2W2XD

Complex of rac2 and plcg2 spph domain
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
107
structure length
105
Chain Sequence
KQQGELYMWDSIDQKWTRHFCAIADAKLSFSDDIEQTMEEDNPLGSLCRGILDLNTYNVVKAPQGKNQKSFVFILEPKQDPPVEFATDKVEELFEWFQSIREITW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RAS-RELATED C3 BOTULINUM TOXIN SUBSTRATE 2
publication title Structural Insights Into Formation of an Active Signaling Complex between Rac and Phospholipase C Gamma 2.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein/hydrolase
total genus 23
structure length 105
sequence length 107
ec nomenclature ec 3.1.4.11: Phosphoinositide phospholipase C.
pdb deposition date 2008-11-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2w2xD00
1FHXA 5DH9B 1J0WA 3PP2A 2K2UA 1J19A 2D9VA 3DXEA 4HAVB 2YSZA 1FOEA 3WYFB 1N3HA 1U2BA 1X05A 2ELBA 1WJMA 2DN6A 5D3WA 2VRWB 1X1GA 5L81A 2YRYA 2W2WA 4CHJA 1WGUA 2EMSA 2LOZA 2D10A 1QQGA 4HB2B 1NI2A 3TVVA 2MWNB 2COCA 2J59M 1P6SA 2DKQA 4HAUB 2J0JA 1U5FA 2GS0A 3TFMA 3PZDA 4HB0B 1SGHA 4HAXB 3KSYA 1AWEA 1GC6A 2P0HA 1XODA 1BAKA 3KZ1A 2DX5A 3BJIA 4Y94A 5HE0A 5EFXA 2I5FA 2Q13A 3HK0A 5D3XA 2QKLA 3AJ4A 4GZUA 2YT0A 4KVGB 1V89A 2HE7A 2H7DA 2D9YA 1P5TA 1MIZB 1XR0B 2UZRA 4XWXA 1DDWA 5DHAB 4KHAA 2RGNB 4CHMA 3TW1A 2M14A 4K17A 3D8EA 4F7GA 1DDMA 2ROVA 5C16A 1K5DB 3GYOA 1RJ2A 4K2OA 1EF1A 3TO1A 3U8ZA 2K00A 1BTNA 3ZVRA 3BINA 3F0WA 5JP4A 4C0AA 3P7ZA 2W2XC 2YVCA 1FGYA 2CRFA 1DROA 1FGZA 5KQ1A 2Y7BA 4WJ7A 1UPQA 1XKEA 1Z87A 4K81A 2NZ8B 2GCLA 2ELAA 2P0DA 4DX8A 4GMVA 2OTXA 4TKNA 4HDOA 5D3VA 1FB8A 1MIXA 5LONB 2RLOA 3D8DA 1UNPA 2DHJA 5HE1A 1GG3A 1XD4A 4B6HA 2DYQA 2K2JA 1U5DA 5HE2A 3NSUA 5CLQB 4HAWB 2V76A 2RUKB 3ZDTA 1UNRA 1PFJA 1NTVA 3O96A 3GYPA 3AU5A 2LYDA 1X86A 1XX0A 1WI1A 2DHKA 5KCVA 2HTHB 1ZC4B 2RVBB 4K2PA 4H8SA 3MPXA 2DKPA 4BBKA 4NSWA 5C5BB 1LW3A 2Z0PA 4L6EA 2CY4A 1MK9B 4YL8A 5J3YA 2LKOA 2I1JA 3N7CA 2BCJA 3KRWA 1W1DA 3ODXA 1ISNA 4ZRJA 4EMOA 1WGQA 5DHFB 1X11A 2MDXA 2OQBA 3U7DA 4TYZA 1ZM0A 3PVWA 5DI9B 2RSGA 4IOYX 4NY0A 2KCJA 3WA0A 3P6AA 1DYNA 4HHVA 3MDBC 2GJYA 2DFKA 1NU2A 1OMWA 3KRXA 2D9XA 1OQNA 3QBVB 2R09A 1MAIA 1W1GA 3HW2B 1EVHA 5JLJB 3CXBB 1TXDA 3ULCA 1V5PA 5D27A 1V88A 5FI1A 3VOQA 2CAYA 4ZRIA 5C5BA 2JP2A 3SUZA 2COFA 5DIFB 1EAZA 1MKEA 2DHIA 2Y8GA 4KHBB 3D8FA 3AU4A 2G35A 2VKIA 2GCJA 3FEHA 1PLSA 3ODWA 1KZGA 1NTYA 3PVLA 1I7AA 4HATB 5JHGA 1I2HA 1V5UA 4A6FB 3DXDA 4CYEA 3PG7A 1KI1B 3SO6A 4PQ0A 2P8VA 4Z2NA 4YONA 4HDQA 2DYNA 4GMXB 1MK7B 3KY9A 3IVFA 2COAA 3PSCA 2D11A 1ZC3B 2Z0OA 1M7RA 1M7EA 4KAXB 1W1HA 2MFQA 2N0YA 4Z2MB 3V5WA 1K5GB 3FSSA 3SNHA 3M1IB 4F7HA 4EKUA 1Y5OA 5FI0A 1B55A 1WG7A 2D9ZA 2FJLA 1XCGA 3ODOA 3VIAA 1WVHA 5GOWB 1KZ7A 1EGXA 3TCAA 2YF0A 2M38A 2IYBA 3CIKA 3OANA 3DXCA 2YS1A 2D4QA 2L1CA 3T06A 1P3RA 2I1KA 3FM8C 3A8QA 2ZPYA 4HB3B 3QWMA 1ZVRA 2R0DA 4A5KA 2NMBA 2J0MA 4A6HA 2UZSA 4ZRKA 3A98B 1DBHA 1LB1A 2RNRB 3HQCA 2DA0A 1BWNA 2AL6A 2EC1A 2QKMA 2LOXA 1GC7A 2N23A 2AEHA 2DLWA 1H4RA 3SYXA 1QC6A 3A8PA 3QIJA 4A6FA 2DTCA 1FAOA 1ZSQA 2CY5A 1SHCA 1TQZA 2W2XD 5JHHA 2X18A 5LOPB 1PMSA 4IFSA 1U5GA 3G9WA 4HB4B 3PEGA 1BTKA 1OY2A 2MKRA 4GXBA 2ROZB 4D0NB 2CODA 2P0FA 4DX90 2D2QA 5D3YA 2ADZA 1FHWA 5C6RA 4MT7A 2VSZA 1E5WA 1V5MA 4HAYB 2L2IA 3ML4A 2J0KA 4WVFB 1U29A 2Z0QA 2H7EA 4A6KA 1FHOA 5CLLB 5C79A 2KGXB 2E2XA 4EJNA 4DBBA 4PNKA 1WJ1A 1TJ6A 2EMTA 3RCPA 1RRPB 2YS3A 4GN1A 3LJUX 2PZ1A 4GPTB 5J3QA 4IAPA 1H10A 2I5CA 3SV1A 1Y19B 4MK0A 4MY6A 1U5EA 1UEFA 2YS5A 2EJ8A 3F5RA 2XQNM 1AQCA 4HAZB 3X23A 4KHOA 4WSFA 5KQ4A 2IFSA 2YT1A 1U27A 1MPHA 4DXAB 1Q67A 5J3TA 2LG1A 1IRSA 4P7IA 2LULA 2D9WA 3UZTA 2KUPA 2UVMA 2DX1A 3ULBA 2Y8FA 1V61A 3PVUA 1UNQA 1DDVA 4F7UP 1X1FA 1UPRA 5HE3A
chains in the Genus database with same CATH superfamily
1FHXA 5DH9B 1J0WA 3PP2A 2K2UA 1J19A 2D9VA 3DXEA 4HAVB 2YSZA 4GNKB 4GOUA 1FOEA 3WYFB 1N3HA 2YT2A 1U2BA 1X05A 2ELBA 1WJMA 2DN6A 5D3WA 2VRWB 1X1GA 5L81A 2YRYA 2W2WA 4CHJA 1WGUA 2EMSA 2LOZA 2D10A 2NBVA 1QQGA 2FJUB 4HB2B 1NI2A 3TVVA 2MWNB 2COCA 2J59M 1P6SA 2Z13A 2DKQA 4HAUB 2J0JA 1U5FA 3U12A 2GS0A 3TFMA 3PZDA 4HB0B 1SGHA 4HAXB 3KSYA 1AWEA 1GC6A 2P0HA 1XODA 1BAKA 2K8EA 3KZ1A 2DX5A 3BJIA 4Y94A 5HE0A 5EFXA 2I5FA 2Q13A 3HK0A 5D3XA 2QKLA 3AJ4A 4GZUA 2YT0A 4KVGB 1V89A 5I2SA 2HE7A 2H7DA 2D9YA 1P5TA 1MIZB 1XR0B 2UZRA 4XWXA 1DDWA 5DHAB 4KHAA 2RGNB 4CHMA 3HIEA 3TW1A 2M14A 4K17A 3D8EA 4F7GA 1DDMA 2ROVA 5C16A 1K5DB 3GYOA 1RJ2A 4K2OA 1EF1A 3TO1A 3U8ZA 2K00A 1BTNA 3ZVRA 3BINA 3F0WA 5JP4A 4C0AA 3NWAA 3P7ZA 2W2XC 2YVCA 1MI1A 1FGYA 2CRFA 1DROA 1FGZA 5KQ1A 2Y7BA 4WJ7A 1UPQA 1XKEA 1Z87A 4K81A 2NZ8B 2GCLA 2ELAA 3A58A 2P0DA 4DX8A 4GMVA 2OTXA 4TKNA 4HDOA 5D3VA 1FB8A 1MIXA 5LONB 2RLOA 3D8DA 2Z14A 1UNPA 2DHJA 5HE1A 1GG3A 1XD4A 4B6HA 2DYQA 2K2JA 1U5DA 5HE2A 3NSUA 5CLQB 4HAWB 2V76A 2RUKB 4QJ5B 3ZDTA 1UNRA 1PFJA 1NTVA 3O96A 3GYPA 2K49A 3AU5A 2LYDA 1X86A 1XX0A 1WI1A 2DHKA 5KCVA 2HTHB 1ZC4B 2RVBB 4K2PA 4H8SA 3MPXA 2DKPA 4BBKA 4NSWA 5C5BB 4QXAB 4HSIA 1LW3A 2Z0PA 4L6EA 2CY4A 1MK9B 4YL8A 5J3YA 2LKOA 2I1JA 3N7CA 2BCJA 3KRWA 1W1DA 3ODXA 1ISNA 1T77A 4ZRJA 4EMOA 1WGQA 3DCXA 5DHFB 1X11A 2MDXA 2OQBA 4L1RA 3U7DA 4TYZA 1ZM0A 3PVWA 5DI9B 2RSGA 4IOYX 4NY0A 2KCJA 3WA0A 3P6AA 1DYNA 4HHVA 3MDBC 2GJYA 2KIEA 2DFKA 1NU2A 4OT1A 1OMWA 3KRXA 2D9XA 1OQNA 3QBVB 2R09A 1MAIA 1W1GA 2KUQA 3HW2B 1EVHA 5JLJB 3CXBB 1TXDA 3ULCA 1V5PA 5D27A 4QJ4B 1V88A 5FI1A 3VOQA 2CAYA 4ZRIA 5C5BA 2JP2A 3SUZA 2COFA 5DIFB 2R2YA 1EAZA 1MKEA 2DHIA 2Y8GA 4KHBB 3D8FA 3NW8A 3AU4A 2G35A 2VKIA 2GCJA 3FEHA 1PLSA 3ODWA 3NWDA 1KZGA 1NTYA 3PVLA 1I7AA 4HATB 5JHGA 3FVCA 1I2HA 1V5UA 4A6FB 3DXDA 4CYEA 3PG7A 1KI1B 3SO6A 4PQ0A 2P8VA 4Z2NA 4YONA 4HDQA 2DYNA 4GMXB 1MK7B 3KY9A 3IVFA 2COAA 5M4YB 3PSCA 2D11A 1ZC3B 2Z0OA 1M7RA 1M7EA 4KAXB 1W1HA 2MFQA 2N0YA 4Z2MB 3V5WA 1K5GB 3FSSA 3SNHA 2RRFA 3M1IB 4F7HA 4EKUA 1Y5OA 5FI0A 1B55A 1WG7A 2D9ZA 2FJLA 1XCGA 3ODOA 3VIAA 1WVHA 5GOWB 1KZ7A 1EGXA 3TCAA 2YF0A 2M38A 2IYBA 3CIKA 3HSAA 3OANA 3DXCA 2YS1A 2D4QA 2L1CA 2Z4DA 3T06A 1P3RA 2I1KA 3FM8C 3A8QA 2ZPYA 4HB3B 3QWMA 1ZVRA 2R0DA 4A5KA 2NMBA 2J0MA 4A6HA 2UZSA 4ZRKA 4QJ3B 3A98B 2ZKMX 1DBHA 1LB1A 2RNRB 3HQCA 2DA0A 1BWNA 4KHBA 4DIXA 2AL6A 2EC1A 2QKMA 2LOXA 1GC7A 2N23A 2AEHA 4CSQA 2DLWA 1H4RA 5LG4B 3SYXA 1QC6A 3A8PA 3B77A 3QIJA 4A6FA 2DTCA 5IRSA 1FAOA 1ZSQA 2CY5A 1SHCA 1TQZA 2W2XD 5JHHA 2X18A 5LOPB 1PMSA 4IFSA 1U5GA 3G9WA 4HB4B 3PEGA 1BTKA 1OY2A 2MKRA 4GXBA 2ROZB 5I2MA 4D0NB 2CODA 2P0FA 4DX90 2D2QA 5D3YA 2ADZA 1FHWA 2Z59A 4OSNA 5C6RA 4MT7A 2VSZA 1E5WA 1V5MA 4HAYB 2L2IA 3ML4A 2J0KA 4WVFB 1U29A 2Z0QA 2H7EA 4A6KA 1FHOA 5CLLB 5C79A 2KGXB 2E2XA 4EJNA 4DBBA 4PNKA 1WJ1A 1TJ6A 2EMTA 3RCPA 1RRPB 2YS3A 4GN1A 3LJUX 2PZ1A 4GPTB 5J3QA 4IAPA 1H10A 2I5CA 3SV1A 4D6WA 1Y19B 4MK0A 4MY6A 1U5EA 3OHMB 1UEFA 2YS5A 2EJ8A 3F5RA 2XQNM 1AQCA 2GUMA 4HAZB 4KHOA 4WSFA 3X23A 5KQ4A 2IFSA 2YT1A 1U27A 1MPHA 4DXAB 1Q67A 5J3TA 3NWFA 2LG1A 1IRSA 4P7IA 2LULA 2KR0A 2D9WA 3UZTA 2KUPA 2UVMA 2DX1A 3ULBA 2Y8FA 1V61A 1ZYIA 3PVUA 1UNQA 1DDVA 4F7UP 1X1FA 1UPRA 5HE3A 2KIGA
chains in the Genus database with same CATH topology
1FHXA 5DH9B 1J0WA 3PP2A 2K2UA 1J19A 2D9VA 3DXEA 4HAVB 2YSZA 1FOEA 3WYFB 1N3HA 1U2BA 1X05A 2ELBA 1WJMA 2DN6A 5D3WA 2VRWB 1X1GA 5L81A 2YRYA 2W2WA 4CHJA 1WGUA 2EMSA 2LOZA 2D10A 1QQGA 4HB2B 1NI2A 3TVVA 2MWNB 2COCA 2J59M 1P6SA 2DKQA 4HAUB 2J0JA 1U5FA 2GS0A 3TFMA 3PZDA 4HB0B 1SGHA 4HAXB 3KSYA 1AWEA 1GC6A 2P0HA 1XODA 1BAKA 3KZ1A 2DX5A 3BJIA 4Y94A 5HE0A 5EFXA 2I5FA 2Q13A 3HK0A 5D3XA 2QKLA 3AJ4A 4GZUA 2YT0A 4KVGB 1V89A 2HE7A 2H7DA 2D9YA 1P5TA 1MIZB 1XR0B 2UZRA 4XWXA 1DDWA 5DHAB 4KHAA 2RGNB 4CHMA 3TW1A 2M14A 4K17A 3D8EA 4F7GA 1DDMA 2ROVA 5C16A 1K5DB 3GYOA 1RJ2A 4K2OA 1EF1A 3TO1A 3U8ZA 2K00A 1BTNA 3ZVRA 3BINA 3F0WA 5JP4A 4C0AA 3P7ZA 2W2XC 2YVCA 1FGYA 2CRFA 1DROA 1FGZA 5KQ1A 2Y7BA 4WJ7A 1UPQA 1XKEA 1Z87A 4K81A 2NZ8B 2GCLA 2ELAA 2P0DA 4DX8A 4GMVA 2OTXA 4TKNA 4HDOA 5D3VA 1FB8A 1MIXA 5LONB 2RLOA 3D8DA 1UNPA 2DHJA 5HE1A 1GG3A 1XD4A 4B6HA 2DYQA 2K2JA 1U5DA 5HE2A 3NSUA 5CLQB 4HAWB 2V76A 2RUKB 3ZDTA 1UNRA 1PFJA 1NTVA 3O96A 3GYPA 3AU5A 2LYDA 1X86A 1XX0A 1WI1A 2DHKA 5KCVA 2HTHB 1ZC4B 2RVBB 4K2PA 4H8SA 3MPXA 2DKPA 4BBKA 4NSWA 5C5BB 1LW3A 2Z0PA 4L6EA 2CY4A 1MK9B 4YL8A 5J3YA 2LKOA 2I1JA 3N7CA 2BCJA 3KRWA 1W1DA 3ODXA 1ISNA 4ZRJA 4EMOA 1WGQA 5DHFB 1X11A 2MDXA 2OQBA 3U7DA 4TYZA 1ZM0A 3PVWA 5DI9B 2RSGA 4IOYX 4NY0A 2KCJA 3WA0A 3P6AA 1DYNA 4HHVA 3MDBC 2GJYA 2DFKA 1NU2A 1OMWA 3KRXA 2D9XA 1OQNA 3QBVB 2R09A 1MAIA 1W1GA 3HW2B 1EVHA 5JLJB 3CXBB 1TXDA 3ULCA 1V5PA 5D27A 1V88A 5FI1A 3VOQA 2CAYA 4ZRIA 5C5BA 2JP2A 3SUZA 2COFA 5DIFB 1EAZA 1MKEA 2DHIA 2Y8GA 4KHBB 3D8FA 3AU4A 2G35A 2VKIA 2GCJA 3FEHA 1PLSA 3ODWA 1KZGA 1NTYA 3PVLA 1I7AA 4HATB 5JHGA 1I2HA 1V5UA 4A6FB 3DXDA 4CYEA 3PG7A 1KI1B 3SO6A 4PQ0A 2P8VA 4Z2NA 4YONA 4HDQA 2DYNA 4GMXB 1MK7B 3KY9A 3IVFA 2COAA 3PSCA 2D11A 1ZC3B 2Z0OA 1M7RA 1M7EA 4KAXB 1W1HA 2MFQA 2N0YA 4Z2MB 3V5WA 1K5GB 3FSSA 3SNHA 3M1IB 4F7HA 4EKUA 1Y5OA 5FI0A 1B55A 1WG7A 2D9ZA 2FJLA 1XCGA 3ODOA 3VIAA 1WVHA 5GOWB 1KZ7A 1EGXA 3TCAA 2YF0A 2M38A 2IYBA 3CIKA 3OANA 3DXCA 2YS1A 2D4QA 2L1CA 3T06A 1P3RA 2I1KA 3FM8C 3A8QA 2ZPYA 4HB3B 3QWMA 1ZVRA 2R0DA 4A5KA 2NMBA 2J0MA 4A6HA 2UZSA 4ZRKA 3A98B 1DBHA 1LB1A 2RNRB 3HQCA 2DA0A 1BWNA 2AL6A 2EC1A 2QKMA 2LOXA 1GC7A 2N23A 2AEHA 2DLWA 1H4RA 3SYXA 1QC6A 3A8PA 3QIJA 4A6FA 2DTCA 1FAOA 1ZSQA 2CY5A 1SHCA 1TQZA 2W2XD 5JHHA 2X18A 5LOPB 1PMSA 4IFSA 1U5GA 3G9WA 4HB4B 3PEGA 1BTKA 1OY2A 2MKRA 4GXBA 2ROZB 4D0NB 2CODA 2P0FA 4DX90 2D2QA 5D3YA 2ADZA 1FHWA 5C6RA 4MT7A 2VSZA 1E5WA 1V5MA 4HAYB 2L2IA 3ML4A 2J0KA 4WVFB 1U29A 2Z0QA 2H7EA 4A6KA 1FHOA 5CLLB 5C79A 2KGXB 2E2XA 4EJNA 4DBBA 4PNKA 1WJ1A 1TJ6A 2EMTA 3RCPA 1RRPB 2YS3A 4GN1A 3LJUX 2PZ1A 4GPTB 5J3QA 4IAPA 1H10A 2I5CA 3SV1A 1Y19B 4MK0A 4MY6A 1U5EA 1UEFA 2YS5A 2EJ8A 3F5RA 2XQNM 1AQCA 4HAZB 3X23A 4KHOA 4WSFA 5KQ4A 2IFSA 2YT1A 1U27A 1MPHA 4DXAB 1Q67A 5J3TA 2LG1A 1IRSA 4P7IA 2LULA 2D9WA 3UZTA 2KUPA 2UVMA 2DX1A 3ULBA 2Y8FA 1V61A 3PVUA 1UNQA 1DDVA 4F7UP 1X1FA 1UPRA 5HE3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FHX A;  5DH9 B;  1J0W A;  3PP2 A;  2K2U A;  1J19 A;  2D9V A;  3DXE A;  4HAV B;  2YSZ A;  1FOE A;  3WYF B;  1N3H A;  1U2B A;  1X05 A;  2ELB A;  1WJM A;  2DN6 A;  5D3W A;  2VRW B;  1X1G A;  5L81 A;  2YRY A;  2W2W A;  4CHJ A;  1WGU A;  2EMS A;  2LOZ A;  2D10 A;  1QQG A;  4HB2 B;  1NI2 A;  3TVV A;  2MWN B;  2COC A;  2J59 M;  1P6S A;  2DKQ A;  4HAU B;  2J0J A;  1U5F A;  2GS0 A;  3TFM A;  3PZD A;  4HB0 B;  1SGH A;  4HAX B;  3KSY A;  1AWE A;  1GC6 A;  2P0H A;  1XOD A;  1BAK A;  3KZ1 A;  2DX5 A;  3BJI A;  4Y94 A;  5HE0 A;  5EFX A;  2I5F A;  2Q13 A;  3HK0 A;  5D3X A;  2QKL A;  3AJ4 A;  4GZU A;  2YT0 A;  4KVG B;  1V89 A;  2HE7 A;  2H7D A;  2D9Y A;  1P5T A;  1MIZ B;  1XR0 B;  2UZR A;  4XWX A;  1DDW A;  5DHA B;  4KHA A;  2RGN B;  4CHM A;  3TW1 A;  2M14 A;  4K17 A;  3D8E A;  4F7G A;  1DDM A;  2ROV A;  5C16 A;  1K5D B;  3GYO A;  1RJ2 A;  4K2O A;  1EF1 A;  3TO1 A;  3U8Z A;  2K00 A;  1BTN A;  3ZVR A;  3BIN A;  3F0W A;  5JP4 A;  4C0A A;  3P7Z A;  2W2X C;  2YVC A;  1FGY A;  2CRF A;  1DRO A;  1FGZ A;  5KQ1 A;  2Y7B A;  4WJ7 A;  1UPQ A;  1XKE A;  1Z87 A;  4K81 A;  2NZ8 B;  2GCL A;  2ELA A;  2P0D A;  4DX8 A;  4GMV A;  2OTX A;  4TKN A;  4HDO A;  5D3V A;  1FB8 A;  1MIX A;  5LON B;  2RLO A;  3D8D A;  1UNP A;  2DHJ A;  5HE1 A;  1GG3 A;  1XD4 A;  4B6H A;  2DYQ A;  2K2J A;  1U5D A;  5HE2 A;  3NSU A;  5CLQ B;  4HAW B;  2V76 A;  2RUK B;  3ZDT A;  1UNR A;  1PFJ A;  1NTV A;  3O96 A;  3GYP A;  3AU5 A;  2LYD A;  1X86 A;  1XX0 A;  1WI1 A;  2DHK A;  5KCV A;  2HTH B;  1ZC4 B;  2RVB B;  4K2P A;  4H8S A;  3MPX A;  2DKP A;  4BBK A;  4NSW A;  5C5B B;  1LW3 A;  2Z0P A;  4L6E A;  2CY4 A;  1MK9 B;  4YL8 A;  5J3Y A;  2LKO A;  2I1J A;  3N7C A;  2BCJ A;  3KRW A;  1W1D A;  3ODX A;  1ISN A;  4ZRJ A;  4EMO A;  1WGQ A;  5DHF B;  1X11 A;  2MDX A;  2OQB A;  3U7D A;  4TYZ A;  1ZM0 A;  3PVW A;  5DI9 B;  2RSG A;  4IOY X;  4NY0 A;  2KCJ A;  3WA0 A;  3P6A A;  1DYN A;  4HHV A;  3MDB C;  2GJY A;  2DFK A;  1NU2 A;  1OMW A;  3KRX A;  2D9X A;  1OQN A;  3QBV B;  2R09 A;  1MAI A;  1W1G A;  3HW2 B;  1EVH A;  5JLJ B;  3CXB B;  1TXD A;  3ULC A;  1V5P A;  5D27 A;  1V88 A;  5FI1 A;  3VOQ A;  2CAY A;  4ZRI A;  5C5B A;  2JP2 A;  3SUZ A;  2COF A;  5DIF B;  1EAZ A;  1MKE A;  2DHI A;  2Y8G A;  4KHB B;  3D8F A;  3AU4 A;  2G35 A;  2VKI A;  2GCJ A;  3FEH A;  1PLS A;  3ODW A;  1KZG A;  1NTY A;  3PVL A;  1I7A A;  4HAT B;  5JHG A;  1I2H A;  1V5U A;  4A6F B;  3DXD A;  4CYE A;  3PG7 A;  1KI1 B;  3SO6 A;  4PQ0 A;  2P8V A;  4Z2N A;  4YON A;  4HDQ A;  2DYN A;  4GMX B;  1MK7 B;  3KY9 A;  3IVF A;  2COA A;  3PSC A;  2D11 A;  1ZC3 B;  2Z0O A;  1M7R A;  1M7E A;  4KAX B;  1W1H A;  2MFQ A;  2N0Y A;  4Z2M B;  3V5W A;  1K5G B;  3FSS A;  3SNH A;  3M1I B;  4F7H A;  4EKU A;  1Y5O A;  5FI0 A;  1B55 A;  1WG7 A;  2D9Z A;  2FJL A;  1XCG A;  3ODO A;  3VIA A;  1WVH A;  5GOW B;  1KZ7 A;  1EGX A;  3TCA A;  2YF0 A;  2M38 A;  2IYB A;  3CIK A;  3OAN A;  3DXC A;  2YS1 A;  2D4Q A;  2L1C A;  3T06 A;  1P3R A;  2I1K A;  3FM8 C;  3A8Q A;  2ZPY A;  4HB3 B;  3QWM A;  1ZVR A;  2R0D A;  4A5K A;  2NMB A;  2J0M A;  4A6H A;  2UZS A;  4ZRK A;  3A98 B;  1DBH A;  1LB1 A;  2RNR B;  3HQC A;  2DA0 A;  1BWN A;  2AL6 A;  2EC1 A;  2QKM A;  2LOX A;  1GC7 A;  2N23 A;  2AEH A;  2DLW A;  1H4R A;  3SYX A;  1QC6 A;  3A8P A;  3QIJ A;  4A6F A;  2DTC A;  1FAO A;  1ZSQ A;  2CY5 A;  1SHC A;  1TQZ A;  2W2X D;  5JHH A;  2X18 A;  5LOP B;  1PMS A;  4IFS A;  1U5G A;  3G9W A;  4HB4 B;  3PEG A;  1BTK A;  1OY2 A;  2MKR A;  4GXB A;  2ROZ B;  4D0N B;  2COD A;  2P0F A;  4DX9 0;  2D2Q A;  5D3Y A;  2ADZ A;  1FHW A;  5C6R A;  4MT7 A;  2VSZ A;  1E5W A;  1V5M A;  4HAY B;  2L2I A;  3ML4 A;  2J0K A;  4WVF B;  1U29 A;  2Z0Q A;  2H7E A;  4A6K A;  1FHO A;  5CLL B;  5C79 A;  2KGX B;  2E2X A;  4EJN A;  4DBB A;  4PNK A;  1WJ1 A;  1TJ6 A;  2EMT A;  3RCP A;  1RRP B;  2YS3 A;  4GN1 A;  3LJU X;  2PZ1 A;  4GPT B;  5J3Q A;  4IAP A;  1H10 A;  2I5C A;  3SV1 A;  1Y19 B;  4MK0 A;  4MY6 A;  1U5E A;  1UEF A;  2YS5 A;  2EJ8 A;  3F5R A;  2XQN M;  1AQC A;  4HAZ B;  3X23 A;  4KHO A;  4WSF A;  5KQ4 A;  2IFS A;  2YT1 A;  1U27 A;  1MPH A;  4DXA B;  1Q67 A;  5J3T A;  2LG1 A;  1IRS A;  4P7I A;  2LUL A;  2D9W A;  3UZT A;  2KUP A;  2UVM A;  2DX1 A;  3ULB A;  2Y8F A;  1V61 A;  3PVU A;  1UNQ A;  1DDV A;  4F7U P;  1X1F A;  1UPR A;  5HE3 A; 
#chains in the Genus database with same CATH topology
 1FHX A;  5DH9 B;  1J0W A;  3PP2 A;  2K2U A;  1J19 A;  2D9V A;  3DXE A;  4HAV B;  2YSZ A;  4GNK B;  4GOU A;  1FOE A;  3WYF B;  1N3H A;  2YT2 A;  1U2B A;  1X05 A;  2ELB A;  1WJM A;  2DN6 A;  5D3W A;  2VRW B;  1X1G A;  5L81 A;  2YRY A;  2W2W A;  4CHJ A;  1WGU A;  2EMS A;  2LOZ A;  2D10 A;  2NBV A;  1QQG A;  2FJU B;  4HB2 B;  1NI2 A;  3TVV A;  2MWN B;  2COC A;  2J59 M;  1P6S A;  2Z13 A;  2DKQ A;  4HAU B;  2J0J A;  1U5F A;  3U12 A;  2GS0 A;  3TFM A;  3PZD A;  4HB0 B;  1SGH A;  4HAX B;  3KSY A;  1AWE A;  1GC6 A;  2P0H A;  1XOD A;  1BAK A;  2K8E A;  3KZ1 A;  2DX5 A;  3BJI A;  4Y94 A;  5HE0 A;  5EFX A;  2I5F A;  2Q13 A;  3HK0 A;  5D3X A;  2QKL A;  3AJ4 A;  4GZU A;  2YT0 A;  4KVG B;  1V89 A;  5I2S A;  2HE7 A;  2H7D A;  2D9Y A;  1P5T A;  1MIZ B;  1XR0 B;  2UZR A;  4XWX A;  1DDW A;  5DHA B;  4KHA A;  2RGN B;  4CHM A;  3HIE A;  3TW1 A;  2M14 A;  4K17 A;  3D8E A;  4F7G A;  1DDM A;  2ROV A;  5C16 A;  1K5D B;  3GYO A;  1RJ2 A;  4K2O A;  1EF1 A;  3TO1 A;  3U8Z A;  2K00 A;  1BTN A;  3ZVR A;  3BIN A;  3F0W A;  5JP4 A;  4C0A A;  3NWA A;  3P7Z A;  2W2X C;  2YVC A;  1MI1 A;  1FGY A;  2CRF A;  1DRO A;  1FGZ A;  5KQ1 A;  2Y7B A;  4WJ7 A;  1UPQ A;  1XKE A;  1Z87 A;  4K81 A;  2NZ8 B;  2GCL A;  2ELA A;  3A58 A;  2P0D A;  4DX8 A;  4GMV A;  2OTX A;  4TKN A;  4HDO A;  5D3V A;  1FB8 A;  1MIX A;  5LON B;  2RLO A;  3D8D A;  2Z14 A;  1UNP A;  2DHJ A;  5HE1 A;  1GG3 A;  1XD4 A;  4B6H A;  2DYQ A;  2K2J A;  1U5D A;  5HE2 A;  3NSU A;  5CLQ B;  4HAW B;  2V76 A;  2RUK B;  4QJ5 B;  3ZDT A;  1UNR A;  1PFJ A;  1NTV A;  3O96 A;  3GYP A;  2K49 A;  3AU5 A;  2LYD A;  1X86 A;  1XX0 A;  1WI1 A;  2DHK A;  5KCV A;  2HTH B;  1ZC4 B;  2RVB B;  4K2P A;  4H8S A;  3MPX A;  2DKP A;  4BBK A;  4NSW A;  5C5B B;  4QXA B;  4HSI A;  1LW3 A;  2Z0P A;  4L6E A;  2CY4 A;  1MK9 B;  4YL8 A;  5J3Y A;  2LKO A;  2I1J A;  3N7C A;  2BCJ A;  3KRW A;  1W1D A;  3ODX A;  1ISN A;  1T77 A;  4ZRJ A;  4EMO A;  1WGQ A;  3DCX A;  5DHF B;  1X11 A;  2MDX A;  2OQB A;  4L1R A;  3U7D A;  4TYZ A;  1ZM0 A;  3PVW A;  5DI9 B;  2RSG A;  4IOY X;  4NY0 A;  2KCJ A;  3WA0 A;  3P6A A;  1DYN A;  4HHV A;  3MDB C;  2GJY A;  2KIE A;  2DFK A;  1NU2 A;  4OT1 A;  1OMW A;  3KRX A;  2D9X A;  1OQN A;  3QBV B;  2R09 A;  1MAI A;  1W1G A;  2KUQ A;  3HW2 B;  1EVH A;  5JLJ B;  3CXB B;  1TXD A;  3ULC A;  1V5P A;  5D27 A;  4QJ4 B;  1V88 A;  5FI1 A;  3VOQ A;  2CAY A;  4ZRI A;  5C5B A;  2JP2 A;  3SUZ A;  2COF A;  5DIF B;  2R2Y A;  1EAZ A;  1MKE A;  2DHI A;  2Y8G A;  4KHB B;  3D8F A;  3NW8 A;  3AU4 A;  2G35 A;  2VKI A;  2GCJ A;  3FEH A;  1PLS A;  3ODW A;  3NWD A;  1KZG A;  1NTY A;  3PVL A;  1I7A A;  4HAT B;  5JHG A;  3FVC A;  1I2H A;  1V5U A;  4A6F B;  3DXD A;  4CYE A;  3PG7 A;  1KI1 B;  3SO6 A;  4PQ0 A;  2P8V A;  4Z2N A;  4YON A;  4HDQ A;  2DYN A;  4GMX B;  1MK7 B;  3KY9 A;  3IVF A;  2COA A;  5M4Y B;  3PSC A;  2D11 A;  1ZC3 B;  2Z0O A;  1M7R A;  1M7E A;  4KAX B;  1W1H A;  2MFQ A;  2N0Y A;  4Z2M B;  3V5W A;  1K5G B;  3FSS A;  3SNH A;  2RRF A;  3M1I B;  4F7H A;  4EKU A;  1Y5O A;  5FI0 A;  1B55 A;  1WG7 A;  2D9Z A;  2FJL A;  1XCG A;  3ODO A;  3VIA A;  1WVH A;  5GOW B;  1KZ7 A;  1EGX A;  3TCA A;  2YF0 A;  2M38 A;  2IYB A;  3CIK A;  3HSA A;  3OAN A;  3DXC A;  2YS1 A;  2D4Q A;  2L1C A;  2Z4D A;  3T06 A;  1P3R A;  2I1K A;  3FM8 C;  3A8Q A;  2ZPY A;  4HB3 B;  3QWM A;  1ZVR A;  2R0D A;  4A5K A;  2NMB A;  2J0M A;  4A6H A;  2UZS A;  4ZRK A;  4QJ3 B;  3A98 B;  2ZKM X;  1DBH A;  1LB1 A;  2RNR B;  3HQC A;  2DA0 A;  1BWN A;  4KHB A;  4DIX A;  2AL6 A;  2EC1 A;  2QKM A;  2LOX A;  1GC7 A;  2N23 A;  2AEH A;  4CSQ A;  2DLW A;  1H4R A;  5LG4 B;  3SYX A;  1QC6 A;  3A8P A;  3B77 A;  3QIJ A;  4A6F A;  2DTC A;  5IRS A;  1FAO A;  1ZSQ A;  2CY5 A;  1SHC A;  1TQZ A;  2W2X D;  5JHH A;  2X18 A;  5LOP B;  1PMS A;  4IFS A;  1U5G A;  3G9W A;  4HB4 B;  3PEG A;  1BTK A;  1OY2 A;  2MKR A;  4GXB A;  2ROZ B;  5I2M A;  4D0N B;  2COD A;  2P0F A;  4DX9 0;  2D2Q A;  5D3Y A;  2ADZ A;  1FHW A;  2Z59 A;  4OSN A;  5C6R A;  4MT7 A;  2VSZ A;  1E5W A;  1V5M A;  4HAY B;  2L2I A;  3ML4 A;  2J0K A;  4WVF B;  1U29 A;  2Z0Q A;  2H7E A;  4A6K A;  1FHO A;  5CLL B;  5C79 A;  2KGX B;  2E2X A;  4EJN A;  4DBB A;  4PNK A;  1WJ1 A;  1TJ6 A;  2EMT A;  3RCP A;  1RRP B;  2YS3 A;  4GN1 A;  3LJU X;  2PZ1 A;  4GPT B;  5J3Q A;  4IAP A;  1H10 A;  2I5C A;  3SV1 A;  4D6W A;  1Y19 B;  4MK0 A;  4MY6 A;  1U5E A;  3OHM B;  1UEF A;  2YS5 A;  2EJ8 A;  3F5R A;  2XQN M;  1AQC A;  2GUM A;  4HAZ B;  4KHO A;  4WSF A;  3X23 A;  5KQ4 A;  2IFS A;  2YT1 A;  1U27 A;  1MPH A;  4DXA B;  1Q67 A;  5J3T A;  3NWF A;  2LG1 A;  1IRS A;  4P7I A;  2LUL A;  2KR0 A;  2D9W A;  3UZT A;  2KUP A;  2UVM A;  2DX1 A;  3ULB A;  2Y8F A;  1V61 A;  1ZYI A;  3PVU A;  1UNQ A;  1DDV A;  4F7U P;  1X1F A;  1UPR A;  5HE3 A;  2KIG A; 
#chains in the Genus database with same CATH homology
 1FHX A;  5DH9 B;  1J0W A;  3PP2 A;  2K2U A;  1J19 A;  2D9V A;  3DXE A;  4HAV B;  2YSZ A;  1FOE A;  3WYF B;  1N3H A;  1U2B A;  1X05 A;  2ELB A;  1WJM A;  2DN6 A;  5D3W A;  2VRW B;  1X1G A;  5L81 A;  2YRY A;  2W2W A;  4CHJ A;  1WGU A;  2EMS A;  2LOZ A;  2D10 A;  1QQG A;  4HB2 B;  1NI2 A;  3TVV A;  2MWN B;  2COC A;  2J59 M;  1P6S A;  2DKQ A;  4HAU B;  2J0J A;  1U5F A;  2GS0 A;  3TFM A;  3PZD A;  4HB0 B;  1SGH A;  4HAX B;  3KSY A;  1AWE A;  1GC6 A;  2P0H A;  1XOD A;  1BAK A;  3KZ1 A;  2DX5 A;  3BJI A;  4Y94 A;  5HE0 A;  5EFX A;  2I5F A;  2Q13 A;  3HK0 A;  5D3X A;  2QKL A;  3AJ4 A;  4GZU A;  2YT0 A;  4KVG B;  1V89 A;  2HE7 A;  2H7D A;  2D9Y A;  1P5T A;  1MIZ B;  1XR0 B;  2UZR A;  4XWX A;  1DDW A;  5DHA B;  4KHA A;  2RGN B;  4CHM A;  3TW1 A;  2M14 A;  4K17 A;  3D8E A;  4F7G A;  1DDM A;  2ROV A;  5C16 A;  1K5D B;  3GYO A;  1RJ2 A;  4K2O A;  1EF1 A;  3TO1 A;  3U8Z A;  2K00 A;  1BTN A;  3ZVR A;  3BIN A;  3F0W A;  5JP4 A;  4C0A A;  3P7Z A;  2W2X C;  2YVC A;  1FGY A;  2CRF A;  1DRO A;  1FGZ A;  5KQ1 A;  2Y7B A;  4WJ7 A;  1UPQ A;  1XKE A;  1Z87 A;  4K81 A;  2NZ8 B;  2GCL A;  2ELA A;  2P0D A;  4DX8 A;  4GMV A;  2OTX A;  4TKN A;  4HDO A;  5D3V A;  1FB8 A;  1MIX A;  5LON B;  2RLO A;  3D8D A;  1UNP A;  2DHJ A;  5HE1 A;  1GG3 A;  1XD4 A;  4B6H A;  2DYQ A;  2K2J A;  1U5D A;  5HE2 A;  3NSU A;  5CLQ B;  4HAW B;  2V76 A;  2RUK B;  3ZDT A;  1UNR A;  1PFJ A;  1NTV A;  3O96 A;  3GYP A;  3AU5 A;  2LYD A;  1X86 A;  1XX0 A;  1WI1 A;  2DHK A;  5KCV A;  2HTH B;  1ZC4 B;  2RVB B;  4K2P A;  4H8S A;  3MPX A;  2DKP A;  4BBK A;  4NSW A;  5C5B B;  1LW3 A;  2Z0P A;  4L6E A;  2CY4 A;  1MK9 B;  4YL8 A;  5J3Y A;  2LKO A;  2I1J A;  3N7C A;  2BCJ A;  3KRW A;  1W1D A;  3ODX A;  1ISN A;  4ZRJ A;  4EMO A;  1WGQ A;  5DHF B;  1X11 A;  2MDX A;  2OQB A;  3U7D A;  4TYZ A;  1ZM0 A;  3PVW A;  5DI9 B;  2RSG A;  4IOY X;  4NY0 A;  2KCJ A;  3WA0 A;  3P6A A;  1DYN A;  4HHV A;  3MDB C;  2GJY A;  2DFK A;  1NU2 A;  1OMW A;  3KRX A;  2D9X A;  1OQN A;  3QBV B;  2R09 A;  1MAI A;  1W1G A;  3HW2 B;  1EVH A;  5JLJ B;  3CXB B;  1TXD A;  3ULC A;  1V5P A;  5D27 A;  1V88 A;  5FI1 A;  3VOQ A;  2CAY A;  4ZRI A;  5C5B A;  2JP2 A;  3SUZ A;  2COF A;  5DIF B;  1EAZ A;  1MKE A;  2DHI A;  2Y8G A;  4KHB B;  3D8F A;  3AU4 A;  2G35 A;  2VKI A;  2GCJ A;  3FEH A;  1PLS A;  3ODW A;  1KZG A;  1NTY A;  3PVL A;  1I7A A;  4HAT B;  5JHG A;  1I2H A;  1V5U A;  4A6F B;  3DXD A;  4CYE A;  3PG7 A;  1KI1 B;  3SO6 A;  4PQ0 A;  2P8V A;  4Z2N A;  4YON A;  4HDQ A;  2DYN A;  4GMX B;  1MK7 B;  3KY9 A;  3IVF A;  2COA A;  3PSC A;  2D11 A;  1ZC3 B;  2Z0O A;  1M7R A;  1M7E A;  4KAX B;  1W1H A;  2MFQ A;  2N0Y A;  4Z2M B;  3V5W A;  1K5G B;  3FSS A;  3SNH A;  3M1I B;  4F7H A;  4EKU A;  1Y5O A;  5FI0 A;  1B55 A;  1WG7 A;  2D9Z A;  2FJL A;  1XCG A;  3ODO A;  3VIA A;  1WVH A;  5GOW B;  1KZ7 A;  1EGX A;  3TCA A;  2YF0 A;  2M38 A;  2IYB A;  3CIK A;  3OAN A;  3DXC A;  2YS1 A;  2D4Q A;  2L1C A;  3T06 A;  1P3R A;  2I1K A;  3FM8 C;  3A8Q A;  2ZPY A;  4HB3 B;  3QWM A;  1ZVR A;  2R0D A;  4A5K A;  2NMB A;  2J0M A;  4A6H A;  2UZS A;  4ZRK A;  3A98 B;  1DBH A;  1LB1 A;  2RNR B;  3HQC A;  2DA0 A;  1BWN A;  2AL6 A;  2EC1 A;  2QKM A;  2LOX A;  1GC7 A;  2N23 A;  2AEH A;  2DLW A;  1H4R A;  3SYX A;  1QC6 A;  3A8P A;  3QIJ A;  4A6F A;  2DTC A;  1FAO A;  1ZSQ A;  2CY5 A;  1SHC A;  1TQZ A;  2W2X D;  5JHH A;  2X18 A;  5LOP B;  1PMS A;  4IFS A;  1U5G A;  3G9W A;  4HB4 B;  3PEG A;  1BTK A;  1OY2 A;  2MKR A;  4GXB A;  2ROZ B;  4D0N B;  2COD A;  2P0F A;  4DX9 0;  2D2Q A;  5D3Y A;  2ADZ A;  1FHW A;  5C6R A;  4MT7 A;  2VSZ A;  1E5W A;  1V5M A;  4HAY B;  2L2I A;  3ML4 A;  2J0K A;  4WVF B;  1U29 A;  2Z0Q A;  2H7E A;  4A6K A;  1FHO A;  5CLL B;  5C79 A;  2KGX B;  2E2X A;  4EJN A;  4DBB A;  4PNK A;  1WJ1 A;  1TJ6 A;  2EMT A;  3RCP A;  1RRP B;  2YS3 A;  4GN1 A;  3LJU X;  2PZ1 A;  4GPT B;  5J3Q A;  4IAP A;  1H10 A;  2I5C A;  3SV1 A;  1Y19 B;  4MK0 A;  4MY6 A;  1U5E A;  1UEF A;  2YS5 A;  2EJ8 A;  3F5R A;  2XQN M;  1AQC A;  4HAZ B;  3X23 A;  4KHO A;  4WSF A;  5KQ4 A;  2IFS A;  2YT1 A;  1U27 A;  1MPH A;  4DXA B;  1Q67 A;  5J3T A;  2LG1 A;  1IRS A;  4P7I A;  2LUL A;  2D9W A;  3UZT A;  2KUP A;  2UVM A;  2DX1 A;  3ULB A;  2Y8F A;  1V61 A;  3PVU A;  1UNQ A;  1DDV A;  4F7U P;  1X1F A;  1UPR A;  5HE3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...