4KHAA

Structural basis of histone h2a-h2b recognition by the essential chaperone fact
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
406
structure length
360
Chain Sequence
DVVEQDKLIEIRNRRPAVLDNVYIRPALEGKRVPGKVEIHQNGIRYQSPLSTTQRVDVLFSNIRHLFFQPCQNEMIVIIHLHLKDPILFGKKKTKDVQFYREAIQEERRRKAELDRLFKSFAEKIAEAGRNEGIEVDMPIRDLGFNGVPNRSNVVIYPTTECLIQITEPPFLVITLEDVEWAHLERVQFGLKNFDLVFVFKDFTRPVVHINTIPVESLEDVKEFLDSSDIPFSEGPLNLNWSVIMKTVTANPHQFFLDGGWGFLQNDSRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural basis of histone H2A-H2B recognition by the essential chaperone FACT.
pubmed doi rcsb
source organism Chaetomium thermophilum var. thermophilum
molecule tags Chaperone/nuclear protein
molecule keywords Spt16M-Histone H2B 1.1 chimera
total genus 99
structure length 360
sequence length 406
ec nomenclature
pdb deposition date 2013-04-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08512 Rtt106 Histone chaperone Rttp106-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 4khaA03
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 4khaA02
2.30.29.150 Mainly Beta Roll PH-domain like PH-domain like 4khaA01
4NFTA 2VSZA 5DNMB 5CP6A 4X23A 5AVCC 2UZSA 4KHBB 1B6WA 5AVCD 5BS7A 3QIJA 4J8WC 2CODA 2ELBA 3MGQD 1P34D 5KDMB 3D8FA 5AVBA 3R45A 5B0YD 5F99C 3OANA 4CYEA 4HGAC 1KX3D 4J8VC 3AZIA 1U5FA 1M7RA 2COAA 3T06A 2ROVA 3R45B 2IYBA 5CPIB 4KAXB 3X1SD 2HE7A 1QQGA 3C1BC 1F66B 5D3VA 1AOID 3ML4A 1P3MB 3B6FA 4HDOA 4WU8A 3PSCA 4A6FB 5DNND 5DNMA 1P3FD 3FEHA 3D8EA 3AV1B 1FHWA 4WV4B 5JA4B 2XQNM 3A8PA 3IVFA 5KQ4A 3A6NC 2FJLA 3AZHA 3F5RA 3P7ZA 3X23A 2IFSA 3B0DB 4QLCC 2H7DA 5FUGB 5B2JC 1EQZB 2CRFA 3NQJB 4WVFB 1P3BC 3WTPD 4YM6D 2LOXA 4NY0A 5F99A 3AZNC 1QC6A 1P3PD 1WG7A 2G35A 2K2UA 4IAPA 3MGPA 5BNVB 1P3PC 1M1AB 4YM6C 5AV8A 4ZUXA 3LZ0B 4KGCB 2UZRA 4XZQC 1TZYB 3LZ0D 5B31D 3AZMA 4KGCD 5B2JD 3B0CT 3C1CA 5AVCA 1P6SA 1WGUA 4CSRB 5B31G 4YS3C 3VH5A 3ZVRA 3A6ND 3DXEA 3AV1D 5DI9B 3V9RA 3KUYB 1KX5C 3VIAA 3A6NB 1SGHA 2D9ZA 1TAFB 5DNMC 2QKMA 4HAXB 1V61A 5JRGD 2DLWA 3TU4A 3C1BB 1GG3A 4EKUA 2RNRB 2LULA 3AZEB 4Z66B 2F8NB 2YRYA 4G92B 1E5WA 4YONA 1P3PB 1M1AC 3TFMA 3AV2A 3B6FC 5JLJB 3AZJA 2EMTA 1M19C 5B0YC 3VH6A 3AZKB 1FAOA 4NE5A 1P3PA 3VH6T 2DN6A 2HIOB 5B2JB 1EQZC 4CAYA 1ZLAB 1V5MA 1KX5D 2FJ7B 1UNRA 3MGRC 3KXBB 1KX5B 2FJ7D 4J8WD 1XX0A 3W98D 5B1MD 3AYWC 3MGRD 2NZ8B 3B6GA 1BFMA 5E5AB 4GMXB 1P3AB 3FM8C 1MPHA 5DNNA 1P3KB 1P3AD 1M19D 4P7IA 3MGSA 5JRGA 3W97C 4KUDA 3O62B 3C1CB 2DHIA 4XZQA 3DXCA 4K2PA 1P3BD 3C1CD 1HQ3A 4JJNA 1ID3D 1RRPB 3LZ0A 4KGCA 2PZ1A 2NQBB 1WVHA 4ZUXD 4XUJD 4HB3B 5FUGA 1EQZA 1X11A 1P3FC 3G9WA 3REKB 3SV1A 3TU4C 1TXDA 4XWXA 2FJ7A 3GYPA 4YS3D 5JA4A 2MFQA 3REID 1ID3C 3REIB 1M19B 3O62C 3W99C 3AZNB 1KI1B 3X1VB 3LJUX 1P3MA 3B6FB 4EO5C 3KRXA 5JHHA 4Z66C 5L81A 3MDBC 3AFAB 4G92C 5B32B 1KX4B 5GSUC 1H3OA 3AZEA 1P34C 3HK0A 5LOPB 4HB0B 3AZLB 2YFVB 5D3XA 2K00A 3AZLD 1F1EA 3TO1A 3KXBC 5AV6B 2P0HA 3AN2D 2NMBA 2RGNB 3AZGB 2M38A 1H3OB 1UEFA 2BYMB 3AFAA 1S32D 3SNHA 5DNNC 5B33C 1S32B 5B24D 3X1VA 2YSZA 1M19A 3UZTA 3AZHC 1BAKA 1W1HA 3UT9C 2CY4A 2UVMA 3TW1A 2D2QA 5B1LD 5AV8B 1M18A 1KU5A 5CP6C 4X23C 3MGRA 5CPKB 2LKOA 4MT7A 3REJB 5B32D 1KX4D 4J8VD 5GT3A 1AOIB 1P3FB 3W96B 2NZDC 1FHXA 2CAYA 1U35B 2JP2A 4J8VB 2QKLA 4YL8A 5DNMD 5AVBD 1P3FA 3BINA 4HAYB 5B0ZD 1U5EA 5CPJB 3WKJD 5CPKA 3FSSA 2AROD 4KUDC 4EMOA 3WA9D 2LYDA 4ZRJA 1W1GA 3O62A 1WI1A 1F66C 3A8QA 2P0FA 3MVDD 5GXQD 4GXBA 5C3IB 4HB4B 4WU8D 3WTPB 5CPIC 3X1VC 4J8XA 2D11A 2P8VA 3SYXA 5KCVA 2F8NK 1WWIA 2BYMA 4Z2MG 3AZGA 1H4RA 3AZFC 3LJAB 4HAUB 5AV6A 3N7CA 1M18C 3ODWA 5DHFB 5B31B 4HGAB 3KXBA 3REHA 3AZLA 1U35D 1P3LC 1BWNA 2RUKB 1KX3A 3KUYD 2DTCA 2GCJA 3WTPE 5B2JA 1X1GA 5HE2A 2BCJA 2W2XC 5B33A 5AV5C 4LD9C 5D3YA 4B6HA 2AL6A 2CY5A 4MY6A 2DKPA 3AZNA 4DRAA 3MNNC 3MGPD 1P3MC 4H9PB 4XUJA 5AV8C 2F8ND 1ZC3B 2M14A 4EO5B 3DXDA 5HE3A 4M6BA 5GSUA 3C1BD 3UT9B 1Z87A 3W99B 1PLSA 1U29A 4NE3A 1UNQA 5B40D 3HW2B 3KWQB 5DIFB 3REKA 4KVGB 3AZIC 1XR0B 3B0DC 4NSWA 5B0ZA 3AV2D 2Y8GA 3AZFA 1HQ3C 2GJYA 2YS3A 3LELA 4HAWB 4R8PD 2L2IA 3RELB 1U5DA 4WU9B 4HAVB 3W98A 5GT0C 3AZMB 2X18A 4G91B 3PZDA 4IOYX 4XZQB 4DBBA 2AEHA 4DX8A 5JRGB 3B0BA 3SUZA 5BNVA 1M1AA 3LELB 4Z2MH 5BNXB 1P3AA 4J8UA 4J8XD 1P3OB 2NZDA 3NQUA 3UTAD 4HDQA 5J3YA 3LZ1B 2MKRA 2Y7BA 2NQBD 3AU5A 4JJND 3AFAD 5B1MA 3UTBD 4WNNA 1XODA 5AY8B 3U7DA 3X1UC 3REHD 3REKC 2N0YA 2HIOD 1ZLAD 4A5KA 2DX5A 2F8NH 4XUJB 1MIXA 3VH6W 5AV5A 3RELC 4LD9A 5J3TA 3RELD 5GT0B 3AZMC 3CXBB 1P3LB 2V76A 3PG7A 3MGQA 5FI0A 5DHAB 4H9QB 4K81A 1P5TA 5B0YB 3X1UD 5E5AD 1KX3B 2DHJA 4Z5TD 3C1BA 3AFAC 1OMWA 3QWMA 3W97B 2NQBC 3AZIB 1NTVA 2KUPA 1J19A 4BBKA 3WAAD 1KZ7A 1BH8A 3LZ1C 5CPKD 5B2ID 3ZDTA 5CHLB 3UTBB 1B55A 3LELC 1BTNA 3VH5T 5AV5B 3REIA 3X1TC 4LD9B 1MK7B 1PFJA 4YS3A 2CV5D 4WU9C 3AZGD 4DRBA 2PYOC 3PP2A 5CLQB 2RLOA 5AY8C 1P3IC 1P3KC 1V89A 5CPKC 3KWQC 4J8UD 1U35A 1BTKA 2W2WA 5FI1A 3W96A 1P3OC 4J8UB 4D0NB 3TVVA 3A98B 5B40C 3WAAB 5J3QA 5B1LA 2ELAA 2IO5C 2F8NG 3MPXA 2J0JA 2Y8FA 1NU2A 1EGXA 2YS1A 1N1JB 2H7EA 3MGSC 2EJ8A 1MIZB 3REJD 3RELA 4KUDB 1ZC4B 4F7GA 4G91C 4E44A 2PYOD 5AV5D 4LD9D 5D27A 4Y94A 5AV6C 5DNNB 1MK9B 3ULBA 4DX90 5GT3D 2CV5B 5B0ZB 5E5AA 3REHC 1P3GC 2I5CA 4F7HA 1IRSA 5C16A 1BH8B 2DHKA 1LB1A 4YM6B 1X1FA 2YFVA 3AZED 3AZFD 4E45A 3LJAC 1TZYC 3UTAC 2RVQD 5GSUB 4GN1A 3AU4A 5B0YA 2RVQC 3KSYA 5B2IA 2D9VA 4H9QA 3LJAD 1TZYD 3AZJD 1UPQA 2L1CA 1F66D 5BT1C 2ROZB 3AZJB 5B33B 3AV2B 2I1JA 2LOZA 2ZPYA 2YVCA 1P3GD 4H9RA 3PVUA 1FHOA 4WNNB 5CPJC 3B6GC 5B31A 5B0ZC 5G49A 5B1MB 3AZMD 1KZGA 2E2XA 2BYKB 2AROB 1P3IA 3LZ1A 3MGSD 3WA9B 3REJC 2D9WA 3A6NA 3QBVB 3W96C 1P3OA 2NZDB 5GXQA 3MVDA 1OY2A 1AWEA 3WTPA 4J8XB 2YT1A 2YT0A 5C3IC 1FOEA 3ODXA 1JFIA 1GC7A 3X1TA 1P3BA 1LW3A 4JJNB 2LG1A 3HQCA 3AZKD 1DBHA 5AV9C 3KWQD 4J8UC 4WU9A 5AY8D 2DYQA 4GMVA 4ZUXB 1RJ2A 1TJ6A 2VKIA 1GC6A 5B33D 2RVBB 4HHVA 3AYWB 2PYOA 1WJMA 3B6GD 2N23A 2EC1A 3B6GB 4J8VA 3NQJA 2CV5C 3VOQA 1P3LD 1X86A 5KQ1A 4H9NB 2BYKA 3LELD 3KRWA 1ISNA 5G49B 1KX5A 3MGRB 3W99A 1M18B 2HTHB 1W1DA 2DA0A 5B2IC 1BH9B 5AV9D 4H9PA 3LZ1D 4WU8C 3AZKC 1TQZA 1ZVRA 2Q13A 4DXAB 3WAAC 2MDXA 3O62D 3TCAA 4ZRIA 2HUEB 4Z5TC 3WA9C 1BH9A 5E5AC 3MNNB 3AN2A 2GCLA 1P3GA 2RSGA 2YS5A 3MNND 3PEGA 4GPTB 3REHB 3TU4B 1P3RA 5AV6D 3U8ZA 5DH9B 5BO0A 4H9NA 4R8PB 4J8WB 4PNKA 3LJAA 2OTXA 1TAFA 4KHAB 1FB8A 3P6AA 3REKD 5B32C 3KUYA 1KX4C 1WJ1A 2YF0A 4ZUXC 5HE0A 5JHGA 3AYWA 5C6RA 1M18D 2D9XA 1EF1A 4A6HA 1P3OD 3AZJC 3X1UA 3AZHD 1NTYA 1P3KA 1K5GB 3PVWA 1P3BB 1V5PA 4J8XC 4K2OA 1P3ID 2K2JA 5CPJA 2J0KA 3WAAA 5F99B 1N3HA 3AZGC 2I5FA 1Q9CA 1UPRA 3X1SA 4K17A 4Z5TA 3WA9A 3ULCA 5GT3B 1AOIA 4R8PC 3V5WA 4GZUA 1P34B 2YFWA 2NQBA 2VRWB 1EQZD 2COFA 4H9RB 3X1UB 4YS3B 2IO5B 1XKEA 3O96A 3RCPA 4H9SA 1NI2A 4WU8B 1H10A 1S32A 1M1AD 1WWSA 3B0CW 5B2IB 1DDVA 2COCA 5AV8D 3W96D 1HTAA 2DX1A 3WKJA 4QLCB 4J8WA 5D3WA 3WYFB 2ADZA 3MGPC 1P3KD 1P3MD 4YM6A 1A7WA 5LONB 2L5AA 5CPJD 4H9OB 3WKJB 2EMSA 5AVBB 3MNNA 5B32A 5KDMA 3KUYC 2HIOA 3AN2B 1KX4A 1U35C 1ZLAA 3AZKA 3MGQB 2KGXB 5GT0A 3UTBC 1FGYA 4WSFA 5BT1D 5B31C 1M7EA 1FGZA 5CP6B 4X23B 4IFSA 3WA0A 5GSUD 1U2BA 1K5DB 4Z66A 5B40B 4C0AA 2YFWB 1P3AC 2LY8A 4ZBJB 5CPID 5B1LB 1Q67A 4KHOA 5GOWB 3AZEC 1P34A 5C79A 1B67A 4UUZB 1I2HA 5C5BB 4L6EA 4QLCD 5B1MC 3AYWD 2D4QA 4HB2B 3W98C 2AROC 2I1KA 4EJNA 4KUDD 2FJ7C 3WKJC 5AV9A 2PYOB 5BNXA 2JSSA 5GT3C 4AWLB 1AQCA 3KZ1A 3SO6A 1HQ3D 4CSRA 3KY9A 5JP4A 5HE1A 1HQ3B 1TZYA 4WJ7A 3M1IB 2NZDD 1ZSQA 4H9SC 3AJ4A 2HIOC 1ZLAC 3MGSB 2DKQA 4A6KA 3MGPB 5BS7C 1JFIB 2Z0QA 3ODOA 5CP6D 4X23D 5AV9B 3AZFB 2R09A 3UTAB 3UTBA 5GXQB 1ULYA 3MVDB 1I7AA 3X1SC 3C1CC 4ZBJC 3UT9D 4KHAA 2Z0PA 4TYZA 1ID3B 1DDWA 1MAIA 1SHCA 5BO0B 4R8PA 3KWQA 3W97A 5JRGC 5B24C 1DROA 2W2XD 2J59M 4Z2MB 5B40A 4F7UP 1P3GB 4HAZB 3MGQC 4CAYB 3AV1C 4WU9D 1DYNA 1V5UA 1EVHA 4H8SA 4A6FA 5GT0D 3AN2C 1V88A 2D10A 3AZLC 3KXBD 1P3LA 1EAZA 3X1TD 1MKEA 1OQNA 1Y19B 1PMSA 1F66A 2R0DA 4CHJA 4XZQD 2OQBA 3AV2C 4PQ0A 2D9YA 2F8NA 5CPIA 4H9OA 4MK0A 2Z0OA 5AY8A 3AZID 4Z66D 3AZND 1R4VA 3CIKA 3W99D 3B6FD 3BJIA 3F0WA 4QLCA 1ID3A 2DFKA 3NQUB 3REIC 5CLLB 3V9RB 1XCGA 2CV5A 3UTAA 3TU4D 4HATB 1U27A 2P0DA 4NE6A 5AVCB 4AWLC 4WZSB 1U5GA 4CHMA 5AVBC 1XD4A 3GYOA 1N1JA 3W98B 2DYNA 3X1TB 1ZM0A 4XUJC 2HUEC 1AOIC 1J0WA 5B24B 2GS0A 3NSUA 1Y5OA 4JJNC 5B1LC 4ZRKA 3D8DA 3LZ0C 4KGCC 4Z5TB 1X05A 4UUZA 2MWNB 5C5BA 3X1SB 2KCJA 4Z2NA 3W97D 2AROA 1P3IB 1WGQA 2CWEA 3REJA 1KX3C 4TKNA 5B24A 3X1VD 3AZHB 5F99D 1DDMA 5GXQC 3MVDC 5B32G 3UT9A 3WTPC 1UNPA 2J0MA 1S32C 3PVLA 5EFXA 3VH5W 3AV1A
chains in the Genus database with same CATH superfamily
4NFTA 2VSZA 5DNMB 5CP6A 4X23A 5AVCC 2UZSA 4KHBB 1B6WA 5AVCD 2G5IC 5BS7A 4J8WC 3QIJA 2CODA 2ELBA 3MGQD 1P34D 5KDMB 3D8FA 5AVBA 3R45A 5B0YD 5F99C 3OANA 4CYEA 4HGAC 1KX3D 4J8VC 3AZIA 1U5FA 1M7RA 2COAA 3T06A 2JE5A 2ROVA 3R45B 2IYBA 5CPIB 4KAXB 3X1SD 2HE7A 1QQGA 3C1BC 3FVCA 4GNKB 1F66B 5D3VA 1AOID 3ML4A 4A6KA 1P3MB 3B6FA 4HDOA 4WU8A 2Z14A 3PSCA 4A6FB 5DNND 5DNMA 1P3FD 3FEHA 3D8EA 3AV1B 1FHWA 4WV4B 5JA4B 2XQNM 2ZKMX 2DQNC 3A8PA 3IVFA 5KQ4A 3A6NC 2FJLA 3AZHA 3F5RA 3P7ZA 3X23A 2IFSA 3B0DB 4QLCC 2H7DA 5FUGB 5B2JC 2Y2NA 1EQZB 3NQJB 2CRFA 4WVFB 1P3BC 3WTPD 4YM6D 2LOXA 4NY0A 5F99A 3AZNC 1QC6A 1P3PD 1WG7A 2G35A 2K2UA 4IAPA 3MGPA 5BNVB 1P3PC 1M1AB 4YM6C 5AV8A 4ZUXA 5I2MA 3LZ0B 4KGCB 2UZRA 4XZQC 4QJ4B 1TZYB 3LZ0D 5B31D 3AZMA 4KGCD 5B2JD 3B0CT 3C1CA 5AVCA 1P6SA 1WGUA 4CSRB 5B31G 4YS3C 3VH5A 3ZVRA 1T3UA 3A6ND 2GUMA 3AV1D 3DXEA 5DI9B 3V9RA 3KUYB 1KX5C 3VIAA 3A6NB 1SGHA 2D9ZA 1TAFB 5DNMC 2QKMA 4HAXB 1V61A 5JRGD 2DLWA 3TU4A 3C1BB 1GG3A 4EKUA 2RNRB 2LULA 3AZEB 4Z66B 3EPKA 2F8NB 2YRYA 4G92B 1E5WA 4YONA 1P3PB 1M1AC 3TFMA 3AV2A 3B6FC 5JLJB 3AZJA 2EMTA 2ZM5A 1M19C 5B0YC 3VH6A 3AZKB 2Y2MA 4NE5A 1P3PA 3VH6T 1FAOA 2HIOB 5B2JB 1EQZC 4CAYA 1ZLAB 3AL0C 1V5MA 2DN6A 1KX5D 2FJ7B 1UNRA 3MGRC 2Y2HA 3KXBB 1KX5B 2FJ7D 1PZRA 4J8WD 1XX0A 3W98D 5B1MD 3AYWC 3H0LC 3MGRD 2NZ8B 3B6GA 3KFUG 1BFMA 5E5AB 4GMXB 1P3AB 3FM8C 1MPHA 5DNNA 1P3KB 1P3AD 1M19D 4P7IA 3MGSA 5JRGA 3W97C 4KUDA 3O62B 3C1CB 2DHIA 4XZQA 3DXCA 4K2PA 1P3BD 2Y2IA 2K49A 3C1CD 1HQ3A 4JJNA 1ID3D 1RRPB 3LZ0A 4KGCA 2PZ1A 2NQBB 1WVHA 4ZUXD 4XUJD 2Y2PA 2ZY3A 4HB3B 5FUGA 1EQZA 1X11A 1P3FC 3G9WA 1Z2CB 3REKB 3SV1A 3TU4C 1TXDA 4XWXA 2FJ7A 3GYPA 4YS3D 5JA4A 2MFQA 2RRFA 3REID 1ID3C 3REIB 1M19B 3O62C 3W99C 3AZNB 1KI1B 3X1VB 3HSAA 3LJUX 1P3MA 3B6FB 4EO5C 3KRXA 5JHHA 4Z66C 5L81A 3MDBC 3AFAB 4G92C 5B32B 1KX4B 5GSUC 1H3OA 3AZEA 1P34C 3HK0A 5LOPB 4HB0B 3AZLB 2YFVB 5D3XA 2K00A 3AZLD 1F1EA 3H0RC 3TO1A 3KXBC 5AV6B 2P0HA 3AN2D 2NMBA 2RGNB 3AZGB 2M38A 1H3OB 1UEFA 2BYMB 2W8SA 3AFAA 1S32D 3SNHA 5DNNC 5B33C 1S32B 5B24D 3X1VA 2YSZA 1M19A 4OT1A 3AZHC 3UZTA 1BAKA 1W1HA 3UT9C 2CY4A 2UVMA 3TW1A 2Y2LA 2D2QA 5B1LD 5AV8B 1M18A 1KU5A 5CP6C 4X23C 3MGRA 5CPKB 2LKOA 4MT7A 3REJB 5B32D 1KX4D 4J8VD 5GT3A 1AOIB 1P3FB 3W96B 2NZDC 1FHXA 2CAYA 1U35B 2JP2A 4J8VB 2QKLA 3NW8A 4YL8A 5DNMD 5AVBD 1P3FA 3BINA 4HAYB 5B0ZD 1U5EA 5CPJB 3WKJD 5CPKA 3FSSA 2AROD 4KUDC 4EMOA 3WA9D 2LYDA 3A58A 4ZRJA 1W1GA 3O62A 1WI1A 1F66C 3A8QA 2P0FA 5GXQD 3MVDD 4GXBA 5C3IB 4HB4B 4WU8D 3WTPB 5CPIC 3X1VC 4J8XA 2D11A 2P8VA 2Y2QA 3SYXA 2F8NK 1WWIA 2BYMA 4Z2MG 5KCVA 3AZGA 1H4RA 3AZFC 3LJAB 4HAUB 5AV6A 3N7CA 3B77A 2ZY4A 1M18C 3ODWA 5DHFB 5B31B 4HGAB 3KXBA 3REHA 3AZLA 1U35D 1P3LC 1BWNA 1ZYIA 1KX3A 2RUKB 3KUYD 2J0MA 2DTCA 2GCJA 5B2JA 3WTPE 1X1GA 5HE2A 2BCJA 2W2XC 5B33A 4UPKA 5AV5C 4LD9C 5D3YA 2AL6A 2CY5A 1MI1A 3H0MC 2DKPA 3AZNA 4MY6A 4DRAA 3MNNC 3MGPD 1P3MC 4H9PB 4XUJA 5AV8C 2F8ND 1ZC3B 2M14A 4EO5B 3DXDA 4L1RA 4M6BA 5GSUA 5HE3A 3C1BD 3UT9B 1Z87A 3W99B 1PLSA 1U29A 4NE3A 1UNQA 5B40D 3HW2B 3KWQB 5DIFB 3REKA 4KVGB 3AZIC 1XR0B 3B0DC 4NSWA 5B0ZA 3AV2D 2Y8GA 3AZFA 1HQ3C 2Y2KA 2GJYA 1T77A 2YS3A 3LELA 4HAWB 4R8PD 2L2IA 2YT2A 3RELB 1U5DA 4WU9B 4HAVB 3W98A 5GT0C 3AZMB 2X18A 4G91B 3PZDA 4IOYX 4XZQB 4DBBA 1W2EA 2AEHA 4DX8A 5JRGB 3B0BA 3SUZA 5BNVA 1M1AA 3LELB 4Z2MH 5I2SA 5BNXB 1P3AA 4J8UA 4J8XD 1P3OB 2NZDA 3NQUA 3UTAD 4HDQA 5J3YA 3LZ1B 2MKRA 2Y7BA 2NQBD 3AU5A 2F2AC 4JJND 3AFAD 5B1MA 3UTBD 3FDDA 4WNNA 1XODA 5AY8B 3U7DA 3X1UC 3REHD 3REKC 2N0YA 2HIOD 1ZLAD 4A5KA 4HSIA 2Y2GA 2DX5A 2F8NH 4XUJB 1MIXA 3VH6W 3DCXA 2XD1A 5AV5A 3RELC 4LD9A 5J3TA 3RELD 5GT0B 3AZMC 3CXBB 1P3LB 2V76A 3PG7A 3MGQA 5FI0A 5DHAB 4H9QB 4K81A 1P5TA 1AWEA 5B0YB 3X1UD 5E5AD 1KX3B 2DHJA 4Z5TD 3C1BA 3AFAC 1OMWA 3QWMA 3W97B 2NQBC 3AZIB 1NTVA 2KUPA 1J19A 4BBKA 3WAAD 1KZ7A 1BH8A 3LZ1C 5CPKD 5B2ID 3ZDTA 5CHLB 3UTBB 2Z4DA 1B55A 3LELC 1BTNA 4KHBA 3VH5T 5AV5B 3REIA 3X1TC 4LD9B 1MK7B 1PFJA 4YS3A 2CV5D 4QXAB 4WU9C 3EPLA 3AZGD 4DRBA 2PYOC 3PP2A 5CLQB 2RLOA 5AY8C 1P3IC 1P3KC 3EG5B 1V89A 5CPKC 3KWQC 4J8UD 1U35A 1BTKA 2W2WA 3U12A 5FI1A 3W96A 1P3OC 4J8UB 4D0NB 3TVVA 3A98B 5B40C 3WAAB 5J3QA 5B1LA 2ELAA 2IO5C 2F8NG 2ZY2A 2J0JA 2Y8FA 3MPXA 1NU2A 1EGXA 2YS1A 1N1JB 2H7EA 3MGSC 2EJ8A 1MIZB 3REJD 4B6HA 3RELA 4KUDB 1ZC4B 4F7GA 4G91C 4E44A 2PYOD 5AV5D 4LD9D 4QJ3B 4Y94A 5AV6C 5DNNB 1MK9B 5D27A 3ULBA 5GT3D 2BG1A 4DX90 2CV5B 5B0ZB 5E5AA 3REHC 1P3GC 2I5CA 4F7HA 1IRSA 5C16A 1BH8B 2DHKA 1LB1A 4YM6B 1X1FA 2YFVA 3AZED 3AZFD 4E45A 3LJAC 1TZYC 3UTAC 2RVQD 5GSUB 4GN1A 3AU4A 5B0YA 2RVQC 3KSYA 5B2IA 2D9VA 2KIGA 4H9QA 3LJAD 2KUQA 2Z13A 1TZYD 3AZJD 1UPQA 2L1CA 1F66D 5BT1C 2ROZB 3AZJB 5B33B 3AV2B 2I1JA 2K8EA 2LOZA 2YVCA 1P3GD 2ZPYA 4H9RA 3PVUA 4QJ5B 1FHOA 4WNNB 5CPJC 3B6GC 5B31A 5B0ZC 5G49A 5B1MB 3AZMD 1KZGA 2E2XA 2BYKB 2AROB 1P3IA 2J8PA 2UWXA 3LZ1A 3MGSD 3WA9B 3REJC 2D9WA 3A6NA 3QBVB 3W96C 2G5HC 1P3OA 2NZDB 5GXQA 3MVDA 3EPJA 1OY2A 3WTPA 4J8XB 2YT1A 2YT0A 5C3IC 1FOEA 2FJUB 1JFIA 3ODXA 1GC7A 3X1TA 1P3BA 1LW3A 3P5JB 4JJNB 2LG1A 3HQCA 3AZKD 4DIXA 1DBHA 5AV9C 3KWQD 4J8UC 4WU9A 5AY8D 2DYQA 4GMVA 4ZUXB 1RJ2A 1TJ6A 2VKIA 1GC6A 5B33D 2RVBB 4HHVA 3NWDA 3AYWB 2PYOA 1WJMA 3B6GD 3EPHA 2N23A 2EC1A 3B6GB 4J8VA 3NQJA 2CV5C 3VOQA 1P3LD 1X86A 5KQ1A 4H9NB 2BYKA 5M4YB 3LELD 3KRWA 2XD5A 5G49B 1KX5A 1ISNA 3MGRB 3W99A 1M18B 4DQYB 2HTHB 2JCHA 1W1DA 2DA0A 5LG4B 4WJ3C 5B2IC 1BH9B 5AV9D 4H9PA 3LZ1D 4WU8C 3AZKC 1TQZA 1ZVRA 2Q13A 4DXAB 3WAAC 2MDXA 3O62D 3TCAA 4ZRIA 2HUEB 4Z5TC 3WA9C 1BH9A 5E5AC 3MNNB 3AN2A 2GCLA 1P3GA 2RSGA 2YS5A 3MNND 3PEGA 4GPTB 3REHB 3TU4B 3OHMB 1P3RA 5AV6D 3U8ZA 5DH9B 5BO0A 2Y2OA 4H9NA 4R8PB 4J8WB 3LJAA 2OTXA 4PNKA 5IRSA 1TAFA 4KHAB 1FB8A 3P6AA 3REKD 5B32C 3KUYA 1KX4C 1WJ1A 2YF0A 4ZUXC 5HE0A 5JHGA 3AYWA 5C6RA 1M18D 4GOUA 2D9XA 1EF1A 4A6HA 1P3OD 3AZJC 3X1UA 3AZHD 1NTYA 1P3KA 1K5GB 2KR0A 3PVWA 1P3BB 1V5PA 4J8XC 4K2OA 1P3ID 2K2JA 5CPJA 2J0KA 3WAAA 5F99B 1N3HA 3AZGC 2I5FA 1Q9CA 1UPRA 3X1SA 4K17A 4Z5TA 3WA9A 3ULCA 5GT3B 1AOIA 4R8PC 3V5WA 4CSQA 4GZUA 1P34B 2YFWA 2NQBA 3F6TA 2VRWB 2Z59A 1EQZD 2COFA 2KIEA 4H9RB 3X1UB 4YS3B 2IO5B 1XKEA 2DF4C 3O96A 3RCPA 4H9SA 1NI2A 4WU8B 1H10A 3HIEA 4D6WA 1S32A 1M1AD 1WWSA 3B0CW 5B2IB 1DDVA 2COCA 5AV8D 3W96D 1HTAA 2DX1A 3WKJA 4QLCB 4J8WA 5D3WA 3WYFB 2ADZA 3MGPC 1P3KD 1P3MD 4YM6A 1A7WA 5LONB 2L5AA 5CPJD 4H9OB 3WKJB 2EMSA 5AVBB 3MNNA 5B32A 5KDMA 3KUYC 2HIOA 3AN2B 1KX4A 1U35C 1ZLAA 3AZKA 3MGQB 2KGXB 5GT0A 3UTBC 1FGYA 4WSFA 3NWAA 5BT1D 5B31C 1M7EA 1FGZA 5CP6B 4X23B 4IFSA 3WA0A 5GSUD 1U2BA 1K5DB 4Z66A 5B40B 4C0AA 2YFWB 1P3AC 2LY8A 4ZBJB 5CPID 5B1LB 1Q67A 4KHOA 5GOWB 3AZEC 1P34A 5C79A 1B67A 4UUZB 1I2HA 5C5BB 4L6EA 4QLCD 3A1KA 5B1MC 3AYWD 2D4QA 4HB2B 3W98C 2AROC 2I1KA 4EJNA 4KUDD 2FJ7C 3WKJC 5AV9A 2PYOB 5BNXA 2JSSA 5GT3C 4AWLB 1AQCA 3KZ1A 3SO6A 1HQ3D 4CSRA 3KY9A 3A1IA 5HE1A 5JP4A 2ZY5A 1HQ3B 3NWFA 1TZYA 4WJ7A 3M1IB 2NZDD 1ZSQA 4H9SC 2R2YA 2HIOC 1ZLAC 3MGSB 2DKQA 3AJ4A 3MGPB 5BS7C 1JFIB 2Z0QA 3ODOA 5CP6D 4X23D 5AV9B 2VQRA 3AZFB 3UTAB 3UTBA 2R09A 5GXQB 1ULYA 3MVDB 1I7AA 3X1SC 3C1CC 4ZBJC 3UT9D 4KHAA 2Z0PA 4TYZA 1ID3B 1DDWA 1MAIA 1SHCA 5BO0B 4R8PA 3KWQA 3W97A 5JRGC 5B24C 1DROA 2W2XD 2Y2JA 2J59M 5B40A 4Z2MB 4F7UP 1P3GB 4HAZB 3MGQC 4CAYB 3AV1C 4WU9D 1DYNA 1V5UA 1EVHA 4H8SA 4A6FA 5GT0D 3AN2C 1V88A 2D10A 3AZLC 3KXBD 1P3LA 1EAZA 3X1TD 1MKEA 1OQNA 1Y19B 1PMSA 1F66A 2R0DA 4CHJA 4XZQD 2OQBA 3AV2C 4PQ0A 2D9YA 2F8NA 5CPIA 4H9OA 4MK0A 2Z0OA 5AY8A 3AZID 4Z66D 4OSNA 3AZND 1R4VA 3CIKA 3W99D 3B6FD 3BJIA 3F0WA 4QLCA 1ID3A 2DFKA 3NQUB 3REIC 2NBVA 5CLLB 3V9RB 1XCGA 2CV5A 3UTAA 3TU4D 4HATB 2RIQA 1U27A 2P0DA 4NE6A 5AVCB 4AWLC 4WZSB 1U5GA 4CHMA 5AVBC 1XD4A 3GYOA 1N1JA 3W98B 2DYNA 3X1TB 1ZM0A 4XUJC 2HUEC 1AOIC 1J0WA 5B24B 2GS0A 3NSUA 1Y5OA 4JJNC 5B1LC 4ZRKA 3D8DA 3LZ0C 4KGCC 2FFFB 4Z5TB 1X05A 4UUZA 2MWNB 5C5BA 3X1SB 2KCJA 4Z2NA 3W97D 2AROA 1P3IB 1WGQA 2CWEA 3REJA 1KX3C 4TKNA 5B24A 3X1VD 3AZHB 5F99D 1DDMA 5GXQC 3MVDC 3IP4C 5B32G 3WTPC 3UT9A 1UNPA 1S32C 3PVLA 5EFXA 3VH5W 3AV1A
chains in the Genus database with same CATH topology
4NFTA 2VSZA 5DNMB 5CP6A 4X23A 5AVCC 2UZSA 4KHBB 1B6WA 5AVCD 2G5IC 5BS7A 4J8WC 3QIJA 2CODA 2ELBA 3MGQD 1P34D 5KDMB 3D8FA 5AVBA 3R45A 5B0YD 5F99C 3OANA 4CYEA 4HGAC 1KX3D 4J8VC 3AZIA 1U5FA 1M7RA 2COAA 3T06A 2JE5A 2ROVA 3R45B 2IYBA 5CPIB 4KAXB 3X1SD 2HE7A 1QQGA 3C1BC 3FVCA 4GNKB 1F66B 5D3VA 4QJ3B 1AOID 3ML4A 1P3MB 3B6FA 4HDOA 4WU8A 2Z14A 3PSCA 4A6FB 5DNND 5DNMA 1P3FD 3FEHA 3D8EA 3AV1B 1FHWA 4WV4B 5JA4B 2XQNM 3A8PA 2DQNC 3IVFA 2ZKMX 5KQ4A 3A6NC 2FJLA 3AZHA 3F5RA 3P7ZA 3X23A 2IFSA 3B0DB 4QLCC 2H7DA 5FUGB 5B2JC 2Y2NA 1EQZB 3NQJB 2CRFA 4WVFB 1P3BC 3WTPD 4YM6D 2LOXA 4NY0A 5F99A 3AZNC 1QC6A 1P3PD 1WG7A 2G35A 2K2UA 4IAPA 3MGPA 5BNVB 1P3PC 1M1AB 4YM6C 5AV8A 4ZUXA 5I2MA 3LZ0B 4KGCB 2UZRA 4XZQC 4QJ4B 1TZYB 3LZ0D 5B31D 3AZMA 4KGCD 5B2JD 3B0CT 3C1CA 5AVCA 1P6SA 1WGUA 4CSRB 5B31G 4YS3C 3VH5A 3ZVRA 1T3UA 3A6ND 3DXEA 3AV1D 5DI9B 2GUMA 3V9RA 3KUYB 1KX5C 3VIAA 3A6NB 1SGHA 2D9ZA 1TAFB 5DNMC 2QKMA 4HAXB 1V61A 5JRGD 2DLWA 3TU4A 3C1BB 1GG3A 4EKUA 2RNRB 2LULA 3AZEB 4Z66B 3EPKA 2F8NB 2YRYA 4G92B 1E5WA 4YONA 1P3PB 1M1AC 3TFMA 3AV2A 3B6FC 5JLJB 3AZJA 2EMTA 2ZM5A 1M19C 5B0YC 3VH6A 3AZKB 2Y2MA 4NE5A 1P3PA 3VH6T 1FAOA 2HIOB 5B2JB 1EQZC 4CAYA 1ZLAB 3AL0C 1V5MA 2DN6A 1KX5D 2FJ7B 1UNRA 3MGRC 2Y2HA 3KXBB 1KX5B 2FJ7D 1PZRA 4J8WD 1XX0A 3W98D 5B1MD 3AYWC 3H0LC 3MGRD 2NZ8B 3B6GA 3KFUG 1BFMA 5E5AB 4GMXB 1P3AB 3FM8C 1MPHA 5DNNA 1P3KB 1P3AD 1M19D 4P7IA 3MGSA 5JRGA 3W97C 4KUDA 3O62B 3C1CB 2DHIA 4XZQA 3DXCA 4K2PA 1P3BD 2Y2IA 2K49A 3C1CD 1HQ3A 4JJNA 1ID3D 1RRPB 3LZ0A 4KGCA 2PZ1A 2NQBB 1WVHA 4ZUXD 4XUJD 2Y2PA 2ZY3A 4HB3B 5FUGA 1EQZA 1X11A 1P3FC 3G9WA 1Z2CB 3REKB 3SV1A 3TU4C 1TXDA 4XWXA 2FJ7A 3GYPA 4YS3D 5JA4A 2MFQA 2RRFA 3REID 1ID3C 3REIB 1M19B 3O62C 3W99C 3AZNB 1KI1B 3X1VB 3LJUX 1P3MA 3B6FB 4EO5C 3KRXA 5JHHA 4Z66C 5L81A 3MDBC 3AFAB 4G92C 5B32B 1KX4B 5GSUC 1H3OA 3AZEA 1P34C 3HK0A 5LOPB 4HB0B 3AZLB 2YFVB 5D3XA 2K00A 3AZLD 1F1EA 3H0RC 3TO1A 3KXBC 5AV6B 2P0HA 3AN2D 2NMBA 2RGNB 4L1RA 3AZGB 2M38A 1H3OB 1UEFA 2BYMB 2W8SA 3AFAA 1S32D 3SNHA 5DNNC 5B33C 1S32B 5B24D 3X1VA 2YSZA 1M19A 3UZTA 3AZHC 1BAKA 4OT1A 1W1HA 3UT9C 2CY4A 2UVMA 3TW1A 2Y2LA 2D2QA 5B1LD 5AV8B 1M18A 1KU5A 5CP6C 4X23C 3MGRA 5CPKB 2LKOA 4MT7A 3REJB 5B32D 1KX4D 4J8VD 5GT3A 1AOIB 1P3FB 3W96B 2NZDC 1FHXA 2CAYA 1U35B 2JP2A 4J8VB 2QKLA 3NW8A 4YL8A 5DNMD 5AVBD 1P3FA 3BINA 4HAYB 5B0ZD 1U5EA 5CPJB 3WKJD 5CPKA 3FSSA 2AROD 4KUDC 4EMOA 3WA9D 2LYDA 3A58A 4ZRJA 1W1GA 3O62A 1WI1A 1F66C 3A8QA 2P0FA 5GXQD 3MVDD 4GXBA 5C3IB 4HB4B 4WU8D 3WTPB 5CPIC 3X1VC 4J8XA 2D11A 2P8VA 2Y2QA 3SYXA 2F8NK 1WWIA 2BYMA 4Z2MG 5KCVA 3AZGA 1H4RA 3AZFC 3LJAB 4HAUB 5AV6A 3N7CA 2ZY4A 1M18C 3ODWA 5DHFB 5B31B 4HGAB 3KXBA 3REHA 3AZLA 1U35D 1P3LC 1BWNA 2RUKB 1KX3A 1ZYIA 3KUYD 2J0MA 2DTCA 2GCJA 5B2JA 3WTPE 1X1GA 5HE2A 2BCJA 2W2XC 5B33A 4UPKA 5AV5C 4LD9C 5D3YA 2AL6A 2CY5A 4MY6A 3H0MC 2DKPA 3AZNA 4DRAA 3MNNC 3MGPD 1P3MC 4H9PB 4XUJA 5AV8C 2F8ND 1ZC3B 2M14A 4EO5B 3DXDA 5HE3A 4M6BA 5GSUA 3C1BD 3UT9B 1Z87A 3W99B 1PLSA 1U29A 4NE3A 1UNQA 5B40D 3HW2B 3KWQB 5DIFB 3REKA 4KVGB 3AZIC 1XR0B 3B0DC 4NSWA 5B0ZA 3AV2D 2Y8GA 3AZFA 1HQ3C 2Y2KA 2GJYA 2YS3A 3LELA 4HAWB 4R8PD 2L2IA 2YT2A 3RELB 1U5DA 4WU9B 4HAVB 3W98A 5GT0C 3AZMB 2X18A 4G91B 3PZDA 4IOYX 4XZQB 4DBBA 1W2EA 2AEHA 4DX8A 5JRGB 3B0BA 3SUZA 5BNVA 1M1AA 3LELB 4Z2MH 5I2SA 5BNXB 1P3AA 4J8UA 4J8XD 1P3OB 2NZDA 3NQUA 3UTAD 4HDQA 5J3YA 3LZ1B 2MKRA 2Y7BA 2NQBD 3AU5A 2F2AC 4JJND 3AFAD 5B1MA 3UTBD 3FDDA 4WNNA 1XODA 5AY8B 3U7DA 3X1UC 3REHD 3REKC 2N0YA 2HIOD 1ZLAD 4A5KA 4HSIA 2Y2GA 2DX5A 2F8NH 4XUJB 1MIXA 3VH6W 2XD1A 5AV5A 3RELC 4LD9A 5J3TA 3RELD 5GT0B 3AZMC 3CXBB 1P3LB 2V76A 3PG7A 3MGQA 5FI0A 5DHAB 4H9QB 4K81A 1P5TA 1AWEA 5B0YB 3X1UD 5E5AD 1KX3B 2DHJA 4Z5TD 3C1BA 3AFAC 1OMWA 3QWMA 3W97B 2NQBC 3AZIB 1NTVA 2KUPA 1J19A 4BBKA 3WAAD 1KZ7A 1BH8A 3LZ1C 5CPKD 5B2ID 3ZDTA 5CHLB 3UTBB 2Z4DA 1B55A 3LELC 1BTNA 4KHBA 3VH5T 5AV5B 3REIA 3X1TC 4LD9B 1MK7B 1PFJA 4YS3A 2CV5D 4QXAB 4WU9C 3EPLA 3AZGD 4DRBA 2PYOC 3PP2A 5CLQB 2RLOA 5AY8C 1P3IC 1P3KC 3EG5B 1V89A 5CPKC 3KWQC 4J8UD 1U35A 1BTKA 2W2WA 3U12A 5FI1A 3W96A 1P3OC 4J8UB 4D0NB 3TVVA 3A98B 5B40C 3WAAB 5J3QA 5B1LA 2ELAA 2IO5C 2F8NG 2ZY2A 2J0JA 2Y8FA 3MPXA 1NU2A 1EGXA 2YS1A 1N1JB 2H7EA 3MGSC 2EJ8A 1MIZB 3REJD 4B6HA 3RELA 4KUDB 1ZC4B 4F7GA 4G91C 4E44A 2PYOD 5AV5D 4LD9D 5D27A 4Y94A 5AV6C 5DNNB 1MK9B 3ULBA 4DX90 5GT3D 2BG1A 2CV5B 5B0ZB 5E5AA 3REHC 1P3GC 2I5CA 4F7HA 1IRSA 5C16A 1BH8B 2DHKA 1LB1A 4YM6B 1X1FA 2YFVA 3AZED 3AZFD 4E45A 3LJAC 1TZYC 3UTAC 2RVQD 5GSUB 4GN1A 3AU4A 5B0YA 2RVQC 3KSYA 5B2IA 2D9VA 2KIGA 4H9QA 3LJAD 2KUQA 2Z13A 1TZYD 3AZJD 1UPQA 2L1CA 1F66D 5BT1C 2ROZB 3AZJB 5B33B 3AV2B 2I1JA 2LOZA 2ZPYA 2YVCA 1P3GD 2K8EA 4H9RA 3PVUA 4QJ5B 1FHOA 4WNNB 5CPJC 3B6GC 5B31A 5B0ZC 5G49A 5B1MB 3AZMD 1KZGA 2E2XA 2BYKB 2AROB 1P3IA 2J8PA 2UWXA 3LZ1A 3MGSD 3WA9B 3REJC 2D9WA 3A6NA 3QBVB 3W96C 2G5HC 1P3OA 2NZDB 5GXQA 3MVDA 3EPJA 1OY2A 3WTPA 4J8XB 2YT1A 2YT0A 5C3IC 1FOEA 3ODXA 1JFIA 2FJUB 1GC7A 3X1TA 1P3BA 1LW3A 3P5JB 4JJNB 2LG1A 3HQCA 3AZKD 4DIXA 1DBHA 5AV9C 3KWQD 4J8UC 4WU9A 5AY8D 2DYQA 4GMVA 4ZUXB 1RJ2A 1TJ6A 2VKIA 1GC6A 5B33D 2RVBB 4HHVA 3NWDA 3AYWB 2PYOA 1WJMA 3B6GD 3EPHA 2N23A 2EC1A 3B6GB 4J8VA 3NQJA 2CV5C 3VOQA 1P3LD 1X86A 5KQ1A 4H9NB 2BYKA 5M4YB 3LELD 3KRWA 2XD5A 5G49B 1KX5A 1ISNA 3MGRB 3W99A 1M18B 4DQYB 2HTHB 2JCHA 1W1DA 2DA0A 5LG4B 4WJ3C 5B2IC 1BH9B 5AV9D 4H9PA 3LZ1D 4WU8C 3AZKC 1TQZA 1ZVRA 2Q13A 4DXAB 3WAAC 2MDXA 3O62D 3TCAA 4ZRIA 2HUEB 4Z5TC 3WA9C 1BH9A 5E5AC 3MNNB 3AN2A 2GCLA 1P3GA 2RSGA 2YS5A 3MNND 3PEGA 4GPTB 3REHB 3TU4B 3OHMB 1P3RA 5AV6D 3U8ZA 5DH9B 5BO0A 2Y2OA 4H9NA 4R8PB 4J8WB 3LJAA 2OTXA 4PNKA 5IRSA 1TAFA 4KHAB 1FB8A 3P6AA 3REKD 5B32C 3KUYA 1KX4C 1WJ1A 2YF0A 4ZUXC 5HE0A 5JHGA 3AYWA 5C6RA 1M18D 4GOUA 2D9XA 1EF1A 4A6HA 1P3OD 3AZJC 3X1UA 3AZHD 1NTYA 1P3KA 1K5GB 2KR0A 3PVWA 1P3BB 1V5PA 4J8XC 4K2OA 1P3ID 2K2JA 5CPJA 2J0KA 3WAAA 5F99B 1N3HA 3AZGC 2I5FA 1Q9CA 1UPRA 3X1SA 4K17A 4Z5TA 3WA9A 3ULCA 5GT3B 1AOIA 4R8PC 3V5WA 4CSQA 4GZUA 1P34B 2YFWA 2NQBA 3F6TA 2VRWB 2Z59A 1EQZD 2COFA 2KIEA 4H9RB 3X1UB 4YS3B 2IO5B 1XKEA 2DF4C 3O96A 3RCPA 4H9SA 1NI2A 4WU8B 1H10A 3HIEA 4D6WA 1S32A 1M1AD 1WWSA 3B0CW 5B2IB 1DDVA 2COCA 5AV8D 3W96D 1HTAA 2DX1A 3WKJA 4QLCB 4J8WA 5D3WA 3WYFB 2R2YA 2ADZA 3MGPC 1P3KD 1P3MD 4YM6A 1A7WA 5LONB 2L5AA 5CPJD 4H9OB 3WKJB 2EMSA 5AVBB 3MNNA 5B32A 5KDMA 3KUYC 2HIOA 3AN2B 1KX4A 1U35C 1ZLAA 3AZKA 3MGQB 2KGXB 5GT0A 3UTBC 1FGYA 4WSFA 3NWAA 5BT1D 5B31C 1M7EA 1FGZA 5CP6B 4X23B 4IFSA 3WA0A 5GSUD 1U2BA 1K5DB 4Z66A 5B40B 4C0AA 2YFWB 1P3AC 2LY8A 4ZBJB 5CPID 5B1LB 1Q67A 4KHOA 5GOWB 3AZEC 1P34A 5C79A 1B67A 4UUZB 1I2HA 5C5BB 4L6EA 4QLCD 3A1KA 5B1MC 3AYWD 2D4QA 4HB2B 3W98C 2AROC 2I1KA 4EJNA 4KUDD 2FJ7C 3WKJC 5AV9A 2PYOB 5BNXA 2JSSA 5GT3C 4AWLB 1AQCA 3KZ1A 3SO6A 1HQ3D 4CSRA 3KY9A 3A1IA 5HE1A 5JP4A 2ZY5A 1HQ3B 3NWFA 1TZYA 4WJ7A 3M1IB 2NZDD 1ZSQA 4H9SC 3AJ4A 2HIOC 1ZLAC 3MGSB 2DKQA 4A6KA 3MGPB 5BS7C 1JFIB 2Z0QA 3ODOA 5CP6D 4X23D 5AV9B 2VQRA 3AZFB 3UTAB 3UTBA 2R09A 5GXQB 1ULYA 3MVDB 1I7AA 3X1SC 3C1CC 4ZBJC 3UT9D 4KHAA 2Z0PA 4TYZA 1ID3B 1DDWA 1MAIA 1SHCA 5BO0B 4R8PA 3KWQA 3W97A 5JRGC 5B24C 1DROA 2W2XD 2Y2JA 2J59M 5B40A 4Z2MB 4F7UP 1P3GB 4HAZB 3MGQC 4CAYB 3AV1C 4WU9D 1DYNA 1V5UA 1EVHA 4H8SA 4A6FA 5GT0D 3AN2C 1V88A 2D10A 3AZLC 3KXBD 1P3LA 1EAZA 3X1TD 1MKEA 1OQNA 1Y19B 1PMSA 1F66A 2R0DA 4CHJA 4XZQD 2OQBA 3AV2C 4PQ0A 2D9YA 2F8NA 5CPIA 4H9OA 4MK0A 2Z0OA 5AY8A 3AZID 4Z66D 4OSNA 3AZND 1R4VA 3CIKA 3W99D 3B6FD 3BJIA 3F0WA 4QLCA 1ID3A 2DFKA 3NQUB 3REIC 2NBVA 5CLLB 3V9RB 1XCGA 2CV5A 3UTAA 3TU4D 4HATB 2RIQA 1U27A 2P0DA 4NE6A 5AVCB 4AWLC 4WZSB 1U5GA 4CHMA 5AVBC 1XD4A 3GYOA 1N1JA 3W98B 2DYNA 3X1TB 1ZM0A 4XUJC 2HUEC 1AOIC 1J0WA 5B24B 2GS0A 3NSUA 1Y5OA 4JJNC 5B1LC 4ZRKA 3D8DA 3LZ0C 4KGCC 2FFFB 4Z5TB 1X05A 4UUZA 2MWNB 5C5BA 3X1SB 2KCJA 4Z2NA 3W97D 2AROA 1P3IB 1WGQA 2CWEA 3REJA 1KX3C 4TKNA 5B24A 3X1VD 3AZHB 5F99D 1DDMA 5GXQC 3MVDC 3IP4C 5B32G 3WTPC 3UT9A 1UNPA 1S32C 3PVLA 5EFXA 3VH5W 3AV1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NFT A;  2VSZ A;  5DNM B;  5CP6 A;  4X23 A;  5AVC C;  2UZS A;  4KHB B;  1B6W A;  5AVC D;  5BS7 A;  3QIJ A;  4J8W C;  2COD A;  2ELB A;  3MGQ D;  1P34 D;  5KDM B;  3D8F A;  5AVB A;  3R45 A;  5B0Y D;  5F99 C;  3OAN A;  4CYE A;  4HGA C;  1KX3 D;  4J8V C;  3AZI A;  1U5F A;  1M7R A;  2COA A;  3T06 A;  2ROV A;  3R45 B;  2IYB A;  5CPI B;  4KAX B;  3X1S D;  2HE7 A;  1QQG A;  3C1B C;  1F66 B;  5D3V A;  1AOI D;  3ML4 A;  1P3M B;  3B6F A;  4HDO A;  4WU8 A;  3PSC A;  4A6F B;  5DNN D;  5DNM A;  1P3F D;  3FEH A;  3D8E A;  3AV1 B;  1FHW A;  4WV4 B;  5JA4 B;  2XQN M;  3A8P A;  3IVF A;  5KQ4 A;  3A6N C;  2FJL A;  3AZH A;  3F5R A;  3P7Z A;  3X23 A;  2IFS A;  3B0D B;  4QLC C;  2H7D A;  5FUG B;  5B2J C;  1EQZ B;  2CRF A;  3NQJ B;  4WVF B;  1P3B C;  3WTP D;  4YM6 D;  2LOX A;  4NY0 A;  5F99 A;  3AZN C;  1QC6 A;  1P3P D;  1WG7 A;  2G35 A;  2K2U A;  4IAP A;  3MGP A;  5BNV B;  1P3P C;  1M1A B;  4YM6 C;  5AV8 A;  4ZUX A;  3LZ0 B;  4KGC B;  2UZR A;  4XZQ C;  1TZY B;  3LZ0 D;  5B31 D;  3AZM A;  4KGC D;  5B2J D;  3B0C T;  3C1C A;  5AVC A;  1P6S A;  1WGU A;  4CSR B;  5B31 G;  4YS3 C;  3VH5 A;  3ZVR A;  3A6N D;  3DXE A;  3AV1 D;  5DI9 B;  3V9R A;  3KUY B;  1KX5 C;  3VIA A;  3A6N B;  1SGH A;  2D9Z A;  1TAF B;  5DNM C;  2QKM A;  4HAX B;  1V61 A;  5JRG D;  2DLW A;  3TU4 A;  3C1B B;  1GG3 A;  4EKU A;  2RNR B;  2LUL A;  3AZE B;  4Z66 B;  2F8N B;  2YRY A;  4G92 B;  1E5W A;  4YON A;  1P3P B;  1M1A C;  3TFM A;  3AV2 A;  3B6F C;  5JLJ B;  3AZJ A;  2EMT A;  1M19 C;  5B0Y C;  3VH6 A;  3AZK B;  1FAO A;  4NE5 A;  1P3P A;  3VH6 T;  2DN6 A;  2HIO B;  5B2J B;  1EQZ C;  4CAY A;  1ZLA B;  1V5M A;  1KX5 D;  2FJ7 B;  1UNR A;  3MGR C;  3KXB B;  1KX5 B;  2FJ7 D;  4J8W D;  1XX0 A;  3W98 D;  5B1M D;  3AYW C;  3MGR D;  2NZ8 B;  3B6G A;  1BFM A;  5E5A B;  4GMX B;  1P3A B;  3FM8 C;  1MPH A;  5DNN A;  1P3K B;  1P3A D;  1M19 D;  4P7I A;  3MGS A;  5JRG A;  3W97 C;  4KUD A;  3O62 B;  3C1C B;  2DHI A;  4XZQ A;  3DXC A;  4K2P A;  1P3B D;  3C1C D;  1HQ3 A;  4JJN A;  1ID3 D;  1RRP B;  3LZ0 A;  4KGC A;  2PZ1 A;  2NQB B;  1WVH A;  4ZUX D;  4XUJ D;  4HB3 B;  5FUG A;  1EQZ A;  1X11 A;  1P3F C;  3G9W A;  3REK B;  3SV1 A;  3TU4 C;  1TXD A;  4XWX A;  2FJ7 A;  3GYP A;  4YS3 D;  5JA4 A;  2MFQ A;  3REI D;  1ID3 C;  3REI B;  1M19 B;  3O62 C;  3W99 C;  3AZN B;  1KI1 B;  3X1V B;  3LJU X;  1P3M A;  3B6F B;  4EO5 C;  3KRX A;  5JHH A;  4Z66 C;  5L81 A;  3MDB C;  3AFA B;  4G92 C;  5B32 B;  1KX4 B;  5GSU C;  1H3O A;  3AZE A;  1P34 C;  3HK0 A;  5LOP B;  4HB0 B;  3AZL B;  2YFV B;  5D3X A;  2K00 A;  3AZL D;  1F1E A;  3TO1 A;  3KXB C;  5AV6 B;  2P0H A;  3AN2 D;  2NMB A;  2RGN B;  3AZG B;  2M38 A;  1H3O B;  1UEF A;  2BYM B;  3AFA A;  1S32 D;  3SNH A;  5DNN C;  5B33 C;  1S32 B;  5B24 D;  3X1V A;  2YSZ A;  1M19 A;  3UZT A;  3AZH C;  1BAK A;  1W1H A;  3UT9 C;  2CY4 A;  2UVM A;  3TW1 A;  2D2Q A;  5B1L D;  5AV8 B;  1M18 A;  1KU5 A;  5CP6 C;  4X23 C;  3MGR A;  5CPK B;  2LKO A;  4MT7 A;  3REJ B;  5B32 D;  1KX4 D;  4J8V D;  5GT3 A;  1AOI B;  1P3F B;  3W96 B;  2NZD C;  1FHX A;  2CAY A;  1U35 B;  2JP2 A;  4J8V B;  2QKL A;  4YL8 A;  5DNM D;  5AVB D;  1P3F A;  3BIN A;  4HAY B;  5B0Z D;  1U5E A;  5CPJ B;  3WKJ D;  5CPK A;  3FSS A;  2ARO D;  4KUD C;  4EMO A;  3WA9 D;  2LYD A;  4ZRJ A;  1W1G A;  3O62 A;  1WI1 A;  1F66 C;  3A8Q A;  2P0F A;  3MVD D;  5GXQ D;  4GXB A;  5C3I B;  4HB4 B;  4WU8 D;  3WTP B;  5CPI C;  3X1V C;  4J8X A;  2D11 A;  2P8V A;  3SYX A;  5KCV A;  2F8N K;  1WWI A;  2BYM A;  4Z2M G;  3AZG A;  1H4R A;  3AZF C;  3LJA B;  4HAU B;  5AV6 A;  3N7C A;  1M18 C;  3ODW A;  5DHF B;  5B31 B;  4HGA B;  3KXB A;  3REH A;  3AZL A;  1U35 D;  1P3L C;  1BWN A;  2RUK B;  1KX3 A;  3KUY D;  2DTC A;  2GCJ A;  3WTP E;  5B2J A;  1X1G A;  5HE2 A;  2BCJ A;  2W2X C;  5B33 A;  5AV5 C;  4LD9 C;  5D3Y A;  4B6H A;  2AL6 A;  2CY5 A;  4MY6 A;  2DKP A;  3AZN A;  4DRA A;  3MNN C;  3MGP D;  1P3M C;  4H9P B;  4XUJ A;  5AV8 C;  2F8N D;  1ZC3 B;  2M14 A;  4EO5 B;  3DXD A;  5HE3 A;  4M6B A;  5GSU A;  3C1B D;  3UT9 B;  1Z87 A;  3W99 B;  1PLS A;  1U29 A;  4NE3 A;  1UNQ A;  5B40 D;  3HW2 B;  3KWQ B;  5DIF B;  3REK A;  4KVG B;  3AZI C;  1XR0 B;  3B0D C;  4NSW A;  5B0Z A;  3AV2 D;  2Y8G A;  3AZF A;  1HQ3 C;  2GJY A;  2YS3 A;  3LEL A;  4HAW B;  4R8P D;  2L2I A;  3REL B;  1U5D A;  4WU9 B;  4HAV B;  3W98 A;  5GT0 C;  3AZM B;  2X18 A;  4G91 B;  3PZD A;  4IOY X;  4XZQ B;  4DBB A;  2AEH A;  4DX8 A;  5JRG B;  3B0B A;  3SUZ A;  5BNV A;  1M1A A;  3LEL B;  4Z2M H;  5BNX B;  1P3A A;  4J8U A;  4J8X D;  1P3O B;  2NZD A;  3NQU A;  3UTA D;  4HDQ A;  5J3Y A;  3LZ1 B;  2MKR A;  2Y7B A;  2NQB D;  3AU5 A;  4JJN D;  3AFA D;  5B1M A;  3UTB D;  4WNN A;  1XOD A;  5AY8 B;  3U7D A;  3X1U C;  3REH D;  3REK C;  2N0Y A;  2HIO D;  1ZLA D;  4A5K A;  2DX5 A;  2F8N H;  4XUJ B;  1MIX A;  3VH6 W;  5AV5 A;  3REL C;  4LD9 A;  5J3T A;  3REL D;  5GT0 B;  3AZM C;  3CXB B;  1P3L B;  2V76 A;  3PG7 A;  3MGQ A;  5FI0 A;  5DHA B;  4H9Q B;  4K81 A;  1P5T A;  5B0Y B;  3X1U D;  5E5A D;  1KX3 B;  2DHJ A;  4Z5T D;  3C1B A;  3AFA C;  1OMW A;  3QWM A;  3W97 B;  2NQB C;  3AZI B;  1NTV A;  2KUP A;  1J19 A;  4BBK A;  3WAA D;  1KZ7 A;  1BH8 A;  3LZ1 C;  5CPK D;  5B2I D;  3ZDT A;  5CHL B;  3UTB B;  1B55 A;  3LEL C;  1BTN A;  3VH5 T;  5AV5 B;  3REI A;  3X1T C;  4LD9 B;  1MK7 B;  1PFJ A;  4YS3 A;  2CV5 D;  4WU9 C;  3AZG D;  4DRB A;  2PYO C;  3PP2 A;  5CLQ B;  2RLO A;  5AY8 C;  1P3I C;  1P3K C;  1V89 A;  5CPK C;  3KWQ C;  4J8U D;  1U35 A;  1BTK A;  2W2W A;  5FI1 A;  3W96 A;  1P3O C;  4J8U B;  4D0N B;  3TVV A;  3A98 B;  5B40 C;  3WAA B;  5J3Q A;  5B1L A;  2ELA A;  2IO5 C;  2F8N G;  3MPX A;  2J0J A;  2Y8F A;  1NU2 A;  1EGX A;  2YS1 A;  1N1J B;  2H7E A;  3MGS C;  2EJ8 A;  1MIZ B;  3REJ D;  3REL A;  4KUD B;  1ZC4 B;  4F7G A;  4G91 C;  4E44 A;  2PYO D;  5AV5 D;  4LD9 D;  5D27 A;  4Y94 A;  5AV6 C;  5DNN B;  1MK9 B;  3ULB A;  4DX9 0;  5GT3 D;  2CV5 B;  5B0Z B;  5E5A A;  3REH C;  1P3G C;  2I5C A;  4F7H A;  1IRS A;  5C16 A;  1BH8 B;  2DHK A;  1LB1 A;  4YM6 B;  1X1F A;  2YFV A;  3AZE D;  3AZF D;  4E45 A;  3LJA C;  1TZY C;  3UTA C;  2RVQ D;  5GSU B;  4GN1 A;  3AU4 A;  5B0Y A;  2RVQ C;  3KSY A;  5B2I A;  2D9V A;  4H9Q A;  3LJA D;  1TZY D;  3AZJ D;  1UPQ A;  2L1C A;  1F66 D;  5BT1 C;  2ROZ B;  3AZJ B;  5B33 B;  3AV2 B;  2I1J A;  2LOZ A;  2ZPY A;  2YVC A;  1P3G D;  4H9R A;  3PVU A;  1FHO A;  4WNN B;  5CPJ C;  3B6G C;  5B31 A;  5B0Z C;  5G49 A;  5B1M B;  3AZM D;  1KZG A;  2E2X A;  2BYK B;  2ARO B;  1P3I A;  3LZ1 A;  3MGS D;  3WA9 B;  3REJ C;  2D9W A;  3A6N A;  3QBV B;  3W96 C;  1P3O A;  2NZD B;  5GXQ A;  3MVD A;  1OY2 A;  1AWE A;  3WTP A;  4J8X B;  2YT1 A;  2YT0 A;  5C3I C;  1FOE A;  3ODX A;  1JFI A;  1GC7 A;  3X1T A;  1P3B A;  1LW3 A;  4JJN B;  2LG1 A;  3HQC A;  3AZK D;  1DBH A;  5AV9 C;  3KWQ D;  4J8U C;  4WU9 A;  5AY8 D;  2DYQ A;  4GMV A;  4ZUX B;  1RJ2 A;  1TJ6 A;  2VKI A;  1GC6 A;  5B33 D;  2RVB B;  4HHV A;  3AYW B;  2PYO A;  1WJM A;  3B6G D;  2N23 A;  2EC1 A;  3B6G B;  4J8V A;  3NQJ A;  2CV5 C;  3VOQ A;  1P3L D;  1X86 A;  5KQ1 A;  4H9N B;  2BYK A;  3LEL D;  3KRW A;  1ISN A;  5G49 B;  1KX5 A;  3MGR B;  3W99 A;  1M18 B;  2HTH B;  1W1D A;  2DA0 A;  5B2I C;  1BH9 B;  5AV9 D;  4H9P A;  3LZ1 D;  4WU8 C;  3AZK C;  1TQZ A;  1ZVR A;  2Q13 A;  4DXA B;  3WAA C;  2MDX A;  3O62 D;  3TCA A;  4ZRI A;  2HUE B;  4Z5T C;  3WA9 C;  1BH9 A;  5E5A C;  3MNN B;  3AN2 A;  2GCL A;  1P3G A;  2RSG A;  2YS5 A;  3MNN D;  3PEG A;  4GPT B;  3REH B;  3TU4 B;  1P3R A;  5AV6 D;  3U8Z A;  5DH9 B;  5BO0 A;  4H9N A;  4R8P B;  4J8W B;  4PNK A;  3LJA A;  2OTX A;  1TAF A;  4KHA B;  1FB8 A;  3P6A A;  3REK D;  5B32 C;  3KUY A;  1KX4 C;  1WJ1 A;  2YF0 A;  4ZUX C;  5HE0 A;  5JHG A;  3AYW A;  5C6R A;  1M18 D;  2D9X A;  1EF1 A;  4A6H A;  1P3O D;  3AZJ C;  3X1U A;  3AZH D;  1NTY A;  1P3K A;  1K5G B;  3PVW A;  1P3B B;  1V5P A;  4J8X C;  4K2O A;  1P3I D;  2K2J A;  5CPJ A;  2J0K A;  3WAA A;  5F99 B;  1N3H A;  3AZG C;  2I5F A;  1Q9C A;  1UPR A;  3X1S A;  4K17 A;  4Z5T A;  3WA9 A;  3ULC A;  5GT3 B;  1AOI A;  4R8P C;  3V5W A;  4GZU A;  1P34 B;  2YFW A;  2NQB A;  2VRW B;  1EQZ D;  2COF A;  4H9R B;  3X1U B;  4YS3 B;  2IO5 B;  1XKE A;  3O96 A;  3RCP A;  4H9S A;  1NI2 A;  4WU8 B;  1H10 A;  1S32 A;  1M1A D;  1WWS A;  3B0C W;  5B2I B;  1DDV A;  2COC A;  5AV8 D;  3W96 D;  1HTA A;  2DX1 A;  3WKJ A;  4QLC B;  4J8W A;  5D3W A;  3WYF B;  2ADZ A;  3MGP C;  1P3K D;  1P3M D;  4YM6 A;  1A7W A;  5LON B;  2L5A A;  5CPJ D;  4H9O B;  3WKJ B;  2EMS A;  5AVB B;  3MNN A;  5B32 A;  5KDM A;  3KUY C;  2HIO A;  3AN2 B;  1KX4 A;  1U35 C;  1ZLA A;  3AZK A;  3MGQ B;  2KGX B;  5GT0 A;  3UTB C;  1FGY A;  4WSF A;  5BT1 D;  5B31 C;  1M7E A;  1FGZ A;  5CP6 B;  4X23 B;  4IFS A;  3WA0 A;  5GSU D;  1U2B A;  1K5D B;  4Z66 A;  5B40 B;  4C0A A;  2YFW B;  1P3A C;  2LY8 A;  4ZBJ B;  5CPI D;  5B1L B;  1Q67 A;  4KHO A;  5GOW B;  3AZE C;  1P34 A;  5C79 A;  1B67 A;  4UUZ B;  1I2H A;  5C5B B;  4L6E A;  4QLC D;  5B1M C;  3AYW D;  2D4Q A;  4HB2 B;  3W98 C;  2ARO C;  2I1K A;  4EJN A;  4KUD D;  2FJ7 C;  3WKJ C;  5AV9 A;  2PYO B;  5BNX A;  2JSS A;  5GT3 C;  4AWL B;  1AQC A;  3KZ1 A;  3SO6 A;  1HQ3 D;  4CSR A;  3KY9 A;  5JP4 A;  5HE1 A;  1HQ3 B;  1TZY A;  4WJ7 A;  3M1I B;  2NZD D;  1ZSQ A;  4H9S C;  3AJ4 A;  2HIO C;  1ZLA C;  3MGS B;  2DKQ A;  4A6K A;  3MGP B;  5BS7 C;  1JFI B;  2Z0Q A;  3ODO A;  5CP6 D;  4X23 D;  5AV9 B;  3AZF B;  2R09 A;  3UTA B;  3UTB A;  5GXQ B;  1ULY A;  3MVD B;  1I7A A;  3X1S C;  3C1C C;  4ZBJ C;  3UT9 D;  4KHA A;  2Z0P A;  4TYZ A;  1ID3 B;  1DDW A;  1MAI A;  1SHC A;  5BO0 B;  4R8P A;  3KWQ A;  3W97 A;  5JRG C;  5B24 C;  1DRO A;  2W2X D;  2J59 M;  4Z2M B;  5B40 A;  4F7U P;  1P3G B;  4HAZ B;  3MGQ C;  4CAY B;  3AV1 C;  4WU9 D;  1DYN A;  1V5U A;  1EVH A;  4H8S A;  4A6F A;  5GT0 D;  3AN2 C;  1V88 A;  2D10 A;  3AZL C;  3KXB D;  1P3L A;  1EAZ A;  3X1T D;  1MKE A;  1OQN A;  1Y19 B;  1PMS A;  1F66 A;  2R0D A;  4CHJ A;  4XZQ D;  2OQB A;  3AV2 C;  4PQ0 A;  2D9Y A;  2F8N A;  5CPI A;  4H9O A;  4MK0 A;  2Z0O A;  5AY8 A;  3AZI D;  4Z66 D;  3AZN D;  1R4V A;  3CIK A;  3W99 D;  3B6F D;  3BJI A;  3F0W A;  4QLC A;  1ID3 A;  2DFK A;  3NQU B;  3REI C;  5CLL B;  3V9R B;  1XCG A;  2CV5 A;  3UTA A;  3TU4 D;  4HAT B;  1U27 A;  2P0D A;  4NE6 A;  5AVC B;  4AWL C;  4WZS B;  1U5G A;  4CHM A;  5AVB C;  1XD4 A;  3GYO A;  1N1J A;  3W98 B;  2DYN A;  3X1T B;  1ZM0 A;  4XUJ C;  2HUE C;  1AOI C;  1J0W A;  5B24 B;  2GS0 A;  3NSU A;  1Y5O A;  4JJN C;  5B1L C;  4ZRK A;  3D8D A;  3LZ0 C;  4KGC C;  4Z5T B;  1X05 A;  4UUZ A;  2MWN B;  5C5B A;  3X1S B;  2KCJ A;  4Z2N A;  3W97 D;  2ARO A;  1P3I B;  1WGQ A;  2CWE A;  3REJ A;  1KX3 C;  4TKN A;  5B24 A;  3X1V D;  3AZH B;  5F99 D;  1DDM A;  5GXQ C;  3MVD C;  5B32 G;  3UT9 A;  3WTP C;  1UNP A;  2J0M A;  1S32 C;  3PVL A;  5EFX A;  3VH5 W;  3AV1 A; 
#chains in the Genus database with same CATH topology
 4NFT A;  2VSZ A;  5DNM B;  5CP6 A;  4X23 A;  5AVC C;  2UZS A;  4KHB B;  1B6W A;  5AVC D;  2G5I C;  5BS7 A;  4J8W C;  3QIJ A;  2COD A;  2ELB A;  3MGQ D;  1P34 D;  5KDM B;  3D8F A;  5AVB A;  3R45 A;  5B0Y D;  5F99 C;  3OAN A;  4CYE A;  4HGA C;  1KX3 D;  4J8V C;  3AZI A;  1U5F A;  1M7R A;  2COA A;  3T06 A;  2JE5 A;  2ROV A;  3R45 B;  2IYB A;  5CPI B;  4KAX B;  3X1S D;  2HE7 A;  1QQG A;  3C1B C;  3FVC A;  4GNK B;  1F66 B;  5D3V A;  1AOI D;  3ML4 A;  4A6K A;  1P3M B;  3B6F A;  4HDO A;  4WU8 A;  2Z14 A;  3PSC A;  4A6F B;  5DNN D;  5DNM A;  1P3F D;  3FEH A;  3D8E A;  3AV1 B;  1FHW A;  4WV4 B;  5JA4 B;  2XQN M;  2ZKM X;  2DQN C;  3A8P A;  3IVF A;  5KQ4 A;  3A6N C;  2FJL A;  3AZH A;  3F5R A;  3P7Z A;  3X23 A;  2IFS A;  3B0D B;  4QLC C;  2H7D A;  5FUG B;  5B2J C;  2Y2N A;  1EQZ B;  3NQJ B;  2CRF A;  4WVF B;  1P3B C;  3WTP D;  4YM6 D;  2LOX A;  4NY0 A;  5F99 A;  3AZN C;  1QC6 A;  1P3P D;  1WG7 A;  2G35 A;  2K2U A;  4IAP A;  3MGP A;  5BNV B;  1P3P C;  1M1A B;  4YM6 C;  5AV8 A;  4ZUX A;  5I2M A;  3LZ0 B;  4KGC B;  2UZR A;  4XZQ C;  4QJ4 B;  1TZY B;  3LZ0 D;  5B31 D;  3AZM A;  4KGC D;  5B2J D;  3B0C T;  3C1C A;  5AVC A;  1P6S A;  1WGU A;  4CSR B;  5B31 G;  4YS3 C;  3VH5 A;  3ZVR A;  1T3U A;  3A6N D;  2GUM A;  3AV1 D;  3DXE A;  5DI9 B;  3V9R A;  3KUY B;  1KX5 C;  3VIA A;  3A6N B;  1SGH A;  2D9Z A;  1TAF B;  5DNM C;  2QKM A;  4HAX B;  1V61 A;  5JRG D;  2DLW A;  3TU4 A;  3C1B B;  1GG3 A;  4EKU A;  2RNR B;  2LUL A;  3AZE B;  4Z66 B;  3EPK A;  2F8N B;  2YRY A;  4G92 B;  1E5W A;  4YON A;  1P3P B;  1M1A C;  3TFM A;  3AV2 A;  3B6F C;  5JLJ B;  3AZJ A;  2EMT A;  2ZM5 A;  1M19 C;  5B0Y C;  3VH6 A;  3AZK B;  2Y2M A;  4NE5 A;  1P3P A;  3VH6 T;  1FAO A;  2HIO B;  5B2J B;  1EQZ C;  4CAY A;  1ZLA B;  3AL0 C;  1V5M A;  2DN6 A;  1KX5 D;  2FJ7 B;  1UNR A;  3MGR C;  2Y2H A;  3KXB B;  1KX5 B;  2FJ7 D;  1PZR A;  4J8W D;  1XX0 A;  3W98 D;  5B1M D;  3AYW C;  3H0L C;  3MGR D;  2NZ8 B;  3B6G A;  3KFU G;  1BFM A;  5E5A B;  4GMX B;  1P3A B;  3FM8 C;  1MPH A;  5DNN A;  1P3K B;  1P3A D;  1M19 D;  4P7I A;  3MGS A;  5JRG A;  3W97 C;  4KUD A;  3O62 B;  3C1C B;  2DHI A;  4XZQ A;  3DXC A;  4K2P A;  1P3B D;  2Y2I A;  2K49 A;  3C1C D;  1HQ3 A;  4JJN A;  1ID3 D;  1RRP B;  3LZ0 A;  4KGC A;  2PZ1 A;  2NQB B;  1WVH A;  4ZUX D;  4XUJ D;  2Y2P A;  2ZY3 A;  4HB3 B;  5FUG A;  1EQZ A;  1X11 A;  1P3F C;  3G9W A;  1Z2C B;  3REK B;  3SV1 A;  3TU4 C;  1TXD A;  4XWX A;  2FJ7 A;  3GYP A;  4YS3 D;  5JA4 A;  2MFQ A;  2RRF A;  3REI D;  1ID3 C;  3REI B;  1M19 B;  3O62 C;  3W99 C;  3AZN B;  1KI1 B;  3X1V B;  3HSA A;  3LJU X;  1P3M A;  3B6F B;  4EO5 C;  3KRX A;  5JHH A;  4Z66 C;  5L81 A;  3MDB C;  3AFA B;  4G92 C;  5B32 B;  1KX4 B;  5GSU C;  1H3O A;  3AZE A;  1P34 C;  3HK0 A;  5LOP B;  4HB0 B;  3AZL B;  2YFV B;  5D3X A;  2K00 A;  3AZL D;  1F1E A;  3H0R C;  3TO1 A;  3KXB C;  5AV6 B;  2P0H A;  3AN2 D;  2NMB A;  2RGN B;  3AZG B;  2M38 A;  1H3O B;  1UEF A;  2BYM B;  2W8S A;  3AFA A;  1S32 D;  3SNH A;  5DNN C;  5B33 C;  1S32 B;  5B24 D;  3X1V A;  2YSZ A;  1M19 A;  4OT1 A;  3AZH C;  3UZT A;  1BAK A;  1W1H A;  3UT9 C;  2CY4 A;  2UVM A;  3TW1 A;  2Y2L A;  2D2Q A;  5B1L D;  5AV8 B;  1M18 A;  1KU5 A;  5CP6 C;  4X23 C;  3MGR A;  5CPK B;  2LKO A;  4MT7 A;  3REJ B;  5B32 D;  1KX4 D;  4J8V D;  5GT3 A;  1AOI B;  1P3F B;  3W96 B;  2NZD C;  1FHX A;  2CAY A;  1U35 B;  2JP2 A;  4J8V B;  2QKL A;  3NW8 A;  4YL8 A;  5DNM D;  5AVB D;  1P3F A;  3BIN A;  4HAY B;  5B0Z D;  1U5E A;  5CPJ B;  3WKJ D;  5CPK A;  3FSS A;  2ARO D;  4KUD C;  4EMO A;  3WA9 D;  2LYD A;  3A58 A;  4ZRJ A;  1W1G A;  3O62 A;  1WI1 A;  1F66 C;  3A8Q A;  2P0F A;  5GXQ D;  3MVD D;  4GXB A;  5C3I B;  4HB4 B;  4WU8 D;  3WTP B;  5CPI C;  3X1V C;  4J8X A;  2D11 A;  2P8V A;  2Y2Q A;  3SYX A;  2F8N K;  1WWI A;  2BYM A;  4Z2M G;  5KCV A;  3AZG A;  1H4R A;  3AZF C;  3LJA B;  4HAU B;  5AV6 A;  3N7C A;  3B77 A;  2ZY4 A;  1M18 C;  3ODW A;  5DHF B;  5B31 B;  4HGA B;  3KXB A;  3REH A;  3AZL A;  1U35 D;  1P3L C;  1BWN A;  1ZYI A;  1KX3 A;  2RUK B;  3KUY D;  2J0M A;  2DTC A;  2GCJ A;  5B2J A;  3WTP E;  1X1G A;  5HE2 A;  2BCJ A;  2W2X C;  5B33 A;  4UPK A;  5AV5 C;  4LD9 C;  5D3Y A;  2AL6 A;  2CY5 A;  1MI1 A;  3H0M C;  2DKP A;  3AZN A;  4MY6 A;  4DRA A;  3MNN C;  3MGP D;  1P3M C;  4H9P B;  4XUJ A;  5AV8 C;  2F8N D;  1ZC3 B;  2M14 A;  4EO5 B;  3DXD A;  4L1R A;  4M6B A;  5GSU A;  5HE3 A;  3C1B D;  3UT9 B;  1Z87 A;  3W99 B;  1PLS A;  1U29 A;  4NE3 A;  1UNQ A;  5B40 D;  3HW2 B;  3KWQ B;  5DIF B;  3REK A;  4KVG B;  3AZI C;  1XR0 B;  3B0D C;  4NSW A;  5B0Z A;  3AV2 D;  2Y8G A;  3AZF A;  1HQ3 C;  2Y2K A;  2GJY A;  1T77 A;  2YS3 A;  3LEL A;  4HAW B;  4R8P D;  2L2I A;  2YT2 A;  3REL B;  1U5D A;  4WU9 B;  4HAV B;  3W98 A;  5GT0 C;  3AZM B;  2X18 A;  4G91 B;  3PZD A;  4IOY X;  4XZQ B;  4DBB A;  1W2E A;  2AEH A;  4DX8 A;  5JRG B;  3B0B A;  3SUZ A;  5BNV A;  1M1A A;  3LEL B;  4Z2M H;  5I2S A;  5BNX B;  1P3A A;  4J8U A;  4J8X D;  1P3O B;  2NZD A;  3NQU A;  3UTA D;  4HDQ A;  5J3Y A;  3LZ1 B;  2MKR A;  2Y7B A;  2NQB D;  3AU5 A;  2F2A C;  4JJN D;  3AFA D;  5B1M A;  3UTB D;  3FDD A;  4WNN A;  1XOD A;  5AY8 B;  3U7D A;  3X1U C;  3REH D;  3REK C;  2N0Y A;  2HIO D;  1ZLA D;  4A5K A;  4HSI A;  2Y2G A;  2DX5 A;  2F8N H;  4XUJ B;  1MIX A;  3VH6 W;  3DCX A;  2XD1 A;  5AV5 A;  3REL C;  4LD9 A;  5J3T A;  3REL D;  5GT0 B;  3AZM C;  3CXB B;  1P3L B;  2V76 A;  3PG7 A;  3MGQ A;  5FI0 A;  5DHA B;  4H9Q B;  4K81 A;  1P5T A;  1AWE A;  5B0Y B;  3X1U D;  5E5A D;  1KX3 B;  2DHJ A;  4Z5T D;  3C1B A;  3AFA C;  1OMW A;  3QWM A;  3W97 B;  2NQB C;  3AZI B;  1NTV A;  2KUP A;  1J19 A;  4BBK A;  3WAA D;  1KZ7 A;  1BH8 A;  3LZ1 C;  5CPK D;  5B2I D;  3ZDT A;  5CHL B;  3UTB B;  2Z4D A;  1B55 A;  3LEL C;  1BTN A;  4KHB A;  3VH5 T;  5AV5 B;  3REI A;  3X1T C;  4LD9 B;  1MK7 B;  1PFJ A;  4YS3 A;  2CV5 D;  4QXA B;  4WU9 C;  3EPL A;  3AZG D;  4DRB A;  2PYO C;  3PP2 A;  5CLQ B;  2RLO A;  5AY8 C;  1P3I C;  1P3K C;  3EG5 B;  1V89 A;  5CPK C;  3KWQ C;  4J8U D;  1U35 A;  1BTK A;  2W2W A;  3U12 A;  5FI1 A;  3W96 A;  1P3O C;  4J8U B;  4D0N B;  3TVV A;  3A98 B;  5B40 C;  3WAA B;  5J3Q A;  5B1L A;  2ELA A;  2IO5 C;  2F8N G;  2ZY2 A;  2J0J A;  2Y8F A;  3MPX A;  1NU2 A;  1EGX A;  2YS1 A;  1N1J B;  2H7E A;  3MGS C;  2EJ8 A;  1MIZ B;  3REJ D;  4B6H A;  3REL A;  4KUD B;  1ZC4 B;  4F7G A;  4G91 C;  4E44 A;  2PYO D;  5AV5 D;  4LD9 D;  4QJ3 B;  4Y94 A;  5AV6 C;  5DNN B;  1MK9 B;  5D27 A;  3ULB A;  5GT3 D;  2BG1 A;  4DX9 0;  2CV5 B;  5B0Z B;  5E5A A;  3REH C;  1P3G C;  2I5C A;  4F7H A;  1IRS A;  5C16 A;  1BH8 B;  2DHK A;  1LB1 A;  4YM6 B;  1X1F A;  2YFV A;  3AZE D;  3AZF D;  4E45 A;  3LJA C;  1TZY C;  3UTA C;  2RVQ D;  5GSU B;  4GN1 A;  3AU4 A;  5B0Y A;  2RVQ C;  3KSY A;  5B2I A;  2D9V A;  2KIG A;  4H9Q A;  3LJA D;  2KUQ A;  2Z13 A;  1TZY D;  3AZJ D;  1UPQ A;  2L1C A;  1F66 D;  5BT1 C;  2ROZ B;  3AZJ B;  5B33 B;  3AV2 B;  2I1J A;  2K8E A;  2LOZ A;  2YVC A;  1P3G D;  2ZPY A;  4H9R A;  3PVU A;  4QJ5 B;  1FHO A;  4WNN B;  5CPJ C;  3B6G C;  5B31 A;  5B0Z C;  5G49 A;  5B1M B;  3AZM D;  1KZG A;  2E2X A;  2BYK B;  2ARO B;  1P3I A;  2J8P A;  2UWX A;  3LZ1 A;  3MGS D;  3WA9 B;  3REJ C;  2D9W A;  3A6N A;  3QBV B;  3W96 C;  2G5H C;  1P3O A;  2NZD B;  5GXQ A;  3MVD A;  3EPJ A;  1OY2 A;  3WTP A;  4J8X B;  2YT1 A;  2YT0 A;  5C3I C;  1FOE A;  2FJU B;  1JFI A;  3ODX A;  1GC7 A;  3X1T A;  1P3B A;  1LW3 A;  3P5J B;  4JJN B;  2LG1 A;  3HQC A;  3AZK D;  4DIX A;  1DBH A;  5AV9 C;  3KWQ D;  4J8U C;  4WU9 A;  5AY8 D;  2DYQ A;  4GMV A;  4ZUX B;  1RJ2 A;  1TJ6 A;  2VKI A;  1GC6 A;  5B33 D;  2RVB B;  4HHV A;  3NWD A;  3AYW B;  2PYO A;  1WJM A;  3B6G D;  3EPH A;  2N23 A;  2EC1 A;  3B6G B;  4J8V A;  3NQJ A;  2CV5 C;  3VOQ A;  1P3L D;  1X86 A;  5KQ1 A;  4H9N B;  2BYK A;  5M4Y B;  3LEL D;  3KRW A;  2XD5 A;  5G49 B;  1KX5 A;  1ISN A;  3MGR B;  3W99 A;  1M18 B;  4DQY B;  2HTH B;  2JCH A;  1W1D A;  2DA0 A;  5LG4 B;  4WJ3 C;  5B2I C;  1BH9 B;  5AV9 D;  4H9P A;  3LZ1 D;  4WU8 C;  3AZK C;  1TQZ A;  1ZVR A;  2Q13 A;  4DXA B;  3WAA C;  2MDX A;  3O62 D;  3TCA A;  4ZRI A;  2HUE B;  4Z5T C;  3WA9 C;  1BH9 A;  5E5A C;  3MNN B;  3AN2 A;  2GCL A;  1P3G A;  2RSG A;  2YS5 A;  3MNN D;  3PEG A;  4GPT B;  3REH B;  3TU4 B;  3OHM B;  1P3R A;  5AV6 D;  3U8Z A;  5DH9 B;  5BO0 A;  2Y2O A;  4H9N A;  4R8P B;  4J8W B;  3LJA A;  2OTX A;  4PNK A;  5IRS A;  1TAF A;  4KHA B;  1FB8 A;  3P6A A;  3REK D;  5B32 C;  3KUY A;  1KX4 C;  1WJ1 A;  2YF0 A;  4ZUX C;  5HE0 A;  5JHG A;  3AYW A;  5C6R A;  1M18 D;  4GOU A;  2D9X A;  1EF1 A;  4A6H A;  1P3O D;  3AZJ C;  3X1U A;  3AZH D;  1NTY A;  1P3K A;  1K5G B;  2KR0 A;  3PVW A;  1P3B B;  1V5P A;  4J8X C;  4K2O A;  1P3I D;  2K2J A;  5CPJ A;  2J0K A;  3WAA A;  5F99 B;  1N3H A;  3AZG C;  2I5F A;  1Q9C A;  1UPR A;  3X1S A;  4K17 A;  4Z5T A;  3WA9 A;  3ULC A;  5GT3 B;  1AOI A;  4R8P C;  3V5W A;  4CSQ A;  4GZU A;  1P34 B;  2YFW A;  2NQB A;  3F6T A;  2VRW B;  2Z59 A;  1EQZ D;  2COF A;  2KIE A;  4H9R B;  3X1U B;  4YS3 B;  2IO5 B;  1XKE A;  2DF4 C;  3O96 A;  3RCP A;  4H9S A;  1NI2 A;  4WU8 B;  1H10 A;  3HIE A;  4D6W A;  1S32 A;  1M1A D;  1WWS A;  3B0C W;  5B2I B;  1DDV A;  2COC A;  5AV8 D;  3W96 D;  1HTA A;  2DX1 A;  3WKJ A;  4QLC B;  4J8W A;  5D3W A;  3WYF B;  2ADZ A;  3MGP C;  1P3K D;  1P3M D;  4YM6 A;  1A7W A;  5LON B;  2L5A A;  5CPJ D;  4H9O B;  3WKJ B;  2EMS A;  5AVB B;  3MNN A;  5B32 A;  5KDM A;  3KUY C;  2HIO A;  3AN2 B;  1KX4 A;  1U35 C;  1ZLA A;  3AZK A;  3MGQ B;  2KGX B;  5GT0 A;  3UTB C;  1FGY A;  4WSF A;  3NWA A;  5BT1 D;  5B31 C;  1M7E A;  1FGZ A;  5CP6 B;  4X23 B;  4IFS A;  3WA0 A;  5GSU D;  1U2B A;  1K5D B;  4Z66 A;  5B40 B;  4C0A A;  2YFW B;  1P3A C;  2LY8 A;  4ZBJ B;  5CPI D;  5B1L B;  1Q67 A;  4KHO A;  5GOW B;  3AZE C;  1P34 A;  5C79 A;  1B67 A;  4UUZ B;  1I2H A;  5C5B B;  4L6E A;  4QLC D;  3A1K A;  5B1M C;  3AYW D;  2D4Q A;  4HB2 B;  3W98 C;  2ARO C;  2I1K A;  4EJN A;  4KUD D;  2FJ7 C;  3WKJ C;  5AV9 A;  2PYO B;  5BNX A;  2JSS A;  5GT3 C;  4AWL B;  1AQC A;  3KZ1 A;  3SO6 A;  1HQ3 D;  4CSR A;  3KY9 A;  3A1I A;  5HE1 A;  5JP4 A;  2ZY5 A;  1HQ3 B;  3NWF A;  1TZY A;  4WJ7 A;  3M1I B;  2NZD D;  1ZSQ A;  4H9S C;  2R2Y A;  2HIO C;  1ZLA C;  3MGS B;  2DKQ A;  3AJ4 A;  3MGP B;  5BS7 C;  1JFI B;  2Z0Q A;  3ODO A;  5CP6 D;  4X23 D;  5AV9 B;  2VQR A;  3AZF B;  3UTA B;  3UTB A;  2R09 A;  5GXQ B;  1ULY A;  3MVD B;  1I7A A;  3X1S C;  3C1C C;  4ZBJ C;  3UT9 D;  4KHA A;  2Z0P A;  4TYZ A;  1ID3 B;  1DDW A;  1MAI A;  1SHC A;  5BO0 B;  4R8P A;  3KWQ A;  3W97 A;  5JRG C;  5B24 C;  1DRO A;  2W2X D;  2Y2J A;  2J59 M;  5B40 A;  4Z2M B;  4F7U P;  1P3G B;  4HAZ B;  3MGQ C;  4CAY B;  3AV1 C;  4WU9 D;  1DYN A;  1V5U A;  1EVH A;  4H8S A;  4A6F A;  5GT0 D;  3AN2 C;  1V88 A;  2D10 A;  3AZL C;  3KXB D;  1P3L A;  1EAZ A;  3X1T D;  1MKE A;  1OQN A;  1Y19 B;  1PMS A;  1F66 A;  2R0D A;  4CHJ A;  4XZQ D;  2OQB A;  3AV2 C;  4PQ0 A;  2D9Y A;  2F8N A;  5CPI A;  4H9O A;  4MK0 A;  2Z0O A;  5AY8 A;  3AZI D;  4Z66 D;  4OSN A;  3AZN D;  1R4V A;  3CIK A;  3W99 D;  3B6F D;  3BJI A;  3F0W A;  4QLC A;  1ID3 A;  2DFK A;  3NQU B;  3REI C;  2NBV A;  5CLL B;  3V9R B;  1XCG A;  2CV5 A;  3UTA A;  3TU4 D;  4HAT B;  2RIQ A;  1U27 A;  2P0D A;  4NE6 A;  5AVC B;  4AWL C;  4WZS B;  1U5G A;  4CHM A;  5AVB C;  1XD4 A;  3GYO A;  1N1J A;  3W98 B;  2DYN A;  3X1T B;  1ZM0 A;  4XUJ C;  2HUE C;  1AOI C;  1J0W A;  5B24 B;  2GS0 A;  3NSU A;  1Y5O A;  4JJN C;  5B1L C;  4ZRK A;  3D8D A;  3LZ0 C;  4KGC C;  2FFF B;  4Z5T B;  1X05 A;  4UUZ A;  2MWN B;  5C5B A;  3X1S B;  2KCJ A;  4Z2N A;  3W97 D;  2ARO A;  1P3I B;  1WGQ A;  2CWE A;  3REJ A;  1KX3 C;  4TKN A;  5B24 A;  3X1V D;  3AZH B;  5F99 D;  1DDM A;  5GXQ C;  3MVD C;  3IP4 C;  5B32 G;  3WTP C;  3UT9 A;  1UNP A;  1S32 C;  3PVL A;  5EFX A;  3VH5 W;  3AV1 A; 
#chains in the Genus database with same CATH homology
 4NFT A;  2VSZ A;  5DNM B;  5CP6 A;  4X23 A;  5AVC C;  2UZS A;  4KHB B;  1B6W A;  5AVC D;  2G5I C;  5BS7 A;  4J8W C;  3QIJ A;  2COD A;  2ELB A;  3MGQ D;  1P34 D;  5KDM B;  3D8F A;  5AVB A;  3R45 A;  5B0Y D;  5F99 C;  3OAN A;  4CYE A;  4HGA C;  1KX3 D;  4J8V C;  3AZI A;  1U5F A;  1M7R A;  2COA A;  3T06 A;  2JE5 A;  2ROV A;  3R45 B;  2IYB A;  5CPI B;  4KAX B;  3X1S D;  2HE7 A;  1QQG A;  3C1B C;  3FVC A;  4GNK B;  1F66 B;  5D3V A;  4QJ3 B;  1AOI D;  3ML4 A;  1P3M B;  3B6F A;  4HDO A;  4WU8 A;  2Z14 A;  3PSC A;  4A6F B;  5DNN D;  5DNM A;  1P3F D;  3FEH A;  3D8E A;  3AV1 B;  1FHW A;  4WV4 B;  5JA4 B;  2XQN M;  3A8P A;  2DQN C;  3IVF A;  2ZKM X;  5KQ4 A;  3A6N C;  2FJL A;  3AZH A;  3F5R A;  3P7Z A;  3X23 A;  2IFS A;  3B0D B;  4QLC C;  2H7D A;  5FUG B;  5B2J C;  2Y2N A;  1EQZ B;  3NQJ B;  2CRF A;  4WVF B;  1P3B C;  3WTP D;  4YM6 D;  2LOX A;  4NY0 A;  5F99 A;  3AZN C;  1QC6 A;  1P3P D;  1WG7 A;  2G35 A;  2K2U A;  4IAP A;  3MGP A;  5BNV B;  1P3P C;  1M1A B;  4YM6 C;  5AV8 A;  4ZUX A;  5I2M A;  3LZ0 B;  4KGC B;  2UZR A;  4XZQ C;  4QJ4 B;  1TZY B;  3LZ0 D;  5B31 D;  3AZM A;  4KGC D;  5B2J D;  3B0C T;  3C1C A;  5AVC A;  1P6S A;  1WGU A;  4CSR B;  5B31 G;  4YS3 C;  3VH5 A;  3ZVR A;  1T3U A;  3A6N D;  3DXE A;  3AV1 D;  5DI9 B;  2GUM A;  3V9R A;  3KUY B;  1KX5 C;  3VIA A;  3A6N B;  1SGH A;  2D9Z A;  1TAF B;  5DNM C;  2QKM A;  4HAX B;  1V61 A;  5JRG D;  2DLW A;  3TU4 A;  3C1B B;  1GG3 A;  4EKU A;  2RNR B;  2LUL A;  3AZE B;  4Z66 B;  3EPK A;  2F8N B;  2YRY A;  4G92 B;  1E5W A;  4YON A;  1P3P B;  1M1A C;  3TFM A;  3AV2 A;  3B6F C;  5JLJ B;  3AZJ A;  2EMT A;  2ZM5 A;  1M19 C;  5B0Y C;  3VH6 A;  3AZK B;  2Y2M A;  4NE5 A;  1P3P A;  3VH6 T;  1FAO A;  2HIO B;  5B2J B;  1EQZ C;  4CAY A;  1ZLA B;  3AL0 C;  1V5M A;  2DN6 A;  1KX5 D;  2FJ7 B;  1UNR A;  3MGR C;  2Y2H A;  3KXB B;  1KX5 B;  2FJ7 D;  1PZR A;  4J8W D;  1XX0 A;  3W98 D;  5B1M D;  3AYW C;  3H0L C;  3MGR D;  2NZ8 B;  3B6G A;  3KFU G;  1BFM A;  5E5A B;  4GMX B;  1P3A B;  3FM8 C;  1MPH A;  5DNN A;  1P3K B;  1P3A D;  1M19 D;  4P7I A;  3MGS A;  5JRG A;  3W97 C;  4KUD A;  3O62 B;  3C1C B;  2DHI A;  4XZQ A;  3DXC A;  4K2P A;  1P3B D;  2Y2I A;  2K49 A;  3C1C D;  1HQ3 A;  4JJN A;  1ID3 D;  1RRP B;  3LZ0 A;  4KGC A;  2PZ1 A;  2NQB B;  1WVH A;  4ZUX D;  4XUJ D;  2Y2P A;  2ZY3 A;  4HB3 B;  5FUG A;  1EQZ A;  1X11 A;  1P3F C;  3G9W A;  1Z2C B;  3REK B;  3SV1 A;  3TU4 C;  1TXD A;  4XWX A;  2FJ7 A;  3GYP A;  4YS3 D;  5JA4 A;  2MFQ A;  2RRF A;  3REI D;  1ID3 C;  3REI B;  1M19 B;  3O62 C;  3W99 C;  3AZN B;  1KI1 B;  3X1V B;  3LJU X;  1P3M A;  3B6F B;  4EO5 C;  3KRX A;  5JHH A;  4Z66 C;  5L81 A;  3MDB C;  3AFA B;  4G92 C;  5B32 B;  1KX4 B;  5GSU C;  1H3O A;  3AZE A;  1P34 C;  3HK0 A;  5LOP B;  4HB0 B;  3AZL B;  2YFV B;  5D3X A;  2K00 A;  3AZL D;  1F1E A;  3H0R C;  3TO1 A;  3KXB C;  5AV6 B;  2P0H A;  3AN2 D;  2NMB A;  2RGN B;  4L1R A;  3AZG B;  2M38 A;  1H3O B;  1UEF A;  2BYM B;  2W8S A;  3AFA A;  1S32 D;  3SNH A;  5DNN C;  5B33 C;  1S32 B;  5B24 D;  3X1V A;  2YSZ A;  1M19 A;  3UZT A;  3AZH C;  1BAK A;  4OT1 A;  1W1H A;  3UT9 C;  2CY4 A;  2UVM A;  3TW1 A;  2Y2L A;  2D2Q A;  5B1L D;  5AV8 B;  1M18 A;  1KU5 A;  5CP6 C;  4X23 C;  3MGR A;  5CPK B;  2LKO A;  4MT7 A;  3REJ B;  5B32 D;  1KX4 D;  4J8V D;  5GT3 A;  1AOI B;  1P3F B;  3W96 B;  2NZD C;  1FHX A;  2CAY A;  1U35 B;  2JP2 A;  4J8V B;  2QKL A;  3NW8 A;  4YL8 A;  5DNM D;  5AVB D;  1P3F A;  3BIN A;  4HAY B;  5B0Z D;  1U5E A;  5CPJ B;  3WKJ D;  5CPK A;  3FSS A;  2ARO D;  4KUD C;  4EMO A;  3WA9 D;  2LYD A;  3A58 A;  4ZRJ A;  1W1G A;  3O62 A;  1WI1 A;  1F66 C;  3A8Q A;  2P0F A;  5GXQ D;  3MVD D;  4GXB A;  5C3I B;  4HB4 B;  4WU8 D;  3WTP B;  5CPI C;  3X1V C;  4J8X A;  2D11 A;  2P8V A;  2Y2Q A;  3SYX A;  2F8N K;  1WWI A;  2BYM A;  4Z2M G;  5KCV A;  3AZG A;  1H4R A;  3AZF C;  3LJA B;  4HAU B;  5AV6 A;  3N7C A;  2ZY4 A;  1M18 C;  3ODW A;  5DHF B;  5B31 B;  4HGA B;  3KXB A;  3REH A;  3AZL A;  1U35 D;  1P3L C;  1BWN A;  2RUK B;  1KX3 A;  1ZYI A;  3KUY D;  2J0M A;  2DTC A;  2GCJ A;  5B2J A;  3WTP E;  1X1G A;  5HE2 A;  2BCJ A;  2W2X C;  5B33 A;  4UPK A;  5AV5 C;  4LD9 C;  5D3Y A;  2AL6 A;  2CY5 A;  4MY6 A;  3H0M C;  2DKP A;  3AZN A;  4DRA A;  3MNN C;  3MGP D;  1P3M C;  4H9P B;  4XUJ A;  5AV8 C;  2F8N D;  1ZC3 B;  2M14 A;  4EO5 B;  3DXD A;  5HE3 A;  4M6B A;  5GSU A;  3C1B D;  3UT9 B;  1Z87 A;  3W99 B;  1PLS A;  1U29 A;  4NE3 A;  1UNQ A;  5B40 D;  3HW2 B;  3KWQ B;  5DIF B;  3REK A;  4KVG B;  3AZI C;  1XR0 B;  3B0D C;  4NSW A;  5B0Z A;  3AV2 D;  2Y8G A;  3AZF A;  1HQ3 C;  2Y2K A;  2GJY A;  2YS3 A;  3LEL A;  4HAW B;  4R8P D;  2L2I A;  2YT2 A;  3REL B;  1U5D A;  4WU9 B;  4HAV B;  3W98 A;  5GT0 C;  3AZM B;  2X18 A;  4G91 B;  3PZD A;  4IOY X;  4XZQ B;  4DBB A;  1W2E A;  2AEH A;  4DX8 A;  5JRG B;  3B0B A;  3SUZ A;  5BNV A;  1M1A A;  3LEL B;  4Z2M H;  5I2S A;  5BNX B;  1P3A A;  4J8U A;  4J8X D;  1P3O B;  2NZD A;  3NQU A;  3UTA D;  4HDQ A;  5J3Y A;  3LZ1 B;  2MKR A;  2Y7B A;  2NQB D;  3AU5 A;  2F2A C;  4JJN D;  3AFA D;  5B1M A;  3UTB D;  3FDD A;  4WNN A;  1XOD A;  5AY8 B;  3U7D A;  3X1U C;  3REH D;  3REK C;  2N0Y A;  2HIO D;  1ZLA D;  4A5K A;  4HSI A;  2Y2G A;  2DX5 A;  2F8N H;  4XUJ B;  1MIX A;  3VH6 W;  2XD1 A;  5AV5 A;  3REL C;  4LD9 A;  5J3T A;  3REL D;  5GT0 B;  3AZM C;  3CXB B;  1P3L B;  2V76 A;  3PG7 A;  3MGQ A;  5FI0 A;  5DHA B;  4H9Q B;  4K81 A;  1P5T A;  1AWE A;  5B0Y B;  3X1U D;  5E5A D;  1KX3 B;  2DHJ A;  4Z5T D;  3C1B A;  3AFA C;  1OMW A;  3QWM A;  3W97 B;  2NQB C;  3AZI B;  1NTV A;  2KUP A;  1J19 A;  4BBK A;  3WAA D;  1KZ7 A;  1BH8 A;  3LZ1 C;  5CPK D;  5B2I D;  3ZDT A;  5CHL B;  3UTB B;  2Z4D A;  1B55 A;  3LEL C;  1BTN A;  4KHB A;  3VH5 T;  5AV5 B;  3REI A;  3X1T C;  4LD9 B;  1MK7 B;  1PFJ A;  4YS3 A;  2CV5 D;  4QXA B;  4WU9 C;  3EPL A;  3AZG D;  4DRB A;  2PYO C;  3PP2 A;  5CLQ B;  2RLO A;  5AY8 C;  1P3I C;  1P3K C;  3EG5 B;  1V89 A;  5CPK C;  3KWQ C;  4J8U D;  1U35 A;  1BTK A;  2W2W A;  3U12 A;  5FI1 A;  3W96 A;  1P3O C;  4J8U B;  4D0N B;  3TVV A;  3A98 B;  5B40 C;  3WAA B;  5J3Q A;  5B1L A;  2ELA A;  2IO5 C;  2F8N G;  2ZY2 A;  2J0J A;  2Y8F A;  3MPX A;  1NU2 A;  1EGX A;  2YS1 A;  1N1J B;  2H7E A;  3MGS C;  2EJ8 A;  1MIZ B;  3REJ D;  4B6H A;  3REL A;  4KUD B;  1ZC4 B;  4F7G A;  4G91 C;  4E44 A;  2PYO D;  5AV5 D;  4LD9 D;  5D27 A;  4Y94 A;  5AV6 C;  5DNN B;  1MK9 B;  3ULB A;  4DX9 0;  5GT3 D;  2BG1 A;  2CV5 B;  5B0Z B;  5E5A A;  3REH C;  1P3G C;  2I5C A;  4F7H A;  1IRS A;  5C16 A;  1BH8 B;  2DHK A;  1LB1 A;  4YM6 B;  1X1F A;  2YFV A;  3AZE D;  3AZF D;  4E45 A;  3LJA C;  1TZY C;  3UTA C;  2RVQ D;  5GSU B;  4GN1 A;  3AU4 A;  5B0Y A;  2RVQ C;  3KSY A;  5B2I A;  2D9V A;  2KIG A;  4H9Q A;  3LJA D;  2KUQ A;  2Z13 A;  1TZY D;  3AZJ D;  1UPQ A;  2L1C A;  1F66 D;  5BT1 C;  2ROZ B;  3AZJ B;  5B33 B;  3AV2 B;  2I1J A;  2LOZ A;  2ZPY A;  2YVC A;  1P3G D;  2K8E A;  4H9R A;  3PVU A;  4QJ5 B;  1FHO A;  4WNN B;  5CPJ C;  3B6G C;  5B31 A;  5B0Z C;  5G49 A;  5B1M B;  3AZM D;  1KZG A;  2E2X A;  2BYK B;  2ARO B;  1P3I A;  2J8P A;  2UWX A;  3LZ1 A;  3MGS D;  3WA9 B;  3REJ C;  2D9W A;  3A6N A;  3QBV B;  3W96 C;  2G5H C;  1P3O A;  2NZD B;  5GXQ A;  3MVD A;  3EPJ A;  1OY2 A;  3WTP A;  4J8X B;  2YT1 A;  2YT0 A;  5C3I C;  1FOE A;  3ODX A;  1JFI A;  2FJU B;  1GC7 A;  3X1T A;  1P3B A;  1LW3 A;  3P5J B;  4JJN B;  2LG1 A;  3HQC A;  3AZK D;  4DIX A;  1DBH A;  5AV9 C;  3KWQ D;  4J8U C;  4WU9 A;  5AY8 D;  2DYQ A;  4GMV A;  4ZUX B;  1RJ2 A;  1TJ6 A;  2VKI A;  1GC6 A;  5B33 D;  2RVB B;  4HHV A;  3NWD A;  3AYW B;  2PYO A;  1WJM A;  3B6G D;  3EPH A;  2N23 A;  2EC1 A;  3B6G B;  4J8V A;  3NQJ A;  2CV5 C;  3VOQ A;  1P3L D;  1X86 A;  5KQ1 A;  4H9N B;  2BYK A;  5M4Y B;  3LEL D;  3KRW A;  2XD5 A;  5G49 B;  1KX5 A;  1ISN A;  3MGR B;  3W99 A;  1M18 B;  4DQY B;  2HTH B;  2JCH A;  1W1D A;  2DA0 A;  5LG4 B;  4WJ3 C;  5B2I C;  1BH9 B;  5AV9 D;  4H9P A;  3LZ1 D;  4WU8 C;  3AZK C;  1TQZ A;  1ZVR A;  2Q13 A;  4DXA B;  3WAA C;  2MDX A;  3O62 D;  3TCA A;  4ZRI A;  2HUE B;  4Z5T C;  3WA9 C;  1BH9 A;  5E5A C;  3MNN B;  3AN2 A;  2GCL A;  1P3G A;  2RSG A;  2YS5 A;  3MNN D;  3PEG A;  4GPT B;  3REH B;  3TU4 B;  3OHM B;  1P3R A;  5AV6 D;  3U8Z A;  5DH9 B;  5BO0 A;  2Y2O A;  4H9N A;  4R8P B;  4J8W B;  3LJA A;  2OTX A;  4PNK A;  5IRS A;  1TAF A;  4KHA B;  1FB8 A;  3P6A A;  3REK D;  5B32 C;  3KUY A;  1KX4 C;  1WJ1 A;  2YF0 A;  4ZUX C;  5HE0 A;  5JHG A;  3AYW A;  5C6R A;  1M18 D;  4GOU A;  2D9X A;  1EF1 A;  4A6H A;  1P3O D;  3AZJ C;  3X1U A;  3AZH D;  1NTY A;  1P3K A;  1K5G B;  2KR0 A;  3PVW A;  1P3B B;  1V5P A;  4J8X C;  4K2O A;  1P3I D;  2K2J A;  5CPJ A;  2J0K A;  3WAA A;  5F99 B;  1N3H A;  3AZG C;  2I5F A;  1Q9C A;  1UPR A;  3X1S A;  4K17 A;  4Z5T A;  3WA9 A;  3ULC A;  5GT3 B;  1AOI A;  4R8P C;  3V5W A;  4CSQ A;  4GZU A;  1P34 B;  2YFW A;  2NQB A;  3F6T A;  2VRW B;  2Z59 A;  1EQZ D;  2COF A;  2KIE A;  4H9R B;  3X1U B;  4YS3 B;  2IO5 B;  1XKE A;  2DF4 C;  3O96 A;  3RCP A;  4H9S A;  1NI2 A;  4WU8 B;  1H10 A;  3HIE A;  4D6W A;  1S32 A;  1M1A D;  1WWS A;  3B0C W;  5B2I B;  1DDV A;  2COC A;  5AV8 D;  3W96 D;  1HTA A;  2DX1 A;  3WKJ A;  4QLC B;  4J8W A;  5D3W A;  3WYF B;  2R2Y A;  2ADZ A;  3MGP C;  1P3K D;  1P3M D;  4YM6 A;  1A7W A;  5LON B;  2L5A A;  5CPJ D;  4H9O B;  3WKJ B;  2EMS A;  5AVB B;  3MNN A;  5B32 A;  5KDM A;  3KUY C;  2HIO A;  3AN2 B;  1KX4 A;  1U35 C;  1ZLA A;  3AZK A;  3MGQ B;  2KGX B;  5GT0 A;  3UTB C;  1FGY A;  4WSF A;  3NWA A;  5BT1 D;  5B31 C;  1M7E A;  1FGZ A;  5CP6 B;  4X23 B;  4IFS A;  3WA0 A;  5GSU D;  1U2B A;  1K5D B;  4Z66 A;  5B40 B;  4C0A A;  2YFW B;  1P3A C;  2LY8 A;  4ZBJ B;  5CPI D;  5B1L B;  1Q67 A;  4KHO A;  5GOW B;  3AZE C;  1P34 A;  5C79 A;  1B67 A;  4UUZ B;  1I2H A;  5C5B B;  4L6E A;  4QLC D;  3A1K A;  5B1M C;  3AYW D;  2D4Q A;  4HB2 B;  3W98 C;  2ARO C;  2I1K A;  4EJN A;  4KUD D;  2FJ7 C;  3WKJ C;  5AV9 A;  2PYO B;  5BNX A;  2JSS A;  5GT3 C;  4AWL B;  1AQC A;  3KZ1 A;  3SO6 A;  1HQ3 D;  4CSR A;  3KY9 A;  3A1I A;  5HE1 A;  5JP4 A;  2ZY5 A;  1HQ3 B;  3NWF A;  1TZY A;  4WJ7 A;  3M1I B;  2NZD D;  1ZSQ A;  4H9S C;  3AJ4 A;  2HIO C;  1ZLA C;  3MGS B;  2DKQ A;  4A6K A;  3MGP B;  5BS7 C;  1JFI B;  2Z0Q A;  3ODO A;  5CP6 D;  4X23 D;  5AV9 B;  2VQR A;  3AZF B;  3UTA B;  3UTB A;  2R09 A;  5GXQ B;  1ULY A;  3MVD B;  1I7A A;  3X1S C;  3C1C C;  4ZBJ C;  3UT9 D;  4KHA A;  2Z0P A;  4TYZ A;  1ID3 B;  1DDW A;  1MAI A;  1SHC A;  5BO0 B;  4R8P A;  3KWQ A;  3W97 A;  5JRG C;  5B24 C;  1DRO A;  2W2X D;  2Y2J A;  2J59 M;  5B40 A;  4Z2M B;  4F7U P;  1P3G B;  4HAZ B;  3MGQ C;  4CAY B;  3AV1 C;  4WU9 D;  1DYN A;  1V5U A;  1EVH A;  4H8S A;  4A6F A;  5GT0 D;  3AN2 C;  1V88 A;  2D10 A;  3AZL C;  3KXB D;  1P3L A;  1EAZ A;  3X1T D;  1MKE A;  1OQN A;  1Y19 B;  1PMS A;  1F66 A;  2R0D A;  4CHJ A;  4XZQ D;  2OQB A;  3AV2 C;  4PQ0 A;  2D9Y A;  2F8N A;  5CPI A;  4H9O A;  4MK0 A;  2Z0O A;  5AY8 A;  3AZI D;  4Z66 D;  4OSN A;  3AZN D;  1R4V A;  3CIK A;  3W99 D;  3B6F D;  3BJI A;  3F0W A;  4QLC A;  1ID3 A;  2DFK A;  3NQU B;  3REI C;  2NBV A;  5CLL B;  3V9R B;  1XCG A;  2CV5 A;  3UTA A;  3TU4 D;  4HAT B;  2RIQ A;  1U27 A;  2P0D A;  4NE6 A;  5AVC B;  4AWL C;  4WZS B;  1U5G A;  4CHM A;  5AVB C;  1XD4 A;  3GYO A;  1N1J A;  3W98 B;  2DYN A;  3X1T B;  1ZM0 A;  4XUJ C;  2HUE C;  1AOI C;  1J0W A;  5B24 B;  2GS0 A;  3NSU A;  1Y5O A;  4JJN C;  5B1L C;  4ZRK A;  3D8D A;  3LZ0 C;  4KGC C;  2FFF B;  4Z5T B;  1X05 A;  4UUZ A;  2MWN B;  5C5B A;  3X1S B;  2KCJ A;  4Z2N A;  3W97 D;  2ARO A;  1P3I B;  1WGQ A;  2CWE A;  3REJ A;  1KX3 C;  4TKN A;  5B24 A;  3X1V D;  3AZH B;  5F99 D;  1DDM A;  5GXQ C;  3MVD C;  3IP4 C;  5B32 G;  3WTP C;  3UT9 A;  1UNP A;  1S32 C;  3PVL A;  5EFX A;  3VH5 W;  3AV1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...