4DX90

Icap1 in complex with integrin beta 1 cytoplasmic tail
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
137
structure length
110
Chain Sequence
CAEFRIKYVGAIGPLDLINYIDVAQQDGKLPFVPPEEEFIMGVSKYGIKVSTLHRHALYLIIRMVCYDDGLGAKSLLALKTSLWVYQCNSLEQAQAICKVLSTAFDSVLT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding
molecule keywords Integrin beta-1-binding protein 1
publication title Mechanism for KRIT1 Release of ICAP1-Mediated Suppression of Integrin Activation.
pubmed doi rcsb
source organism Homo sapiens
total genus 16
structure length 110
sequence length 137
chains with identical sequence 1, 2, 3, 4, 5, A, C, E, G, I, K, M, O, Q, S, U, W, Y, a, c, e, g, i, k, m, o, q, s, u, w, y
ec nomenclature
pdb deposition date 2012-02-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 4dx9000
2MWNB 5KQ1A 1H10A 3TW1A 2D4QA 1LW3A 3SV1A 1GC7A 1DYNA 1Q67A 2YS3A 2H7EA 1WJ1A 2D9ZA 1W1GA 3GYOA 1NTYA 3A8QA 1PMSA 2Y8GA 1TQZA 5D3VA 1EVHA 3CIKA 3TVVA 3PVLA 3P6AA 2ADZA 5C5BB 5LONB 2D9VA 3SNHA 1V5UA 2DLWA 5FI1A 2DA0A 2X18A 4Y94A 2AL6A 4L6EA 2DTCA 2DKQA 1ZSQA 1OMWA 2RNRB 1FHOA 4GMVA 4EJNA 1NTVA 3HQCA 2GJYA 4EMOA 2FJLA 5JHHA 2COFA 3HK0A 4Z2NA 2YT1A 1MIXA 1B55A 2UZSA 2COAA 2I1JA 3PVWA 4ZRJA 2N0YA 5D3YA 4A6FA 1QQGA 3UZTA 1AWEA 3WA0A 3CXBB 2IFSA 1M7RA 1SGHA 1XKEA 3AU4A 4HAXB 2LOXA 1P6SA 5CLQB 1UPRA 2PZ1A 4HAYB 1U5DA 2I5CA 2RSGA 4GN1A 1V5PA 4HB2B 2P0DA 2DHJA 1N3HA 2W2XD 3A98B 4ZRIA 4DBBA 1XODA 4KVGB 3IVFA 4IAPA 1NI2A 3SUZA 5C5BA 2IYBA 2CY5A 3D8DA 2DX1A 2OQBA 1DDMA 3T06A 2Y7BA 3WYFB 2LKOA 4F7GA 1FHWA 1BAKA 3G9WA 1EGXA 2D9WA 4YL8A 5DHFB 1UNQA 1IRSA 2V76A 2YSZA 2YRYA 1X86A 1KZ7A 1BWNA 3MDBC 4KHBB 1ISNA 4IFSA 4HDOA 2BCJA 2Z0QA 4PQ0A 5CLLB 1GC6A 3F0WA 2EC1A 4TYZA 1U2BA 5C79A 2GCJA 1UNPA 4MK0A 3DXDA 2J0MA 4A6FB 4GZUA 5JP4A 5HE0A 2QKLA 1FHXA 4YONA 3PZDA 1XR0B 2VRWB 4A5KA 3PG7A 4CHJA 5HE3A 1DBHA 2P0FA 3MPXA 3ODWA 1DDWA 4GXBA 5KCVA 2GCLA 3LJUX 4K2OA 2EJ8A 3FSSA 1U5EA 2P8VA 1U5GA 1X11A 2I5FA 3PEGA 2COCA 1XCGA 4HATB 2YS1A 4MT7A 1LB1A 4DX8A 3QWMA 1RRPB 2LOZA 1X1GA 1P3RA 4P7IA 1DROA 5L81A 3P7ZA 4K2PA 3BJIA 1J0WA 1WGQA 1GG3A 3FEHA 3ODXA 2R0DA 3NSUA 1SHCA 4HHVA 1FGYA 2N23A 1KI1B 2ELAA 3KRWA 4XWXA 1WG7A 4A6HA 1NU2A 3D8EA 2DKPA 1M7EA 5LOPB 2W2WA 3OANA 5DH9B 3ULCA 2YVCA 1RJ2A 3RCPA 2ROZB 2I1KA 1XX0A 3ML4A 3AU5A 1UEFA 3QIJA 4MY6A 2K2UA 1WJMA 4C0AA 4F7HA 4K17A 2RVBB 3V5WA 2LYDA 2Z0OA 1UNRA 1MKEA 4CHMA 1Z87A 1BTKA 4TKNA 4D0NB 1AQCA 5HE2A 5D3XA 2EMSA 2ZPYA 5D3WA 2YF0A 3D8FA 1V88A 1PLSA 1KZGA 1Y5OA 2K2JA 2KGXB 5HE1A 3ZVRA 1MK7B 1U29A 1PFJA 1OY2A 2MDXA 4HAVB 5C6RA 5J3QA 4B6HA 1H4RA 4EKUA 5DIFB 2MKRA 1W1HA 1ZM0A 1FAOA 3BINA 2KUPA 2D10A 4HAUB 2VKIA 3KSYA 1EF1A 4BBKA 3SYXA 2XQNM 4KHOA 2RUKB 3N7CA 4CYEA 2DFKA 4H8SA 2ELBA 3KY9A 2YS5A 2W2XC 1U5FA 1ZVRA 2LG1A 3ZDTA 1W1DA 1OQNA 2GS0A 1WVHA 4KHAA 1TJ6A 2HTHB 3U7DA 4Z2MB 2P0HA 2Z0PA 1I2HA 2DHKA 2YT0A 5J3TA 3O96A 5D27A 1X1FA 1EAZA 5JLJB 2JP2A 1U27A 1FOEA 1UPQA 2NMBA 2DN6A 2D9YA 1ZC3B 1QC6A 2VSZA 4GMXB 3DXEA 4WSFA 4DXAB 1I7AA 3X23A 2NZ8B 3TFMA 3KRXA 4HAZB 4WJ7A 2J0JA 5KQ4A 2D2QA 2D11A 2QKMA 2RLOA 2J59M 2E2XA 4DX90 3SO6A 1MAIA 4NY0A 1J19A 1ZC4B 2UZRA 2OTXA 4HB0B 3ODOA 3ULBA 2L1CA 3HW2B 5JHGA 5DHAB 3PP2A 4HB4B 1FB8A 2DHIA 4F7UP 3PSCA 1MK9B 3A8PA 2CRFA 3QBVB 1MIZB 4K81A 2ROVA 3DXCA 1K5DB 2MFQA 1Y19B 1V5MA 1P5TA 1WGUA 5EFXA 5DI9B 5C16A 2M14A 4NSWA 1X05A 3TCAA 2D9XA 2DYNA 2K00A 2Y8FA 4HB3B 5GOWB 3TO1A 2RGNB 3FM8C 5J3YA 1V61A 1MPHA 2G35A 2HE7A 4HAWB 2CY4A 4ZRKA 1BTNA 3F5RA 2KCJA 2CODA 3U8ZA 2H7DA 2J0KA 5FI0A 2EMTA 2M38A 1K5GB 1XD4A 2R09A 3KZ1A 1V89A 3GYPA 2CAYA 4A6KA 2DX5A 4PNKA 1FGZA 2L2IA 4IOYX 2AEHA 1TXDA 1E5WA 2DYQA 3PVUA 3AJ4A 2UVMA 3VOQA 1WI1A 4HDQA 4GPTB 4WVFB 3VIAA 3M1IB 4KAXB 2Q13A 1DDVA 2LULA
chains in the Genus database with same CATH superfamily
2MWNB 5KQ1A 1H10A 3TW1A 2D4QA 1LW3A 3SV1A 1GC7A 1DYNA 1Q67A 2YS3A 2H7EA 1WJ1A 2D9ZA 1W1GA 3GYOA 1NTYA 3A8QA 1PMSA 2Y8GA 1TQZA 5D3VA 1EVHA 3CIKA 3TVVA 3PVLA 3P6AA 2ADZA 5C5BB 5LONB 2D9VA 3SNHA 1V5UA 2DLWA 5FI1A 2DA0A 2Z14A 3HSAA 2X18A 4Y94A 2AL6A 4L6EA 2DTCA 2DKQA 1ZSQA 2FJUB 1OMWA 2RNRB 1FHOA 4GMVA 4EJNA 1NTVA 3U12A 3HQCA 2GJYA 4EMOA 2FJLA 4QJ4B 5JHHA 2COFA 3HK0A 4Z2NA 2YT1A 1MIXA 1B55A 2UZSA 2COAA 2I1JA 3PVWA 4ZRJA 2N0YA 5D3YA 4A6FA 1QQGA 3UZTA 1AWEA 3WA0A 3CXBB 2IFSA 1M7RA 1SGHA 1XKEA 3AU4A 4HAXB 2LOXA 1P6SA 5CLQB 1UPRA 2PZ1A 4HAYB 1U5DA 2I5CA 2RSGA 4GN1A 1V5PA 4HB2B 2P0DA 2DHJA 3HIEA 1N3HA 2W2XD 3A98B 4ZRIA 4DBBA 1XODA 4KVGB 3IVFA 4QXAB 4IAPA 1NI2A 3SUZA 5C5BA 2IYBA 2CY5A 3D8DA 2DX1A 2OQBA 1DDMA 4OT1A 3T06A 2Y7BA 3WYFB 2LKOA 4F7GA 1FHWA 1BAKA 3G9WA 1EGXA 2D9WA 4YL8A 5DHFB 1UNQA 1IRSA 2V76A 2YSZA 2YRYA 1X86A 1KZ7A 1BWNA 5I2MA 3MDBC 4KHBB 1ISNA 4IFSA 3DCXA 4HDOA 2BCJA 2Z0QA 4PQ0A 5CLLB 1GC6A 3F0WA 2EC1A 4TYZA 1U2BA 5C79A 2GCJA 1UNPA 4MK0A 3DXDA 2J0MA 4A6FB 4GZUA 5JP4A 5HE0A 2QKLA 1ZYIA 1FHXA 4YONA 3PZDA 1XR0B 2VRWB 4A5KA 3PG7A 4CHJA 5HE3A 1DBHA 2K8EA 2P0FA 3MPXA 3ODWA 1DDWA 3NWFA 4GXBA 5KCVA 2GCLA 3LJUX 4K2OA 2EJ8A 3FSSA 1U5EA 2P8VA 1U5GA 1X11A 2I5FA 3PEGA 2COCA 1XCGA 4HATB 2YS1A 4MT7A 1LB1A 4DX8A 3FVCA 3QWMA 1RRPB 2Z4DA 4KHBA 2LOZA 1X1GA 1P3RA 4P7IA 2KIGA 1DROA 5L81A 3P7ZA 4K2PA 3BJIA 1J0WA 4QJ3B 1WGQA 1GG3A 3FEHA 3ODXA 5M4YB 2R0DA 3NSUA 1SHCA 4HHVA 1FGYA 2N23A 1KI1B 2ELAA 3KRWA 4XWXA 1WG7A 4A6HA 1NU2A 3D8EA 2DKPA 1M7EA 5LOPB 2W2WA 1T77A 3OANA 5DH9B 3ULCA 2YVCA 1RJ2A 3RCPA 2ROZB 2I1KA 1XX0A 3ML4A 3AU5A 1UEFA 3QIJA 4MY6A 2K2UA 1WJMA 4C0AA 4F7HA 4K17A 2RVBB 3V5WA 2LYDA 2Z0OA 2K49A 1UNRA 1MKEA 4CHMA 1Z87A 1BTKA 2NBVA 4TKNA 4D0NB 1AQCA 5HE2A 5D3XA 5IRSA 2EMSA 2ZPYA 5D3WA 2YF0A 3D8FA 1V88A 1PLSA 1KZGA 1Y5OA 4L1RA 2K2JA 2KGXB 1MI1A 5HE1A 2KR0A 3ZVRA 1MK7B 1U29A 1PFJA 1OY2A 2MDXA 4QJ5B 4HAVB 5C6RA 5J3QA 4B6HA 1H4RA 4EKUA 5DIFB 2MKRA 1W1HA 1ZM0A 1FAOA 3BINA 2KUPA 2D10A 4HAUB 3OHMB 5LG4B 3NWAA 2VKIA 3KSYA 1EF1A 2KIEA 4BBKA 3SYXA 2YT2A 2XQNM 4KHOA 2RUKB 3N7CA 4CYEA 2DFKA 4OSNA 4GNKB 4H8SA 2ELBA 3KY9A 2YS5A 2W2XC 1U5FA 1ZVRA 2LG1A 3ZDTA 1W1DA 1OQNA 2GS0A 1WVHA 4KHAA 1TJ6A 2HTHB 3U7DA 4Z2MB 2P0HA 2Z0PA 1I2HA 2DHKA 2YT0A 5J3TA 3O96A 5D27A 1X1FA 1EAZA 4HSIA 5JLJB 2JP2A 1U27A 2Z13A 2ZKMX 1FOEA 1UPQA 2NMBA 2GUMA 2DN6A 2D9YA 1ZC3B 1QC6A 2VSZA 4GMXB 3DXEA 4WSFA 4DXAB 1I7AA 4GOUA 3X23A 2NZ8B 3TFMA 3KRXA 4HAZB 4WJ7A 2J0JA 5KQ4A 3NWDA 2D2QA 2D11A 2QKMA 2RLOA 2J59M 3NW8A 2E2XA 4DX90 3SO6A 1MAIA 4D6WA 4NY0A 1J19A 1ZC4B 2UZRA 2OTXA 4HB0B 3ODOA 3ULBA 2L1CA 3HW2B 5JHGA 5DHAB 3PP2A 4HB4B 1FB8A 2DHIA 4F7UP 3PSCA 1MK9B 3A8PA 2KUQA 2CRFA 3QBVB 1MIZB 4K81A 2ROVA 3DXCA 1K5DB 2MFQA 1Y19B 1V5MA 1P5TA 1WGUA 5EFXA 5DI9B 5C16A 2M14A 4NSWA 1X05A 3TCAA 2D9XA 2DYNA 2K00A 2Y8FA 4HB3B 5GOWB 3TO1A 2RGNB 3FM8C 5J3YA 1V61A 5I2SA 1MPHA 2G35A 2HE7A 4HAWB 2CY4A 4ZRKA 1BTNA 3F5RA 2KCJA 2CODA 3U8ZA 2H7DA 2J0KA 3B77A 5FI0A 2EMTA 2M38A 1K5GB 1XD4A 2Z59A 2R09A 3GYPA 1V89A 3KZ1A 2CAYA 4A6KA 2DX5A 4PNKA 1FGZA 2R2YA 2L2IA 3A58A 4IOYX 2AEHA 1TXDA 1E5WA 2DYQA 3PVUA 3AJ4A 2UVMA 3VOQA 4DIXA 1WI1A 4HDQA 4GPTB 4WVFB 3VIAA 4CSQA 3M1IB 4KAXB 2Q13A 1DDVA 2LULA 2RRFA
chains in the Genus database with same CATH topology
2MWNB 5KQ1A 1H10A 3TW1A 2D4QA 1LW3A 3SV1A 1GC7A 1DYNA 1Q67A 2YS3A 2H7EA 1WJ1A 2D9ZA 1W1GA 3GYOA 1NTYA 3A8QA 1PMSA 2Y8GA 1TQZA 5D3VA 1EVHA 3CIKA 3TVVA 3PVLA 3P6AA 2ADZA 5C5BB 5LONB 2D9VA 3SNHA 1V5UA 2DLWA 5FI1A 2DA0A 2X18A 4Y94A 2AL6A 4L6EA 2DTCA 2DKQA 1ZSQA 1OMWA 2RNRB 1FHOA 4GMVA 4EJNA 1NTVA 3HQCA 2GJYA 4EMOA 2FJLA 5JHHA 2COFA 3HK0A 4Z2NA 2YT1A 1MIXA 1B55A 2UZSA 2COAA 2I1JA 3PVWA 4ZRJA 2N0YA 5D3YA 4A6FA 1QQGA 3UZTA 1AWEA 3WA0A 3CXBB 2IFSA 1M7RA 1SGHA 1XKEA 3AU4A 4HAXB 2LOXA 1P6SA 5CLQB 1UPRA 2PZ1A 4HAYB 1U5DA 2I5CA 2RSGA 4GN1A 1V5PA 4HB2B 2P0DA 2DHJA 1N3HA 2W2XD 3A98B 4ZRIA 4DBBA 1XODA 4KVGB 3IVFA 4IAPA 1NI2A 3SUZA 5C5BA 2IYBA 2CY5A 3D8DA 2DX1A 2OQBA 1DDMA 3T06A 2Y7BA 3WYFB 2LKOA 4F7GA 1FHWA 1BAKA 3G9WA 1EGXA 2D9WA 4YL8A 5DHFB 1UNQA 1IRSA 2V76A 2YSZA 2YRYA 1X86A 1KZ7A 1BWNA 3MDBC 4KHBB 1ISNA 4IFSA 4HDOA 2BCJA 2Z0QA 4PQ0A 5CLLB 1GC6A 3F0WA 2EC1A 4TYZA 1U2BA 5C79A 2GCJA 1UNPA 4MK0A 3DXDA 2J0MA 4A6FB 4GZUA 5JP4A 5HE0A 2QKLA 1FHXA 4YONA 3PZDA 1XR0B 2VRWB 4A5KA 3PG7A 4CHJA 5HE3A 1DBHA 2P0FA 3MPXA 3ODWA 1DDWA 4GXBA 5KCVA 2GCLA 3LJUX 4K2OA 2EJ8A 3FSSA 1U5EA 2P8VA 1U5GA 1X11A 2I5FA 3PEGA 2COCA 1XCGA 4HATB 2YS1A 4MT7A 1LB1A 4DX8A 3QWMA 1RRPB 2LOZA 1X1GA 1P3RA 4P7IA 1DROA 5L81A 3P7ZA 4K2PA 3BJIA 1J0WA 1WGQA 1GG3A 3FEHA 3ODXA 2R0DA 3NSUA 1SHCA 4HHVA 1FGYA 2N23A 1KI1B 2ELAA 3KRWA 4XWXA 1WG7A 4A6HA 1NU2A 3D8EA 2DKPA 1M7EA 5LOPB 2W2WA 3OANA 5DH9B 3ULCA 2YVCA 1RJ2A 3RCPA 2ROZB 2I1KA 1XX0A 3ML4A 3AU5A 1UEFA 3QIJA 4MY6A 2K2UA 1WJMA 4C0AA 4F7HA 4K17A 2RVBB 3V5WA 2LYDA 2Z0OA 1UNRA 1MKEA 4CHMA 1Z87A 1BTKA 4TKNA 4D0NB 1AQCA 5HE2A 5D3XA 2EMSA 2ZPYA 5D3WA 2YF0A 3D8FA 1V88A 1PLSA 1KZGA 1Y5OA 2K2JA 2KGXB 5HE1A 3ZVRA 1MK7B 1U29A 1PFJA 1OY2A 2MDXA 4HAVB 5C6RA 5J3QA 4B6HA 1H4RA 4EKUA 5DIFB 2MKRA 1W1HA 1ZM0A 1FAOA 3BINA 2KUPA 2D10A 4HAUB 2VKIA 3KSYA 1EF1A 4BBKA 3SYXA 2XQNM 4KHOA 2RUKB 3N7CA 4CYEA 2DFKA 4H8SA 2ELBA 3KY9A 2YS5A 2W2XC 1U5FA 1ZVRA 2LG1A 3ZDTA 1W1DA 1OQNA 2GS0A 1WVHA 4KHAA 1TJ6A 2HTHB 3U7DA 4Z2MB 2P0HA 2Z0PA 1I2HA 2DHKA 2YT0A 5J3TA 3O96A 5D27A 1X1FA 1EAZA 5JLJB 2JP2A 1U27A 1FOEA 1UPQA 2NMBA 2DN6A 2D9YA 1ZC3B 1QC6A 2VSZA 4GMXB 3DXEA 4WSFA 4DXAB 1I7AA 3X23A 2NZ8B 3TFMA 3KRXA 4HAZB 4WJ7A 2J0JA 5KQ4A 2D2QA 2D11A 2QKMA 2RLOA 2J59M 2E2XA 4DX90 3SO6A 1MAIA 4NY0A 1J19A 1ZC4B 2UZRA 2OTXA 4HB0B 3ODOA 3ULBA 2L1CA 3HW2B 5JHGA 5DHAB 3PP2A 4HB4B 1FB8A 2DHIA 4F7UP 3PSCA 1MK9B 3A8PA 2CRFA 3QBVB 1MIZB 4K81A 2ROVA 3DXCA 1K5DB 2MFQA 1Y19B 1V5MA 1P5TA 1WGUA 5EFXA 5DI9B 5C16A 2M14A 4NSWA 1X05A 3TCAA 2D9XA 2DYNA 2K00A 2Y8FA 4HB3B 5GOWB 3TO1A 2RGNB 3FM8C 5J3YA 1V61A 1MPHA 2G35A 2HE7A 4HAWB 2CY4A 4ZRKA 1BTNA 3F5RA 2KCJA 2CODA 3U8ZA 2H7DA 2J0KA 5FI0A 2EMTA 2M38A 1K5GB 1XD4A 2R09A 3KZ1A 1V89A 3GYPA 2CAYA 4A6KA 2DX5A 4PNKA 1FGZA 2L2IA 4IOYX 2AEHA 1TXDA 1E5WA 2DYQA 3PVUA 3AJ4A 2UVMA 3VOQA 1WI1A 4HDQA 4GPTB 4WVFB 3VIAA 3M1IB 4KAXB 2Q13A 1DDVA 2LULA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MWN B;  5KQ1 A;  1H10 A;  3TW1 A;  2D4Q A;  1LW3 A;  3SV1 A;  1GC7 A;  1DYN A;  1Q67 A;  2YS3 A;  2H7E A;  1WJ1 A;  2D9Z A;  1W1G A;  3GYO A;  1NTY A;  3A8Q A;  1PMS A;  2Y8G A;  1TQZ A;  5D3V A;  1EVH A;  3CIK A;  3TVV A;  3PVL A;  3P6A A;  2ADZ A;  5C5B B;  5LON B;  2D9V A;  3SNH A;  1V5U A;  2DLW A;  5FI1 A;  2DA0 A;  2X18 A;  4Y94 A;  2AL6 A;  4L6E A;  2DTC A;  2DKQ A;  1ZSQ A;  1OMW A;  2RNR B;  1FHO A;  4GMV A;  4EJN A;  1NTV A;  3HQC A;  2GJY A;  4EMO A;  2FJL A;  5JHH A;  2COF A;  3HK0 A;  4Z2N A;  2YT1 A;  1MIX A;  1B55 A;  2UZS A;  2COA A;  2I1J A;  3PVW A;  4ZRJ A;  2N0Y A;  5D3Y A;  4A6F A;  1QQG A;  3UZT A;  1AWE A;  3WA0 A;  3CXB B;  2IFS A;  1M7R A;  1SGH A;  1XKE A;  3AU4 A;  4HAX B;  2LOX A;  1P6S A;  5CLQ B;  1UPR A;  2PZ1 A;  4HAY B;  1U5D A;  2I5C A;  2RSG A;  4GN1 A;  1V5P A;  4HB2 B;  2P0D A;  2DHJ A;  1N3H A;  2W2X D;  3A98 B;  4ZRI A;  4DBB A;  1XOD A;  4KVG B;  3IVF A;  4IAP A;  1NI2 A;  3SUZ A;  5C5B A;  2IYB A;  2CY5 A;  3D8D A;  2DX1 A;  2OQB A;  1DDM A;  3T06 A;  2Y7B A;  3WYF B;  2LKO A;  4F7G A;  1FHW A;  1BAK A;  3G9W A;  1EGX A;  2D9W A;  4YL8 A;  5DHF B;  1UNQ A;  1IRS A;  2V76 A;  2YSZ A;  2YRY A;  1X86 A;  1KZ7 A;  1BWN A;  3MDB C;  4KHB B;  1ISN A;  4IFS A;  4HDO A;  2BCJ A;  2Z0Q A;  4PQ0 A;  5CLL B;  1GC6 A;  3F0W A;  2EC1 A;  4TYZ A;  1U2B A;  5C79 A;  2GCJ A;  1UNP A;  4MK0 A;  3DXD A;  2J0M A;  4A6F B;  4GZU A;  5JP4 A;  5HE0 A;  2QKL A;  1FHX A;  4YON A;  3PZD A;  1XR0 B;  2VRW B;  4A5K A;  3PG7 A;  4CHJ A;  5HE3 A;  1DBH A;  2P0F A;  3MPX A;  3ODW A;  1DDW A;  4GXB A;  5KCV A;  2GCL A;  3LJU X;  4K2O A;  2EJ8 A;  3FSS A;  1U5E A;  2P8V A;  1U5G A;  1X11 A;  2I5F A;  3PEG A;  2COC A;  1XCG A;  4HAT B;  2YS1 A;  4MT7 A;  1LB1 A;  4DX8 A;  3QWM A;  1RRP B;  2LOZ A;  1X1G A;  1P3R A;  4P7I A;  1DRO A;  5L81 A;  3P7Z A;  4K2P A;  3BJI A;  1J0W A;  1WGQ A;  1GG3 A;  3FEH A;  3ODX A;  2R0D A;  3NSU A;  1SHC A;  4HHV A;  1FGY A;  2N23 A;  1KI1 B;  2ELA A;  3KRW A;  4XWX A;  1WG7 A;  4A6H A;  1NU2 A;  3D8E A;  2DKP A;  1M7E A;  5LOP B;  2W2W A;  3OAN A;  5DH9 B;  3ULC A;  2YVC A;  1RJ2 A;  3RCP A;  2ROZ B;  2I1K A;  1XX0 A;  3ML4 A;  3AU5 A;  1UEF A;  3QIJ A;  4MY6 A;  2K2U A;  1WJM A;  4C0A A;  4F7H A;  4K17 A;  2RVB B;  3V5W A;  2LYD A;  2Z0O A;  1UNR A;  1MKE A;  4CHM A;  1Z87 A;  1BTK A;  4TKN A;  4D0N B;  1AQC A;  5HE2 A;  5D3X A;  2EMS A;  2ZPY A;  5D3W A;  2YF0 A;  3D8F A;  1V88 A;  1PLS A;  1KZG A;  1Y5O A;  2K2J A;  2KGX B;  5HE1 A;  3ZVR A;  1MK7 B;  1U29 A;  1PFJ A;  1OY2 A;  2MDX A;  4HAV B;  5C6R A;  5J3Q A;  4B6H A;  1H4R A;  4EKU A;  5DIF B;  2MKR A;  1W1H A;  1ZM0 A;  1FAO A;  3BIN A;  2KUP A;  2D10 A;  4HAU B;  2VKI A;  3KSY A;  1EF1 A;  4BBK A;  3SYX A;  2XQN M;  4KHO A;  2RUK B;  3N7C A;  4CYE A;  2DFK A;  4H8S A;  2ELB A;  3KY9 A;  2YS5 A;  2W2X C;  1U5F A;  1ZVR A;  2LG1 A;  3ZDT A;  1W1D A;  1OQN A;  2GS0 A;  1WVH A;  4KHA A;  1TJ6 A;  2HTH B;  3U7D A;  4Z2M B;  2P0H A;  2Z0P A;  1I2H A;  2DHK A;  2YT0 A;  5J3T A;  3O96 A;  5D27 A;  1X1F A;  1EAZ A;  5JLJ B;  2JP2 A;  1U27 A;  1FOE A;  1UPQ A;  2NMB A;  2DN6 A;  2D9Y A;  1ZC3 B;  1QC6 A;  2VSZ A;  4GMX B;  3DXE A;  4WSF A;  4DXA B;  1I7A A;  3X23 A;  2NZ8 B;  3TFM A;  3KRX A;  4HAZ B;  4WJ7 A;  2J0J A;  5KQ4 A;  2D2Q A;  2D11 A;  2QKM A;  2RLO A;  2J59 M;  2E2X A;  4DX9 0;  3SO6 A;  1MAI A;  4NY0 A;  1J19 A;  1ZC4 B;  2UZR A;  2OTX A;  4HB0 B;  3ODO A;  3ULB A;  2L1C A;  3HW2 B;  5JHG A;  5DHA B;  3PP2 A;  4HB4 B;  1FB8 A;  2DHI A;  4F7U P;  3PSC A;  1MK9 B;  3A8P A;  2CRF A;  3QBV B;  1MIZ B;  4K81 A;  2ROV A;  3DXC A;  1K5D B;  2MFQ A;  1Y19 B;  1V5M A;  1P5T A;  1WGU A;  5EFX A;  5DI9 B;  5C16 A;  2M14 A;  4NSW A;  1X05 A;  3TCA A;  2D9X A;  2DYN A;  2K00 A;  2Y8F A;  4HB3 B;  5GOW B;  3TO1 A;  2RGN B;  3FM8 C;  5J3Y A;  1V61 A;  1MPH A;  2G35 A;  2HE7 A;  4HAW B;  2CY4 A;  4ZRK A;  1BTN A;  3F5R A;  2KCJ A;  2COD A;  3U8Z A;  2H7D A;  2J0K A;  5FI0 A;  2EMT A;  2M38 A;  1K5G B;  1XD4 A;  2R09 A;  3KZ1 A;  1V89 A;  3GYP A;  2CAY A;  4A6K A;  2DX5 A;  4PNK A;  1FGZ A;  2L2I A;  4IOY X;  2AEH A;  1TXD A;  1E5W A;  2DYQ A;  3PVU A;  3AJ4 A;  2UVM A;  3VOQ A;  1WI1 A;  4HDQ A;  4GPT B;  4WVF B;  3VIA A;  3M1I B;  4KAX B;  2Q13 A;  1DDV A;  2LUL A; 
#chains in the Genus database with same CATH topology
 2MWN B;  5KQ1 A;  1H10 A;  3TW1 A;  2D4Q A;  1LW3 A;  3SV1 A;  1GC7 A;  1DYN A;  1Q67 A;  2YS3 A;  2H7E A;  1WJ1 A;  2D9Z A;  1W1G A;  3GYO A;  1NTY A;  3A8Q A;  1PMS A;  2Y8G A;  1TQZ A;  5D3V A;  1EVH A;  3CIK A;  3TVV A;  3PVL A;  3P6A A;  2ADZ A;  5C5B B;  5LON B;  2D9V A;  3SNH A;  1V5U A;  2DLW A;  5FI1 A;  2DA0 A;  2Z14 A;  3HSA A;  2X18 A;  4Y94 A;  2AL6 A;  4L6E A;  2DTC A;  2DKQ A;  1ZSQ A;  2FJU B;  1OMW A;  2RNR B;  1FHO A;  4GMV A;  4EJN A;  1NTV A;  3U12 A;  3HQC A;  2GJY A;  4EMO A;  2FJL A;  4QJ4 B;  5JHH A;  2COF A;  3HK0 A;  4Z2N A;  2YT1 A;  1MIX A;  1B55 A;  2UZS A;  2COA A;  2I1J A;  3PVW A;  4ZRJ A;  2N0Y A;  5D3Y A;  4A6F A;  1QQG A;  3UZT A;  1AWE A;  3WA0 A;  3CXB B;  2IFS A;  1M7R A;  1SGH A;  1XKE A;  3AU4 A;  4HAX B;  2LOX A;  1P6S A;  5CLQ B;  1UPR A;  2PZ1 A;  4HAY B;  1U5D A;  2I5C A;  2RSG A;  4GN1 A;  1V5P A;  4HB2 B;  2P0D A;  2DHJ A;  3HIE A;  1N3H A;  2W2X D;  3A98 B;  4ZRI A;  4DBB A;  1XOD A;  4KVG B;  3IVF A;  4QXA B;  4IAP A;  1NI2 A;  3SUZ A;  5C5B A;  2IYB A;  2CY5 A;  3D8D A;  2DX1 A;  2OQB A;  1DDM A;  4OT1 A;  3T06 A;  2Y7B A;  3WYF B;  2LKO A;  4F7G A;  1FHW A;  1BAK A;  3G9W A;  1EGX A;  2D9W A;  4YL8 A;  5DHF B;  1UNQ A;  1IRS A;  2V76 A;  2YSZ A;  2YRY A;  1X86 A;  1KZ7 A;  1BWN A;  5I2M A;  3MDB C;  4KHB B;  1ISN A;  4IFS A;  3DCX A;  4HDO A;  2BCJ A;  2Z0Q A;  4PQ0 A;  5CLL B;  1GC6 A;  3F0W A;  2EC1 A;  4TYZ A;  1U2B A;  5C79 A;  2GCJ A;  1UNP A;  4MK0 A;  3DXD A;  2J0M A;  4A6F B;  4GZU A;  5JP4 A;  5HE0 A;  2QKL A;  1ZYI A;  1FHX A;  4YON A;  3PZD A;  1XR0 B;  2VRW B;  4A5K A;  3PG7 A;  4CHJ A;  5HE3 A;  1DBH A;  2K8E A;  2P0F A;  3MPX A;  3ODW A;  1DDW A;  3NWF A;  4GXB A;  5KCV A;  2GCL A;  3LJU X;  4K2O A;  2EJ8 A;  3FSS A;  1U5E A;  2P8V A;  1U5G A;  1X11 A;  2I5F A;  3PEG A;  2COC A;  1XCG A;  4HAT B;  2YS1 A;  4MT7 A;  1LB1 A;  4DX8 A;  3FVC A;  3QWM A;  1RRP B;  2Z4D A;  4KHB A;  2LOZ A;  1X1G A;  1P3R A;  4P7I A;  2KIG A;  1DRO A;  5L81 A;  3P7Z A;  4K2P A;  3BJI A;  1J0W A;  4QJ3 B;  1WGQ A;  1GG3 A;  3FEH A;  3ODX A;  5M4Y B;  2R0D A;  3NSU A;  1SHC A;  4HHV A;  1FGY A;  2N23 A;  1KI1 B;  2ELA A;  3KRW A;  4XWX A;  1WG7 A;  4A6H A;  1NU2 A;  3D8E A;  2DKP A;  1M7E A;  5LOP B;  2W2W A;  1T77 A;  3OAN A;  5DH9 B;  3ULC A;  2YVC A;  1RJ2 A;  3RCP A;  2ROZ B;  2I1K A;  1XX0 A;  3ML4 A;  3AU5 A;  1UEF A;  3QIJ A;  4MY6 A;  2K2U A;  1WJM A;  4C0A A;  4F7H A;  4K17 A;  2RVB B;  3V5W A;  2LYD A;  2Z0O A;  2K49 A;  1UNR A;  1MKE A;  4CHM A;  1Z87 A;  1BTK A;  2NBV A;  4TKN A;  4D0N B;  1AQC A;  5HE2 A;  5D3X A;  5IRS A;  2EMS A;  2ZPY A;  5D3W A;  2YF0 A;  3D8F A;  1V88 A;  1PLS A;  1KZG A;  1Y5O A;  4L1R A;  2K2J A;  2KGX B;  1MI1 A;  5HE1 A;  2KR0 A;  3ZVR A;  1MK7 B;  1U29 A;  1PFJ A;  1OY2 A;  2MDX A;  4QJ5 B;  4HAV B;  5C6R A;  5J3Q A;  4B6H A;  1H4R A;  4EKU A;  5DIF B;  2MKR A;  1W1H A;  1ZM0 A;  1FAO A;  3BIN A;  2KUP A;  2D10 A;  4HAU B;  3OHM B;  5LG4 B;  3NWA A;  2VKI A;  3KSY A;  1EF1 A;  2KIE A;  4BBK A;  3SYX A;  2YT2 A;  2XQN M;  4KHO A;  2RUK B;  3N7C A;  4CYE A;  2DFK A;  4OSN A;  4GNK B;  4H8S A;  2ELB A;  3KY9 A;  2YS5 A;  2W2X C;  1U5F A;  1ZVR A;  2LG1 A;  3ZDT A;  1W1D A;  1OQN A;  2GS0 A;  1WVH A;  4KHA A;  1TJ6 A;  2HTH B;  3U7D A;  4Z2M B;  2P0H A;  2Z0P A;  1I2H A;  2DHK A;  2YT0 A;  5J3T A;  3O96 A;  5D27 A;  1X1F A;  1EAZ A;  4HSI A;  5JLJ B;  2JP2 A;  1U27 A;  2Z13 A;  2ZKM X;  1FOE A;  1UPQ A;  2NMB A;  2GUM A;  2DN6 A;  2D9Y A;  1ZC3 B;  1QC6 A;  2VSZ A;  4GMX B;  3DXE A;  4WSF A;  4DXA B;  1I7A A;  4GOU A;  3X23 A;  2NZ8 B;  3TFM A;  3KRX A;  4HAZ B;  4WJ7 A;  2J0J A;  5KQ4 A;  3NWD A;  2D2Q A;  2D11 A;  2QKM A;  2RLO A;  2J59 M;  3NW8 A;  2E2X A;  4DX9 0;  3SO6 A;  1MAI A;  4D6W A;  4NY0 A;  1J19 A;  1ZC4 B;  2UZR A;  2OTX A;  4HB0 B;  3ODO A;  3ULB A;  2L1C A;  3HW2 B;  5JHG A;  5DHA B;  3PP2 A;  4HB4 B;  1FB8 A;  2DHI A;  4F7U P;  3PSC A;  1MK9 B;  3A8P A;  2KUQ A;  2CRF A;  3QBV B;  1MIZ B;  4K81 A;  2ROV A;  3DXC A;  1K5D B;  2MFQ A;  1Y19 B;  1V5M A;  1P5T A;  1WGU A;  5EFX A;  5DI9 B;  5C16 A;  2M14 A;  4NSW A;  1X05 A;  3TCA A;  2D9X A;  2DYN A;  2K00 A;  2Y8F A;  4HB3 B;  5GOW B;  3TO1 A;  2RGN B;  3FM8 C;  5J3Y A;  1V61 A;  5I2S A;  1MPH A;  2G35 A;  2HE7 A;  4HAW B;  2CY4 A;  4ZRK A;  1BTN A;  3F5R A;  2KCJ A;  2COD A;  3U8Z A;  2H7D A;  2J0K A;  3B77 A;  5FI0 A;  2EMT A;  2M38 A;  1K5G B;  1XD4 A;  2Z59 A;  2R09 A;  3GYP A;  1V89 A;  3KZ1 A;  2CAY A;  4A6K A;  2DX5 A;  4PNK A;  1FGZ A;  2R2Y A;  2L2I A;  3A58 A;  4IOY X;  2AEH A;  1TXD A;  1E5W A;  2DYQ A;  3PVU A;  3AJ4 A;  2UVM A;  3VOQ A;  4DIX A;  1WI1 A;  4HDQ A;  4GPT B;  4WVF B;  3VIA A;  4CSQ A;  3M1I B;  4KAX B;  2Q13 A;  1DDV A;  2LUL A;  2RRF A; 
#chains in the Genus database with same CATH homology
 2MWN B;  5KQ1 A;  1H10 A;  3TW1 A;  2D4Q A;  1LW3 A;  3SV1 A;  1GC7 A;  1DYN A;  1Q67 A;  2YS3 A;  2H7E A;  1WJ1 A;  2D9Z A;  1W1G A;  3GYO A;  1NTY A;  3A8Q A;  1PMS A;  2Y8G A;  1TQZ A;  5D3V A;  1EVH A;  3CIK A;  3TVV A;  3PVL A;  3P6A A;  2ADZ A;  5C5B B;  5LON B;  2D9V A;  3SNH A;  1V5U A;  2DLW A;  5FI1 A;  2DA0 A;  2X18 A;  4Y94 A;  2AL6 A;  4L6E A;  2DTC A;  2DKQ A;  1ZSQ A;  1OMW A;  2RNR B;  1FHO A;  4GMV A;  4EJN A;  1NTV A;  3HQC A;  2GJY A;  4EMO A;  2FJL A;  5JHH A;  2COF A;  3HK0 A;  4Z2N A;  2YT1 A;  1MIX A;  1B55 A;  2UZS A;  2COA A;  2I1J A;  3PVW A;  4ZRJ A;  2N0Y A;  5D3Y A;  4A6F A;  1QQG A;  3UZT A;  1AWE A;  3WA0 A;  3CXB B;  2IFS A;  1M7R A;  1SGH A;  1XKE A;  3AU4 A;  4HAX B;  2LOX A;  1P6S A;  5CLQ B;  1UPR A;  2PZ1 A;  4HAY B;  1U5D A;  2I5C A;  2RSG A;  4GN1 A;  1V5P A;  4HB2 B;  2P0D A;  2DHJ A;  1N3H A;  2W2X D;  3A98 B;  4ZRI A;  4DBB A;  1XOD A;  4KVG B;  3IVF A;  4IAP A;  1NI2 A;  3SUZ A;  5C5B A;  2IYB A;  2CY5 A;  3D8D A;  2DX1 A;  2OQB A;  1DDM A;  3T06 A;  2Y7B A;  3WYF B;  2LKO A;  4F7G A;  1FHW A;  1BAK A;  3G9W A;  1EGX A;  2D9W A;  4YL8 A;  5DHF B;  1UNQ A;  1IRS A;  2V76 A;  2YSZ A;  2YRY A;  1X86 A;  1KZ7 A;  1BWN A;  3MDB C;  4KHB B;  1ISN A;  4IFS A;  4HDO A;  2BCJ A;  2Z0Q A;  4PQ0 A;  5CLL B;  1GC6 A;  3F0W A;  2EC1 A;  4TYZ A;  1U2B A;  5C79 A;  2GCJ A;  1UNP A;  4MK0 A;  3DXD A;  2J0M A;  4A6F B;  4GZU A;  5JP4 A;  5HE0 A;  2QKL A;  1FHX A;  4YON A;  3PZD A;  1XR0 B;  2VRW B;  4A5K A;  3PG7 A;  4CHJ A;  5HE3 A;  1DBH A;  2P0F A;  3MPX A;  3ODW A;  1DDW A;  4GXB A;  5KCV A;  2GCL A;  3LJU X;  4K2O A;  2EJ8 A;  3FSS A;  1U5E A;  2P8V A;  1U5G A;  1X11 A;  2I5F A;  3PEG A;  2COC A;  1XCG A;  4HAT B;  2YS1 A;  4MT7 A;  1LB1 A;  4DX8 A;  3QWM A;  1RRP B;  2LOZ A;  1X1G A;  1P3R A;  4P7I A;  1DRO A;  5L81 A;  3P7Z A;  4K2P A;  3BJI A;  1J0W A;  1WGQ A;  1GG3 A;  3FEH A;  3ODX A;  2R0D A;  3NSU A;  1SHC A;  4HHV A;  1FGY A;  2N23 A;  1KI1 B;  2ELA A;  3KRW A;  4XWX A;  1WG7 A;  4A6H A;  1NU2 A;  3D8E A;  2DKP A;  1M7E A;  5LOP B;  2W2W A;  3OAN A;  5DH9 B;  3ULC A;  2YVC A;  1RJ2 A;  3RCP A;  2ROZ B;  2I1K A;  1XX0 A;  3ML4 A;  3AU5 A;  1UEF A;  3QIJ A;  4MY6 A;  2K2U A;  1WJM A;  4C0A A;  4F7H A;  4K17 A;  2RVB B;  3V5W A;  2LYD A;  2Z0O A;  1UNR A;  1MKE A;  4CHM A;  1Z87 A;  1BTK A;  4TKN A;  4D0N B;  1AQC A;  5HE2 A;  5D3X A;  2EMS A;  2ZPY A;  5D3W A;  2YF0 A;  3D8F A;  1V88 A;  1PLS A;  1KZG A;  1Y5O A;  2K2J A;  2KGX B;  5HE1 A;  3ZVR A;  1MK7 B;  1U29 A;  1PFJ A;  1OY2 A;  2MDX A;  4HAV B;  5C6R A;  5J3Q A;  4B6H A;  1H4R A;  4EKU A;  5DIF B;  2MKR A;  1W1H A;  1ZM0 A;  1FAO A;  3BIN A;  2KUP A;  2D10 A;  4HAU B;  2VKI A;  3KSY A;  1EF1 A;  4BBK A;  3SYX A;  2XQN M;  4KHO A;  2RUK B;  3N7C A;  4CYE A;  2DFK A;  4H8S A;  2ELB A;  3KY9 A;  2YS5 A;  2W2X C;  1U5F A;  1ZVR A;  2LG1 A;  3ZDT A;  1W1D A;  1OQN A;  2GS0 A;  1WVH A;  4KHA A;  1TJ6 A;  2HTH B;  3U7D A;  4Z2M B;  2P0H A;  2Z0P A;  1I2H A;  2DHK A;  2YT0 A;  5J3T A;  3O96 A;  5D27 A;  1X1F A;  1EAZ A;  5JLJ B;  2JP2 A;  1U27 A;  1FOE A;  1UPQ A;  2NMB A;  2DN6 A;  2D9Y A;  1ZC3 B;  1QC6 A;  2VSZ A;  4GMX B;  3DXE A;  4WSF A;  4DXA B;  1I7A A;  3X23 A;  2NZ8 B;  3TFM A;  3KRX A;  4HAZ B;  4WJ7 A;  2J0J A;  5KQ4 A;  2D2Q A;  2D11 A;  2QKM A;  2RLO A;  2J59 M;  2E2X A;  4DX9 0;  3SO6 A;  1MAI A;  4NY0 A;  1J19 A;  1ZC4 B;  2UZR A;  2OTX A;  4HB0 B;  3ODO A;  3ULB A;  2L1C A;  3HW2 B;  5JHG A;  5DHA B;  3PP2 A;  4HB4 B;  1FB8 A;  2DHI A;  4F7U P;  3PSC A;  1MK9 B;  3A8P A;  2CRF A;  3QBV B;  1MIZ B;  4K81 A;  2ROV A;  3DXC A;  1K5D B;  2MFQ A;  1Y19 B;  1V5M A;  1P5T A;  1WGU A;  5EFX A;  5DI9 B;  5C16 A;  2M14 A;  4NSW A;  1X05 A;  3TCA A;  2D9X A;  2DYN A;  2K00 A;  2Y8F A;  4HB3 B;  5GOW B;  3TO1 A;  2RGN B;  3FM8 C;  5J3Y A;  1V61 A;  1MPH A;  2G35 A;  2HE7 A;  4HAW B;  2CY4 A;  4ZRK A;  1BTN A;  3F5R A;  2KCJ A;  2COD A;  3U8Z A;  2H7D A;  2J0K A;  5FI0 A;  2EMT A;  2M38 A;  1K5G B;  1XD4 A;  2R09 A;  3KZ1 A;  1V89 A;  3GYP A;  2CAY A;  4A6K A;  2DX5 A;  4PNK A;  1FGZ A;  2L2I A;  4IOY X;  2AEH A;  1TXD A;  1E5W A;  2DYQ A;  3PVU A;  3AJ4 A;  2UVM A;  3VOQ A;  1WI1 A;  4HDQ A;  4GPT B;  4WVF B;  3VIA A;  3M1I B;  4KAX B;  2Q13 A;  1DDV A;  2LUL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...