D;  4H9N A;  3LEL C;  2YS3 A;  5AV5 A;  2I5C A;  2N23 A;  2VRW B;  4KGC A;  1U29 A;  5AV6 D;  2XQN M;  2Y2N A;  3FVC A;  3C1B D;  4F7G A;  3AZI B;  5B40 B;  3REH B;  1GC7 A;  5G49 B;  5JRG D;  2PYO B;  3SV1 A;  1H10 A;  3W96 B;  3TO1 A;  1M18 B;  5F99 A;  3MVD D;  3REK A;  3AYW C;  3REI B;  2COA A;  3SUZ A;  4H9O B;  1DDM A;  2ARO A;  5BO0 A;  3MNN B;  2P8V A;  2J59 M;  3AZG A;  1W1H A;  1P3I C;  3WA9 C;  4YS3 D;  2AEH A;  4XWX A;  2Z0O A;  3X1V A;  4DRA A;  5GSU C;  3ML4 A;  4UPK A;  3MDB C;  1BTK A;  5CPJ A;  1J19 A;  5B24 C;  1XX0 A;  3PVL A;  4HAX B;  1U5D A;  2L5A A;  4QLC C;  2G5H C;  4GOU A;  3WA9 D;  3MGS D;  5GSU D;  1Q9C A;  1S32 D;  4J8X A;  4IFS A;  3X23 A;  5CPI B;  1TJ6 A;  2X18 A;  5DNN C;  1U35 A;  2XD5 A;  5L81 A;  4XZQ C;  3GYO A;  5DHA B;  1K5G B;  1TZY B;  2Y2H A;  3X1S A;  1KX4 D;  1P3G C;  3TCA A;  2OQB A;  2F8N G;  5B0Y D;  5AV9 C;  5B1L B;  3VH5 T;  3C1B A;  3AU5 A;  5B40 D;  3REH D;  3AZM A;  1M18 A;  4LD9 D;  2RVB B;  4WU8 A;  5JRG B;  2PYO D;  2JE5 A;  1U5E A;  2UZR A;  4H8S A;  3W96 D;  3U12 A;  1FHW A;  3MVD B;  1AOI C;  1DYN A;  5AVC C;  5J3Y A;  1Y19 B;  2Z4D A;  5C6R A;  2ZY2 A;  1BFM A;  1FHX A;  2YT0 A;  5B31 C;  1EQZ C;  3FEH A;  3KUY C;  4WU9 C;  2VQR A;  2FJ7 A;  2I1J A;  5CP6 A;  4A6F A;  2Y2O A;  3LEL B;  3H0L C;  5AV8 D;  1V88 A;  1QC6 A;  4Z2M B;  5BNV B;  3QWM A;  3UTA B;  5D3Y A;  5JA4 A;  2BG1 A;  2BCJ A;  3PG7 A;  4EMO A;  1ID3 C;  3MGS A;  4G92 C;  5B32 D;  3X1V C;  4KUD B;  4KHB B;  5CPI D;  3UT9 C;  5J3Q A;  1R4V A;  4HAZ B;  4GN1 A;  2NQB A;  1TZY D;  1P3A C;  1X11 A;  3AFA A;  3REI C;  4DXA B;  3AZL A;  4LD9 B;  2Q13 A;  4JJN A;  1ZLA B;  3MNN C;  4H9Q B;  4YM6 A;  3EG5 B;  5FI1 A;  1P3I B;  1OY2 A;  3QBV B;  1ZC4 B;  2D4Q A;  4J8V C;  4Z5T B;  1Z2C B;  3TU4 C;  1P3L B;  5CLQ B;  3TFM A;  5BNX B;  4DIX A;  4HDO A;  4QJ4 B;  4YON A;  2UVM A;  5AV6 A;  1PFJ A;  5HE1 A;  3TU4 D;  3A98 B;  1TAF B;  2COD A;  3REK C;  3ZVR A;  2MWN B;  5KCV A;  1ULY A;  1JFI A;  3ULB A;  2BYK B;  1P3G B;  3NW8 A;  1P3L A;  1S32 A;  4WJ3 C;  5AV9 B;  2L2I A;  3N7C A;  2J0J A;  1P3I A;  4NFT A;  3X1T A;  2HIO D;  5KDM B;  2NZD A;  3LJA B;  3W99 A;  2ELA A;  2H7D A;  3AV2 C;  2LKO A;  1KX4 A;  1WVH A;  1RRP B;  3B0C T;  5B1M A;  3V9R B;  3AZL B;  3AN2 C;  3B6G B;  1P3M C;  3GYP A;  2K49 A;  4QJ5 B;  3AFA B;  5B32 C;  3X1V D;  3BJI A;  2M38 A;  3UT9 D;  1ZLA D;  1ZC3 B;  1P3F B;  4F7U P;  1AQC A;  1M1A B;  1T77 A;  2KIE A;  4DRB A;  1WI1 A;  3TVV A;  3R45 B;  3KRX A;  2AL6 A;  3X1S C;  3AZI C;  1DDW A;  5AV8 C;  4Z66 A;  2DQN C;  3X1U C;  3MGQ A;  2KCJ A;  3DXC A;  5GT3 D;  3AZK D;  3UTA C;  1ZM0 A;  1M18 C;  3LEL A;  3UZT A;  3EPL A;  3T06 A;  1P3B C;  1P3P C;  5AVB D;  1NI2 A;  4J8U D;  4H9S A;  2JP2 A;  5B31 D;  4ZRK A;  2DX5 A;  1I7A A;  1U5G A;  3AL0 C;  5HE0 A;  5C79 A;  5B33 A;  3VH6 A;  5B33 B;  5DNM B;  5AV9 D;  4L1R A;  3REL B;  2D10 A;  2F8N H;  2HIO B;  3VIA A;  5D3W A;  5LOP B;  4YL8 A;  5M4Y B;  3LZ1 A;  4X23 D;  3AZN D;  1BH9 A;  3B6G D;  2Y2Q A;  2ARO C;  5DH9 B;  1P3L C;  1S32 C;  4HB4 B;  4Z2M G;  2D9X A;  5DNN B;  3X1U D;  3PSC A;  4F7H A;  5B2I B;  1M1A D;  1TZY C;  3UT9 A;  2G5I C;  3O62 C;  5CPI A;  1UEF A;  3R45 A;  4M6B A;  3DCX A;  4R8P C;  2YSZ A;  4QLC A;  5B24 D;  3AV1 C;  3HW2 B;  2E2X A;  2RVQ D;  1LB1 A;  3AZK B;  2CY4 A;  3F5R A;  5CPJ B;  4GNK B;  3WA0 A;  1NTV A;  4J8U B;  3SO6 A;  2DLW A;  5B31 B;  3AV2 B;  1PMS A;  1V5U A;  3VOQ A;  3AN2 B;  3B6G C;  5JLJ B;  5B33 D;  3REI A;  5DNM A;  3WYF B;  4HB0 B;  1EAZ A;  5LON B;  5C5B A;  4HAT B;  4ZUX C;  2PZ1 A;  3W96 C;  3C1C A;  2F8N B;  2I5F A;  5AY8 B;  5B40 A;  3REH A;  4WNN A;  5AV6 B;  4Z2N A;  5GOW B;  3C1B B;  2IO5 B;  5B1L A;  3KXB A;  4EO5 C;  2K8E A;  2QKL A;  4NSW A;  3X1U B;  1I2H A;  1KX5 A;  1M18 D;  1U35 B;  2Y2I A;  3MGP C;  1P34 C;  2NBV A;  5B24 B;  1FB8 A;  2BYM A;  3MNN D;  4ZRJ A;  1F66 A;  4CSR A;  4QLC D;  3UTB B;  4J8W C;  1E5W A;  1V61 A;  4J8V B;  4AWL B;  2W2W A;  2P0D A;  1P3A A;  4EJN A;  3W99 C;  5GT0 A;  1Q67 A;  2DA0 A;  2KUQ A;  3AV2 D;  3AZE C;  2Z0Q A;  4KUD A;  5AV8 A;  4Z66 C;  3AN2 D;  2GS0 A;  2P0F A;  3MGS B;  2ARO B;  5BO0 B;  3PP2 A;  5AV9 A;  1QQG A;  1S32 B;  4H9O A;  3UTA A;  2W2X D;  3PVU A;  1M7E A;  2OTX A;  3REK B;  4TYZ A;  4BBK A;  4E44 A;  5B2I C;  2RSG A;  3LZ1 D;  3NQU B;  4DQY B;  5CP6 B;  2F8N D;  4GMX B;  4A6F B;  1TAF A;  3MVD C;  5G49 A;  5B0Y B;  1NU2 A;  3AZI A;  3AZG D;  1ZSQ A;  3V5W A;  2YFW A;  4CHJ A;  3WTP A;  2DHK A;  4A5K A;  4GXB A;  3B0D C;  3WTP B;  5AV5 C;  3KUY B;  2DYN A;  2LY8 A;  5C3I C;  1U35 D;  1P3O C;  1P3P A;  4Z5T A;  3QIJ A;  1NTY A;  1DDV A;  1TXD A;  4J8U C;  3G9W A;  1DRO A;  1HQ3 C;  4ZBJ B;  2IFS A;  1P5T A;  2HUE C;  3AZM D;  2CV5 A;  4LD9 A;  1Y5O A;  2EC1 A;  5FUG A;  4J8V D;  2RGN B;  3X1S B;  1MPH A;  5AV8 B;  2RNR B;  2KUP A;  4H9R A;  2LUL A;  4J8X B;  3RCP A;  1P3A D;  1M19 B;  1BWN A;  5HE2 A;  3DXE A;  4KHB A;  3H0R C;  4KUD D;  2Y8F A;  4B6H A;  3EPJ A;  5DI9 B;  1KU5 A;  1ZLA C;  4YM6 C;  2YS1 A;  3P7Z A;  4WSF A;  5CP6 D;  5B24 A;  2XD1 A;  3BIN A;  3HK0 A;  3AZG B;  5HE3 A;  2K00 A;  2HIO C;  1B55 A;  1PZR A;  5DHF B;  3EPK A;  3WTP D;  3KUY D;  5GXQ A;  5B2J C;  3OAN A;  5DIF B;  4H9S C;  1KZG A;  5CPK A;  1A7W A;  3NQJ A;  1KI1 B;  2CY5 A;  2YFV B;  5KQ1 A;  2YFV A;  3KWQ B;  3AZM B;  3VH5 A;  4WU8 C;  1X1F A;  5FI0 A;  1AOI D;  3SNH A;  1XD4 A;  1AWE A;  4OSN A;  4C0A A;  1DBH A;  4KGC C;  2LG1 A;  4K81 A;  3AV2 A;  4ZUX A;  5B0Z B;  1HQ3 A;  5D3X A;  4HHV A;  3AZK C;  4H9N B;  4J8X D;  1P3G D;  1B6W A;  4HAY B;  2COC A;  4XUJ D;  5B0Y C;  3AZH C;  5E5A D;  1T3U A;  1EQZ A;  3B6F A;  2LOX A;  3LJA D;  3PZD A;  2CAY A;  3ODW A;  3AZE D;  1BTN A;  3IVF A;  3AV1 A;  4YS3 A;  4G92 B;  4R8P D;  3AFA D;  3X1V B;  1ID3 B;  4KUD C;  3D8F A;  3UT9 B;  1ZYI A;  1P3F D;  2KR0 A;  2DF4 C;  1WG7 A;  2HUE B;  4H9R B;  5GT0 D;  2HTH B;  2ROZ B;  5E5A A;  1U27 A;  4EO5 B;  2GJY A;  2FJ7 D;  3WTP E;  2YT1 A;  3AZE A;  5GT3 B;  2MKR A;  4DBB A;  4J8X C;  3X1T D;  3WKJ A;  2Z14 A;  2Z0P A;  1U35 C;  1P3O D;  4HAW B;  1AOI A;  3A6N C;  3FDD A;  3MGP B;  3REL C;  1P34 B;  1TQZ A;  2DHJ A;  5EFX A;  5B0Z D;  4ZUX D;  4P7I A;  2DTC A;  4GPT B;  3MGR A;  3AZJ B;  4XUJ B;  1P3B D;  2EMT A;  3OHM B;  3AZG C;  3KRW A;  3NQU A;  3C1C D;  1W1G A;  2CRF A;  3WKJ B;  2JCH A;  3DXD A;  3HIE A;  2J0M A;  4WVF B;  5GT3 A;  3AZE B;  1GC6 A;  1LW3 A;  2RLO A;  5AVB A;  4Z66 B;  4X23 B;  3AZN B;  5B2J B;  1FGZ A;  3FM8 C;  3PVW A;  4CSQ A;  3REJ C;  4R8P B;  1MIX A;  1V89 A;  1UNR A;  5DNN D;  3AV1 D;  3P6A A;  1X1G A;  4GZU A;  4YM6 D;  4D6W A;  2CWE A;  4KHO A;  5CP6 C;  3SYX A;  5GT0 B;  3MPX A;  4HAV B;  5GSU A;  2R0D A;  3AFA C;  2NMB A;  3TW1 A;  5IRS A;  2GCL A;  4CSR B;  3UTB A;  3AZF B;  3V9R A;  1PLS A;  1P3M A;  2Y2J A;  3A1K A;  5CHL B;  1W1D A;  2VKI A;  2YRY A;  4MK0 A;  5LG4 B;  3X1T B;  3O62 D;  2RIQ A;  2BYM B;  1B67 A;  3VH5 W;  1P3O B;  2K2J A;  4KVG B;  5E5A C;  3MGP D;  1P34 D;  1KX5 B;  1EF1 A;  2I1K A;  4GMV A;  1HQ3 B;  4ZBJ C;  4ZUX B;  4Z2M H;  5B0Z A;  3VH6 T;  3KXB B;  1X86 A;  4D0N B;  4KHA B;  1N1J A;  3X1U A;  3MGQ C;  2YVC A;  3MGR D;  1P3B B;  3W98 A;  1OMW A;  3C1B C;  2YS5 A;  4DX8 A;  3C1C B;  4WU9 A;  2F8N A;  2ZKM X;  3KSY A;  3KWQ A;  4WNN B;  5F99 C;  2PYO C;  2ZM5 A;  4NY0 A;  3NQJ B;  5J3T A;  1IRS A;  5BNX A;  5AY8 D;  3D8D A;  5B2J D;  1UPR A;  3AYW B;  5C5B B;  3MGR C;  1V5P A;  2N0Y A;  4K17 A;  3WAA B;  2ROV A;  2Z13 A;  4NE3 A;  4XZQ D;  4YM6 B;  4HGA C;  4H9Q A;  5GT3 C;  1F66 C;  2RRF A;  1KX4 C;  1K5D B;  2Z59 A;  3LZ0 B;  3W98 D;  3REJ A;  2LOZ A;  1WJM A;  2J0K A;  2YT2 A;  1KX3 A;  3W97 D;  2NQB D;  2D9V A;  3AZK A;  4QLC B;  3UTB D;  1ISN A;  2D9W A;  4JJN C;  3O62 B;  3KY9 A;  3MGS C;  1WJ1 A;  2MFQ A;  1KX5 D;  5CPI C;  3O62 A;  3W97 C;  5BS7 A;  1M19 A;  2RUK B;  5D27 A;  2NQB C;  3KXB D;  4G91 B;  1OQN A;  3U8Z A;  1KX3 B;  3AZM C;  2Y2P A;  4YS3 C;  2ARO D;  4IOY X;  3REJ B;  3LZ0 A;  1P3K B;  1MAI A;  2ZPY A;  3REK D;  1ZVR A;  4IAP A;  5JRG C;  4CHM A;  1F66 D;  3A58 A;  3LZ1 B;  3REL A;  3CXB B;  5AVC A;  2MDX A;  4NE6 A;  5B32 G;  3WAA A;  4CYE A;  3AYW D;  3O96 A;  3AZH B;  1BAK A;  1H3O B;  3TU4 A;  3KUY A;  3NWA A;  3X1T C;  2NZD C;  4WU9 B;  1UNP A;  4H9P A;  5AV6 C;  1GG3 A;  3LZ0 D;  3A6N A;  3W98 B;  5AVB C;  1P3K A;  4KHA A;  3REH C;  5B40 C;  1RJ2 A;  3B0C W;  1W2E A;  2KGX B;  3KXB C;  2DYQ A;  4A6H A;  3MGQ B;  1U2B A;  4HSI A;  2ELB A;  2W2X C;  3X1S D;  3D8E A;  3UTB C;  1M1A A;  1SHC A;  4HB3 B;  1P3A B;  3AZF A;  1BH8 A;  1WWS A;  1M19 D;  1P3M D;  3WA9 B;  2DKP A;  5B32 A;  5GSU B;  2D9Z A;  1P3K D;  2IYB A;  4PNK A;  1FHO A;  3W99 B;  4HGA B;  1F66 B;  5C16 A;  1KX4 B;  2GUM A;  3AU4 A;  2D9Y A;  4CAY A;  3LJA A;  2QKM A;  4XUJ C;  3AZH D;  5CPK C;  4OT1 A;  5B1L D;  5D3V A;  2BYK A;  3WKJ C;  1XCG A;  2KIG A;  1MK7 B;  4X23 C;  3AZN C;  3KWQ C;  4WU9 D;  1SGH A;  4E45 A;  2YF0 A;  4HB2 B;  4H9P B;  1H4R A;  4K2P A;  3A6N D;  4DX9 0;  1Z87 A;  1EVH A;  2FJL A;  2L1C A;  4KGC B;  5AY8 A;  4QXA B;  5B0Z C;  3B0D B;  4QJ3 B;  5AV5 B;  3WTP C;  3KWQ D;  2ZY3 A;  3MGQ D;  3AZH A;  5C3I B;  1AOI B;  2ADZ A;  2R2Y A;  3CIK A;  3B6F C;  2Y2G A;  5AVC B;  1X05 A;  3LEL D;  4CAY B;  4HAU B;  5B1M C;  3AN2 A;  1P3O A;  4TKN A;  2COF A;  5B31 A;  1F1E A;  3LZ1 C;  1P6S A;  3UTA D;  2DX1 A;  4J8U A;  2HE7 A;  3B0B A;  1U5F A;  1P3M B;  5CPK D;  3PEG A;  5E5A B;  5B32 B;  2G35 A;  3AJ4 A;  3ZDT A;  1KX5 C;  3P5J B;  1BH8 B;  5GXQ D;  2CV5 C;  3WA9 A;  3W99 D;  5JP4 A;  2Y7B A;  1P3F C;  3W97 A;  5BS7 C;  1M19 C;  1WGU A;  2W8S A;  1ID3 D;  2UWX A;  5BNV A;  4J8W A;  3U7D A;  1WGQ A;  5JHG A;  1MIZ B;  5B2I A;  3VH6 W;  2F2A C;  5DNN A;  1P3I D;  5I2M A;  2H7E A;  4Z5T D;  1P3L D;  3A6N B;  3B6F D;  3NSU A;  1UPQ A;  3WAA C;  2GCJ A;  4KGC D;  1BH9 B;  5B1M D;  3ODX A;  2FJ7 B;  5KQ4 A;  5JHH A;  2ZY5 A;  1EGX A;  5AV5 D;  2HIO A;  2NZD D;  5B31 G;  2F8N K;  3AZJ C;  2Y2M A;  3LZ0 C;  5DNM C;  3AYW A;  1H3O A;  3TU4 B;  5AVC D;  2DN6 A;  2EMS A;  4MT7 A;  1M7R A;  3LJU X;  5JRG A;  5F99 D;  3MVD A;  4UUZ A;  4WJ7 A;  4ZRI A;  4WV4 B;  4WU8 B;  3AZJ D;  5CPK B;  1P3P D;  5B1L C;  2D2Q A;  4L6E A;  1TZY A;  5GXQ B;  2DHI A;  2EJ8 A;  3WKJ D;  3M1I B;  4A6K A;  4EKU A;  3HQC A;  4Z66 D;  3AZL D;  1KX3 C;  5GT0 C;  3KFU G;  2UZS A;  2V76 A;  1WWI A;  1P3K C; 
#chains in the Genus database with same CATH homology
 3AZF C;  3ODO A;  3AV1 B;  1ID3 A;  1XR0 B;  3FSS A;  1FGY A;  1P3F A;  2RVQ C;  4Y94 A;  4WZS B;  4J8W D;  4JJN D;  5CPJ C;  2K2U A;  2Y8G A;  1HTA A;  2Y2L A;  3IP4 C;  3B6F B;  2M14 A;  3AZF D;  5B1M B;  3B6G A;  4K2O A;  1M1A C;  2DFK A;  5KDM A;  5BT1 C;  2NZD B;  3MNN A;  4MY6 A;  3W98 C;  5FUG B;  1N3H A;  2P0H A;  5AVB B;  4X23 A;  3W96 A;  3C1C C;  3AZN A;  2CV5 B;  4NE5 A;  1P3G A;  2PYO A;  5F99 B;  1UNQ A;  5I2S A;  1HQ3 D;  4UUZ B;  1JFI B;  1MK9 B;  4HDQ A;  1KZ7 A;  1EQZ D;  5CLL B;  5AY8 C;  3ULC A;  4WU8 D;  4XUJ A;  3MGR B;  3AZJ A;  2JSS A;  5DNM D;  1P3B A;  1P3P B;  2IO5 C;  3BIN A;  3REL D;  1XOD A;  1N1J B;  4LD9 C;  1FAO A;  3F6T A;  3A8P A;  3MGP A;  1P34 A;  2YFW B;  3H0M C;  5B33 C;  3A1I A;  4Z5T C;  5B0Y A;  3AZI D;  3WAA D;  1V5M A;  2LYD A;  2FJ7 C;  4XZQ B;  2D11 A;  5B2I D;  2DKQ A;  4KAX B;  4PQ0 A;  2FFF B;  3NWD A;  4J8W B;  4JJN B;  5BT1 D;  2ZY4 A;  1ZLA A;  3EPH A;  3NWF A;  3REI D;  4AWL C;  2VSZ A;  3A8Q A;  3W97 B;  1MKE A;  3F0W A;  2NQB B;  4G91 C;  1FOE A;  5CPJ D;  2NZ8 B;  4YS3 B;  1XKE A;  4J8V A;  4R8P A;  3KZ1 A;  5GXQ C;  5B2J A;  2CV5 D;  5JA4 B;  2R09 A;  4XZQ A;  3LJA C;  1J0W A;  1EQZ B;  3AZL C;  1KX3 D;  2Y2K A;  2J8P A;  1P3R A;  3REJ D;  4H9N A;  3LEL C;  2YS3 A;  5AV5 A;  2I5C A;  2N23 A;  2VRW B;  4KGC A;  1U29 A;  5AV6 D;  2XQN M;  2Y2N A;  4F7G A;  3C1B D;  3FVC A;  3AZI B;  5B40 B;  3REH B;  1GC7 A;  5G49 B;  5JRG D;  2PYO B;  3SV1 A;  1H10 A;  3W96 B;  3TO1 A;  1M18 B;  5F99 A;  3MVD D;  3REK A;  3AYW C;  3REI B;  2COA A;  3SUZ A;  4H9O B;  1DDM A;  2ARO A;  5BO0 A;  3MNN B;  2P8V A;  2J59 M;  3AZG A;  1W1H A;  1P3I C;  3WA9 C;  4YS3 D;  2AEH A;  4XWX A;  2Z0O A;  3X1V A;  4DRA A;  5GSU C;  3ML4 A;  4UPK A;  3MDB C;  1BTK A;  5CPJ A;  1J19 A;  5B24 C;  1XX0 A;  3PVL A;  4HAX B;  1U5D A;  2L5A A;  4QLC C;  2G5H C;  4GOU A;  3WA9 D;  3MGS D;  5GSU D;  1Q9C A;  1S32 D;  4J8X A;  4IFS A;  3X23 A;  5CPI B;  1TJ6 A;  2X18 A;  5DNN C;  1U35 A;  2XD5 A;  5L81 A;  4XZQ C;  3GYO A;  5DHA B;  1K5G B;  1TZY B;  2Y2H A;  3X1S A;  1KX4 D;  1P3G C;  3TCA A;  2OQB A;  2F8N G;  5B0Y D;  5AV9 C;  5B1L B;  3VH5 T;  3C1B A;  3AU5 A;  5B40 D;  3REH D;  3AZM A;  1M18 A;  4LD9 D;  2RVB B;  4WU8 A;  5JRG B;  2PYO D;  2JE5 A;  1U5E A;  2UZR A;  4H8S A;  3W96 D;  3U12 A;  1FHW A;  3MVD B;  1AOI C;  1DYN A;  5AVC C;  5J3Y A;  1Y19 B;  5C6R A;  2Z4D A;  2ZY2 A;  1BFM A;  1FHX A;  2YT0 A;  5B31 C;  1EQZ C;  3FEH A;  3KUY C;  4WU9 C;  2VQR A;  2FJ7 A;  2I1J A;  5CP6 A;  4A6F A;  2Y2O A;  3LEL B;  3H0L C;  5AV8 D;  1V88 A;  1QC6 A;  4Z2M B;  5BNV B;  3QWM A;  3UTA B;  5D3Y A;  5JA4 A;  2BG1 A;  2BCJ A;  3PG7 A;  4EMO A;  1ID3 C;  3MGS A;  4G92 C;  5B32 D;  3X1V C;  4KUD B;  4KHB B;  5CPI D;  3UT9 C;  5J3Q A;  1R4V A;  4HAZ B;  4GN1 A;  2NQB A;  1TZY D;  1P3A C;  1X11 A;  3AFA A;  3REI C;  4DXA B;  3AZL A;  4LD9 B;  2Q13 A;  4JJN A;  1ZLA B;  3MNN C;  4H9Q B;  4YM6 A;  3EG5 B;  5FI1 A;  1P3I B;  1OY2 A;  3QBV B;  1ZC4 B;  2D4Q A;  4J8V C;  4Z5T B;  1Z2C B;  3TU4 C;  1P3L B;  5CLQ B;  3TFM A;  5BNX B;  4DIX A;  4HDO A;  4QJ4 B;  4YON A;  2UVM A;  5AV6 A;  1PFJ A;  5HE1 A;  3TU4 D;  3A98 B;  1TAF B;  2COD A;  3REK C;  3ZVR A;  2MWN B;  5KCV A;  1ULY A;  1JFI A;  3ULB A;  2BYK B;  1P3G B;  3NW8 A;  1P3L A;  1S32 A;  4WJ3 C;  5AV9 B;  2L2I A;  3N7C A;  2J0J A;  1P3I A;  4NFT A;  3X1T A;  2HIO D;  5KDM B;  2NZD A;  3LJA B;  3W99 A;  2ELA A;  2H7D A;  3AV2 C;  2LKO A;  1KX4 A;  1WVH A;  1RRP B;  3B0C T;  5B1M A;  3V9R B;  3AZL B;  3AN2 C;  3B6G B;  1P3M C;  3GYP A;  2K49 A;  4QJ5 B;  3AFA B;  5B32 C;  3X1V D;  3BJI A;  2M38 A;  3UT9 D;  1ZLA D;  1ZC3 B;  1P3F B;  4F7U P;  1AQC A;  1M1A B;  2KIE A;  4DRB A;  1WI1 A;  3TVV A;  3R45 B;  3KRX A;  2AL6 A;  3X1S C;  3AZI C;  1DDW A;  5AV8 C;  4Z66 A;  2DQN C;  3X1U C;  3MGQ A;  2KCJ A;  3DXC A;  5GT3 D;  3AZK D;  3UTA C;  1ZM0 A;  1M18 C;  3LEL A;  3UZT A;  3EPL A;  3T06 A;  1P3B C;  1P3P C;  5AVB D;  1NI2 A;  4J8U D;  4H9S A;  2JP2 A;  5B31 D;  4ZRK A;  2DX5 A;  1I7A A;  1U5G A;  3AL0 C;  5HE0 A;  5C79 A;  5B33 A;  3VH6 A;  5B33 B;  5DNM B;  5AV9 D;  4L1R A;  3REL B;  2D10 A;  2F8N H;  2HIO B;  3VIA A;  5D3W A;  5LOP B;  4YL8 A;  5M4Y B;  3LZ1 A;  4X23 D;  3AZN D;  1BH9 A;  3B6G D;  2Y2Q A;  2ARO C;  5DH9 B;  1P3L C;  1S32 C;  4HB4 B;  4Z2M G;  2D9X A;  5DNN B;  3X1U D;  3PSC A;  4F7H A;  5B2I B;  1M1A D;  1TZY C;  3UT9 A;  2G5I C;  3O62 C;  5CPI A;  1UEF A;  3R45 A;  4M6B A;  4R8P C;  2YSZ A;  4QLC A;  5B24 D;  3AV1 C;  3HW2 B;  2E2X A;  2RVQ D;  1LB1 A;  3AZK B;  2CY4 A;  3F5R A;  5CPJ B;  4GNK B;  3WA0 A;  1NTV A;  4J8U B;  3SO6 A;  2DLW A;  5B31 B;  3AV2 B;  1PMS A;  1V5U A;  3VOQ A;  3AN2 B;  3B6G C;  5JLJ B;  5B33 D;  3REI A;  5DNM A;  3WYF B;  4HB0 B;  1EAZ A;  5LON B;  5C5B A;  4HAT B;  4ZUX C;  2PZ1 A;  3W96 C;  3C1C A;  2F8N B;  2I5F A;  5AY8 B;  5B40 A;  3REH A;  4WNN A;  5AV6 B;  4Z2N A;  5GOW B;  3C1B B;  2IO5 B;  5B1L A;  3KXB A;  4EO5 C;  2QKL A;  4NSW A;  2K8E A;  3X1U B;  1I2H A;  1KX5 A;  1M18 D;  1U35 B;  2Y2I A;  3MGP C;  1P34 C;  2NBV A;  5B24 B;  1FB8 A;  2BYM A;  3MNN D;  4ZRJ A;  1F66 A;  4CSR A;  4QLC D;  3UTB B;  4J8W C;  1E5W A;  1V61 A;  4J8V B;  4AWL B;  2W2W A;  2P0D A;  1P3A A;  4EJN A;  3W99 C;  5GT0 A;  1Q67 A;  2DA0 A;  2Z0Q A;  3AV2 D;  3AZE C;  2KUQ A;  4KUD A;  5AV8 A;  4Z66 C;  3AN2 D;  2GS0 A;  2P0F A;  3MGS B;  2ARO B;  5BO0 B;  3PP2 A;  5AV9 A;  1QQG A;  1S32 B;  4H9O A;  3UTA A;  2W2X D;  3PVU A;  1M7E A;  2OTX A;  3REK B;  4TYZ A;  4BBK A;  4E44 A;  5B2I C;  2RSG A;  3LZ1 D;  3NQU B;  4DQY B;  5CP6 B;  2F8N D;  4GMX B;  4A6F B;  1TAF A;  3MVD C;  5G49 A;  5B0Y B;  1NU2 A;  3AZI A;  3AZG D;  1ZSQ A;  3V5W A;  2YFW A;  4CHJ A;  3WTP A;  2DHK A;  4A5K A;  4GXB A;  3B0D C;  3WTP B;  5AV5 C;  3KUY B;  2DYN A;  2LY8 A;  5C3I C;  1U35 D;  1P3O C;  1P3P A;  4Z5T A;  3QIJ A;  1NTY A;  1DDV A;  1TXD A;  4J8U C;  3G9W A;  1DRO A;  1HQ3 C;  4ZBJ B;  2IFS A;  1P5T A;  2HUE C;  3AZM D;  2CV5 A;  4LD9 A;  1Y5O A;  2EC1 A;  5FUG A;  4J8V D;  2RGN B;  3X1S B;  1MPH A;  5AV8 B;  2RNR B;  2KUP A;  4H9R A;  2LUL A;  4J8X B;  3RCP A;  1P3A D;  1M19 B;  2FJU B;  1BWN A;  5HE2 A;  3DXE A;  4KHB A;  3H0R C;  4KUD D;  2Y8F A;  4B6H A;  3EPJ A;  5DI9 B;  1KU5 A;  1ZLA C;  4YM6 C;  2YS1 A;  3P7Z A;  4WSF A;  5CP6 D;  5B24 A;  2XD1 A;  3HK0 A;  3AZG B;  5HE3 A;  2K00 A;  2HIO C;  1B55 A;  1PZR A;  5DHF B;  3EPK A;  3WTP D;  3KUY D;  5GXQ A;  5B2J C;  3OAN A;  5DIF B;  4H9S C;  1KZG A;  5CPK A;  1A7W A;  3NQJ A;  1KI1 B;  2CY5 A;  2YFV B;  5KQ1 A;  2YFV A;  3KWQ B;  3AZM B;  3VH5 A;  4WU8 C;  1X1F A;  5FI0 A;  1AOI D;  3SNH A;  1XD4 A;  1AWE A;  4OSN A;  4C0A A;  1DBH A;  4KGC C;  2LG1 A;  4K81 A;  3AV2 A;  4ZUX A;  5B0Z B;  1HQ3 A;  5D3X A;  4HHV A;  3AZK C;  4H9N B;  4J8X D;  1P3G D;  1B6W A;  4HAY B;  2COC A;  4XUJ D;  5B0Y C;  3AZH C;  5E5A D;  1T3U A;  1EQZ A;  3B6F A;  2LOX A;  3LJA D;  3PZD A;  2CAY A;  3ODW A;  3AZE D;  1BTN A;  3IVF A;  3AV1 A;  4YS3 A;  4G92 B;  4R8P D;  3AFA D;  3X1V B;  1ID3 B;  4KUD C;  3D8F A;  3UT9 B;  1ZYI A;  1P3F D;  2KR0 A;  2DF4 C;  1WG7 A;  2HUE B;  4H9R B;  5GT0 D;  2HTH B;  2ROZ B;  5E5A A;  1U27 A;  4EO5 B;  2GJY A;  2FJ7 D;  3WTP E;  2YT1 A;  3AZE A;  5GT3 B;  2MKR A;  4DBB A;  4J8X C;  3X1T D;  3WKJ A;  2Z0P A;  2Z14 A;  1U35 C;  1P3O D;  4HAW B;  1AOI A;  3A6N C;  3FDD A;  3MGP B;  3REL C;  1P34 B;  1TQZ A;  2DHJ A;  5EFX A;  5B0Z D;  4ZUX D;  4P7I A;  2DTC A;  4GPT B;  3MGR A;  3AZJ B;  4XUJ B;  1P3B D;  2EMT A;  3OHM B;  3AZG C;  3KRW A;  3NQU A;  3C1C D;  1W1G A;  2CRF A;  3WKJ B;  2JCH A;  3DXD A;  4WVF B;  2J0M A;  3HIE A;  5GT3 A;  3AZE B;  1GC6 A;  1LW3 A;  2RLO A;  5AVB A;  4Z66 B;  4X23 B;  3AZN B;  5B2J B;  1FGZ A;  3FM8 C;  3PVW A;  4CSQ A;  3REJ C;  4R8P B;  1MIX A;  1V89 A;  1UNR A;  5DNN D;  3AV1 D;  3P6A A;  1X1G A;  4GZU A;  4YM6 D;  4D6W A;  2CWE A;  4KHO A;  5CP6 C;  3SYX A;  5GT0 B;  3MPX A;  4HAV B;  5GSU A;  2R0D A;  3AFA C;  2NMB A;  3TW1 A;  5IRS A;  2GCL A;  4CSR B;  3UTB A;  3AZF B;  3V9R A;  1PLS A;  1P3M A;  2Y2J A;  3A1K A;  5CHL B;  1W1D A;  2VKI A;  2YRY A;  4MK0 A;  5LG4 B;  3X1T B;  3O62 D;  2RIQ A;  2BYM B;  1B67 A;  3VH5 W;  1P3O B;  2K2J A;  4KVG B;  5E5A C;  3MGP D;  1P34 D;  1KX5 B;  1EF1 A;  2I1K A;  4GMV A;  1HQ3 B;  4ZBJ C;  4ZUX B;  4Z2M H;  5B0Z A;  3VH6 T;  3KXB B;  1X86 A;  4D0N B;  4KHA B;  1N1J A;  3X1U A;  3MGQ C;  2YVC A;  3MGR D;  1P3B B;  3W98 A;  1OMW A;  3C1B C;  2YS5 A;  4DX8 A;  3C1C B;  4WU9 A;  2F8N A;  2ZKM X;  3KSY A;  3KWQ A;  4WNN B;  5F99 C;  2PYO C;  2ZM5 A;  4NY0 A;  3NQJ B;  5J3T A;  1IRS A;  5BNX A;  5AY8 D;  3D8D A;  5B2J D;  1UPR A;  3AYW B;  5C5B B;  3MGR C;  1V5P A;  2N0Y A;  4K17 A;  3WAA B;  2ROV A;  2Z13 A;  4NE3 A;  4XZQ D;  4YM6 B;  4HGA C;  4H9Q A;  5GT3 C;  1F66 C;  2RRF A;  1KX4 C;  1K5D B;  2Z59 A;  3LZ0 B;  3W98 D;  3REJ A;  2LOZ A;  1WJM A;  2J0K A;  2R2Y A;  2YT2 A;  1KX3 A;  3W97 D;  2NQB D;  2D9V A;  3AZK A;  4QLC B;  3UTB D;  1ISN A;  2D9W A;  4JJN C;  3O62 B;  3KY9 A;  3MGS C;  1WJ1 A;  2MFQ A;  1KX5 D;  5CPI C;  3O62 A;  3W97 C;  5BS7 A;  1M19 A;  2RUK B;  5D27 A;  2NQB C;  3KXB D;  4G91 B;  1OQN A;  3U8Z A;  1KX3 B;  3AZM C;  2Y2P A;  4YS3 C;  2ARO D;  4IOY X;  3REJ B;  3LZ0 A;  1P3K B;  1MAI A;  2ZPY A;  3REK D;  1ZVR A;  4IAP A;  5JRG C;  4CHM A;  1F66 D;  3A58 A;  3LZ1 B;  3REL A;  3CXB B;  5AVC A;  2MDX A;  4NE6 A;  5B32 G;  3WAA A;  4CYE A;  3AYW D;  3O96 A;  3AZH B;  1BAK A;  1H3O B;  3TU4 A;  3KUY A;  3NWA A;  3X1T C;  2NZD C;  4WU9 B;  1UNP A;  4H9P A;  5AV6 C;  1GG3 A;  3LZ0 D;  3A6N A;  3W98 B;  5AVB C;  1P3K A;  4KHA A;  3REH C;  5B40 C;  1RJ2 A;  3B0C W;  1W2E A;  2KGX B;  3KXB C;  2DYQ A;  4A6H A;  3MGQ B;  1U2B A;  4HSI A;  2ELB A;  2W2X C;  3X1S D;  3D8E A;  3UTB C;  1M1A A;  1SHC A;  4HB3 B;  1P3A B;  3AZF A;  1BH8 A;  1WWS A;  1M19 D;  1P3M D;  3WA9 B;  2DKP A;  5B32 A;  5GSU B;  2D9Z A;  1P3K D;  2IYB A;  4PNK A;  1FHO A;  3W99 B;  4HGA B;  1F66 B;  5C16 A;  1KX4 B;  3AU4 A;  2GUM A;  2D9Y A;  4CAY A;  3LJA A;  2QKM A;  4XUJ C;  3AZH D;  5CPK C;  4OT1 A;  5B1L D;  5D3V A;  2BYK A;  3WKJ C;  1XCG A;  2KIG A;  1MK7 B;  4X23 C;  3AZN C;  3KWQ C;  4WU9 D;  1SGH A;  4E45 A;  2YF0 A;  4HB2 B;  4H9P B;  1H4R A;  4K2P A;  3A6N D;  4DX9 0;  1Z87 A;  1EVH A;  2FJL A;  2L1C A;  4KGC B;  5AY8 A;  4QXA B;  5B0Z C;  3B0D B;  4QJ3 B;  5AV5 B;  3WTP C;  3KWQ D;  2ZY3 A;  3MGQ D;  3AZH A;  5C3I B;  1AOI B;  2ADZ A;  3CIK A;  4HAU B;  3B6F C;  2Y2G A;  5AVC B;  1X05 A;  3LEL D;  4CAY B;  4TKN A;  5B1M C;  3AN2 A;  1P3O A;  2COF A;  5B31 A;  1F1E A;  3LZ1 C;  1P6S A;  3UTA D;  2DX1 A;  4J8U A;  2HE7 A;  3B0B A;  1U5F A;  1P3M B;  5CPK D;  3PEG A;  5E5A B;  5B32 B;  2G35 A;  3AJ4 A;  3ZDT A;  1KX5 C;  3P5J B;  1BH8 B;  5GXQ D;  2CV5 C;  3WA9 A;  3W99 D;  5JP4 A;  2Y7B A;  1P3F C;  3W97 A;  5BS7 C;  1M19 C;  1WGU A;  2W8S A;  1ID3 D;  2UWX A;  5BNV A;  4J8W A;  3U7D A;  1WGQ A;  5JHG A;  1MIZ B;  5B2I A;  3VH6 W;  2F2A C;  5DNN A;  1P3I D;  5I2M A;  2H7E A;  4Z5T D;  1P3L D;  3A6N B;  3B6F D;  3NSU A;  1UPQ A;  3WAA C;  2GCJ A;  4KGC D;  1BH9 B;  5B1M D;  3ODX A;  2FJ7 B;  5KQ4 A;  5JHH A;  2ZY5 A;  1EGX A;  5AV5 D;  2HIO A;  2NZD D;  5B31 G;  2F8N K;  3AZJ C;  2Y2M A;  3LZ0 C;  5DNM C;  3AYW A;  1H3O A;  3TU4 B;  5AVC D;  2DN6 A;  2EMS A;  4MT7 A;  1M7R A;  3LJU X;  5JRG A;  5F99 D;  3MVD A;  4UUZ A;  4WJ7 A;  4ZRI A;  4WV4 B;  4WU8 B;  3AZJ D;  5CPK B;  1P3P D;  5B1L C;  2D2Q A;  4L6E A;  1TZY A;  5GXQ B;  2DHI A;  2EJ8 A;  3WKJ D;  3M1I B;  4A6K A;  4EKU A;  3HQC A;  4Z66 D;  3AZL D;  1KX3 C;  5GT0 C;  3KFU G;  2UZS A;  2V76 A;  1WWI A;  1P3K C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...