2W2XD

Complex of rac2 and plcg2 spph domain
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
107
structure length
105
Chain Sequence
KQQGELYMWDSIDQKWTRHFCAIADAKLSFSDDIEQTMEEDNPLGSLCRGILDLNTYNVVKAPQGKNQKSFVFILEPKQDPPVEFATDKVEELFEWFQSIREITW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein/hydrolase
molecule keywords RAS-RELATED C3 BOTULINUM TOXIN SUBSTRATE 2
publication title Structural Insights Into Formation of an Active Signaling Complex between Rac and Phospholipase C Gamma 2.
pubmed doi rcsb
source organism Homo sapiens
total genus 23
structure length 105
sequence length 107
ec nomenclature ec 3.1.4.11: Phosphoinositide phospholipase C.
pdb deposition date 2008-11-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2w2xD00
4K17A 2D9XA 4EJNA 4KHBB 2QKLA 3AU4A 1EAZA 4WJ7A 1ZC3B 2P0DA 1NTVA 2KGXB 1DROA 1XODA 3KRWA 3G9WA 1FHOA 5JHHA 3VIAA 2FJLA 3V5WA 1X11A 1UEFA 1Y5OA 2D2QA 4Y94A 2OTXA 2Z0PA 1X05A 2M38A 2YSZA 5KQ1A 2P0HA 1N3HA 3QIJA 1K5DB 1WVHA 4GN1A 1PLSA 2CAYA 2D9WA 2J59M 4GPTB 3N7CA 1SHCA 4A5KA 1OQNA 1IRSA 3PG7A 1UPQA 1AQCA 3BINA 3RCPA 1OMWA 1Q67A 4EMOA 2COCA 1U5EA 2DTCA 4HB0B 4PNKA 3T06A 1KI1B 4KHAA 1PFJA 4H8SA 1W1GA 4HB4B 1V5UA 4DXAB 2HTHB 2J0KA 1U29A 4A6KA 3O96A 1P3RA 1XD4A 2JP2A 3DXCA 1KZGA 5JLJB 5DIFB 2AL6A 1DYNA 2R0DA 2D9VA 5LOPB 4K2OA 4HAZB 4A6FA 3A98B 2J0JA 5D3YA 4F7UP 4A6FB 3ZVRA 5L81A 1FHWA 4B6HA 4HAVB 3SO6A 2MFQA 4GMVA 1Z87A 2DHIA 4BBKA 3U8ZA 1V61A 2UZRA 2COAA 2RSGA 2H7DA 2EJ8A 1I7AA 2LYDA 3DXEA 2Z0QA 2P8VA 2Y8FA 5D3VA 1WG7A 1GC6A 4HB2B 2LOXA 2ADZA 5EFXA 4CHMA 1UPRA 1J19A 4CYEA 2KUPA 2N23A 2X18A 1FOEA 3HW2B 2Q13A 3PVUA 1I2HA 3ODOA 4KHOA 3D8EA 3PZDA 1U5FA 1NTYA 5HE0A 1XR0B 2GJYA 1U2BA 1V5PA 3SUZA 5C5BA 2DHJA 2YT1A 2KCJA 4C0AA 3PP2A 5C5BB 2DLWA 2W2WA 4P7IA 4EKUA 4F7HA 5C16A 4HAWB 2GCLA 2MDXA 3WYFB 2RLOA 4HDOA 5FI1A 1MIXA 5DHAB 4ZRKA 2I5CA 2VRWB 1U5GA 4IOYX 1XX0A 1ZVRA 5J3TA 2G35A 4A6HA 4ZRJA 2BCJA 1FGYA 2L1CA 1GG3A 4MK0A 3ULCA 5DI9B 3A8QA 4HAYB 1MAIA 2NMBA 4HHVA 4YL8A 1MK9B 1BAKA 4MT7A 2VKIA 4HAXB 4K81A 3TVVA 5D3XA 2K00A 2ELAA 4GZUA 4WVFB 3FSSA 1DDMA 3TCAA 3M1IB 4XWXA 1Y19B 2CY5A 5HE1A 4CHJA 1WJ1A 3AJ4A 5C6RA 5JHGA 2DHKA 3F0WA 4TKNA 2Z0OA 2DKQA 2ZPYA 1MPHA 1U27A 4KAXB 5FI0A 3KRXA 3CIKA 1K5GB 1BWNA 4YONA 2RUKB 2EC1A 1BTKA 3MPXA 4L6EA 1X1GA 2D9YA 2AEHA 1WGQA 1SGHA 3HK0A 1E5WA 2IFSA 4GMXB 1B55A 2DKPA 2ROZB 4DX90 1U5DA 2E2XA 2DX1A 1ZM0A 2YF0A 2Y7BA 2EMSA 5GOWB 3ODWA 2D10A 2LKOA 5C79A 3SNHA 3U7DA 3CXBB 3A8PA 3NSUA 1WGUA 1NU2A 2L2IA 2J0MA 1UNPA 5J3QA 2ELBA 1ISNA 2I1JA 4Z2MB 2YS1A 2YS5A 5CLLB 2H7EA 1UNQA 1DBHA 2GS0A 4IAPA 2DN6A 2RNRB 1LW3A 1KZ7A 3P7ZA 3ZDTA 2MKRA 1FHXA 3VOQA 3PVLA 2RGNB 4D0NB 1TXDA 2LULA 2OQBA 4WSFA 3FEHA 1FB8A 2DYQA 1EGXA 1RRPB 4PQ0A 1AWEA 1P6SA 1TQZA 1H10A 2D11A 3SYXA 1TJ6A 2Y8GA 2V76A 2M14A 3ULBA 1W1DA 2HE7A 1WI1A 2ROVA 1MKEA 2P0FA 1GC7A 1RJ2A 2K2JA 1OY2A 2EMTA 2I5FA 2K2UA 1P5TA 3OANA 5DHFB 4NY0A 3MDBC 5D3WA 3PVWA 5LONB 1H4RA 3DXDA 1DDWA 3AU5A 4F7GA 3ODXA 3PSCA 4HB3B 2W2XD 2CODA 2NZ8B 5KQ4A 2MWNB 5D27A 1BTNA 1FAOA 4DBBA 3QWMA 2YS3A 1ZC4B 2DFKA 3PEGA 2W2XC 3TFMA 4TYZA 2I1KA 2N0YA 2R09A 1QQGA 1NI2A 3P6AA 1W1HA 1X86A 1PMSA 5J3YA 3D8FA 1FGZA 4KVGB 3UZTA 2LG1A 3IVFA 1X1FA 2CY4A 3BJIA 2DA0A 3HQCA 5HE2A 2YT0A 2DX5A 3D8DA 3GYPA 2PZ1A 1V88A 1EF1A 4NSWA 5DH9B 4HDQA 2IYBA 4HATB 3ML4A 3TW1A 2DYNA 4Z2NA 2QKMA 5HE3A 2XQNM 1WJMA 1MIZB 2VSZA 2LOZA 5KCVA 3F5RA 4IFSA 1UNRA 3X23A 1XKEA 3GYOA 1M7EA 2UZSA 3WA0A 3TO1A 2RVBB 2COFA 1V89A 2YRYA 4MY6A 3QBVB 2GCJA 2CRFA 4GXBA 3SV1A 2UVMA 1XCGA 3FM8C 1ZSQA 4DX8A 4ZRIA 1DDVA 3KZ1A 5CLQB 1V5MA 2YVCA 2D9ZA 1MK7B 3KSYA 4K2PA 2D4QA 4HAUB 1J0WA 1EVHA 1LB1A 3KY9A 5JP4A 3LJUX 1M7RA 1QC6A
chains in the Genus database with same CATH superfamily
4K17A 4KHBA 2D9XA 4EJNA 4KHBB 2QKLA 3AU4A 1ZYIA 1EAZA 4WJ7A 3NWAA 1ZC3B 2P0DA 1NTVA 2KGXB 1DROA 1XODA 3KRWA 3G9WA 1FHOA 5JHHA 3VIAA 2FJLA 3V5WA 1X11A 1UEFA 1Y5OA 2D2QA 4Y94A 2OTXA 3B77A 2Z0PA 1X05A 2M38A 2YSZA 5KQ1A 2P0HA 1N3HA 3QIJA 1K5DB 1WVHA 4GN1A 1PLSA 2CAYA 5I2SA 2D9WA 2J59M 4GPTB 3N7CA 1SHCA 4A5KA 1OQNA 1IRSA 3PG7A 1UPQA 1AQCA 3BINA 3RCPA 1OMWA 1Q67A 3DCXA 4EMOA 2COCA 1U5EA 2DTCA 4HB0B 4PNKA 2ZKMX 3T06A 1KI1B 4KHAA 1PFJA 4H8SA 1W1GA 4HB4B 1V5UA 4DXAB 2HTHB 2J0KA 1U29A 4A6KA 3O96A 1P3RA 1XD4A 2JP2A 3DXCA 1KZGA 5JLJB 5DIFB 2AL6A 1DYNA 4L1RA 2R0DA 2D9VA 5LOPB 4K2OA 4HAZB 4A6FA 3A98B 2J0JA 5D3YA 4F7UP 4A6FB 4GNKB 3ZVRA 4OSNA 5L81A 1FHWA 4B6HA 4HAVB 3SO6A 2MFQA 4GMVA 1Z87A 2DHIA 4BBKA 3U8ZA 3NWDA 1V61A 2UZRA 2COAA 2RSGA 5M4YB 2H7DA 2EJ8A 1I7AA 2LYDA 3DXEA 2Z0QA 3A58A 2P8VA 2Y8FA 5D3VA 1WG7A 2K49A 1GC6A 4HB2B 2LOXA 2ADZA 5EFXA 4CHMA 1UPRA 1J19A 4CYEA 2KUPA 2N23A 2X18A 1FOEA 3HW2B 2Q13A 3PVUA 1I2HA 2Z4DA 3ODOA 4KHOA 3D8EA 3PZDA 1NTYA 1U5FA 5HE0A 1XR0B 2GJYA 1U2BA 1V5PA 3SUZA 5C5BA 2DHJA 2YT1A 2KCJA 4C0AA 3PP2A 5C5BB 2DLWA 2W2WA 4GOUA 4P7IA 4EKUA 4F7HA 5C16A 4HAWB 2GCLA 2MDXA 3WYFB 2RLOA 4HDOA 5FI1A 1MIXA 2NBVA 3NW8A 5DHAB 4ZRKA 2I5CA 2VRWB 1T77A 1U5GA 4IOYX 1XX0A 1ZVRA 5J3TA 2G35A 4A6HA 4ZRJA 2BCJA 1FGYA 2L1CA 1GG3A 4MK0A 3ULCA 5DI9B 3A8QA 4HAYB 2RRFA 1MAIA 2KUQA 2NMBA 4HHVA 4YL8A 1MK9B 2FJUB 1BAKA 4MT7A 2VKIA 4HAXB 2KIEA 4K81A 3TVVA 5D3XA 2K00A 2ELAA 4GZUA 4WVFB 3FSSA 1DDMA 3TCAA 3M1IB 4XWXA 1Y19B 2CY5A 5HE1A 3HSAA 3HIEA 4CHJA 1WJ1A 3AJ4A 5C6RA 5JHGA 2DHKA 3F0WA 4TKNA 2Z0OA 2DKQA 2KR0A 2ZPYA 1MPHA 1U27A 2Z14A 4KAXB 5FI0A 3KRXA 3CIKA 1K5GB 1BWNA 4YONA 2RUKB 2EC1A 1BTKA 3MPXA 4L6EA 1X1GA 2D9YA 2AEHA 1WGQA 1SGHA 4QXAB 3HK0A 1E5WA 2IFSA 4GMXB 1B55A 2DKPA 2ROZB 2Z59A 4DX90 1U5DA 2E2XA 2DX1A 1ZM0A 2YF0A 2Y7BA 4QJ4B 2EMSA 5GOWB 3ODWA 2D10A 2YT2A 2LKOA 3FVCA 5C79A 3SNHA 3U7DA 3CXBB 3A8PA 3NSUA 1WGUA 4QJ5B 1NU2A 2L2IA 2J0MA 1UNPA 5J3QA 2ELBA 1ISNA 2I1JA 4Z2MB 2YS1A 2YS5A 5CLLB 4DIXA 2H7EA 1UNQA 3NWFA 1DBHA 2GS0A 4IAPA 2DN6A 2RNRB 1LW3A 1KZ7A 3P7ZA 4HSIA 3ZDTA 2MKRA 1FHXA 3VOQA 3PVLA 2RGNB 4D0NB 1TXDA 2LULA 2OQBA 2R2YA 4WSFA 3FEHA 1FB8A 2DYQA 1EGXA 1RRPB 4PQ0A 2K8EA 1AWEA 1P6SA 1TQZA 1H10A 2D11A 3SYXA 1TJ6A 2Y8GA 2V76A 2M14A 4OT1A 3ULBA 1W1DA 2HE7A 1WI1A 1MI1A 2ROVA 4QJ3B 1MKEA 2P0FA 1GC7A 1RJ2A 2K2JA 5I2MA 1OY2A 3U12A 2EMTA 2I5FA 2K2UA 1P5TA 3OANA 5DHFB 4D6WA 4NY0A 3MDBC 2Z13A 3PVWA 5D3WA 2GUMA 5LONB 1H4RA 3DXDA 1DDWA 3AU5A 4F7GA 3ODXA 5LG4B 3PSCA 4HB3B 2W2XD 2CODA 2NZ8B 5KQ4A 2MWNB 5D27A 1BTNA 1FAOA 4DBBA 3QWMA 2YS3A 1ZC4B 2DFKA 3PEGA 2W2XC 3TFMA 4TYZA 2I1KA 2N0YA 2R09A 2KIGA 1QQGA 1NI2A 3OHMB 3P6AA 1W1HA 1X86A 1PMSA 5J3YA 3D8FA 1FGZA 4KVGB 3UZTA 2LG1A 3IVFA 1X1FA 5IRSA 4CSQA 2CY4A 3BJIA 2DA0A 3HQCA 5HE2A 2YT0A 2DX5A 3D8DA 3GYPA 2PZ1A 1V88A 1EF1A 4NSWA 5DH9B 4HDQA 2IYBA 4HATB 3ML4A 3TW1A 2DYNA 4Z2NA 2QKMA 5HE3A 2XQNM 1WJMA 1MIZB 2VSZA 2LOZA 5KCVA 3F5RA 4IFSA 1UNRA 3X23A 1XKEA 3GYOA 1M7EA 2UZSA 3WA0A 3TO1A 2RVBB 2COFA 1V89A 2YRYA 4MY6A 3QBVB 2GCJA 2CRFA 4GXBA 3SV1A 2UVMA 1XCGA 3FM8C 1ZSQA 4DX8A 4ZRIA 1DDVA 3KZ1A 5CLQB 1V5MA 2YVCA 2D9ZA 1MK7B 3KSYA 4K2PA 2D4QA 4HAUB 1J0WA 1EVHA 1LB1A 3KY9A 5JP4A 3LJUX 1M7RA 1QC6A
chains in the Genus database with same CATH topology
4K17A 2D9XA 4EJNA 4KHBB 2QKLA 3AU4A 1EAZA 4WJ7A 1ZC3B 2P0DA 1NTVA 2KGXB 1DROA 1XODA 3KRWA 3G9WA 1FHOA 5JHHA 3VIAA 2FJLA 3V5WA 1X11A 1UEFA 1Y5OA 2D2QA 4Y94A 2OTXA 2Z0PA 1X05A 2M38A 2YSZA 5KQ1A 2P0HA 1N3HA 3QIJA 1K5DB 1WVHA 4GN1A 1PLSA 2CAYA 2D9WA 2J59M 4GPTB 3N7CA 1SHCA 4A5KA 1OQNA 1IRSA 3PG7A 1UPQA 1AQCA 3BINA 3RCPA 1OMWA 1Q67A 4EMOA 2COCA 1U5EA 2DTCA 4HB0B 4PNKA 3T06A 1KI1B 4KHAA 1PFJA 4H8SA 1W1GA 4HB4B 1V5UA 4DXAB 2HTHB 2J0KA 1U29A 4A6KA 3O96A 1P3RA 1XD4A 2JP2A 3DXCA 1KZGA 5JLJB 5DIFB 2AL6A 1DYNA 2R0DA 2D9VA 5LOPB 4K2OA 4HAZB 4A6FA 3A98B 2J0JA 5D3YA 4F7UP 4A6FB 3ZVRA 5L81A 1FHWA 4B6HA 4HAVB 3SO6A 2MFQA 4GMVA 1Z87A 2DHIA 4BBKA 3U8ZA 1V61A 2UZRA 2COAA 2RSGA 2H7DA 2EJ8A 1I7AA 2LYDA 3DXEA 2Z0QA 2P8VA 2Y8FA 5D3VA 1WG7A 1GC6A 4HB2B 2LOXA 2ADZA 5EFXA 4CHMA 1UPRA 1J19A 4CYEA 2KUPA 2N23A 2X18A 1FOEA 3HW2B 2Q13A 3PVUA 1I2HA 3ODOA 4KHOA 3D8EA 3PZDA 1U5FA 1NTYA 5HE0A 1XR0B 2GJYA 1U2BA 1V5PA 3SUZA 5C5BA 2DHJA 2YT1A 2KCJA 4C0AA 3PP2A 5C5BB 2DLWA 2W2WA 4P7IA 4EKUA 4F7HA 5C16A 4HAWB 2GCLA 2MDXA 3WYFB 2RLOA 4HDOA 5FI1A 1MIXA 5DHAB 4ZRKA 2I5CA 2VRWB 1U5GA 4IOYX 1XX0A 1ZVRA 5J3TA 2G35A 4A6HA 4ZRJA 2BCJA 1FGYA 2L1CA 1GG3A 4MK0A 3ULCA 5DI9B 3A8QA 4HAYB 1MAIA 2NMBA 4HHVA 4YL8A 1MK9B 1BAKA 4MT7A 2VKIA 4HAXB 4K81A 3TVVA 5D3XA 2K00A 2ELAA 4GZUA 4WVFB 3FSSA 1DDMA 3TCAA 3M1IB 4XWXA 1Y19B 2CY5A 5HE1A 4CHJA 1WJ1A 3AJ4A 5C6RA 5JHGA 2DHKA 3F0WA 4TKNA 2Z0OA 2DKQA 2ZPYA 1MPHA 1U27A 4KAXB 5FI0A 3KRXA 3CIKA 1K5GB 1BWNA 4YONA 2RUKB 2EC1A 1BTKA 3MPXA 4L6EA 1X1GA 2D9YA 2AEHA 1WGQA 1SGHA 3HK0A 1E5WA 2IFSA 4GMXB 1B55A 2DKPA 2ROZB 4DX90 1U5DA 2E2XA 2DX1A 1ZM0A 2YF0A 2Y7BA 2EMSA 5GOWB 3ODWA 2D10A 2LKOA 5C79A 3SNHA 3U7DA 3CXBB 3A8PA 3NSUA 1WGUA 1NU2A 2L2IA 2J0MA 1UNPA 5J3QA 2ELBA 1ISNA 2I1JA 4Z2MB 2YS1A 2YS5A 5CLLB 2H7EA 1UNQA 1DBHA 2GS0A 4IAPA 2DN6A 2RNRB 1LW3A 1KZ7A 3P7ZA 3ZDTA 2MKRA 1FHXA 3VOQA 3PVLA 2RGNB 4D0NB 1TXDA 2LULA 2OQBA 4WSFA 3FEHA 1FB8A 2DYQA 1EGXA 1RRPB 4PQ0A 1AWEA 1P6SA 1TQZA 1H10A 2D11A 3SYXA 1TJ6A 2Y8GA 2V76A 2M14A 3ULBA 1W1DA 2HE7A 1WI1A 2ROVA 1MKEA 2P0FA 1GC7A 1RJ2A 2K2JA 1OY2A 2EMTA 2I5FA 2K2UA 1P5TA 3OANA 5DHFB 4NY0A 3MDBC 5D3WA 3PVWA 5LONB 1H4RA 3DXDA 1DDWA 3AU5A 4F7GA 3ODXA 3PSCA 4HB3B 2W2XD 2CODA 2NZ8B 5KQ4A 2MWNB 5D27A 1BTNA 1FAOA 4DBBA 3QWMA 2YS3A 1ZC4B 2DFKA 3PEGA 2W2XC 3TFMA 4TYZA 2I1KA 2N0YA 2R09A 1QQGA 1NI2A 3P6AA 1W1HA 1X86A 1PMSA 5J3YA 3D8FA 1FGZA 4KVGB 3UZTA 2LG1A 3IVFA 1X1FA 2CY4A 3BJIA 2DA0A 3HQCA 5HE2A 2YT0A 2DX5A 3D8DA 3GYPA 2PZ1A 1V88A 1EF1A 4NSWA 5DH9B 4HDQA 2IYBA 4HATB 3ML4A 3TW1A 2DYNA 4Z2NA 2QKMA 5HE3A 2XQNM 1WJMA 1MIZB 2VSZA 2LOZA 5KCVA 3F5RA 4IFSA 1UNRA 3X23A 1XKEA 3GYOA 1M7EA 2UZSA 3WA0A 3TO1A 2RVBB 2COFA 1V89A 2YRYA 4MY6A 3QBVB 2GCJA 2CRFA 4GXBA 3SV1A 2UVMA 1XCGA 3FM8C 1ZSQA 4DX8A 4ZRIA 1DDVA 3KZ1A 5CLQB 1V5MA 2YVCA 2D9ZA 1MK7B 3KSYA 4K2PA 2D4QA 4HAUB 1J0WA 1EVHA 1LB1A 3KY9A 5JP4A 3LJUX 1M7RA 1QC6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4K17 A;  2D9X A;  4EJN A;  4KHB B;  2QKL A;  3AU4 A;  1EAZ A;  4WJ7 A;  1ZC3 B;  2P0D A;  1NTV A;  2KGX B;  1DRO A;  1XOD A;  3KRW A;  3G9W A;  1FHO A;  5JHH A;  3VIA A;  2FJL A;  3V5W A;  1X11 A;  1UEF A;  1Y5O A;  2D2Q A;  4Y94 A;  2OTX A;  2Z0P A;  1X05 A;  2M38 A;  2YSZ A;  5KQ1 A;  2P0H A;  1N3H A;  3QIJ A;  1K5D B;  1WVH A;  4GN1 A;  1PLS A;  2CAY A;  2D9W A;  2J59 M;  4GPT B;  3N7C A;  1SHC A;  4A5K A;  1OQN A;  1IRS A;  3PG7 A;  1UPQ A;  1AQC A;  3BIN A;  3RCP A;  1OMW A;  1Q67 A;  4EMO A;  2COC A;  1U5E A;  2DTC A;  4HB0 B;  4PNK A;  3T06 A;  1KI1 B;  4KHA A;  1PFJ A;  4H8S A;  1W1G A;  4HB4 B;  1V5U A;  4DXA B;  2HTH B;  2J0K A;  1U29 A;  4A6K A;  3O96 A;  1P3R A;  1XD4 A;  2JP2 A;  3DXC A;  1KZG A;  5JLJ B;  5DIF B;  2AL6 A;  1DYN A;  2R0D A;  2D9V A;  5LOP B;  4K2O A;  4HAZ B;  4A6F A;  3A98 B;  2J0J A;  5D3Y A;  4F7U P;  4A6F B;  3ZVR A;  5L81 A;  1FHW A;  4B6H A;  4HAV B;  3SO6 A;  2MFQ A;  4GMV A;  1Z87 A;  2DHI A;  4BBK A;  3U8Z A;  1V61 A;  2UZR A;  2COA A;  2RSG A;  2H7D A;  2EJ8 A;  1I7A A;  2LYD A;  3DXE A;  2Z0Q A;  2P8V A;  2Y8F A;  5D3V A;  1WG7 A;  1GC6 A;  4HB2 B;  2LOX A;  2ADZ A;  5EFX A;  4CHM A;  1UPR A;  1J19 A;  4CYE A;  2KUP A;  2N23 A;  2X18 A;  1FOE A;  3HW2 B;  2Q13 A;  3PVU A;  1I2H A;  3ODO A;  4KHO A;  3D8E A;  3PZD A;  1U5F A;  1NTY A;  5HE0 A;  1XR0 B;  2GJY A;  1U2B A;  1V5P A;  3SUZ A;  5C5B A;  2DHJ A;  2YT1 A;  2KCJ A;  4C0A A;  3PP2 A;  5C5B B;  2DLW A;  2W2W A;  4P7I A;  4EKU A;  4F7H A;  5C16 A;  4HAW B;  2GCL A;  2MDX A;  3WYF B;  2RLO A;  4HDO A;  5FI1 A;  1MIX A;  5DHA B;  4ZRK A;  2I5C A;  2VRW B;  1U5G A;  4IOY X;  1XX0 A;  1ZVR A;  5J3T A;  2G35 A;  4A6H A;  4ZRJ A;  2BCJ A;  1FGY A;  2L1C A;  1GG3 A;  4MK0 A;  3ULC A;  5DI9 B;  3A8Q A;  4HAY B;  1MAI A;  2NMB A;  4HHV A;  4YL8 A;  1MK9 B;  1BAK A;  4MT7 A;  2VKI A;  4HAX B;  4K81 A;  3TVV A;  5D3X A;  2K00 A;  2ELA A;  4GZU A;  4WVF B;  3FSS A;  1DDM A;  3TCA A;  3M1I B;  4XWX A;  1Y19 B;  2CY5 A;  5HE1 A;  4CHJ A;  1WJ1 A;  3AJ4 A;  5C6R A;  5JHG A;  2DHK A;  3F0W A;  4TKN A;  2Z0O A;  2DKQ A;  2ZPY A;  1MPH A;  1U27 A;  4KAX B;  5FI0 A;  3KRX A;  3CIK A;  1K5G B;  1BWN A;  4YON A;  2RUK B;  2EC1 A;  1BTK A;  3MPX A;  4L6E A;  1X1G A;  2D9Y A;  2AEH A;  1WGQ A;  1SGH A;  3HK0 A;  1E5W A;  2IFS A;  4GMX B;  1B55 A;  2DKP A;  2ROZ B;  4DX9 0;  1U5D A;  2E2X A;  2DX1 A;  1ZM0 A;  2YF0 A;  2Y7B A;  2EMS A;  5GOW B;  3ODW A;  2D10 A;  2LKO A;  5C79 A;  3SNH A;  3U7D A;  3CXB B;  3A8P A;  3NSU A;  1WGU A;  1NU2 A;  2L2I A;  2J0M A;  1UNP A;  5J3Q A;  2ELB A;  1ISN A;  2I1J A;  4Z2M B;  2YS1 A;  2YS5 A;  5CLL B;  2H7E A;  1UNQ A;  1DBH A;  2GS0 A;  4IAP A;  2DN6 A;  2RNR B;  1LW3 A;  1KZ7 A;  3P7Z A;  3ZDT A;  2MKR A;  1FHX A;  3VOQ A;  3PVL A;  2RGN B;  4D0N B;  1TXD A;  2LUL A;  2OQB A;  4WSF A;  3FEH A;  1FB8 A;  2DYQ A;  1EGX A;  1RRP B;  4PQ0 A;  1AWE A;  1P6S A;  1TQZ A;  1H10 A;  2D11 A;  3SYX A;  1TJ6 A;  2Y8G A;  2V76 A;  2M14 A;  3ULB A;  1W1D A;  2HE7 A;  1WI1 A;  2ROV A;  1MKE A;  2P0F A;  1GC7 A;  1RJ2 A;  2K2J A;  1OY2 A;  2EMT A;  2I5F A;  2K2U A;  1P5T A;  3OAN A;  5DHF B;  4NY0 A;  3MDB C;  5D3W A;  3PVW A;  5LON B;  1H4R A;  3DXD A;  1DDW A;  3AU5 A;  4F7G A;  3ODX A;  3PSC A;  4HB3 B;  2W2X D;  2COD A;  2NZ8 B;  5KQ4 A;  2MWN B;  5D27 A;  1BTN A;  1FAO A;  4DBB A;  3QWM A;  2YS3 A;  1ZC4 B;  2DFK A;  3PEG A;  2W2X C;  3TFM A;  4TYZ A;  2I1K A;  2N0Y A;  2R09 A;  1QQG A;  1NI2 A;  3P6A A;  1W1H A;  1X86 A;  1PMS A;  5J3Y A;  3D8F A;  1FGZ A;  4KVG B;  3UZT A;  2LG1 A;  3IVF A;  1X1F A;  2CY4 A;  3BJI A;  2DA0 A;  3HQC A;  5HE2 A;  2YT0 A;  2DX5 A;  3D8D A;  3GYP A;  2PZ1 A;  1V88 A;  1EF1 A;  4NSW A;  5DH9 B;  4HDQ A;  2IYB A;  4HAT B;  3ML4 A;  3TW1 A;  2DYN A;  4Z2N A;  2QKM A;  5HE3 A;  2XQN M;  1WJM A;  1MIZ B;  2VSZ A;  2LOZ A;  5KCV A;  3F5R A;  4IFS A;  1UNR A;  3X23 A;  1XKE A;  3GYO A;  1M7E A;  2UZS A;  3WA0 A;  3TO1 A;  2RVB B;  2COF A;  1V89 A;  2YRY A;  4MY6 A;  3QBV B;  2GCJ A;  2CRF A;  4GXB A;  3SV1 A;  2UVM A;  1XCG A;  3FM8 C;  1ZSQ A;  4DX8 A;  4ZRI A;  1DDV A;  3KZ1 A;  5CLQ B;  1V5M A;  2YVC A;  2D9Z A;  1MK7 B;  3KSY A;  4K2P A;  2D4Q A;  4HAU B;  1J0W A;  1EVH A;  1LB1 A;  3KY9 A;  5JP4 A;  3LJU X;  1M7R A;  1QC6 A; 
#chains in the Genus database with same CATH topology
 4K17 A;  4KHB A;  2D9X A;  4EJN A;  4KHB B;  2QKL A;  3AU4 A;  1ZYI A;  1EAZ A;  4WJ7 A;  3NWA A;  1ZC3 B;  2P0D A;  1NTV A;  2KGX B;  1DRO A;  1XOD A;  3KRW A;  3G9W A;  1FHO A;  5JHH A;  3VIA A;  2FJL A;  3V5W A;  1X11 A;  1UEF A;  1Y5O A;  2D2Q A;  4Y94 A;  2OTX A;  3B77 A;  2Z0P A;  1X05 A;  2M38 A;  2YSZ A;  5KQ1 A;  2P0H A;  1N3H A;  3QIJ A;  1K5D B;  1WVH A;  4GN1 A;  1PLS A;  2CAY A;  5I2S A;  2D9W A;  2J59 M;  4GPT B;  3N7C A;  1SHC A;  4A5K A;  1OQN A;  1IRS A;  3PG7 A;  1UPQ A;  1AQC A;  3BIN A;  3RCP A;  1OMW A;  1Q67 A;  3DCX A;  4EMO A;  2COC A;  1U5E A;  2DTC A;  4HB0 B;  4PNK A;  2ZKM X;  3T06 A;  1KI1 B;  4KHA A;  1PFJ A;  4H8S A;  1W1G A;  4HB4 B;  1V5U A;  4DXA B;  2HTH B;  2J0K A;  1U29 A;  4A6K A;  3O96 A;  1P3R A;  1XD4 A;  2JP2 A;  3DXC A;  1KZG A;  5JLJ B;  5DIF B;  2AL6 A;  1DYN A;  4L1R A;  2R0D A;  2D9V A;  5LOP B;  4K2O A;  4HAZ B;  4A6F A;  3A98 B;  2J0J A;  5D3Y A;  4F7U P;  4A6F B;  4GNK B;  3ZVR A;  4OSN A;  5L81 A;  1FHW A;  4B6H A;  4HAV B;  3SO6 A;  2MFQ A;  4GMV A;  1Z87 A;  2DHI A;  4BBK A;  3U8Z A;  3NWD A;  1V61 A;  2UZR A;  2COA A;  2RSG A;  5M4Y B;  2H7D A;  2EJ8 A;  1I7A A;  2LYD A;  3DXE A;  2Z0Q A;  3A58 A;  2P8V A;  2Y8F A;  5D3V A;  1WG7 A;  2K49 A;  1GC6 A;  4HB2 B;  2LOX A;  2ADZ A;  5EFX A;  4CHM A;  1UPR A;  1J19 A;  4CYE A;  2KUP A;  2N23 A;  2X18 A;  1FOE A;  3HW2 B;  2Q13 A;  3PVU A;  1I2H A;  2Z4D A;  3ODO A;  4KHO A;  3D8E A;  3PZD A;  1NTY A;  1U5F A;  5HE0 A;  1XR0 B;  2GJY A;  1U2B A;  1V5P A;  3SUZ A;  5C5B A;  2DHJ A;  2YT1 A;  2KCJ A;  4C0A A;  3PP2 A;  5C5B B;  2DLW A;  2W2W A;  4GOU A;  4P7I A;  4EKU A;  4F7H A;  5C16 A;  4HAW B;  2GCL A;  2MDX A;  3WYF B;  2RLO A;  4HDO A;  5FI1 A;  1MIX A;  2NBV A;  3NW8 A;  5DHA B;  4ZRK A;  2I5C A;  2VRW B;  1T77 A;  1U5G A;  4IOY X;  1XX0 A;  1ZVR A;  5J3T A;  2G35 A;  4A6H A;  4ZRJ A;  2BCJ A;  1FGY A;  2L1C A;  1GG3 A;  4MK0 A;  3ULC A;  5DI9 B;  3A8Q A;  4HAY B;  2RRF A;  1MAI A;  2KUQ A;  2NMB A;  4HHV A;  4YL8 A;  1MK9 B;  2FJU B;  1BAK A;  4MT7 A;  2VKI A;  4HAX B;  2KIE A;  4K81 A;  3TVV A;  5D3X A;  2K00 A;  2ELA A;  4GZU A;  4WVF B;  3FSS A;  1DDM A;  3TCA A;  3M1I B;  4XWX A;  1Y19 B;  2CY5 A;  5HE1 A;  3HSA A;  3HIE A;  4CHJ A;  1WJ1 A;  3AJ4 A;  5C6R A;  5JHG A;  2DHK A;  3F0W A;  4TKN A;  2Z0O A;  2DKQ A;  2KR0 A;  2ZPY A;  1MPH A;  1U27 A;  2Z14 A;  4KAX B;  5FI0 A;  3KRX A;  3CIK A;  1K5G B;  1BWN A;  4YON A;  2RUK B;  2EC1 A;  1BTK A;  3MPX A;  4L6E A;  1X1G A;  2D9Y A;  2AEH A;  1WGQ A;  1SGH A;  4QXA B;  3HK0 A;  1E5W A;  2IFS A;  4GMX B;  1B55 A;  2DKP A;  2ROZ B;  2Z59 A;  4DX9 0;  1U5D A;  2E2X A;  2DX1 A;  1ZM0 A;  2YF0 A;  2Y7B A;  4QJ4 B;  2EMS A;  5GOW B;  3ODW A;  2D10 A;  2YT2 A;  2LKO A;  3FVC A;  5C79 A;  3SNH A;  3U7D A;  3CXB B;  3A8P A;  3NSU A;  1WGU A;  4QJ5 B;  1NU2 A;  2L2I A;  2J0M A;  1UNP A;  5J3Q A;  2ELB A;  1ISN A;  2I1J A;  4Z2M B;  2YS1 A;  2YS5 A;  5CLL B;  4DIX A;  2H7E A;  1UNQ A;  3NWF A;  1DBH A;  2GS0 A;  4IAP A;  2DN6 A;  2RNR B;  1LW3 A;  1KZ7 A;  3P7Z A;  4HSI A;  3ZDT A;  2MKR A;  1FHX A;  3VOQ A;  3PVL A;  2RGN B;  4D0N B;  1TXD A;  2LUL A;  2OQB A;  2R2Y A;  4WSF A;  3FEH A;  1FB8 A;  2DYQ A;  1EGX A;  1RRP B;  4PQ0 A;  2K8E A;  1AWE A;  1P6S A;  1TQZ A;  1H10 A;  2D11 A;  3SYX A;  1TJ6 A;  2Y8G A;  2V76 A;  2M14 A;  4OT1 A;  3ULB A;  1W1D A;  2HE7 A;  1WI1 A;  1MI1 A;  2ROV A;  4QJ3 B;  1MKE A;  2P0F A;  1GC7 A;  1RJ2 A;  2K2J A;  5I2M A;  1OY2 A;  3U12 A;  2EMT A;  2I5F A;  2K2U A;  1P5T A;  3OAN A;  5DHF B;  4D6W A;  4NY0 A;  3MDB C;  2Z13 A;  3PVW A;  5D3W A;  2GUM A;  5LON B;  1H4R A;  3DXD A;  1DDW A;  3AU5 A;  4F7G A;  3ODX A;  5LG4 B;  3PSC A;  4HB3 B;  2W2X D;  2COD A;  2NZ8 B;  5KQ4 A;  2MWN B;  5D27 A;  1BTN A;  1FAO A;  4DBB A;  3QWM A;  2YS3 A;  1ZC4 B;  2DFK A;  3PEG A;  2W2X C;  3TFM A;  4TYZ A;  2I1K A;  2N0Y A;  2R09 A;  2KIG A;  1QQG A;  1NI2 A;  3OHM B;  3P6A A;  1W1H A;  1X86 A;  1PMS A;  5J3Y A;  3D8F A;  1FGZ A;  4KVG B;  3UZT A;  2LG1 A;  3IVF A;  1X1F A;  5IRS A;  4CSQ A;  2CY4 A;  3BJI A;  2DA0 A;  3HQC A;  5HE2 A;  2YT0 A;  2DX5 A;  3D8D A;  3GYP A;  2PZ1 A;  1V88 A;  1EF1 A;  4NSW A;  5DH9 B;  4HDQ A;  2IYB A;  4HAT B;  3ML4 A;  3TW1 A;  2DYN A;  4Z2N A;  2QKM A;  5HE3 A;  2XQN M;  1WJM A;  1MIZ B;  2VSZ A;  2LOZ A;  5KCV A;  3F5R A;  4IFS A;  1UNR A;  3X23 A;  1XKE A;  3GYO A;  1M7E A;  2UZS A;  3WA0 A;  3TO1 A;  2RVB B;  2COF A;  1V89 A;  2YRY A;  4MY6 A;  3QBV B;  2GCJ A;  2CRF A;  4GXB A;  3SV1 A;  2UVM A;  1XCG A;  3FM8 C;  1ZSQ A;  4DX8 A;  4ZRI A;  1DDV A;  3KZ1 A;  5CLQ B;  1V5M A;  2YVC A;  2D9Z A;  1MK7 B;  3KSY A;  4K2P A;  2D4Q A;  4HAU B;  1J0W A;  1EVH A;  1LB1 A;  3KY9 A;  5JP4 A;  3LJU X;  1M7R A;  1QC6 A; 
#chains in the Genus database with same CATH homology
 4K17 A;  2D9X A;  4EJN A;  4KHB B;  2QKL A;  3AU4 A;  1EAZ A;  4WJ7 A;  1ZC3 B;  2P0D A;  1NTV A;  2KGX B;  1DRO A;  1XOD A;  3KRW A;  3G9W A;  1FHO A;  5JHH A;  3VIA A;  2FJL A;  3V5W A;  1X11 A;  1UEF A;  1Y5O A;  2D2Q A;  4Y94 A;  2OTX A;  2Z0P A;  1X05 A;  2M38 A;  2YSZ A;  5KQ1 A;  2P0H A;  1N3H A;  3QIJ A;  1K5D B;  1WVH A;  4GN1 A;  1PLS A;  2CAY A;  2D9W A;  2J59 M;  4GPT B;  3N7C A;  1SHC A;  4A5K A;  1OQN A;  1IRS A;  3PG7 A;  1UPQ A;  1AQC A;  3BIN A;  3RCP A;  1OMW A;  1Q67 A;  4EMO A;  2COC A;  1U5E A;  2DTC A;  4HB0 B;  4PNK A;  3T06 A;  1KI1 B;  4KHA A;  1PFJ A;  4H8S A;  1W1G A;  4HB4 B;  1V5U A;  4DXA B;  2HTH B;  2J0K A;  1U29 A;  4A6K A;  3O96 A;  1P3R A;  1XD4 A;  2JP2 A;  3DXC A;  1KZG A;  5JLJ B;  5DIF B;  2AL6 A;  1DYN A;  2R0D A;  2D9V A;  5LOP B;  4K2O A;  4HAZ B;  4A6F A;  3A98 B;  2J0J A;  5D3Y A;  4F7U P;  4A6F B;  3ZVR A;  5L81 A;  1FHW A;  4B6H A;  4HAV B;  3SO6 A;  2MFQ A;  4GMV A;  1Z87 A;  2DHI A;  4BBK A;  3U8Z A;  1V61 A;  2UZR A;  2COA A;  2RSG A;  2H7D A;  2EJ8 A;  1I7A A;  2LYD A;  3DXE A;  2Z0Q A;  2P8V A;  2Y8F A;  5D3V A;  1WG7 A;  1GC6 A;  4HB2 B;  2LOX A;  2ADZ A;  5EFX A;  4CHM A;  1UPR A;  1J19 A;  4CYE A;  2KUP A;  2N23 A;  2X18 A;  1FOE A;  3HW2 B;  2Q13 A;  3PVU A;  1I2H A;  3ODO A;  4KHO A;  3D8E A;  3PZD A;  1U5F A;  1NTY A;  5HE0 A;  1XR0 B;  2GJY A;  1U2B A;  1V5P A;  3SUZ A;  5C5B A;  2DHJ A;  2YT1 A;  2KCJ A;  4C0A A;  3PP2 A;  5C5B B;  2DLW A;  2W2W A;  4P7I A;  4EKU A;  4F7H A;  5C16 A;  4HAW B;  2GCL A;  2MDX A;  3WYF B;  2RLO A;  4HDO A;  5FI1 A;  1MIX A;  5DHA B;  4ZRK A;  2I5C A;  2VRW B;  1U5G A;  4IOY X;  1XX0 A;  1ZVR A;  5J3T A;  2G35 A;  4A6H A;  4ZRJ A;  2BCJ A;  1FGY A;  2L1C A;  1GG3 A;  4MK0 A;  3ULC A;  5DI9 B;  3A8Q A;  4HAY B;  1MAI A;  2NMB A;  4HHV A;  4YL8 A;  1MK9 B;  1BAK A;  4MT7 A;  2VKI A;  4HAX B;  4K81 A;  3TVV A;  5D3X A;  2K00 A;  2ELA A;  4GZU A;  4WVF B;  3FSS A;  1DDM A;  3TCA A;  3M1I B;  4XWX A;  1Y19 B;  2CY5 A;  5HE1 A;  4CHJ A;  1WJ1 A;  3AJ4 A;  5C6R A;  5JHG A;  2DHK A;  3F0W A;  4TKN A;  2Z0O A;  2DKQ A;  2ZPY A;  1MPH A;  1U27 A;  4KAX B;  5FI0 A;  3KRX A;  3CIK A;  1K5G B;  1BWN A;  4YON A;  2RUK B;  2EC1 A;  1BTK A;  3MPX A;  4L6E A;  1X1G A;  2D9Y A;  2AEH A;  1WGQ A;  1SGH A;  3HK0 A;  1E5W A;  2IFS A;  4GMX B;  1B55 A;  2DKP A;  2ROZ B;  4DX9 0;  1U5D A;  2E2X A;  2DX1 A;  1ZM0 A;  2YF0 A;  2Y7B A;  2EMS A;  5GOW B;  3ODW A;  2D10 A;  2LKO A;  5C79 A;  3SNH A;  3U7D A;  3CXB B;  3A8P A;  3NSU A;  1WGU A;  1NU2 A;  2L2I A;  2J0M A;  1UNP A;  5J3Q A;  2ELB A;  1ISN A;  2I1J A;  4Z2M B;  2YS1 A;  2YS5 A;  5CLL B;  2H7E A;  1UNQ A;  1DBH A;  2GS0 A;  4IAP A;  2DN6 A;  2RNR B;  1LW3 A;  1KZ7 A;  3P7Z A;  3ZDT A;  2MKR A;  1FHX A;  3VOQ A;  3PVL A;  2RGN B;  4D0N B;  1TXD A;  2LUL A;  2OQB A;  4WSF A;  3FEH A;  1FB8 A;  2DYQ A;  1EGX A;  1RRP B;  4PQ0 A;  1AWE A;  1P6S A;  1TQZ A;  1H10 A;  2D11 A;  3SYX A;  1TJ6 A;  2Y8G A;  2V76 A;  2M14 A;  3ULB A;  1W1D A;  2HE7 A;  1WI1 A;  2ROV A;  1MKE A;  2P0F A;  1GC7 A;  1RJ2 A;  2K2J A;  1OY2 A;  2EMT A;  2I5F A;  2K2U A;  1P5T A;  3OAN A;  5DHF B;  4NY0 A;  3MDB C;  5D3W A;  3PVW A;  5LON B;  1H4R A;  3DXD A;  1DDW A;  3AU5 A;  4F7G A;  3ODX A;  3PSC A;  4HB3 B;  2W2X D;  2COD A;  2NZ8 B;  5KQ4 A;  2MWN B;  5D27 A;  1BTN A;  1FAO A;  4DBB A;  3QWM A;  2YS3 A;  1ZC4 B;  2DFK A;  3PEG A;  2W2X C;  3TFM A;  4TYZ A;  2I1K A;  2N0Y A;  2R09 A;  1QQG A;  1NI2 A;  3P6A A;  1W1H A;  1X86 A;  1PMS A;  5J3Y A;  3D8F A;  1FGZ A;  4KVG B;  3UZT A;  2LG1 A;  3IVF A;  1X1F A;  2CY4 A;  3BJI A;  2DA0 A;  3HQC A;  5HE2 A;  2YT0 A;  2DX5 A;  3D8D A;  3GYP A;  2PZ1 A;  1V88 A;  1EF1 A;  4NSW A;  5DH9 B;  4HDQ A;  2IYB A;  4HAT B;  3ML4 A;  3TW1 A;  2DYN A;  4Z2N A;  2QKM A;  5HE3 A;  2XQN M;  1WJM A;  1MIZ B;  2VSZ A;  2LOZ A;  5KCV A;  3F5R A;  4IFS A;  1UNR A;  3X23 A;  1XKE A;  3GYO A;  1M7E A;  2UZS A;  3WA0 A;  3TO1 A;  2RVB B;  2COF A;  1V89 A;  2YRY A;  4MY6 A;  3QBV B;  2GCJ A;  2CRF A;  4GXB A;  3SV1 A;  2UVM A;  1XCG A;  3FM8 C;  1ZSQ A;  4DX8 A;  4ZRI A;  1DDV A;  3KZ1 A;  5CLQ B;  1V5M A;  2YVC A;  2D9Z A;  1MK7 B;  3KSY A;  4K2P A;  2D4Q A;  4HAU B;  1J0W A;  1EVH A;  1LB1 A;  3KY9 A;  5JP4 A;  3LJU X;  1M7R A;  1QC6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...