4KHAA

Structural basis of histone h2a-h2b recognition by the essential chaperone fact
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
406
structure length
360
Chain Sequence
DVVEQDKLIEIRNRRPAVLDNVYIRPALEGKRVPGKVEIHQNGIRYQSPLSTTQRVDVLFSNIRHLFFQPCQNEMIVIIHLHLKDPILFGKKKTKDVQFYREAIQEERRRKAELDRLFKSFAEKIAEAGRNEGIEVDMPIRDLGFNGVPNRSNVVIYPTTECLIQITEPPFLVITLEDVEWAHLERVQFGLKNFDLVFVFKDFTRPVVHINTIPVESLEDVKEFLDSSDIPFSEGPLNLNWSVIMKTVTANPHQFFLDGGWGFLQNDSRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Chaperone/nuclear protein
molecule keywords Spt16M-Histone H2B 1.1 chimera
publication title Structural basis of histone H2A-H2B recognition by the essential chaperone FACT.
pubmed doi rcsb
source organism Chaetomium thermophilum var. thermophilum
total genus 99
structure length 360
sequence length 406
ec nomenclature
pdb deposition date 2013-04-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08512 Rtt106 Histone chaperone Rttp106-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 4khaA03
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 4khaA02
2.30.29.150 Mainly Beta Roll PH-domain like PH-domain like 4khaA01
2UZSA 3REHB 4CSRB 3B0CW 3MGQC 3A6ND 2F8ND 2CWEA 3AZJD 1KX3B 1K5DB 5AV5A 3UT9B 3MGPD 4EO5B 5E5AB 2DX1A 5B32D 2K2UA 3LZ0C 3AFAA 3AZHB 5B2IB 4J8UA 3AZGC 4JJNB 1ZLAC 4KGCC 1RJ2A 1JFIA 3REJD 1KX5C 4K2PA 1P3AC 5HE0A 1M19B 5B0YC 2NQBD 3W98D 5AV5B 4GN1A 4J8VA 3ML4A 3X1TB 3WAAB 4GMVA 5BNVA 3AN2D 3X1SD 1X86A 3D8EA 3AZIC 4J8XD 1I7AA 3WTPE 5C16A 4WU9B 2BCJA 4KHOA 4H9SA 1XCGA 4H9PA 1P3BD 3MGSC 3FSSA 3PVLA 4Z2MH 4HDQA 3KWQA 1TAFB 4Z5TD 4CHMA 4CHJA 1TQZA 1KI1B 2FJ7A 2F8NA 2BYMB 4WNNA 3LJUX 3OANA 4DBBA 3SUZA 5DNMD 3KWQB 3B0DC 3KSYA 4LD9B 1B67A 5CHLB 3W96D 2JP2A 1J0WA 1GG3A 2HIOB 3NQUB 3R45B 3REJA 5CPJB 5CPKD 1P3LA 1MK9B 3W98A 1V5PA 3VOQA 5JP4A 3TU4C 4YM6C 2RLOA 1P3IB 2YT0A 3ODXA 1F1EA 5AV6B 1W1GA 4BBKA 3MGRC 3D8FA 1M18D 4EJNA 2CV5D 3MPXA 3KUYD 1P3BA 3AYWC 3CIKA 3LJAB 5B40A 3REIB 2Z0OA 4Z5TA 3W99C 3AU5A 3RELB 3AV1C 3UTBB 3UTAC 1U35D 3WKJD 2KUPA 2NZ8B 5GOWB 3TFMA 5J3QA 5GSUC 1EQZB 3BJIA 5AY8D 5B1MC 5DNMA 4YS3B 1UNPA 1V5MA 2BYKB 2YS5A 3PVUA 5AV8C 3X1VD 3B6FA 5C5BA 3F5RA 1FHXA 3U8ZA 1Y5OA 3W96A 4J8WA 2L1CA 2EJ8A 3MVDB 5B24B 3LELB 5CPKA 1WWIA 3C1CC 2K00A 3IVFA 2AROD 2Z0PA 1LB1A 2PYOC 1W1DA 4XUJD 3V9RA 4G92B 3W97C 1FB8A 2CV5A 1RRPB 2D9XA 3KUYA 2CAYA 3LZ1B 1BTKA 4AWLB 2OTXA 3A8QA 1TJ6A 4WSFA 1M1AD 5DNNB 5GT0B 5CPIC 3AZMD 5GXQC 1U35A 4G91C 4H9NB 5B31D 1MIZB 3X1UC 1P3MB 1OQNA 1EGXA 3MDBC 4X23D 1HQ3A 1Z87A 3TW1A 1ID3C 1P3KD 4ZRKA 1BH9B 5B2JC 2N23A 5BT1D 5B33D 1KU5A 3X1VA 4WU8C 1U5FA 5B1LB 3HK0A 3PP2A 3RCPA 3V5WA 4A5KA 4GZUA 3MGQB 1SHCA 4XWXA 1HQ3B 2RVQD 3C1BC 2Q13A 3X23A 1UNQA 5B0YA 2MKRA 2AROA 2CODA 4XZQC 3LZ0B 4KGCB 1KX4C 1UPQA 3AZGB 1ZLAB 3AZKD 3NQJA 2ZPYA 4NSWA 4XUJA 4QLCC 1KX5B 1P3AB 1U29A 2H7DA 3P7ZA 5B0YB 3AZLA 3WA9C 2NMBA 1P3PA 1EVHA 1M7RA 4CYEA 5G49A 2Y8FA 3PVWA 2W2XC 1M1AA 2NZDC 3AZMA 4KUDD 5AV9D 3AZIB 3AZNC 1IRSA 1MK7B 1ZC4B 2J0MA 2P0HA 1U2BA 1U5EA 4X23A 3QIJA 3MGSB 4ZRIA 1WGUA 3VH5T 1TZYC 1V5UA 3UT9D 1ISNA 4HAZB 5D3YA 5BNXA 4DXAB 5E5AD 2YFWA 2COAA 4HB0B 2EMSA 5BS7A 3AZHD 5B2ID 2YS1A 3GYOA 1I2HA 5JA4B 3MGPC 4WV4B 3B0DB 1WJMA 4Z66C 5AV5D 3X1TD 3WAAD 1NI2A 3AZKA 2YFWB 3A98B 4A6FA 3B6GA 2NQBC 1Q9CA 4HAVB 2D9VA 3TU4B 4YM6B 1PLSA 3AN2C 1A7WA 2I5CA 3AZFA 4J8VD 3VH6A 4J8XC 3MGRB 2GJYA 5GT0A 5CP6C 1DYNA 3AZEC 3AYWB 3REHA 1S32C 1OMWA 2Z0QA 3W99B 1KX3A 4B6HA 1MIXA 4HAWB 3KWQD 2OQBA 3AV1B 3UT9A 3UTAB 2DKPA 3WTPC 5E5AA 3VIAA 5B32G 4LD9D 5GSUB 4KAXB 3AZHA 5B2IA 3WYFB 5B1MB 4JJNA 2FJ7D 2COFA 2HIOD 3VH6W 5B0ZC 5CPJD 5AV8B 2RSGA 1M19A 1WGQA 2K2JA 5HE1A 4NFTA 3X1TA 3WAAA 1P34C 1P3ID 5L81A 4DRAA 2L5AA 3C1CB 1R4VA 1P3LD 2R0DA 2PYOB 4WU9A 2GCJA 3P6AA 3LJAD 2JSSA 5KDMB 1TAFA 2LKOA 3W97B 1K5GB 2P0FA 4GPTB 5DI9B 2BYMA 2F8NH 5B40D 4YS3D 5CPIB 5GXQB 3WKJC 4G91B 1BWNA 1FGYA 1U5GA 3X1UB 3B0BA 4LD9A 2EMTA 3ZVRA 1ID3B 3MVDD 2DA0A 2HIOA 3NQUA 3R45A 5AVCC 5CPJA 3PSCA 4WU8B 3AJ4A 3MNNC 5AVBC 2LYDA 3B6FD 2DFKA 1P3IA 1F66C 5AV6A 3C1BB 4J8WD 2J59M 4A6KA 3AV2C 1HTAA 1TXDA 4XZQB 5JHGA 3DXDA 1KX4B 2P8VA 3LZ1D 3LJAA 3REIA 2CY4A 5C6RA 4QLCB 3RELA 5DNND 3WA9B 3UTBA 2COCA 2YF0A 1P3MD 2RNRB 1P3FC 1EQZA 1UEFA 2I5FA 4YS3A 5F99C 2NZDB 3AZNB 2BYKA 5B31C 1B55A 1V88A 1W1HA 3HW2B 3QWMA 4A6HA 1P6SA 5B1LD 4EMOA 1MKEA 1GC7A 5JHHA 3TCAA 4HAXB 5GT3C 3MGQD 3MVDA 5B24A 4H9RB 1HQ3D 2IO5C 3LELA 5B33C 1TZYB 3TO1A 5DH9B 2HTHB 4ZUXC 4P7IA 3ODOA 4F7GA 2RVQC 1WG7A 3LZ0D 4KGCD 3AZGD 3O62C 2VKIA 3PG7A 1H3OB 3MGPB 1FHOA 2VRWB 4Z66B 5B0YD 1P3OC 2YSZA 2DHJA 3LZ1A 4YONA 2YFVB 3CXBB 2ROZB 2NQBB 3N7CA 5DNNA 4DX90 1X05A 3AZID 4DX8A 4D0NB 5B31G 4IAPA 4H9NA 1WVHA 1P3MA 3AN2B 3QBVB 3AZLD 4IFSA 4H9QA 1UNRA 1P3PD 4DRBA 5AV9C 4J8XB 1BH9A 1BH8B 1WWSA 2IYBA 4H8SA 3TVVA 1AOIC 5B1LA 1FOEA 2CRFA 5CP6B 3AZEB 1S32B 1FHWA 1H10A 3MGQA 4H9QB 3GYPA 5JRGC 1P3GC 4K81A 2MDXA 2YRYA 3WTPB 4TKNA 1P34A 1BTNA 3LZ0A 4KGCA 1SGHA 3AZGA 1ZLAA 2DLWA 4UUZB 2Y7BA 5B0ZB 1KX5A 1P3AA 3TU4D 4E45A 1P34B 3AFAC 4J8UC 2N0YA 3MGRD 3AZIA 1ZSQA 3REKC 3SNHA 4HATB 3B6GD 3NSUA 3F0WA 1WJ1A 1DDWA 4R8PC 4J8VC 1BFMA 4HHVA 3KXBC 3MGSA 1N1JA 3AYWD 5J3TA 3AZFD 1PMSA 4IOYX 1DDMA 3W99D 5JLJB 3ULBA 3UTAD 5D3XA 4H9SC 5GT0D 2L2IA 5GSUD 3D8DA 1X1GA 5HE2A 2V76A 1N1JB 3REHD 5HE3A 4Z2NA 5JA4A 5AVBA 1KX3D 3WKJB 2D11A 2FJ7C 1XR0B 2P0DA 3A6NC 2XQNM 5FUGB 3AZJC 5AVCB 3AV2A 3KRWA 1BAKA 3C1CD 4JJND 2CY5A 4HAUB 3MNNB 5AVBB 2DYNA 3TU4A 4YM6A 5B32C 1M19D 1F66B 2PYOD 1X1FA 1Y19B 2DYQA 1ULYA 2MWNB 3U7DA 3REJC 3MGRA 1P3LC 3AV2B 2ROVA 2F8NK 3W97D 3W98C 2YVCA 4HB4B 4CAYA 3PZDA 2LULA 2X18A 3AYWA 4WU9D 2YT1A 3X1SC 1N3HA 3W99A 3B0CT 5LONB 3VH5A 4KHAB 3AV1A 5GXQD 3UTAA 5D3WA 2E2XA 4CAYB 1P3FB 5GSUA 1P3BC 3M1IB 5B40C 1P5TA 4HAYB 5B1MA 2H7EA 5F99B 4Z5TC 1ID3D 5B31B 2F8NG 4Z2MG 5AV8A 1NTVA 4WU8D 3SO6A 1P3RA 5GT3B 3O62A 5B33B 2IO5B 3C1BD 5DNMC 3C1CA 3B6FC 4ZUXB 2PYOA 3VH5W 4XZQD 2KCJA 3W96C 4J8WC 3T06A 3O62B 5AV6D 2RUKB 5CPKC 5D3VA 5KDMA 4QLCD 1XKEA 3W97A 1QC6A 1P3OB 2HUEC 3WA9D 5BO0B 2KGXB 5EFXA 5C79A 4NE6A 3REID 2NZDD 1M18C 5CPIA 3AZND 5GXQA 2CV5C 2LOXA 3RELD 3X1UA 2MFQA 3KUYC 4EKUA 3UTBD 4ZBJC 1Q67A 1P3GA 5AV9B 1ID3A 1EQZD 2DKQA 5B2JA 4WU8A 1AOIB 1AQCA 1U35C 1B6WA 1FAOA 4GMXB 5KQ1A 1KZ7A 2Y8GA 5AY8C 1HQ3C 2D10A 3ZDTA 3C1BA 5JRGB 1P3GB 5DHAB 1ZC3B 1AWEA 3HQCA 5B24D 5B2JB 3X1VC 3LELD 5CLLB 4XZQA 4Z66D 2QKMA 3G9WA 1KX4A 2D2QA 4QLCA 3REKA 5C3IC 3KRXA 2DN6A 2AROC 3A8PA 3SV1A 4R8PA 3WA9A 4HB3B 3DXEA 3KXBA 4L6EA 3AFAB 4E44A 5DIFB 4J8UB 2D9ZA 3KY9A 4ZRJA 4XUJC 1JFIB 2NZDA 3AZNA 3REKB 3UZTA 3AZLC 4R8PB 4J8VB 4MT7A 5CP6D 3AU4A 1P3PC 3KXBB 3AZED 5BNVB 1S32D 1U27A 4H9RA 1M1AC 2J0KA 3AZMC 1TZYA 1PFJA 3WTPD 2VSZA 1DBHA 4Y94A 4X23C 3A6NA 4H9PB 1EF1A 3AZJA 1KZGA 1P3KC 1UPRA 1H3OA 5BT1C 3MGPA 5B0ZD 2ELBA 2UVMA 5B32A 4Z66A 4PQ0A 1EAZA 2FJ7B 1P34D 2RGNB 3A6NB 4WNNB 2YFVA 5BS7C 3AZJB 2F8NB 2D9WA 2AEHA 2RVBB 4NE3A 1ZLAD 2NQBA 5DHFB 2I1KA 3PEGA 1KX5D 1P3AD 5B32B 5LOPB 3AN2A 3X1SA 1DROA 3AZKC 4K2OA 4NY0A 4J8XA 3REJB 1P3LB 1BH8A 3B6GC 2M38A 3W98B 3ULCA 5CP6A 3AZEA 1S32A 4HGAC 3X1SB 3AZFC 4MY6A 3MGSD 4KUDC 2LG1A 1E5WA 3WTPA 5GT0C 1FGZA 4GXBA 1P3BB 3REHC 5B40B 2R09A 2QKLA 4Z5TB 4UUZA 1KX3C 5B0ZA 5AVCD 3UT9C 3MNND 5AVBD 5FI0A 4EO5C 5E5AC 5CLQB 2DHIA 1F66D 4KHBB 3AZHC 5B2IC 4HDOA 5DNMB 4JJNC 3AV2D 3B6FB 5J3YA 1M19C 5C5BB 5AV5C 3W96B 4J8WB 3WAAC 3X1TC 4YM6D 2G35A 1M18A 5CPKB 1OY2A 3ODWA 1MAIA 2HUEB 4C0AA 4WU9C 1P3FD 5F99D 1M18B 1H4RA 3V9RB 3WKJA 2CV5B 3KUYB 2UZRA 5AY8A 3AV1D 4ZBJB 5GT3D 5D27A 5FUGA 5AVCA 2ADZA 3KZ1A 3KWQC 5B1MD 1NTYA 5KQ4A 1U35B 3MNNA 5AV8D 4LD9C 4ZUXD 1F66A 4KVGB 5AY8B 1GC6A 2YS3A 3BINA 4Z2MB 3O62D 2HIOC 1DDVA 1XODA 5CPJC 3X1VB 3FEHA 1P3OD 1P3IC 2HE7A 3O96A 5AV6C 2DTCA 2GS0A 1NU2A 5C3IB 3FM8C 2AROB 4KHAA 3SYXA 4HB2B 4F7UP 1X11A 1P3FA 5KCVA 3LJAC 3REIC 3NQJB 1XX0A 4WZSB 4XUJB 5F99A 1XD4A 2J0JA 5B31A 3RELC 1WI1A 2FJLA 1J19A 4M6BA 3AZLB 1TZYD 3UTBC 3VH6T 5CPID 1AOID 1U5DA 1P3PB 2GCLA 3X1UD 5G49B 5GT3A 1P3KA 1EQZC 2W2WA 5B33A 2ELAA 3DXCA 5JRGD 4YS3C 4H9OA 3AZMB 1P3GD 1M1AB 1V61A 1V89A 2D9YA 5B2JD 2DX5A 2I1JA 1LW3A 4ZUXA 4X23B 5FI1A 1MPHA 1P3KB 3MVDC 5B24C 3LELC 2D4QA 4YL8A 4H9OB 2PZ1A 1P3OA 4K17A 1ZM0A 5BNXB 4NE5A 5BO0A 3WA0A 4F7HA 4PNKA 3AFAD 4J8UD 1KX4D 2IFSA 4G92C 3REKD 4R8PD 3LZ1C 2M14A 3KXBD 3AZKB 4AWLC 5AV9A 4KUDA 4A6FB 3B6GB 5DNNC 1QQGA 2W2XD 1AOIA 2LY8A 4TYZA 4WJ7A 1P3MC 4CSRA 4MK0A 2DHKA 4HGAB 3AZFB 4WVFB 2LOZA 5JRGA 2EC1A 4KUDB 2AL6A 1M7EA 1ZVRA 5B1LC
chains in the Genus database with same CATH superfamily
3REHB 3B0CW 3MGQC 2F8ND 3AZJD 3MGPD 2DX1A 5B32D 2K2UA 3AZHB 4J8UA 4JJNB 4K2PA 3REJD 4GN1A 5B0YC 3W98D 5AV5B 3X1SD 3AZIC 4H9SA 3PVLA 4HDQA 3KWQA 4Z5TD 4CHMA 4CHJA 1TQZA 4DBBA 3KSYA 4LD9B 5CHLB 3NQUB 3R45B 1P3LA 5JP4A 2RLOA 5AV6B 4OT1A 2CV5D 2RIQA 3KUYD 3REIB 5GOWB 3WKJD 3TFMA 4KHBA 1EQZB 3BJIA 4YS3B 2YS5A 3PVUA 1T3UA 3X1VD 5C5BA 3W96A 4J8WA 1WWIA 4G92B 4AWLB 3A8QA 1TJ6A 1U35A 5B31D 2RRFA 3RCPA 4GZUA 2Y2KA 5I2SA 1P3AB 3P7ZA 3WA9C 4CYEA 5G49A 2Y8FA 3AZNC 1WGUA 4HAZB 5E5AD 2ZY4A 5B2ID 5JA4B 1WJMA 3WAAD 3AZKA 2YFWB 3B6GA 1Q9CA 4HAVB 3AN2C 3B77A 3FVCA 3REHA 4QXAB 3W99B 3KWQD 3WTPC 3VIAA 3AZHA 3WYFB 5B1MB 4JJNA 1WGQA 4DIXA 5L81A 4DRAA 1P3LD 3LJAD 4GPTB 5DI9B 5GXQB 4LD9A 3ZVRA 3MVDD 3NQUA 3R45A 5AVBC 1F66C 5AV6A 3C1BB 4J8WD 4XZQB 1KX4B 3REIA 4QLCB 1P3MD 2RNRB 1P3FC 1EQZA 4YS3A 5F99C 3QWMA 4A6HA 1P6SA 2ZY3A 2IO5C 3TO1A 2HTHB 4P7IA 4KGCD 3AZGD 1FHOA 2VRWB 2DHJA 4YONA 2Y2LA 3CXBB 4DX8A 4D0NB 4IAPA 1WVHA 4H9QA 4DRBA 5AV9C 2CRFA 3AZEB 1S32B 1P34A 1BTNA 4UUZB 5B0ZB 1P3AA 3TU4D 4E45A 3MGRD 3FDDA 2GUMA 3B6GD 1WJ1A 4HHVA 4J8VC 1BFMA 3AYWD 1N1JA 3ULBA 3UTAD 5D3XA 2L2IA 5GSUD 3D8DA 5HE2A 3REHD 4Z2NA 5JA4A 2FJ7C 3A6NC 3KRWA 3AV2A 4JJND 3MNNB 2DYNA 1X1FA 1Y19B 3W97D 2YVCA 5M4YB 3W99A 4DQYB 3M1IB 5B1MA 4Z2MG 4WU8D 5DNMC 3O62B 5AV6D 5CPKC 4WJ3C 1QC6A 5BO0B 5C79A 3REID 1M18C 5GXQA 2MFQA 4EKUA 1Q67A 1EQZD 5B2JA 1AQCA 1FAOA 1AWEA 3C1BA 5JRGB 1P3GB 4XZQA 4Z66D 1KX4A 2D2QA 4QLCA 3A1IA 3KXBA 4L6EA 3AFAB 2D9ZA 3KY9A 5CP6D 2J0KA 3AZMC 4Y94A 1P3KC 2UVMA 4PQ0A 2RGNB 1P34D 2F8NB 5BS7C 3AZJB 2D9WA 2AEHA 3PEGA 1P3AD 5B32B 5LOPB 1DROA 4K2OA 3REJB 3W98B 3AZEA 1S32A 3X1SB 4KUDC 1FGZA 4Z5TB 4UUZA 1KX3C 5B0ZA 3UT9C 2DHIA 3IP4C 3AV2D 3X1TC 1OY2A 2JE5A 2CV5B 3KUYB 3EPHA 4ZBJB 2ADZA 1NTYA 5B1MD 3MNNA 3EG5B 2HIOC 1XODA 5CPJC 3X1VB 3NWAA 1P3OD 1NU2A 1X11A 5KCVA 3NQJB 2FJLA 1J19A 3UTBC 3DXCA 2D9YA 5B2JD 1LW3A 2D4QA 3LELC 4YL8A 4H9OB 3WA0A 5BO0A 4F7HA 4PNKA 1KX4D 3H0RC 3LZ1C 3KXBD 4TYZA 4CSRA 2F2AC 3AZFB 2LOZA 4UPKA 5JRGA 1K5DB 2G5HC 4EO5B 5E5AB 3LZ0C 3AFAA 5B2IB 2Y2MA 3WAAB 4GMVA 3OHMB 3WTPE 1P3BD 3MGSC 1TAFB 1KI1B 1T77A 2F8NA 3KWQB 3B0DC 1GG3A 3REJA 3W98A 3ODXA 1W1GA 4BBKA 3D8FA 3MPXA 3LJAB 4Z5TA 3AU5A 3RELB 3AV1C 2KUPA 1V5MA 2BYKB 3F5RA 3U8ZA 3MVDB 3C1CC 2K00A 2AROD 2PYOC 4XUJD 1RRPB 2CV5A 3KUYA 2DF4C 2OTXA 4WSFA 1M1AD 5CPIC 3X1UC 1P3MB 1OQNA 3MDBC 4X23D 3TW1A 1ID3C 4ZRKA 2N23A 5BT1D 3X1VA 4A5KA 2Q13A 3X23A 5B0YA 2MKRA 2FFFB 2CODA 4KGCB 3AZGB 1ZLAB 2ZPYA 3NQJA 1KX5B 2H7DA 2NMBA 3PVWA 3PP2A 2NZDC 1MK7B 4ZRIA 1V5UA 3MGPC 4WV4B 1NI2A 3A98B 1ZYIA 3TU4B 4YM6B 1PLSA 3AZFA 3MGRB 2GJYA 1DYNA 3AYWB 2Z0QA 1MIXA 2OQBA 3UTAB 5E5AA 5GSUB 5B2IA 2COFA 5AV8B 5HE1A 4NFTA 3WAAA 1P3ID 2L5AA 1R4VA 2R0DA 2R2YA 2Y2JA 5KDMB 1TAFA 3W97B 2P0FA 3WKJC 1BWNA 4G91B 1FGYA 1U5GA 3B0BA 2DA0A 5AVCC 4WU8B 4A6KA 1TXDA 3DXDA 3LJAA 3RELA 5DNND 4QJ4B 2COCA 2YF0A 2BYKA 5B31C 2Y2PA 5B1LD 3TCAA 5GT3C 3MGQD 3MVDA 1TZYB 5DH9B 4ZUXC 3PG7A 2VKIA 4Z66B 5B0YD 2ROZB 2NQBB 3AZID 1P3MA 4IFSA 4J8XB 1AOIC 5CP6B 4H9QB 3GYPA 4K81A 2MDXA 2YRYA 5IRSA 1SGHA 4KGCA 3AZGA 1ZLAA 2DLWA 2Y7BA 1KX5A 2J8PA 1P34B 4J8UC 3SNHA 3REKC 1DDWA 4R8PC 3AZFD 5JLJB 4H9SC 1N1JB 5AVBA 2P0DA 1BAKA 4HAUB 3TU4A 4YM6A 2MWNB 3U7DA 3MGRA 1P3LC 3AV2B 4HB4B 2F8NK 4CAYA 3AYWA 4KHAB 3UTAA 5GSUA 2KR0A 1P5TA 4HAYB 5AV8A 3SO6A 1P3RA 5B33B 3DCXA 3T06A 3W96C 4J8WC 3AL0C 5KDMA 3W97A 1P3OB 3WA9D 4NE6A 2Y2QA 3AZND 2LOXA 3RELD 4CSQA 4WU8A 1U35C 1B6WA 5AY8C 2D10A 5DHAB 5B2JB 2W8SA 3SV1A 3A8PA 3DXEA 5DIFB 1JFIB 3KXBB 1U27A 1TZYA 3WTPD 3A6NA 4H9PB 1KZGA 2VQRA 4Z66A 1EAZA 3AJ4A 4Z2MB 1ZLAD 2NQBA 1KX5D 3AZKC 4J8XA 3B6GC 5CP6A 4HGAC 2Y2NA 2LG1A 1E5WA 1P3BB 3REHC 5B40B 2UWXA 5AVBD 1F66D 3AZHC 4HDOA 4JJNC 3B6FB 5AV5C 4YM6D 1M18A 2HUEB 4C0AA 1P3FD 5F99D 1H4RA 3V9RB 4GOUA 2UZRA 2K8EA 5D27A 3KZ1A 5AV8D 4LD9C 4KVGB 1GC6A 2YS3A 2HE7A 3O96A 5AV6C 2DTCA 2GS0A 5C3IB 2AROB 4KHAA 3REIC 4WZSB 4XUJB 3A58A 1WI1A 3AZLB 1U5DA 3VH6T 2NBVA 1P3PB 2W2WA 1P3KA 1EQZC 5B33A 2ELAA 1M1AB 4YS3C 2I1JA 1V89A 2DX5A 4X23B 5FI1A 1P3OA 2IFSA 4G92C 4AWLC 4KUDA 2Z13A 2W2XD 2LY8A 4WJ7A 5GT0B 1TZYD 2UZSA 4CSRB 3A6ND 2CWEA 1RJ2A 1JFIA 1P3AC 1M19B 2NQBD 4J8XD 1I7AA 4WU9B 1XCGA 4H9PA 3EPLA 2BYMB 3SUZA 5DNMD 1B67A 5CPKD 1MK9B 1V5PA 3VOQA 2YT0A 1P3IB 1F1EA 1M18D 4EJNA 1P3BA 5B40A 2KIGA 2Z0OA 3W99C 2NZ8B 5J3QA 2ZKMX 5B1MC 1UNPA 3B6FA 5B24B 3IVFA 3V9RA 2D9XA 2CAYA 5DNNB 3AZMD 5GXQC 4H9NB 1MIZB 1EGXA 1HQ3A 1P3KD 1BH9B 5B2JC 5B33D 5B1LB 3NWFA 3MGQB 3C1BC 2RVQD 1UNQA 2AROA 4QJ3B 2KIEA 4XZQC 1KX4C 4XUJA 4QLCC 5B0YB 3AZLA 3KFUG 1P3PA 1M7RA 1M1AA 4KUDD 3AZIB 1IRSA 2J0MA 1U2BA 4X23A 3QIJA 2Z59A 3UT9D 1ISNA 4HB0B 2YS1A 3X1TD 2ZM5A 3VH6A 5I2MA 5GT0A 3AZEC 1S32C 1OMWA 4HAWB 5B32G 4KAXB 2HIOD 3VH6W 5B0ZC 5CPJD 1M19A 2JCHA 3NWDA 4WU9A 2GCJA 3P6AA 2JSSA 2LKOA 1K5GB 2BYMA 5B40D 2EMTA 3PSCA 3MNNC 3A1KA 3B6FD 1P3IA 2P8VA 5C6RA 3LZ1D 2CY4A 3WA9B 1UEFA 2I5FA 3HW2B 3AZNB 1B55A 1V88A 4EMOA 1MKEA 1GC7A 5JHHA 4HAXB 5B24A 4H9RB 1HQ3D 3ODOA 4F7GA 3LZ0D 3O62C 1H3OB 2YFVB 5DNNA 5B31G 4H9NA 3AN2B 3AZLD 1UNRA 1P3PD 1BH9A 3TVVA 5B1LA 1FHWA 3MGQA 5JRGC 1P3GC 3WTPB 1W2EA 3HSAA 3AFAC 3AZIA 1ZSQA 4HATB 3F0WA 1PMSA 4IOYX 1DDMA 5GT0D 1X1GA 2V76A 2D11A 1XR0B 2XQNM 5FUGB 3AZJC 3C1CD 5AVBB 5B32C 1M19D 1F66B 2PYOD 2DYQA 1ULYA 3REJC 3W98C 3PZDA 2LULA 2X18A 4WU9D 3X1SC 1N3HA 5LONB 5D3WA 4CAYB 1P3FB 4D6WA 5F99B 4Z5TC 1ID3D 1NTVA 2IO5B 2RUKB 2KGXB 2NZDD 2CV5C 3KUYC 4ZBJC 1MI1A 5AV9B 2DKQA 1KZ7A 3ZDTA 1ZC3B 5B24D 3X1VC 2QKMA 3G9WA 4OSNA 3REKA 3KRXA 4R8PA 2G5IC 3WA9A 4ZRJA 3AZNA 3UZTA 4J8VB 4MT7A 1Z2CB 5BNVB 4H9RA 1PFJA 1DBHA 1UPRA 1H3OA 3P5JB 2FJ7B 3A6NB 4WNNB 4GNKB 2YFVA 4NE3A 2Y2OA 3AN2A 2M38A 3AZFC 3EPJA 3WTPA 5AVCD 5FI0A 4EO5C 5E5AC 5B2IC 5DNMB 3WAAC 2G35A 5CPKB 3ODWA 1MAIA 1M18B 5AY8A 5GT3D 5FUGA 3KWQC 4ZUXD 1F66A 1DDVA 1PZRA 3FM8C 4HB2B 4F7UP 1P3FA 3LJAC 5F99A 2J0JA 3RELC 1AOID 2PZ1A 2GCLA 3AZMB 1V61A 1P3KB 3MVDC 1ZM0A 5BNXB 4NE5A 4J8UD 2YT2A 3REKD 4R8PD 5AV9A 4A6FB 1QQGA 1P3MC 2DHKA 4WVFB 5LG4B 4KUDB 1M7EA 1ZVRA 1KX3B 5AV5A 3UT9B 2FJUB 4KGCC 3AZGC 1ZLAC 5HE0A 1KX5C 4J8VA 3ML4A 3X1TB 5BNVA 3AN2D 1X86A 3D8EA 5C16A 2BCJA 4KHOA 3FSSA 4Z2MH 2FJ7A 3LJUX 4WNNA 3OANA 4QJ5B 2JP2A 3W96D 1J0WA 2HIOB 5CPJB 3TU4C 4YM6C 4L1RA 3MGRC 3AYWC 3CIKA 3UTBB 3UTAC 1U35D 5GSUC 5AY8D 5DNMA 5AV8C 2BG1A 1FHXA 1Y5OA 2L1CA 2EJ8A 3LELB 5CPKA 2Z0PA 1LB1A 1W1DA 3W97C 1FB8A 3LZ1B 1BTKA 4G91C 1Z87A 1U5FA 1KU5A 4WU8C 3HK0A 3V5WA 2ZY2A 1SHCA 4XWXA 1HQ3B 3LZ0B 1UPQA 4NSWA 3AZKD 1U29A 3HIEA 1EVHA 2W2XC 3AZMA 1ZC4B 5AV9D 2P0HA 1U5EA 3MGSB 3VH5T 1TZYC 4DXAB 5D3YA 5BNXA 2YFWA 2COAA 2EMSA 5BS7A 3AZHD 3GYOA 1I2HA 3B0DB 4Z66C 5AV5D 4A6FA 2NQBC 2D9VA 1A7WA 2I5CA 4J8VD 2Z14A 4J8XC 5CP6C 4B6HA 1KX3A 3AV1B 3UT9A 2DKPA 4LD9D 2FJ7D 2RSGA 2K2JA 3X1TA 1P34C 3C1CB 2PYOB 2F8NH 2XD1A 4YS3D 5CPIB 3F6TA 3X1UB 3U12A 1ID3B 2HIOA 5CPJA 2Y2HA 2LYDA 2DFKA 2J59M 3AV2C 1HTAA 5JHGA 3UTBA 2NZDB 1W1HA 5B33C 3LELA 3EPKA 2RVQC 1WG7A 3MGPB 1P3OC 2KUQA 2YSZA 3LZ1A 4DX90 3N7CA 1X05A 3QBVB 2XD5A 1BH8B 1WWSA 2Y2GA 3H0LC 2IYBA 4H8SA 1FOEA 1H10A 4TKNA 3LZ0A 2N0YA 3NSUA 3H0MC 3KXBC 3MGSA 5J3TA 3W99D 5HE3A 3WKJB 1KX3D 5AVCB 2CY5A 2ROVA 2YT1A 3B0CT 3VH5A 3AV1A 5GXQD 2E2XA 1P3BC 3NW8A 5B40C 2H7EA 2K49A 2F8NG 5B31B 5GT3B 3O62A 2Y2IA 3C1BD 3C1CA 3B6FC 4ZUXB 2PYOA 3VH5W 4XZQD 2KCJA 5D3VA 4QLCD 1XKEA 2HUEC 5EFXA 5CPIA 3X1UA 3UTBD 2ZY5A 1P3GA 1ID3A 1AOIB 5KQ1A 4GMXB 2Y8GA 1HQ3C 3HQCA 3LELD 5CLLB 5C3IC 2DN6A 2AROC 4HB3B 4E44A 4J8UB 4XUJC 2NZDA 3REKB 2Z4DA 3AZLC 4R8PB 5DHFB 3AU4A 1P3PC 3AZED 1S32D 1M1AC 2VSZA 4X23C 1EF1A 3AZJA 5BT1C 3MGPA 5B0ZD 2ELBA 5B32A 2RVBB 2I1KA 3X1SA 4NY0A 1P3LB 1BH8A 3ULCA 4MY6A 3MGSD 5GT0C 4GXBA 2R09A 2QKLA 3MNND 5CLQB 4KHBB 5J3YA 1M19C 5C5BB 3W96B 4J8WB 4WU9C 2DQNC 3WKJA 3AV1D 5AVCA 5KQ4A 1U35B 5AY8B 3BINA 3O62D 3FEHA 1P3IC 3SYXA 1XD4A 1XX0A 5B31A 4M6BA 5CPID 3X1UD 5G49B 5GT3A 5JRGD 1P3GD 4H9OA 4ZUXA 1MPHA 5B24C 4K17A 3AFAD 2M14A 3AZKB 3B6GB 5DNNC 1AOIA 4HSIA 4MK0A 4HGAB 2EC1A 2AL6A 5B1LC
chains in the Genus database with same CATH topology
3REHB 3B0CW 3MGQC 2F8ND 3AZJD 3MGPD 2DX1A 5B32D 2K2UA 3AZHB 4J8UA 4JJNB 4K2PA 3REJD 4GN1A 5B0YC 3W98D 5AV5B 3X1SD 3AZIC 4H9SA 3PVLA 4HDQA 3KWQA 4Z5TD 4CHMA 4CHJA 1TQZA 4DBBA 3KSYA 4LD9B 5CHLB 3NQUB 3R45B 1P3LA 5JP4A 2RLOA 5AV6B 4OT1A 2CV5D 2RIQA 3KUYD 3REIB 5GOWB 3WKJD 3TFMA 4KHBA 1EQZB 3BJIA 4YS3B 2YS5A 3PVUA 1T3UA 3X1VD 5C5BA 3W96A 4J8WA 1WWIA 4G92B 4AWLB 3A8QA 1TJ6A 1U35A 5B31D 2RRFA 3RCPA 4GZUA 2Y2KA 5I2SA 1P3AB 3P7ZA 3WA9C 4CYEA 5G49A 2Y8FA 3AZNC 1WGUA 4HAZB 5E5AD 2ZY4A 5B2ID 5JA4B 1WJMA 3WAAD 3AZKA 2YFWB 3B6GA 1Q9CA 4HAVB 3AN2C 3FVCA 3REHA 4QXAB 3W99B 3KWQD 3WTPC 3VIAA 3AZHA 3WYFB 5B1MB 4JJNA 1WGQA 4DIXA 5L81A 4DRAA 1P3LD 3LJAD 4GPTB 5DI9B 5GXQB 4LD9A 3ZVRA 3MVDD 3NQUA 3R45A 5AVBC 1F66C 5AV6A 3C1BB 4J8WD 4XZQB 1KX4B 3REIA 4QLCB 1P3MD 2RNRB 1P3FC 1EQZA 4YS3A 5F99C 3QWMA 4A6HA 1P6SA 2ZY3A 2IO5C 3TO1A 2HTHB 4P7IA 4KGCD 3AZGD 1FHOA 2VRWB 2DHJA 4YONA 2Y2LA 3CXBB 4DX8A 4D0NB 4IAPA 1WVHA 4H9QA 4DRBA 5AV9C 2CRFA 3AZEB 1S32B 1P34A 1BTNA 4UUZB 5B0ZB 1P3AA 3TU4D 4E45A 3MGRD 3FDDA 2GUMA 3B6GD 1WJ1A 4HHVA 4J8VC 1BFMA 3AYWD 1N1JA 3ULBA 3UTAD 5D3XA 2L2IA 5GSUD 3D8DA 5HE2A 3REHD 4Z2NA 5JA4A 2FJ7C 3A6NC 3KRWA 3AV2A 4JJND 3MNNB 2DYNA 1X1FA 1Y19B 3W97D 2YVCA 5M4YB 3W99A 4DQYB 3M1IB 5B1MA 4Z2MG 4WU8D 5DNMC 3O62B 5AV6D 5CPKC 4WJ3C 1QC6A 5BO0B 5C79A 3REID 1M18C 5GXQA 2MFQA 4EKUA 1Q67A 1EQZD 5B2JA 1AQCA 1FAOA 1AWEA 3C1BA 5JRGB 1P3GB 4XZQA 4Z66D 1KX4A 2D2QA 4QLCA 3A1IA 3KXBA 4L6EA 3AFAB 2D9ZA 3KY9A 5CP6D 2J0KA 3AZMC 4Y94A 1P3KC 2UVMA 4PQ0A 2RGNB 1P34D 2F8NB 5BS7C 3AZJB 2D9WA 2AEHA 3PEGA 1P3AD 5B32B 5LOPB 1DROA 4K2OA 3REJB 3W98B 3AZEA 1S32A 3X1SB 4KUDC 1FGZA 4Z5TB 4UUZA 1KX3C 5B0ZA 3UT9C 2DHIA 3IP4C 3AV2D 3X1TC 1OY2A 2JE5A 2CV5B 3KUYB 3EPHA 4ZBJB 2ADZA 1NTYA 5B1MD 3MNNA 3EG5B 2HIOC 1XODA 5CPJC 3X1VB 3NWAA 1P3OD 1NU2A 1X11A 5KCVA 3NQJB 2FJLA 1J19A 3UTBC 3DXCA 2D9YA 5B2JD 1LW3A 2D4QA 3LELC 4YL8A 4H9OB 3WA0A 5BO0A 4F7HA 4PNKA 1KX4D 3H0RC 3LZ1C 3KXBD 4TYZA 4CSRA 2F2AC 3AZFB 2LOZA 4UPKA 5JRGA 1K5DB 2G5HC 4EO5B 5E5AB 3LZ0C 3AFAA 5B2IB 2Y2MA 3WAAB 4GMVA 3OHMB 3WTPE 1P3BD 3MGSC 1TAFB 1KI1B 2F8NA 3KWQB 3B0DC 1GG3A 3REJA 3W98A 3ODXA 1W1GA 4BBKA 3D8FA 3MPXA 3LJAB 4Z5TA 3AU5A 3RELB 3AV1C 2KUPA 1V5MA 2BYKB 3F5RA 3U8ZA 3MVDB 3C1CC 2K00A 2AROD 2PYOC 4XUJD 1RRPB 2CV5A 3KUYA 2DF4C 2OTXA 4WSFA 1M1AD 5CPIC 3X1UC 1P3MB 1OQNA 3MDBC 4X23D 3TW1A 1ID3C 4ZRKA 2N23A 5BT1D 3X1VA 4A5KA 2Q13A 3X23A 5B0YA 2MKRA 2FFFB 2CODA 4KGCB 3AZGB 1ZLAB 2ZPYA 3NQJA 1KX5B 2H7DA 2NMBA 3PVWA 3PP2A 2NZDC 1MK7B 4ZRIA 1V5UA 3MGPC 4WV4B 1NI2A 3A98B 1ZYIA 3TU4B 4YM6B 1PLSA 3AZFA 3MGRB 2GJYA 1DYNA 3AYWB 2Z0QA 1MIXA 2OQBA 3UTAB 5E5AA 5GSUB 5B2IA 2COFA 5AV8B 5HE1A 4NFTA 3WAAA 1P3ID 2L5AA 1R4VA 2R0DA 2R2YA 2Y2JA 5KDMB 1TAFA 3W97B 2P0FA 3WKJC 1BWNA 4G91B 1FGYA 1U5GA 3B0BA 2DA0A 5AVCC 4WU8B 4A6KA 1TXDA 3DXDA 3LJAA 3RELA 5DNND 4QJ4B 2COCA 2YF0A 2BYKA 5B31C 2Y2PA 5B1LD 3TCAA 5GT3C 3MGQD 3MVDA 1TZYB 5DH9B 4ZUXC 3PG7A 2VKIA 4Z66B 5B0YD 2ROZB 2NQBB 3AZID 1P3MA 4IFSA 4J8XB 1AOIC 5CP6B 4H9QB 3GYPA 4K81A 2MDXA 2YRYA 5IRSA 1SGHA 4KGCA 3AZGA 1ZLAA 2DLWA 2Y7BA 1KX5A 2J8PA 1P34B 4J8UC 3SNHA 3REKC 1DDWA 4R8PC 3AZFD 5JLJB 4H9SC 1N1JB 5AVBA 2P0DA 1BAKA 4HAUB 3TU4A 4YM6A 2MWNB 3U7DA 3MGRA 1P3LC 3AV2B 4HB4B 2F8NK 4CAYA 3AYWA 4KHAB 3UTAA 5GSUA 2KR0A 1P5TA 4HAYB 5AV8A 3SO6A 1P3RA 5B33B 3T06A 3W96C 4J8WC 3AL0C 5KDMA 3W97A 1P3OB 3WA9D 4NE6A 2Y2QA 3AZND 2LOXA 3RELD 4CSQA 4WU8A 1U35C 1B6WA 5AY8C 2D10A 5DHAB 5B2JB 2W8SA 3SV1A 3A8PA 3DXEA 5DIFB 1JFIB 3KXBB 1U27A 1TZYA 3WTPD 3A6NA 4H9PB 1KZGA 2VQRA 4Z66A 1EAZA 3AJ4A 4Z2MB 1ZLAD 2NQBA 1KX5D 3AZKC 4J8XA 3B6GC 5CP6A 4HGAC 2Y2NA 2LG1A 1E5WA 1P3BB 3REHC 5B40B 2UWXA 5AVBD 1F66D 3AZHC 4HDOA 4JJNC 3B6FB 5AV5C 4YM6D 1M18A 2HUEB 4C0AA 1P3FD 5F99D 1H4RA 3V9RB 4GOUA 2UZRA 2K8EA 5D27A 3KZ1A 5AV8D 4LD9C 4KVGB 1GC6A 2YS3A 2HE7A 3O96A 5AV6C 2DTCA 2GS0A 5C3IB 2AROB 4KHAA 3REIC 4WZSB 4XUJB 3A58A 1WI1A 3AZLB 1U5DA 3VH6T 2NBVA 1P3PB 2W2WA 1P3KA 1EQZC 5B33A 2ELAA 1M1AB 4YS3C 2I1JA 1V89A 2DX5A 4X23B 5FI1A 1P3OA 2IFSA 4G92C 4AWLC 4KUDA 2Z13A 2W2XD 2LY8A 4WJ7A 5GT0B 1TZYD 2UZSA 4CSRB 3A6ND 2CWEA 1RJ2A 1JFIA 1P3AC 1M19B 2NQBD 4J8XD 1I7AA 4WU9B 1XCGA 4H9PA 3EPLA 2BYMB 3SUZA 5DNMD 1B67A 5CPKD 1MK9B 1V5PA 3VOQA 2YT0A 1P3IB 1F1EA 1M18D 4EJNA 1P3BA 5B40A 2KIGA 2Z0OA 3W99C 2NZ8B 5J3QA 2ZKMX 5B1MC 1UNPA 3B6FA 5B24B 3IVFA 3V9RA 2D9XA 2CAYA 5DNNB 3AZMD 5GXQC 4H9NB 1MIZB 1EGXA 1HQ3A 1P3KD 1BH9B 5B2JC 5B33D 5B1LB 3NWFA 3MGQB 3C1BC 2RVQD 1UNQA 2AROA 4QJ3B 2KIEA 4XZQC 1KX4C 4XUJA 4QLCC 5B0YB 3AZLA 3KFUG 1P3PA 1M7RA 1M1AA 4KUDD 3AZIB 1IRSA 2J0MA 1U2BA 4X23A 3QIJA 2Z59A 3UT9D 1ISNA 4HB0B 2YS1A 3X1TD 2ZM5A 3VH6A 5I2MA 5GT0A 3AZEC 1S32C 1OMWA 4HAWB 5B32G 4KAXB 2HIOD 3VH6W 5B0ZC 5CPJD 1M19A 2JCHA 3NWDA 4WU9A 2GCJA 3P6AA 2JSSA 2LKOA 1K5GB 2BYMA 5B40D 2EMTA 3PSCA 3MNNC 3A1KA 3B6FD 1P3IA 2P8VA 5C6RA 3LZ1D 2CY4A 3WA9B 1UEFA 2I5FA 3HW2B 3AZNB 1B55A 1V88A 4EMOA 1MKEA 1GC7A 5JHHA 4HAXB 5B24A 4H9RB 1HQ3D 3ODOA 4F7GA 3LZ0D 3O62C 1H3OB 2YFVB 5DNNA 5B31G 4H9NA 3AN2B 3AZLD 1UNRA 1P3PD 1BH9A 3TVVA 5B1LA 1FHWA 3MGQA 5JRGC 1P3GC 3WTPB 1W2EA 3AFAC 3AZIA 1ZSQA 4HATB 3F0WA 1PMSA 4IOYX 1DDMA 5GT0D 1X1GA 2V76A 2D11A 1XR0B 2XQNM 5FUGB 3AZJC 3C1CD 5AVBB 5B32C 1M19D 1F66B 2PYOD 2DYQA 1ULYA 3REJC 3W98C 3PZDA 2LULA 2X18A 4WU9D 3X1SC 1N3HA 5LONB 5D3WA 4CAYB 1P3FB 4D6WA 5F99B 4Z5TC 1ID3D 1NTVA 2IO5B 2RUKB 2KGXB 2NZDD 2CV5C 3KUYC 4ZBJC 5AV9B 2DKQA 1KZ7A 3ZDTA 1ZC3B 5B24D 3X1VC 2QKMA 3G9WA 4OSNA 3REKA 3KRXA 4R8PA 2G5IC 3WA9A 4ZRJA 3AZNA 3UZTA 4J8VB 4MT7A 1Z2CB 5BNVB 4H9RA 1PFJA 1DBHA 1UPRA 1H3OA 3P5JB 2FJ7B 3A6NB 4WNNB 2YFVA 4GNKB 4NE3A 2Y2OA 3AN2A 2M38A 3AZFC 3EPJA 3WTPA 5AVCD 5FI0A 4EO5C 5E5AC 5B2IC 5DNMB 3WAAC 2G35A 5CPKB 3ODWA 1MAIA 1M18B 5AY8A 5GT3D 5FUGA 3KWQC 4ZUXD 1F66A 1DDVA 1PZRA 3FM8C 4HB2B 4F7UP 1P3FA 3LJAC 5F99A 2J0JA 3RELC 1AOID 2PZ1A 2GCLA 3AZMB 1V61A 1P3KB 3MVDC 1ZM0A 5BNXB 4NE5A 4J8UD 2YT2A 3REKD 4R8PD 5AV9A 4A6FB 1QQGA 1P3MC 2DHKA 4WVFB 5LG4B 4KUDB 1M7EA 1ZVRA 1KX3B 5AV5A 3UT9B 2FJUB 4KGCC 3AZGC 1ZLAC 5HE0A 1KX5C 4J8VA 3ML4A 3X1TB 5BNVA 3AN2D 1X86A 3D8EA 5C16A 2BCJA 4KHOA 3FSSA 4Z2MH 2FJ7A 3LJUX 4WNNA 3OANA 4QJ5B 2JP2A 3W96D 1J0WA 2HIOB 5CPJB 3TU4C 4YM6C 4L1RA 3MGRC 3AYWC 3CIKA 3UTBB 3UTAC 1U35D 5GSUC 5AY8D 5DNMA 5AV8C 2BG1A 1FHXA 1Y5OA 2L1CA 2EJ8A 3LELB 5CPKA 2Z0PA 1LB1A 1W1DA 3W97C 1FB8A 3LZ1B 1BTKA 4G91C 1Z87A 1U5FA 1KU5A 4WU8C 3HK0A 3V5WA 2ZY2A 1SHCA 4XWXA 1HQ3B 3LZ0B 1UPQA 4NSWA 3AZKD 1U29A 3HIEA 1EVHA 2W2XC 3AZMA 1ZC4B 5AV9D 2P0HA 1U5EA 3MGSB 3VH5T 1TZYC 4DXAB 5D3YA 5BNXA 2YFWA 2COAA 2EMSA 5BS7A 3AZHD 3GYOA 1I2HA 3B0DB 4Z66C 5AV5D 4A6FA 2NQBC 2D9VA 1A7WA 2I5CA 4J8VD 2Z14A 4J8XC 5CP6C 4B6HA 1KX3A 3AV1B 3UT9A 2DKPA 4LD9D 2FJ7D 2RSGA 2K2JA 3X1TA 1P34C 3C1CB 2PYOB 2F8NH 2XD1A 4YS3D 5CPIB 3F6TA 3X1UB 3U12A 1ID3B 2HIOA 5CPJA 2Y2HA 2LYDA 2DFKA 2J59M 3AV2C 1HTAA 5JHGA 3UTBA 2NZDB 1W1HA 5B33C 3LELA 3EPKA 2RVQC 1WG7A 3MGPB 1P3OC 2KUQA 2YSZA 3LZ1A 4DX90 3N7CA 1X05A 3QBVB 2XD5A 1BH8B 1WWSA 2Y2GA 3H0LC 2IYBA 4H8SA 1FOEA 1H10A 4TKNA 3LZ0A 2N0YA 3NSUA 3H0MC 3KXBC 3MGSA 5J3TA 3W99D 5HE3A 3WKJB 1KX3D 5AVCB 2CY5A 2ROVA 2YT1A 3B0CT 3VH5A 3AV1A 5GXQD 2E2XA 1P3BC 3NW8A 5B40C 2H7EA 2K49A 2F8NG 5B31B 5GT3B 3O62A 2Y2IA 3C1BD 3C1CA 3B6FC 4ZUXB 2PYOA 3VH5W 4XZQD 2KCJA 5D3VA 4QLCD 1XKEA 2HUEC 5EFXA 5CPIA 3X1UA 3UTBD 2ZY5A 1P3GA 1ID3A 1AOIB 5KQ1A 4GMXB 2Y8GA 1HQ3C 3HQCA 3LELD 5CLLB 5C3IC 2DN6A 2AROC 4HB3B 4E44A 4J8UB 4XUJC 2NZDA 3REKB 2Z4DA 3AZLC 4R8PB 5DHFB 3AU4A 1P3PC 3AZED 1S32D 1M1AC 2VSZA 4X23C 1EF1A 3AZJA 5BT1C 3MGPA 5B0ZD 2ELBA 5B32A 2RVBB 2I1KA 3X1SA 4NY0A 1P3LB 1BH8A 3ULCA 4MY6A 3MGSD 5GT0C 4GXBA 2R09A 2QKLA 3MNND 5CLQB 4KHBB 5J3YA 1M19C 5C5BB 3W96B 4J8WB 4WU9C 2DQNC 3WKJA 3AV1D 5AVCA 5KQ4A 1U35B 5AY8B 3BINA 3O62D 3FEHA 1P3IC 3SYXA 1XD4A 1XX0A 5B31A 4M6BA 5CPID 3X1UD 5G49B 5GT3A 5JRGD 1P3GD 4H9OA 4ZUXA 1MPHA 5B24C 4K17A 3AFAD 2M14A 3AZKB 3B6GB 5DNNC 1AOIA 4HSIA 4MK0A 4HGAB 2EC1A 2AL6A 5B1LC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2UZS A;  3REH B;  4CSR B;  3B0C W;  3MGQ C;  3A6N D;  2F8N D;  2CWE A;  3AZJ D;  1KX3 B;  1K5D B;  5AV5 A;  3UT9 B;  3MGP D;  4EO5 B;  5E5A B;  2DX1 A;  5B32 D;  2K2U A;  3LZ0 C;  3AFA A;  3AZH B;  5B2I B;  4J8U A;  3AZG C;  4JJN B;  1ZLA C;  4KGC C;  1RJ2 A;  1JFI A;  3REJ D;  1KX5 C;  4K2P A;  1P3A C;  5HE0 A;  1M19 B;  5B0Y C;  2NQB D;  3W98 D;  5AV5 B;  4GN1 A;  4J8V A;  3ML4 A;  3X1T B;  3WAA B;  4GMV A;  5BNV A;  3AN2 D;  3X1S D;  1X86 A;  3D8E A;  3AZI C;  4J8X D;  1I7A A;  3WTP E;  5C16 A;  4WU9 B;  2BCJ A;  4KHO A;  4H9S A;  1XCG A;  4H9P A;  1P3B D;  3MGS C;  3FSS A;  3PVL A;  4Z2M H;  4HDQ A;  3KWQ A;  1TAF B;  4Z5T D;  4CHM A;  4CHJ A;  1TQZ A;  1KI1 B;  2FJ7 A;  2F8N A;  2BYM B;  4WNN A;  3LJU X;  3OAN A;  4DBB A;  3SUZ A;  5DNM D;  3KWQ B;  3B0D C;  3KSY A;  4LD9 B;  1B67 A;  5CHL B;  3W96 D;  2JP2 A;  1J0W A;  1GG3 A;  2HIO B;  3NQU B;  3R45 B;  3REJ A;  5CPJ B;  5CPK D;  1P3L A;  1MK9 B;  3W98 A;  1V5P A;  3VOQ A;  5JP4 A;  3TU4 C;  4YM6 C;  2RLO A;  1P3I B;  2YT0 A;  3ODX A;  1F1E A;  5AV6 B;  1W1G A;  4BBK A;  3MGR C;  3D8F A;  1M18 D;  4EJN A;  2CV5 D;  3MPX A;  3KUY D;  1P3B A;  3AYW C;  3CIK A;  3LJA B;  5B40 A;  3REI B;  2Z0O A;  4Z5T A;  3W99 C;  3AU5 A;  3REL B;  3AV1 C;  3UTB B;  3UTA C;  1U35 D;  3WKJ D;  2KUP A;  2NZ8 B;  5GOW B;  3TFM A;  5J3Q A;  5GSU C;  1EQZ B;  3BJI A;  5AY8 D;  5B1M C;  5DNM A;  4YS3 B;  1UNP A;  1V5M A;  2BYK B;  2YS5 A;  3PVU A;  5AV8 C;  3X1V D;  3B6F A;  5C5B A;  3F5R A;  1FHX A;  3U8Z A;  1Y5O A;  3W96 A;  4J8W A;  2L1C A;  2EJ8 A;  3MVD B;  5B24 B;  3LEL B;  5CPK A;  1WWI A;  3C1C C;  2K00 A;  3IVF A;  2ARO D;  2Z0P A;  1LB1 A;  2PYO C;  1W1D A;  4XUJ D;  3V9R A;  4G92 B;  3W97 C;  1FB8 A;  2CV5 A;  1RRP B;  2D9X A;  3KUY A;  2CAY A;  3LZ1 B;  1BTK A;  4AWL B;  2OTX A;  3A8Q A;  1TJ6 A;  4WSF A;  1M1A D;  5DNN B;  5GT0 B;  5CPI C;  3AZM D;  5GXQ C;  1U35 A;  4G91 C;  4H9N B;  5B31 D;  1MIZ B;  3X1U C;  1P3M B;  1OQN A;  1EGX A;  3MDB C;  4X23 D;  1HQ3 A;  1Z87 A;  3TW1 A;  1ID3 C;  1P3K D;  4ZRK A;  1BH9 B;  5B2J C;  2N23 A;  5BT1 D;  5B33 D;  1KU5 A;  3X1V A;  4WU8 C;  1U5F A;  5B1L B;  3HK0 A;  3PP2 A;  3RCP A;  3V5W A;  4A5K A;  4GZU A;  3MGQ B;  1SHC A;  4XWX A;  1HQ3 B;  2RVQ D;  3C1B C;  2Q13 A;  3X23 A;  1UNQ A;  5B0Y A;  2MKR A;  2ARO A;  2COD A;  4XZQ C;  3LZ0 B;  4KGC B;  1KX4 C;  1UPQ A;  3AZG B;  1ZLA B;  3AZK D;  3NQJ A;  2ZPY A;  4NSW A;  4XUJ A;  4QLC C;  1KX5 B;  1P3A B;  1U29 A;  2H7D A;  3P7Z A;  5B0Y B;  3AZL A;  3WA9 C;  2NMB A;  1P3P A;  1EVH A;  1M7R A;  4CYE A;  5G49 A;  2Y8F A;  3PVW A;  2W2X C;  1M1A A;  2NZD C;  3AZM A;  4KUD D;  5AV9 D;  3AZI B;  3AZN C;  1IRS A;  1MK7 B;  1ZC4 B;  2J0M A;  2P0H A;  1U2B A;  1U5E A;  4X23 A;  3QIJ A;  3MGS B;  4ZRI A;  1WGU A;  3VH5 T;  1TZY C;  1V5U A;  3UT9 D;  1ISN A;  4HAZ B;  5D3Y A;  5BNX A;  4DXA B;  5E5A D;  2YFW A;  2COA A;  4HB0 B;  2EMS A;  5BS7 A;  3AZH D;  5B2I D;  2YS1 A;  3GYO A;  1I2H A;  5JA4 B;  3MGP C;  4WV4 B;  3B0D B;  1WJM A;  4Z66 C;  5AV5 D;  3X1T D;  3WAA D;  1NI2 A;  3AZK A;  2YFW B;  3A98 B;  4A6F A;  3B6G A;  2NQB C;  1Q9C A;  4HAV B;  2D9V A;  3TU4 B;  4YM6 B;  1PLS A;  3AN2 C;  1A7W A;  2I5C A;  3AZF A;  4J8V D;  3VH6 A;  4J8X C;  3MGR B;  2GJY A;  5GT0 A;  5CP6 C;  1DYN A;  3AZE C;  3AYW B;  3REH A;  1S32 C;  1OMW A;  2Z0Q A;  3W99 B;  1KX3 A;  4B6H A;  1MIX A;  4HAW B;  3KWQ D;  2OQB A;  3AV1 B;  3UT9 A;  3UTA B;  2DKP A;  3WTP C;  5E5A A;  3VIA A;  5B32 G;  4LD9 D;  5GSU B;  4KAX B;  3AZH A;  5B2I A;  3WYF B;  5B1M B;  4JJN A;  2FJ7 D;  2COF A;  2HIO D;  3VH6 W;  5B0Z C;  5CPJ D;  5AV8 B;  2RSG A;  1M19 A;  1WGQ A;  2K2J A;  5HE1 A;  4NFT A;  3X1T A;  3WAA A;  1P34 C;  1P3I D;  5L81 A;  4DRA A;  2L5A A;  3C1C B;  1R4V A;  1P3L D;  2R0D A;  2PYO B;  4WU9 A;  2GCJ A;  3P6A A;  3LJA D;  2JSS A;  5KDM B;  1TAF A;  2LKO A;  3W97 B;  1K5G B;  2P0F A;  4GPT B;  5DI9 B;  2BYM A;  2F8N H;  5B40 D;  4YS3 D;  5CPI B;  5GXQ B;  3WKJ C;  4G91 B;  1BWN A;  1FGY A;  1U5G A;  3X1U B;  3B0B A;  4LD9 A;  2EMT A;  3ZVR A;  1ID3 B;  3MVD D;  2DA0 A;  2HIO A;  3NQU A;  3R45 A;  5AVC C;  5CPJ A;  3PSC A;  4WU8 B;  3AJ4 A;  3MNN C;  5AVB C;  2LYD A;  3B6F D;  2DFK A;  1P3I A;  1F66 C;  5AV6 A;  3C1B B;  4J8W D;  2J59 M;  4A6K A;  3AV2 C;  1HTA A;  1TXD A;  4XZQ B;  5JHG A;  3DXD A;  1KX4 B;  2P8V A;  3LZ1 D;  3LJA A;  3REI A;  2CY4 A;  5C6R A;  4QLC B;  3REL A;  5DNN D;  3WA9 B;  3UTB A;  2COC A;  2YF0 A;  1P3M D;  2RNR B;  1P3F C;  1EQZ A;  1UEF A;  2I5F A;  4YS3 A;  5F99 C;  2NZD B;  3AZN B;  2BYK A;  5B31 C;  1B55 A;  1V88 A;  1W1H A;  3HW2 B;  3QWM A;  4A6H A;  1P6S A;  5B1L D;  4EMO A;  1MKE A;  1GC7 A;  5JHH A;  3TCA A;  4HAX B;  5GT3 C;  3MGQ D;  3MVD A;  5B24 A;  4H9R B;  1HQ3 D;  2IO5 C;  3LEL A;  5B33 C;  1TZY B;  3TO1 A;  5DH9 B;  2HTH B;  4ZUX C;  4P7I A;  3ODO A;  4F7G A;  2RVQ C;  1WG7 A;  3LZ0 D;  4KGC D;  3AZG D;  3O62 C;  2VKI A;  3PG7 A;  1H3O B;  3MGP B;  1FHO A;  2VRW B;  4Z66 B;  5B0Y D;  1P3O C;  2YSZ A;  2DHJ A;  3LZ1 A;  4YON A;  2YFV B;  3CXB B;  2ROZ B;  2NQB B;  3N7C A;  5DNN A;  4DX9 0;  1X05 A;  3AZI D;  4DX8 A;  4D0N B;  5B31 G;  4IAP A;  4H9N A;  1WVH A;  1P3M A;  3AN2 B;  3QBV B;  3AZL D;  4IFS A;  4H9Q A;  1UNR A;  1P3P D;  4DRB A;  5AV9 C;  4J8X B;  1BH9 A;  1BH8 B;  1WWS A;  2IYB A;  4H8S A;  3TVV A;  1AOI C;  5B1L A;  1FOE A;  2CRF A;  5CP6 B;  3AZE B;  1S32 B;  1FHW A;  1H10 A;  3MGQ A;  4H9Q B;  3GYP A;  5JRG C;  1P3G C;  4K81 A;  2MDX A;  2YRY A;  3WTP B;  4TKN A;  1P34 A;  1BTN A;  3LZ0 A;  4KGC A;  1SGH A;  3AZG A;  1ZLA A;  2DLW A;  4UUZ B;  2Y7B A;  5B0Z B;  1KX5 A;  1P3A A;  3TU4 D;  4E45 A;  1P34 B;  3AFA C;  4J8U C;  2N0Y A;  3MGR D;  3AZI A;  1ZSQ A;  3REK C;  3SNH A;  4HAT B;  3B6G D;  3NSU A;  3F0W A;  1WJ1 A;  1DDW A;  4R8P C;  4J8V C;  1BFM A;  4HHV A;  3KXB C;  3MGS A;  1N1J A;  3AYW D;  5J3T A;  3AZF D;  1PMS A;  4IOY X;  1DDM A;  3W99 D;  5JLJ B;  3ULB A;  3UTA D;  5D3X A;  4H9S C;  5GT0 D;  2L2I A;  5GSU D;  3D8D A;  1X1G A;  5HE2 A;  2V76 A;  1N1J B;  3REH D;  5HE3 A;  4Z2N A;  5JA4 A;  5AVB A;  1KX3 D;  3WKJ B;  2D11 A;  2FJ7 C;  1XR0 B;  2P0D A;  3A6N C;  2XQN M;  5FUG B;  3AZJ C;  5AVC B;  3AV2 A;  3KRW A;  1BAK A;  3C1C D;  4JJN D;  2CY5 A;  4HAU B;  3MNN B;  5AVB B;  2DYN A;  3TU4 A;  4YM6 A;  5B32 C;  1M19 D;  1F66 B;  2PYO D;  1X1F A;  1Y19 B;  2DYQ A;  1ULY A;  2MWN B;  3U7D A;  3REJ C;  3MGR A;  1P3L C;  3AV2 B;  2ROV A;  2F8N K;  3W97 D;  3W98 C;  2YVC A;  4HB4 B;  4CAY A;  3PZD A;  2LUL A;  2X18 A;  3AYW A;  4WU9 D;  2YT1 A;  3X1S C;  1N3H A;  3W99 A;  3B0C T;  5LON B;  3VH5 A;  4KHA B;  3AV1 A;  5GXQ D;  3UTA A;  5D3W A;  2E2X A;  4CAY B;  1P3F B;  5GSU A;  1P3B C;  3M1I B;  5B40 C;  1P5T A;  4HAY B;  5B1M A;  2H7E A;  5F99 B;  4Z5T C;  1ID3 D;  5B31 B;  2F8N G;  4Z2M G;  5AV8 A;  1NTV A;  4WU8 D;  3SO6 A;  1P3R A;  5GT3 B;  3O62 A;  5B33 B;  2IO5 B;  3C1B D;  5DNM C;  3C1C A;  3B6F C;  4ZUX B;  2PYO A;  3VH5 W;  4XZQ D;  2KCJ A;  3W96 C;  4J8W C;  3T06 A;  3O62 B;  5AV6 D;  2RUK B;  5CPK C;  5D3V A;  5KDM A;  4QLC D;  1XKE A;  3W97 A;  1QC6 A;  1P3O B;  2HUE C;  3WA9 D;  5BO0 B;  2KGX B;  5EFX A;  5C79 A;  4NE6 A;  3REI D;  2NZD D;  1M18 C;  5CPI A;  3AZN D;  5GXQ A;  2CV5 C;  2LOX A;  3REL D;  3X1U A;  2MFQ A;  3KUY C;  4EKU A;  3UTB D;  4ZBJ C;  1Q67 A;  1P3G A;  5AV9 B;  1ID3 A;  1EQZ D;  2DKQ A;  5B2J A;  4WU8 A;  1AOI B;  1AQC A;  1U35 C;  1B6W A;  1FAO A;  4GMX B;  5KQ1 A;  1KZ7 A;  2Y8G A;  5AY8 C;  1HQ3 C;  2D10 A;  3ZDT A;  3C1B A;  5JRG B;  1P3G B;  5DHA B;  1ZC3 B;  1AWE A;  3HQC A;  5B24 D;  5B2J B;  3X1V C;  3LEL D;  5CLL B;  4XZQ A;  4Z66 D;  2QKM A;  3G9W A;  1KX4 A;  2D2Q A;  4QLC A;  3REK A;  5C3I C;  3KRX A;  2DN6 A;  2ARO C;  3A8P A;  3SV1 A;  4R8P A;  3WA9 A;  4HB3 B;  3DXE A;  3KXB A;  4L6E A;  3AFA B;  4E44 A;  5DIF B;  4J8U B;  2D9Z A;  3KY9 A;  4ZRJ A;  4XUJ C;  1JFI B;  2NZD A;  3AZN A;  3REK B;  3UZT A;  3AZL C;  4R8P B;  4J8V B;  4MT7 A;  5CP6 D;  3AU4 A;  1P3P C;  3KXB B;  3AZE D;  5BNV B;  1S32 D;  1U27 A;  4H9R A;  1M1A C;  2J0K A;  3AZM C;  1TZY A;  1PFJ A;  3WTP D;  2VSZ A;  1DBH A;  4Y94 A;  4X23 C;  3A6N A;  4H9P B;  1EF1 A;  3AZJ A;  1KZG A;  1P3K C;  1UPR A;  1H3O A;  5BT1 C;  3MGP A;  5B0Z D;  2ELB A;  2UVM A;  5B32 A;  4Z66 A;  4PQ0 A;  1EAZ A;  2FJ7 B;  1P34 D;  2RGN B;  3A6N B;  4WNN B;  2YFV A;  5BS7 C;  3AZJ B;  2F8N B;  2D9W A;  2AEH A;  2RVB B;  4NE3 A;  1ZLA D;  2NQB A;  5DHF B;  2I1K A;  3PEG A;  1KX5 D;  1P3A D;  5B32 B;  5LOP B;  3AN2 A;  3X1S A;  1DRO A;  3AZK C;  4K2O A;  4NY0 A;  4J8X A;  3REJ B;  1P3L B;  1BH8 A;  3B6G C;  2M38 A;  3W98 B;  3ULC A;  5CP6 A;  3AZE A;  1S32 A;  4HGA C;  3X1S B;  3AZF C;  4MY6 A;  3MGS D;  4KUD C;  2LG1 A;  1E5W A;  3WTP A;  5GT0 C;  1FGZ A;  4GXB A;  1P3B B;  3REH C;  5B40 B;  2R09 A;  2QKL A;  4Z5T B;  4UUZ A;  1KX3 C;  5B0Z A;  5AVC D;  3UT9 C;  3MNN D;  5AVB D;  5FI0 A;  4EO5 C;  5E5A C;  5CLQ B;  2DHI A;  1F66 D;  4KHB B;  3AZH C;  5B2I C;  4HDO A;  5DNM B;  4JJN C;  3AV2 D;  3B6F B;  5J3Y A;  1M19 C;  5C5B B;  5AV5 C;  3W96 B;  4J8W B;  3WAA C;  3X1T C;  4YM6 D;  2G35 A;  1M18 A;  5CPK B;  1OY2 A;  3ODW A;  1MAI A;  2HUE B;  4C0A A;  4WU9 C;  1P3F D;  5F99 D;  1M18 B;  1H4R A;  3V9R B;  3WKJ A;  2CV5 B;  3KUY B;  2UZR A;  5AY8 A;  3AV1 D;  4ZBJ B;  5GT3 D;  5D27 A;  5FUG A;  5AVC A;  2ADZ A;  3KZ1 A;  3KWQ C;  5B1M D;  1NTY A;  5KQ4 A;  1U35 B;  3MNN A;  5AV8 D;  4LD9 C;  4ZUX D;  1F66 A;  4KVG B;  5AY8 B;  1GC6 A;  2YS3 A;  3BIN A;  4Z2M B;  3O62 D;  2HIO C;  1DDV A;  1XOD A;  5CPJ C;  3X1V B;  3FEH A;  1P3O D;  1P3I C;  2HE7 A;  3O96 A;  5AV6 C;  2DTC A;  2GS0 A;  1NU2 A;  5C3I B;  3FM8 C;  2ARO B;  4KHA A;  3SYX A;  4HB2 B;  4F7U P;  1X11 A;  1P3F A;  5KCV A;  3LJA C;  3REI C;  3NQJ B;  1XX0 A;  4WZS B;  4XUJ B;  5F99 A;  1XD4 A;  2J0J A;  5B31 A;  3REL C;  1WI1 A;  2FJL A;  1J19 A;  4M6B A;  3AZL B;  1TZY D;  3UTB C;  3VH6 T;  5CPI D;  1AOI D;  1U5D A;  1P3P B;  2GCL A;  3X1U D;  5G49 B;  5GT3 A;  1P3K A;  1EQZ C;  2W2W A;  5B33 A;  2ELA A;  3DXC A;  5JRG D;  4YS3 C;  4H9O A;  3AZM B;  1P3G D;  1M1A B;  1V61 A;  1V89 A;  2D9Y A;  5B2J D;  2DX5 A;  2I1J A;  1LW3 A;  4ZUX A;  4X23 B;  5FI1 A;  1MPH A;  1P3K B;  3MVD C;  5B24 C;  3LEL C;  2D4Q A;  4YL8 A;  4H9O B;  2PZ1 A;  1P3O A;  4K17 A;  1ZM0 A;  5BNX B;  4NE5 A;  5BO0 A;  3WA0 A;  4F7H A;  4PNK A;  3AFA D;  4J8U D;  1KX4 D;  2IFS A;  4G92 C;  3REK D;  4R8P D;  3LZ1 C;  2M14 A;  3KXB D;  3AZK B;  4AWL C;  5AV9 A;  4KUD A;  4A6F B;  3B6G B;  5DNN C;  1QQG A;  2W2X D;  1AOI A;  2LY8 A;  4TYZ A;  4WJ7 A;  1P3M C;  4CSR A;  4MK0 A;  2DHK A;  4HGA B;  3AZF B;  4WVF B;  2LOZ A;  5JRG A;  2EC1 A;  4KUD B;  2AL6 A;  1M7E A;  1ZVR A;  5B1L C; 
#chains in the Genus database with same CATH topology
 3REH B;  3B0C W;  3MGQ C;  2F8N D;  3AZJ D;  3MGP D;  2DX1 A;  5B32 D;  2K2U A;  3AZH B;  4J8U A;  4JJN B;  4K2P A;  3REJ D;  4GN1 A;  5B0Y C;  3W98 D;  5AV5 B;  3X1S D;  3AZI C;  4H9S A;  3PVL A;  4HDQ A;  3KWQ A;  4Z5T D;  4CHM A;  4CHJ A;  1TQZ A;  4DBB A;  3KSY A;  4LD9 B;  5CHL B;  3NQU B;  3R45 B;  1P3L A;  5JP4 A;  2RLO A;  5AV6 B;  4OT1 A;  2CV5 D;  2RIQ A;  3KUY D;  3REI B;  5GOW B;  3WKJ D;  3TFM A;  4KHB A;  1EQZ B;  3BJI A;  4YS3 B;  2YS5 A;  3PVU A;  1T3U A;  3X1V D;  5C5B A;  3W96 A;  4J8W A;  1WWI A;  4G92 B;  4AWL B;  3A8Q A;  1TJ6 A;  1U35 A;  5B31 D;  2RRF A;  3RCP A;  4GZU A;  2Y2K A;  5I2S A;  1P3A B;  3P7Z A;  3WA9 C;  4CYE A;  5G49 A;  2Y8F A;  3AZN C;  1WGU A;  4HAZ B;  5E5A D;  2ZY4 A;  5B2I D;  5JA4 B;  1WJM A;  3WAA D;  3AZK A;  2YFW B;  3B6G A;  1Q9C A;  4HAV B;  3AN2 C;  3B77 A;  3FVC A;  3REH A;  4QXA B;  3W99 B;  3KWQ D;  3WTP C;  3VIA A;  3AZH A;  3WYF B;  5B1M B;  4JJN A;  1WGQ A;  4DIX A;  5L81 A;  4DRA A;  1P3L D;  3LJA D;  4GPT B;  5DI9 B;  5GXQ B;  4LD9 A;  3ZVR A;  3MVD D;  3NQU A;  3R45 A;  5AVB C;  1F66 C;  5AV6 A;  3C1B B;  4J8W D;  4XZQ B;  1KX4 B;  3REI A;  4QLC B;  1P3M D;  2RNR B;  1P3F C;  1EQZ A;  4YS3 A;  5F99 C;  3QWM A;  4A6H A;  1P6S A;  2ZY3 A;  2IO5 C;  3TO1 A;  2HTH B;  4P7I A;  4KGC D;  3AZG D;  1FHO A;  2VRW B;  2DHJ A;  4YON A;  2Y2L A;  3CXB B;  4DX8 A;  4D0N B;  4IAP A;  1WVH A;  4H9Q A;  4DRB A;  5AV9 C;  2CRF A;  3AZE B;  1S32 B;  1P34 A;  1BTN A;  4UUZ B;  5B0Z B;  1P3A A;  3TU4 D;  4E45 A;  3MGR D;  3FDD A;  2GUM A;  3B6G D;  1WJ1 A;  4HHV A;  4J8V C;  1BFM A;  3AYW D;  1N1J A;  3ULB A;  3UTA D;  5D3X A;  2L2I A;  5GSU D;  3D8D A;  5HE2 A;  3REH D;  4Z2N A;  5JA4 A;  2FJ7 C;  3A6N C;  3KRW A;  3AV2 A;  4JJN D;  3MNN B;  2DYN A;  1X1F A;  1Y19 B;  3W97 D;  2YVC A;  5M4Y B;  3W99 A;  4DQY B;  3M1I B;  5B1M A;  4Z2M G;  4WU8 D;  5DNM C;  3O62 B;  5AV6 D;  5CPK C;  4WJ3 C;  1QC6 A;  5BO0 B;  5C79 A;  3REI D;  1M18 C;  5GXQ A;  2MFQ A;  4EKU A;  1Q67 A;  1EQZ D;  5B2J A;  1AQC A;  1FAO A;  1AWE A;  3C1B A;  5JRG B;  1P3G B;  4XZQ A;  4Z66 D;  1KX4 A;  2D2Q A;  4QLC A;  3A1I A;  3KXB A;  4L6E A;  3AFA B;  2D9Z A;  3KY9 A;  5CP6 D;  2J0K A;  3AZM C;  4Y94 A;  1P3K C;  2UVM A;  4PQ0 A;  2RGN B;  1P34 D;  2F8N B;  5BS7 C;  3AZJ B;  2D9W A;  2AEH A;  3PEG A;  1P3A D;  5B32 B;  5LOP B;  1DRO A;  4K2O A;  3REJ B;  3W98 B;  3AZE A;  1S32 A;  3X1S B;  4KUD C;  1FGZ A;  4Z5T B;  4UUZ A;  1KX3 C;  5B0Z A;  3UT9 C;  2DHI A;  3IP4 C;  3AV2 D;  3X1T C;  1OY2 A;  2JE5 A;  2CV5 B;  3KUY B;  3EPH A;  4ZBJ B;  2ADZ A;  1NTY A;  5B1M D;  3MNN A;  3EG5 B;  2HIO C;  1XOD A;  5CPJ C;  3X1V B;  3NWA A;  1P3O D;  1NU2 A;  1X11 A;  5KCV A;  3NQJ B;  2FJL A;  1J19 A;  3UTB C;  3DXC A;  2D9Y A;  5B2J D;  1LW3 A;  2D4Q A;  3LEL C;  4YL8 A;  4H9O B;  3WA0 A;  5BO0 A;  4F7H A;  4PNK A;  1KX4 D;  3H0R C;  3LZ1 C;  3KXB D;  4TYZ A;  4CSR A;  2F2A C;  3AZF B;  2LOZ A;  4UPK A;  5JRG A;  1K5D B;  2G5H C;  4EO5 B;  5E5A B;  3LZ0 C;  3AFA A;  5B2I B;  2Y2M A;  3WAA B;  4GMV A;  3OHM B;  3WTP E;  1P3B D;  3MGS C;  1TAF B;  1KI1 B;  1T77 A;  2F8N A;  3KWQ B;  3B0D C;  1GG3 A;  3REJ A;  3W98 A;  3ODX A;  1W1G A;  4BBK A;  3D8F A;  3MPX A;  3LJA B;  4Z5T A;  3AU5 A;  3REL B;  3AV1 C;  2KUP A;  1V5M A;  2BYK B;  3F5R A;  3U8Z A;  3MVD B;  3C1C C;  2K00 A;  2ARO D;  2PYO C;  4XUJ D;  1RRP B;  2CV5 A;  3KUY A;  2DF4 C;  2OTX A;  4WSF A;  1M1A D;  5CPI C;  3X1U C;  1P3M B;  1OQN A;  3MDB C;  4X23 D;  3TW1 A;  1ID3 C;  4ZRK A;  2N23 A;  5BT1 D;  3X1V A;  4A5K A;  2Q13 A;  3X23 A;  5B0Y A;  2MKR A;  2FFF B;  2COD A;  4KGC B;  3AZG B;  1ZLA B;  2ZPY A;  3NQJ A;  1KX5 B;  2H7D A;  2NMB A;  3PVW A;  3PP2 A;  2NZD C;  1MK7 B;  4ZRI A;  1V5U A;  3MGP C;  4WV4 B;  1NI2 A;  3A98 B;  1ZYI A;  3TU4 B;  4YM6 B;  1PLS A;  3AZF A;  3MGR B;  2GJY A;  1DYN A;  3AYW B;  2Z0Q A;  1MIX A;  2OQB A;  3UTA B;  5E5A A;  5GSU B;  5B2I A;  2COF A;  5AV8 B;  5HE1 A;  4NFT A;  3WAA A;  1P3I D;  2L5A A;  1R4V A;  2R0D A;  2R2Y A;  2Y2J A;  5KDM B;  1TAF A;  3W97 B;  2P0F A;  3WKJ C;  1BWN A;  4G91 B;  1FGY A;  1U5G A;  3B0B A;  2DA0 A;  5AVC C;  4WU8 B;  4A6K A;  1TXD A;  3DXD A;  3LJA A;  3REL A;  5DNN D;  4QJ4 B;  2COC A;  2YF0 A;  2BYK A;  5B31 C;  2Y2P A;  5B1L D;  3TCA A;  5GT3 C;  3MGQ D;  3MVD A;  1TZY B;  5DH9 B;  4ZUX C;  3PG7 A;  2VKI A;  4Z66 B;  5B0Y D;  2ROZ B;  2NQB B;  3AZI D;  1P3M A;  4IFS A;  4J8X B;  1AOI C;  5CP6 B;  4H9Q B;  3GYP A;  4K81 A;  2MDX A;  2YRY A;  5IRS A;  1SGH A;  4KGC A;  3AZG A;  1ZLA A;  2DLW A;  2Y7B A;  1KX5 A;  2J8P A;  1P34 B;  4J8U C;  3SNH A;  3REK C;  1DDW A;  4R8P C;  3AZF D;  5JLJ B;  4H9S C;  1N1J B;  5AVB A;  2P0D A;  1BAK A;  4HAU B;  3TU4 A;  4YM6 A;  2MWN B;  3U7D A;  3MGR A;  1P3L C;  3AV2 B;  4HB4 B;  2F8N K;  4CAY A;  3AYW A;  4KHA B;  3UTA A;  5GSU A;  2KR0 A;  1P5T A;  4HAY B;  5AV8 A;  3SO6 A;  1P3R A;  5B33 B;  3DCX A;  3T06 A;  3W96 C;  4J8W C;  3AL0 C;  5KDM A;  3W97 A;  1P3O B;  3WA9 D;  4NE6 A;  2Y2Q A;  3AZN D;  2LOX A;  3REL D;  4CSQ A;  4WU8 A;  1U35 C;  1B6W A;  5AY8 C;  2D10 A;  5DHA B;  5B2J B;  2W8S A;  3SV1 A;  3A8P A;  3DXE A;  5DIF B;  1JFI B;  3KXB B;  1U27 A;  1TZY A;  3WTP D;  3A6N A;  4H9P B;  1KZG A;  2VQR A;  4Z66 A;  1EAZ A;  3AJ4 A;  4Z2M B;  1ZLA D;  2NQB A;  1KX5 D;  3AZK C;  4J8X A;  3B6G C;  5CP6 A;  4HGA C;  2Y2N A;  2LG1 A;  1E5W A;  1P3B B;  3REH C;  5B40 B;  2UWX A;  5AVB D;  1F66 D;  3AZH C;  4HDO A;  4JJN C;  3B6F B;  5AV5 C;  4YM6 D;  1M18 A;  2HUE B;  4C0A A;  1P3F D;  5F99 D;  1H4R A;  3V9R B;  4GOU A;  2UZR A;  2K8E A;  5D27 A;  3KZ1 A;  5AV8 D;  4LD9 C;  4KVG B;  1GC6 A;  2YS3 A;  2HE7 A;  3O96 A;  5AV6 C;  2DTC A;  2GS0 A;  5C3I B;  2ARO B;  4KHA A;  3REI C;  4WZS B;  4XUJ B;  3A58 A;  1WI1 A;  3AZL B;  1U5D A;  3VH6 T;  2NBV A;  1P3P B;  2W2W A;  1P3K A;  1EQZ C;  5B33 A;  2ELA A;  1M1A B;  4YS3 C;  2I1J A;  1V89 A;  2DX5 A;  4X23 B;  5FI1 A;  1P3O A;  2IFS A;  4G92 C;  4AWL C;  4KUD A;  2Z13 A;  2W2X D;  2LY8 A;  4WJ7 A;  5GT0 B;  1TZY D;  2UZS A;  4CSR B;  3A6N D;  2CWE A;  1RJ2 A;  1JFI A;  1P3A C;  1M19 B;  2NQB D;  4J8X D;  1I7A A;  4WU9 B;  1XCG A;  4H9P A;  3EPL A;  2BYM B;  3SUZ A;  5DNM D;  1B67 A;  5CPK D;  1MK9 B;  1V5P A;  3VOQ A;  2YT0 A;  1P3I B;  1F1E A;  1M18 D;  4EJN A;  1P3B A;  5B40 A;  2KIG A;  2Z0O A;  3W99 C;  2NZ8 B;  5J3Q A;  2ZKM X;  5B1M C;  1UNP A;  3B6F A;  5B24 B;  3IVF A;  3V9R A;  2D9X A;  2CAY A;  5DNN B;  3AZM D;  5GXQ C;  4H9N B;  1MIZ B;  1EGX A;  1HQ3 A;  1P3K D;  1BH9 B;  5B2J C;  5B33 D;  5B1L B;  3NWF A;  3MGQ B;  3C1B C;  2RVQ D;  1UNQ A;  2ARO A;  4QJ3 B;  2KIE A;  4XZQ C;  1KX4 C;  4XUJ A;  4QLC C;  5B0Y B;  3AZL A;  3KFU G;  1P3P A;  1M7R A;  1M1A A;  4KUD D;  3AZI B;  1IRS A;  2J0M A;  1U2B A;  4X23 A;  3QIJ A;  2Z59 A;  3UT9 D;  1ISN A;  4HB0 B;  2YS1 A;  3X1T D;  2ZM5 A;  3VH6 A;  5I2M A;  5GT0 A;  3AZE C;  1S32 C;  1OMW A;  4HAW B;  5B32 G;  4KAX B;  2HIO D;  3VH6 W;  5B0Z C;  5CPJ D;  1M19 A;  2JCH A;  3NWD A;  4WU9 A;  2GCJ A;  3P6A A;  2JSS A;  2LKO A;  1K5G B;  2BYM A;  5B40 D;  2EMT A;  3PSC A;  3MNN C;  3A1K A;  3B6F D;  1P3I A;  2P8V A;  5C6R A;  3LZ1 D;  2CY4 A;  3WA9 B;  1UEF A;  2I5F A;  3HW2 B;  3AZN B;  1B55 A;  1V88 A;  4EMO A;  1MKE A;  1GC7 A;  5JHH A;  4HAX B;  5B24 A;  4H9R B;  1HQ3 D;  3ODO A;  4F7G A;  3LZ0 D;  3O62 C;  1H3O B;  2YFV B;  5DNN A;  5B31 G;  4H9N A;  3AN2 B;  3AZL D;  1UNR A;  1P3P D;  1BH9 A;  3TVV A;  5B1L A;  1FHW A;  3MGQ A;  5JRG C;  1P3G C;  3WTP B;  1W2E A;  3HSA A;  3AFA C;  3AZI A;  1ZSQ A;  4HAT B;  3F0W A;  1PMS A;  4IOY X;  1DDM A;  5GT0 D;  1X1G A;  2V76 A;  2D11 A;  1XR0 B;  2XQN M;  5FUG B;  3AZJ C;  3C1C D;  5AVB B;  5B32 C;  1M19 D;  1F66 B;  2PYO D;  2DYQ A;  1ULY A;  3REJ C;  3W98 C;  3PZD A;  2LUL A;  2X18 A;  4WU9 D;  3X1S C;  1N3H A;  5LON B;  5D3W A;  4CAY B;  1P3F B;  4D6W A;  5F99 B;  4Z5T C;  1ID3 D;  1NTV A;  2IO5 B;  2RUK B;  2KGX B;  2NZD D;  2CV5 C;  3KUY C;  4ZBJ C;  1MI1 A;  5AV9 B;  2DKQ A;  1KZ7 A;  3ZDT A;  1ZC3 B;  5B24 D;  3X1V C;  2QKM A;  3G9W A;  4OSN A;  3REK A;  3KRX A;  4R8P A;  2G5I C;  3WA9 A;  4ZRJ A;  3AZN A;  3UZT A;  4J8V B;  4MT7 A;  1Z2C B;  5BNV B;  4H9R A;  1PFJ A;  1DBH A;  1UPR A;  1H3O A;  3P5J B;  2FJ7 B;  3A6N B;  4WNN B;  4GNK B;  2YFV A;  4NE3 A;  2Y2O A;  3AN2 A;  2M38 A;  3AZF C;  3EPJ A;  3WTP A;  5AVC D;  5FI0 A;  4EO5 C;  5E5A C;  5B2I C;  5DNM B;  3WAA C;  2G35 A;  5CPK B;  3ODW A;  1MAI A;  1M18 B;  5AY8 A;  5GT3 D;  5FUG A;  3KWQ C;  4ZUX D;  1F66 A;  1DDV A;  1PZR A;  3FM8 C;  4HB2 B;  4F7U P;  1P3F A;  3LJA C;  5F99 A;  2J0J A;  3REL C;  1AOI D;  2PZ1 A;  2GCL A;  3AZM B;  1V61 A;  1P3K B;  3MVD C;  1ZM0 A;  5BNX B;  4NE5 A;  4J8U D;  2YT2 A;  3REK D;  4R8P D;  5AV9 A;  4A6F B;  1QQG A;  1P3M C;  2DHK A;  4WVF B;  5LG4 B;  4KUD B;  1M7E A;  1ZVR A;  1KX3 B;  5AV5 A;  3UT9 B;  2FJU B;  4KGC C;  3AZG C;  1ZLA C;  5HE0 A;  1KX5 C;  4J8V A;  3ML4 A;  3X1T B;  5BNV A;  3AN2 D;  1X86 A;  3D8E A;  5C16 A;  2BCJ A;  4KHO A;  3FSS A;  4Z2M H;  2FJ7 A;  3LJU X;  4WNN A;  3OAN A;  4QJ5 B;  2JP2 A;  3W96 D;  1J0W A;  2HIO B;  5CPJ B;  3TU4 C;  4YM6 C;  4L1R A;  3MGR C;  3AYW C;  3CIK A;  3UTB B;  3UTA C;  1U35 D;  5GSU C;  5AY8 D;  5DNM A;  5AV8 C;  2BG1 A;  1FHX A;  1Y5O A;  2L1C A;  2EJ8 A;  3LEL B;  5CPK A;  2Z0P A;  1LB1 A;  1W1D A;  3W97 C;  1FB8 A;  3LZ1 B;  1BTK A;  4G91 C;  1Z87 A;  1U5F A;  1KU5 A;  4WU8 C;  3HK0 A;  3V5W A;  2ZY2 A;  1SHC A;  4XWX A;  1HQ3 B;  3LZ0 B;  1UPQ A;  4NSW A;  3AZK D;  1U29 A;  3HIE A;  1EVH A;  2W2X C;  3AZM A;  1ZC4 B;  5AV9 D;  2P0H A;  1U5E A;  3MGS B;  3VH5 T;  1TZY C;  4DXA B;  5D3Y A;  5BNX A;  2YFW A;  2COA A;  2EMS A;  5BS7 A;  3AZH D;  3GYO A;  1I2H A;  3B0D B;  4Z66 C;  5AV5 D;  4A6F A;  2NQB C;  2D9V A;  1A7W A;  2I5C A;  4J8V D;  2Z14 A;  4J8X C;  5CP6 C;  4B6H A;  1KX3 A;  3AV1 B;  3UT9 A;  2DKP A;  4LD9 D;  2FJ7 D;  2RSG A;  2K2J A;  3X1T A;  1P34 C;  3C1C B;  2PYO B;  2F8N H;  2XD1 A;  4YS3 D;  5CPI B;  3F6T A;  3X1U B;  3U12 A;  1ID3 B;  2HIO A;  5CPJ A;  2Y2H A;  2LYD A;  2DFK A;  2J59 M;  3AV2 C;  1HTA A;  5JHG A;  3UTB A;  2NZD B;  1W1H A;  5B33 C;  3LEL A;  3EPK A;  2RVQ C;  1WG7 A;  3MGP B;  1P3O C;  2KUQ A;  2YSZ A;  3LZ1 A;  4DX9 0;  3N7C A;  1X05 A;  3QBV B;  2XD5 A;  1BH8 B;  1WWS A;  2Y2G A;  3H0L C;  2IYB A;  4H8S A;  1FOE A;  1H10 A;  4TKN A;  3LZ0 A;  2N0Y A;  3NSU A;  3H0M C;  3KXB C;  3MGS A;  5J3T A;  3W99 D;  5HE3 A;  3WKJ B;  1KX3 D;  5AVC B;  2CY5 A;  2ROV A;  2YT1 A;  3B0C T;  3VH5 A;  3AV1 A;  5GXQ D;  2E2X A;  1P3B C;  3NW8 A;  5B40 C;  2H7E A;  2K49 A;  2F8N G;  5B31 B;  5GT3 B;  3O62 A;  2Y2I A;  3C1B D;  3C1C A;  3B6F C;  4ZUX B;  2PYO A;  3VH5 W;  4XZQ D;  2KCJ A;  5D3V A;  4QLC D;  1XKE A;  2HUE C;  5EFX A;  5CPI A;  3X1U A;  3UTB D;  2ZY5 A;  1P3G A;  1ID3 A;  1AOI B;  5KQ1 A;  4GMX B;  2Y8G A;  1HQ3 C;  3HQC A;  3LEL D;  5CLL B;  5C3I C;  2DN6 A;  2ARO C;  4HB3 B;  4E44 A;  4J8U B;  4XUJ C;  2NZD A;  3REK B;  2Z4D A;  3AZL C;  4R8P B;  5DHF B;  3AU4 A;  1P3P C;  3AZE D;  1S32 D;  1M1A C;  2VSZ A;  4X23 C;  1EF1 A;  3AZJ A;  5BT1 C;  3MGP A;  5B0Z D;  2ELB A;  5B32 A;  2RVB B;  2I1K A;  3X1S A;  4NY0 A;  1P3L B;  1BH8 A;  3ULC A;  4MY6 A;  3MGS D;  5GT0 C;  4GXB A;  2R09 A;  2QKL A;  3MNN D;  5CLQ B;  4KHB B;  5J3Y A;  1M19 C;  5C5B B;  3W96 B;  4J8W B;  4WU9 C;  2DQN C;  3WKJ A;  3AV1 D;  5AVC A;  5KQ4 A;  1U35 B;  5AY8 B;  3BIN A;  3O62 D;  3FEH A;  1P3I C;  3SYX A;  1XD4 A;  1XX0 A;  5B31 A;  4M6B A;  5CPI D;  3X1U D;  5G49 B;  5GT3 A;  5JRG D;  1P3G D;  4H9O A;  4ZUX A;  1MPH A;  5B24 C;  4K17 A;  3AFA D;  2M14 A;  3AZK B;  3B6G B;  5DNN C;  1AOI A;  4HSI A;  4MK0 A;  4HGA B;  2EC1 A;  2AL6 A;  5B1L C; 
#chains in the Genus database with same CATH homology
 3REH B;  3B0C W;  3MGQ C;  2F8N D;  3AZJ D;  3MGP D;  2DX1 A;  5B32 D;  2K2U A;  3AZH B;  4J8U A;  4JJN B;  4K2P A;  3REJ D;  4GN1 A;  5B0Y C;  3W98 D;  5AV5 B;  3X1S D;  3AZI C;  4H9S A;  3PVL A;  4HDQ A;  3KWQ A;  4Z5T D;  4CHM A;  4CHJ A;  1TQZ A;  4DBB A;  3KSY A;  4LD9 B;  5CHL B;  3NQU B;  3R45 B;  1P3L A;  5JP4 A;  2RLO A;  5AV6 B;  4OT1 A;  2CV5 D;  2RIQ A;  3KUY D;  3REI B;  5GOW B;  3WKJ D;  3TFM A;  4KHB A;  1EQZ B;  3BJI A;  4YS3 B;  2YS5 A;  3PVU A;  1T3U A;  3X1V D;  5C5B A;  3W96 A;  4J8W A;  1WWI A;  4G92 B;  4AWL B;  3A8Q A;  1TJ6 A;  1U35 A;  5B31 D;  2RRF A;  3RCP A;  4GZU A;  2Y2K A;  5I2S A;  1P3A B;  3P7Z A;  3WA9 C;  4CYE A;  5G49 A;  2Y8F A;  3AZN C;  1WGU A;  4HAZ B;  5E5A D;  2ZY4 A;  5B2I D;  5JA4 B;  1WJM A;  3WAA D;  3AZK A;  2YFW B;  3B6G A;  1Q9C A;  4HAV B;  3AN2 C;  3FVC A;  3REH A;  4QXA B;  3W99 B;  3KWQ D;  3WTP C;  3VIA A;  3AZH A;  3WYF B;  5B1M B;  4JJN A;  1WGQ A;  4DIX A;  5L81 A;  4DRA A;  1P3L D;  3LJA D;  4GPT B;  5DI9 B;  5GXQ B;  4LD9 A;  3ZVR A;  3MVD D;  3NQU A;  3R45 A;  5AVB C;  1F66 C;  5AV6 A;  3C1B B;  4J8W D;  4XZQ B;  1KX4 B;  3REI A;  4QLC B;  1P3M D;  2RNR B;  1P3F C;  1EQZ A;  4YS3 A;  5F99 C;  3QWM A;  4A6H A;  1P6S A;  2ZY3 A;  2IO5 C;  3TO1 A;  2HTH B;  4P7I A;  4KGC D;  3AZG D;  1FHO A;  2VRW B;  2DHJ A;  4YON A;  2Y2L A;  3CXB B;  4DX8 A;  4D0N B;  4IAP A;  1WVH A;  4H9Q A;  4DRB A;  5AV9 C;  2CRF A;  3AZE B;  1S32 B;  1P34 A;  1BTN A;  4UUZ B;  5B0Z B;  1P3A A;  3TU4 D;  4E45 A;  3MGR D;  3FDD A;  2GUM A;  3B6G D;  1WJ1 A;  4HHV A;  4J8V C;  1BFM A;  3AYW D;  1N1J A;  3ULB A;  3UTA D;  5D3X A;  2L2I A;  5GSU D;  3D8D A;  5HE2 A;  3REH D;  4Z2N A;  5JA4 A;  2FJ7 C;  3A6N C;  3KRW A;  3AV2 A;  4JJN D;  3MNN B;  2DYN A;  1X1F A;  1Y19 B;  3W97 D;  2YVC A;  5M4Y B;  3W99 A;  4DQY B;  3M1I B;  5B1M A;  4Z2M G;  4WU8 D;  5DNM C;  3O62 B;  5AV6 D;  5CPK C;  4WJ3 C;  1QC6 A;  5BO0 B;  5C79 A;  3REI D;  1M18 C;  5GXQ A;  2MFQ A;  4EKU A;  1Q67 A;  1EQZ D;  5B2J A;  1AQC A;  1FAO A;  1AWE A;  3C1B A;  5JRG B;  1P3G B;  4XZQ A;  4Z66 D;  1KX4 A;  2D2Q A;  4QLC A;  3A1I A;  3KXB A;  4L6E A;  3AFA B;  2D9Z A;  3KY9 A;  5CP6 D;  2J0K A;  3AZM C;  4Y94 A;  1P3K C;  2UVM A;  4PQ0 A;  2RGN B;  1P34 D;  2F8N B;  5BS7 C;  3AZJ B;  2D9W A;  2AEH A;  3PEG A;  1P3A D;  5B32 B;  5LOP B;  1DRO A;  4K2O A;  3REJ B;  3W98 B;  3AZE A;  1S32 A;  3X1S B;  4KUD C;  1FGZ A;  4Z5T B;  4UUZ A;  1KX3 C;  5B0Z A;  3UT9 C;  2DHI A;  3IP4 C;  3AV2 D;  3X1T C;  1OY2 A;  2JE5 A;  2CV5 B;  3KUY B;  3EPH A;  4ZBJ B;  2ADZ A;  1NTY A;  5B1M D;  3MNN A;  3EG5 B;  2HIO C;  1XOD A;  5CPJ C;  3X1V B;  3NWA A;  1P3O D;  1NU2 A;  1X11 A;  5KCV A;  3NQJ B;  2FJL A;  1J19 A;  3UTB C;  3DXC A;  2D9Y A;  5B2J D;  1LW3 A;  2D4Q A;  3LEL C;  4YL8 A;  4H9O B;  3WA0 A;  5BO0 A;  4F7H A;  4PNK A;  1KX4 D;  3H0R C;  3LZ1 C;  3KXB D;  4TYZ A;  4CSR A;  2F2A C;  3AZF B;  2LOZ A;  4UPK A;  5JRG A;  1K5D B;  2G5H C;  4EO5 B;  5E5A B;  3LZ0 C;  3AFA A;  5B2I B;  2Y2M A;  3WAA B;  4GMV A;  3OHM B;  3WTP E;  1P3B D;  3MGS C;  1TAF B;  1KI1 B;  2F8N A;  3KWQ B;  3B0D C;  1GG3 A;  3REJ A;  3W98 A;  3ODX A;  1W1G A;  4BBK A;  3D8F A;  3MPX A;  3LJA B;  4Z5T A;  3AU5 A;  3REL B;  3AV1 C;  2KUP A;  1V5M A;  2BYK B;  3F5R A;  3U8Z A;  3MVD B;  3C1C C;  2K00 A;  2ARO D;  2PYO C;  4XUJ D;  1RRP B;  2CV5 A;  3KUY A;  2DF4 C;  2OTX A;  4WSF A;  1M1A D;  5CPI C;  3X1U C;  1P3M B;  1OQN A;  3MDB C;  4X23 D;  3TW1 A;  1ID3 C;  4ZRK A;  2N23 A;  5BT1 D;  3X1V A;  4A5K A;  2Q13 A;  3X23 A;  5B0Y A;  2MKR A;  2FFF B;  2COD A;  4KGC B;  3AZG B;  1ZLA B;  2ZPY A;  3NQJ A;  1KX5 B;  2H7D A;  2NMB A;  3PVW A;  3PP2 A;  2NZD C;  1MK7 B;  4ZRI A;  1V5U A;  3MGP C;  4WV4 B;  1NI2 A;  3A98 B;  1ZYI A;  3TU4 B;  4YM6 B;  1PLS A;  3AZF A;  3MGR B;  2GJY A;  1DYN A;  3AYW B;  2Z0Q A;  1MIX A;  2OQB A;  3UTA B;  5E5A A;  5GSU B;  5B2I A;  2COF A;  5AV8 B;  5HE1 A;  4NFT A;  3WAA A;  1P3I D;  2L5A A;  1R4V A;  2R0D A;  2R2Y A;  2Y2J A;  5KDM B;  1TAF A;  3W97 B;  2P0F A;  3WKJ C;  1BWN A;  4G91 B;  1FGY A;  1U5G A;  3B0B A;  2DA0 A;  5AVC C;  4WU8 B;  4A6K A;  1TXD A;  3DXD A;  3LJA A;  3REL A;  5DNN D;  4QJ4 B;  2COC A;  2YF0 A;  2BYK A;  5B31 C;  2Y2P A;  5B1L D;  3TCA A;  5GT3 C;  3MGQ D;  3MVD A;  1TZY B;  5DH9 B;  4ZUX C;  3PG7 A;  2VKI A;  4Z66 B;  5B0Y D;  2ROZ B;  2NQB B;  3AZI D;  1P3M A;  4IFS A;  4J8X B;  1AOI C;  5CP6 B;  4H9Q B;  3GYP A;  4K81 A;  2MDX A;  2YRY A;  5IRS A;  1SGH A;  4KGC A;  3AZG A;  1ZLA A;  2DLW A;  2Y7B A;  1KX5 A;  2J8P A;  1P34 B;  4J8U C;  3SNH A;  3REK C;  1DDW A;  4R8P C;  3AZF D;  5JLJ B;  4H9S C;  1N1J B;  5AVB A;  2P0D A;  1BAK A;  4HAU B;  3TU4 A;  4YM6 A;  2MWN B;  3U7D A;  3MGR A;  1P3L C;  3AV2 B;  4HB4 B;  2F8N K;  4CAY A;  3AYW A;  4KHA B;  3UTA A;  5GSU A;  2KR0 A;  1P5T A;  4HAY B;  5AV8 A;  3SO6 A;  1P3R A;  5B33 B;  3T06 A;  3W96 C;  4J8W C;  3AL0 C;  5KDM A;  3W97 A;  1P3O B;  3WA9 D;  4NE6 A;  2Y2Q A;  3AZN D;  2LOX A;  3REL D;  4CSQ A;  4WU8 A;  1U35 C;  1B6W A;  5AY8 C;  2D10 A;  5DHA B;  5B2J B;  2W8S A;  3SV1 A;  3A8P A;  3DXE A;  5DIF B;  1JFI B;  3KXB B;  1U27 A;  1TZY A;  3WTP D;  3A6N A;  4H9P B;  1KZG A;  2VQR A;  4Z66 A;  1EAZ A;  3AJ4 A;  4Z2M B;  1ZLA D;  2NQB A;  1KX5 D;  3AZK C;  4J8X A;  3B6G C;  5CP6 A;  4HGA C;  2Y2N A;  2LG1 A;  1E5W A;  1P3B B;  3REH C;  5B40 B;  2UWX A;  5AVB D;  1F66 D;  3AZH C;  4HDO A;  4JJN C;  3B6F B;  5AV5 C;  4YM6 D;  1M18 A;  2HUE B;  4C0A A;  1P3F D;  5F99 D;  1H4R A;  3V9R B;  4GOU A;  2UZR A;  2K8E A;  5D27 A;  3KZ1 A;  5AV8 D;  4LD9 C;  4KVG B;  1GC6 A;  2YS3 A;  2HE7 A;  3O96 A;  5AV6 C;  2DTC A;  2GS0 A;  5C3I B;  2ARO B;  4KHA A;  3REI C;  4WZS B;  4XUJ B;  3A58 A;  1WI1 A;  3AZL B;  1U5D A;  3VH6 T;  2NBV A;  1P3P B;  2W2W A;  1P3K A;  1EQZ C;  5B33 A;  2ELA A;  1M1A B;  4YS3 C;  2I1J A;  1V89 A;  2DX5 A;  4X23 B;  5FI1 A;  1P3O A;  2IFS A;  4G92 C;  4AWL C;  4KUD A;  2Z13 A;  2W2X D;  2LY8 A;  4WJ7 A;  5GT0 B;  1TZY D;  2UZS A;  4CSR B;  3A6N D;  2CWE A;  1RJ2 A;  1JFI A;  1P3A C;  1M19 B;  2NQB D;  4J8X D;  1I7A A;  4WU9 B;  1XCG A;  4H9P A;  3EPL A;  2BYM B;  3SUZ A;  5DNM D;  1B67 A;  5CPK D;  1MK9 B;  1V5P A;  3VOQ A;  2YT0 A;  1P3I B;  1F1E A;  1M18 D;  4EJN A;  1P3B A;  5B40 A;  2KIG A;  2Z0O A;  3W99 C;  2NZ8 B;  5J3Q A;  2ZKM X;  5B1M C;  1UNP A;  3B6F A;  5B24 B;  3IVF A;  3V9R A;  2D9X A;  2CAY A;  5DNN B;  3AZM D;  5GXQ C;  4H9N B;  1MIZ B;  1EGX A;  1HQ3 A;  1P3K D;  1BH9 B;  5B2J C;  5B33 D;  5B1L B;  3NWF A;  3MGQ B;  3C1B C;  2RVQ D;  1UNQ A;  2ARO A;  4QJ3 B;  2KIE A;  4XZQ C;  1KX4 C;  4XUJ A;  4QLC C;  5B0Y B;  3AZL A;  3KFU G;  1P3P A;  1M7R A;  1M1A A;  4KUD D;  3AZI B;  1IRS A;  2J0M A;  1U2B A;  4X23 A;  3QIJ A;  2Z59 A;  3UT9 D;  1ISN A;  4HB0 B;  2YS1 A;  3X1T D;  2ZM5 A;  3VH6 A;  5I2M A;  5GT0 A;  3AZE C;  1S32 C;  1OMW A;  4HAW B;  5B32 G;  4KAX B;  2HIO D;  3VH6 W;  5B0Z C;  5CPJ D;  1M19 A;  2JCH A;  3NWD A;  4WU9 A;  2GCJ A;  3P6A A;  2JSS A;  2LKO A;  1K5G B;  2BYM A;  5B40 D;  2EMT A;  3PSC A;  3MNN C;  3A1K A;  3B6F D;  1P3I A;  2P8V A;  5C6R A;  3LZ1 D;  2CY4 A;  3WA9 B;  1UEF A;  2I5F A;  3HW2 B;  3AZN B;  1B55 A;  1V88 A;  4EMO A;  1MKE A;  1GC7 A;  5JHH A;  4HAX B;  5B24 A;  4H9R B;  1HQ3 D;  3ODO A;  4F7G A;  3LZ0 D;  3O62 C;  1H3O B;  2YFV B;  5DNN A;  5B31 G;  4H9N A;  3AN2 B;  3AZL D;  1UNR A;  1P3P D;  1BH9 A;  3TVV A;  5B1L A;  1FHW A;  3MGQ A;  5JRG C;  1P3G C;  3WTP B;  1W2E A;  3AFA C;  3AZI A;  1ZSQ A;  4HAT B;  3F0W A;  1PMS A;  4IOY X;  1DDM A;  5GT0 D;  1X1G A;  2V76 A;  2D11 A;  1XR0 B;  2XQN M;  5FUG B;  3AZJ C;  3C1C D;  5AVB B;  5B32 C;  1M19 D;  1F66 B;  2PYO D;  2DYQ A;  1ULY A;  3REJ C;  3W98 C;  3PZD A;  2LUL A;  2X18 A;  4WU9 D;  3X1S C;  1N3H A;  5LON B;  5D3W A;  4CAY B;  1P3F B;  4D6W A;  5F99 B;  4Z5T C;  1ID3 D;  1NTV A;  2IO5 B;  2RUK B;  2KGX B;  2NZD D;  2CV5 C;  3KUY C;  4ZBJ C;  5AV9 B;  2DKQ A;  1KZ7 A;  3ZDT A;  1ZC3 B;  5B24 D;  3X1V C;  2QKM A;  3G9W A;  4OSN A;  3REK A;  3KRX A;  4R8P A;  2G5I C;  3WA9 A;  4ZRJ A;  3AZN A;  3UZT A;  4J8V B;  4MT7 A;  1Z2C B;  5BNV B;  4H9R A;  1PFJ A;  1DBH A;  1UPR A;  1H3O A;  3P5J B;  2FJ7 B;  3A6N B;  4WNN B;  2YFV A;  4GNK B;  4NE3 A;  2Y2O A;  3AN2 A;  2M38 A;  3AZF C;  3EPJ A;  3WTP A;  5AVC D;  5FI0 A;  4EO5 C;  5E5A C;  5B2I C;  5DNM B;  3WAA C;  2G35 A;  5CPK B;  3ODW A;  1MAI A;  1M18 B;  5AY8 A;  5GT3 D;  5FUG A;  3KWQ C;  4ZUX D;  1F66 A;  1DDV A;  1PZR A;  3FM8 C;  4HB2 B;  4F7U P;  1P3F A;  3LJA C;  5F99 A;  2J0J A;  3REL C;  1AOI D;  2PZ1 A;  2GCL A;  3AZM B;  1V61 A;  1P3K B;  3MVD C;  1ZM0 A;  5BNX B;  4NE5 A;  4J8U D;  2YT2 A;  3REK D;  4R8P D;  5AV9 A;  4A6F B;  1QQG A;  1P3M C;  2DHK A;  4WVF B;  5LG4 B;  4KUD B;  1M7E A;  1ZVR A;  1KX3 B;  5AV5 A;  3UT9 B;  2FJU B;  4KGC C;  3AZG C;  1ZLA C;  5HE0 A;  1KX5 C;  4J8V A;  3ML4 A;  3X1T B;  5BNV A;  3AN2 D;  1X86 A;  3D8E A;  5C16 A;  2BCJ A;  4KHO A;  3FSS A;  4Z2M H;  2FJ7 A;  3LJU X;  4WNN A;  3OAN A;  4QJ5 B;  2JP2 A;  3W96 D;  1J0W A;  2HIO B;  5CPJ B;  3TU4 C;  4YM6 C;  4L1R A;  3MGR C;  3AYW C;  3CIK A;  3UTB B;  3UTA C;  1U35 D;  5GSU C;  5AY8 D;  5DNM A;  5AV8 C;  2BG1 A;  1FHX A;  1Y5O A;  2L1C A;  2EJ8 A;  3LEL B;  5CPK A;  2Z0P A;  1LB1 A;  1W1D A;  3W97 C;  1FB8 A;  3LZ1 B;  1BTK A;  4G91 C;  1Z87 A;  1U5F A;  1KU5 A;  4WU8 C;  3HK0 A;  3V5W A;  2ZY2 A;  1SHC A;  4XWX A;  1HQ3 B;  3LZ0 B;  1UPQ A;  4NSW A;  3AZK D;  1U29 A;  3HIE A;  1EVH A;  2W2X C;  3AZM A;  1ZC4 B;  5AV9 D;  2P0H A;  1U5E A;  3MGS B;  3VH5 T;  1TZY C;  4DXA B;  5D3Y A;  5BNX A;  2YFW A;  2COA A;  2EMS A;  5BS7 A;  3AZH D;  3GYO A;  1I2H A;  3B0D B;  4Z66 C;  5AV5 D;  4A6F A;  2NQB C;  2D9V A;  1A7W A;  2I5C A;  4J8V D;  2Z14 A;  4J8X C;  5CP6 C;  4B6H A;  1KX3 A;  3AV1 B;  3UT9 A;  2DKP A;  4LD9 D;  2FJ7 D;  2RSG A;  2K2J A;  3X1T A;  1P34 C;  3C1C B;  2PYO B;  2F8N H;  2XD1 A;  4YS3 D;  5CPI B;  3F6T A;  3X1U B;  3U12 A;  1ID3 B;  2HIO A;  5CPJ A;  2Y2H A;  2LYD A;  2DFK A;  2J59 M;  3AV2 C;  1HTA A;  5JHG A;  3UTB A;  2NZD B;  1W1H A;  5B33 C;  3LEL A;  3EPK A;  2RVQ C;  1WG7 A;  3MGP B;  1P3O C;  2KUQ A;  2YSZ A;  3LZ1 A;  4DX9 0;  3N7C A;  1X05 A;  3QBV B;  2XD5 A;  1BH8 B;  1WWS A;  2Y2G A;  3H0L C;  2IYB A;  4H8S A;  1FOE A;  1H10 A;  4TKN A;  3LZ0 A;  2N0Y A;  3NSU A;  3H0M C;  3KXB C;  3MGS A;  5J3T A;  3W99 D;  5HE3 A;  3WKJ B;  1KX3 D;  5AVC B;  2CY5 A;  2ROV A;  2YT1 A;  3B0C T;  3VH5 A;  3AV1 A;  5GXQ D;  2E2X A;  1P3B C;  3NW8 A;  5B40 C;  2H7E A;  2K49 A;  2F8N G;  5B31 B;  5GT3 B;  3O62 A;  2Y2I A;  3C1B D;  3C1C A;  3B6F C;  4ZUX B;  2PYO A;  3VH5 W;  4XZQ D;  2KCJ A;  5D3V A;  4QLC D;  1XKE A;  2HUE C;  5EFX A;  5CPI A;  3X1U A;  3UTB D;  2ZY5 A;  1P3G A;  1ID3 A;  1AOI B;  5KQ1 A;  4GMX B;  2Y8G A;  1HQ3 C;  3HQC A;  3LEL D;  5CLL B;  5C3I C;  2DN6 A;  2ARO C;  4HB3 B;  4E44 A;  4J8U B;  4XUJ C;  2NZD A;  3REK B;  2Z4D A;  3AZL C;  4R8P B;  5DHF B;  3AU4 A;  1P3P C;  3AZE D;  1S32 D;  1M1A C;  2VSZ A;  4X23 C;  1EF1 A;  3AZJ A;  5BT1 C;  3MGP A;  5B0Z D;  2ELB A;  5B32 A;  2RVB B;  2I1K A;  3X1S A;  4NY0 A;  1P3L B;  1BH8 A;  3ULC A;  4MY6 A;  3MGS D;  5GT0 C;  4GXB A;  2R09 A;  2QKL A;  3MNN D;  5CLQ B;  4KHB B;  5J3Y A;  1M19 C;  5C5B B;  3W96 B;  4J8W B;  4WU9 C;  2DQN C;  3WKJ A;  3AV1 D;  5AVC A;  5KQ4 A;  1U35 B;  5AY8 B;  3BIN A;  3O62 D;  3FEH A;  1P3I C;  3SYX A;  1XD4 A;  1XX0 A;  5B31 A;  4M6B A;  5CPI D;  3X1U D;  5G49 B;  5GT3 A;  5JRG D;  1P3G D;  4H9O A;  4ZUX A;  1MPH A;  5B24 C;  4K17 A;  3AFA D;  2M14 A;  3AZK B;  3B6G B;  5DNN C;  1AOI A;  4HSI A;  4MK0 A;  4HGA B;  2EC1 A;  2AL6 A;  5B1L C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...