4DX90

Icap1 in complex with integrin beta 1 cytoplasmic tail
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
137
structure length
110
Chain Sequence
CAEFRIKYVGAIGPLDLINYIDVAQQDGKLPFVPPEEEFIMGVSKYGIKVSTLHRHALYLIIRMVCYDDGLGAKSLLALKTSLWVYQCNSLEQAQAICKVLSTAFDSVLT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Integrin beta-1-binding protein 1
publication title Mechanism for KRIT1 Release of ICAP1-Mediated Suppression of Integrin Activation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 16
structure length 110
sequence length 137
chains with identical sequence 1, 2, 3, 4, 5, A, C, E, G, I, K, M, O, Q, S, U, W, Y, a, c, e, g, i, k, m, o, q, s, u, w, y
ec nomenclature
pdb deposition date 2012-02-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 4dx9000
2GJYA 4KHBB 1W1GA 2DHJA 2DLWA 5C5BA 2I5CA 3SNHA 2HE7A 1J0WA 3BINA 2DX5A 2IYBA 1FAOA 2NMBA 3TW1A 2NZ8B 1DDWA 2ELBA 4HAUB 3PG7A 1Q67A 2LYDA 2GCJA 3M1IB 4NY0A 4ZRIA 1PLSA 1MK9B 2CRFA 2Z0OA 2MWNB 3FM8C 1X05A 4HB4B 2BCJA 2D4QA 1FGYA 2RGNB 1DDVA 1WGQA 3P7ZA 2KCJA 4P7IA 1SHCA 1V5UA 1UNRA 1TJ6A 2YS5A 2QKLA 4K81A 1MKEA 1U5EA 2I1KA 2ZPYA 2J0KA 1GC6A 5J3TA 3WA0A 1W1HA 3CXBB 3LJUX 1MIXA 1B55A 3ODOA 1ZSQA 2K00A 2DN6A 2I1JA 2J59M 4H8SA 4MY6A 1XR0B 2DA0A 4HDQA 2P0HA 2LOZA 2M38A 1U5FA 3MPXA 2J0JA 3V5WA 1BWNA 1M7RA 2PZ1A 4GMVA 3DXCA 4ZRKA 5KCVA 4HHVA 3FEHA 4YL8A 2CY5A 1DYNA 1BAKA 3HQCA 5GOWB 5DH9B 1XODA 2D9WA 3ULCA 3PVUA 2AL6A 1M7EA 1MIZB 4GN1A 1ISNA 2L2IA 2J0MA 4KVGB 3PVLA 3D8EA 3KRXA 2K2JA 3WYFB 2RVBB 1WI1A 4A5KA 1XKEA 1K5DB 4L6EA 2DKQA 5DI9B 2LOXA 3QIJA 1OMWA 2YT1A 2EJ8A 2LKOA 3BJIA 3KZ1A 5FI1A 4DBBA 3ZVRA 2YS3A 2RUKB 1DBHA 2ROZB 2Y7BA 4Z2MB 5C6RA 3ULBA 4TKNA 5FI0A 2X18A 4HDOA 4PQ0A 3PEGA 1U5DA 1N3HA 4A6KA 3AU5A 2COFA 4GZUA 2L1CA 4HATB 3P6AA 2D10A 4F7HA 2G35A 1P6SA 1AWEA 1P5TA 2N23A 2RNRB 4DX8A 2CAYA 2Z0QA 1I2HA 1UPRA 2DKPA 2UVMA 1TXDA 1MPHA 4A6FB 4BBKA 2DX1A 1U27A 3SV1A 3F0WA 3GYOA 1LW3A 5J3YA 5JLJB 3DXEA 2P0DA 1MK7B 4K2PA 3AJ4A 2KUPA 2DYQA 3A8PA 1NI2A 3AU4A 2VKIA 2YT0A 3U8ZA 4EJNA 1WJ1A 2Z0PA 3A8QA 1H10A 1K5GB 5CLLB 4F7GA 2Y8GA 3QWMA 1WG7A 1UPQA 2RSGA 1XX0A 4GPTB 2AEHA 2DFKA 3TVVA 5EFXA 1Y5OA 4KHOA 1FB8A 3F5RA 4HB2B 4HB3B 1V61A 2FJLA 4PNKA 1PMSA 2ROVA 2M14A 3ODXA 5JHHA 1GC7A 1X11A 3KRWA 5D3XA 5J3QA 3U7DA 2W2XC 4HAWB 3KY9A 1WGUA 4Y94A 1U5GA 2D9YA 1XCGA 2OTXA 2GS0A 2QKMA 3FSSA 2Y8FA 3TO1A 2V76A 1X1GA 3HK0A 1BTKA 2D9VA 2RLOA 5JHGA 5LONB 2KGXB 1U2BA 2W2XD 1EVHA 2DHKA 1V88A 4ZRJA 3NSUA 5HE2A 4CHJA 4A6FA 3GYPA 3VOQA 4XWXA 4C0AA 1X86A 1KZGA 1LB1A 5HE0A 2D9XA 4B6HA 3DXDA 1NTVA 4DXAB 2YF0A 4HAZB 5D3WA 3CIKA 5LOPB 2D11A 1RRPB 1FGZA 1W1DA 1UNQA 4IFSA 2H7EA 4CHMA 2XQNM 2R09A 2COAA 2EMSA 3UZTA 2LG1A 4TYZA 3X23A 1FHWA 3PP2A 3SO6A 3T06A 2MFQA 3TCAA 1EAZA 2OQBA 5CLQB 2Q13A 3TFMA 3PVWA 1Y19B 5D3VA 1U29A 1GG3A 2N0YA 4K17A 1P3RA 5KQ4A 5D27A 4K2OA 1QC6A 1ZC3B 5JP4A 4WJ7A 2DHIA 1UNPA 5DHAB 1WJMA 1AQCA 3PZDA 5C79A 4IOYX 4MT7A 2VRWB 4IAPA 4YONA 3N7CA 4WSFA 2EMTA 2P8VA 4HAVB 3ODWA 1BTNA 2ELAA 1QQGA 1OY2A 4KAXB 2DYNA 4WVFB 4KHAA 1V5MA 1XD4A 2DTCA 2H7DA 4EMOA 1OQNA 2UZRA 4GMXB 2VSZA 4MK0A 1EF1A 4HAXB 5D3YA 1MAIA 2D2QA 5C16A 3RCPA 2YS1A 2YSZA 1PFJA 5DIFB 1SGHA 2EC1A 3VIAA 1RJ2A 2D9ZA 4HB0B 1KZ7A 2MKRA 4HAYB 5L81A 2I5FA 3MDBC 2YVCA 3QBVB 1KI1B 5C5BB 3IVFA 2MDXA 4GXBA 2W2WA 1TQZA 1DDMA 1ZM0A 5DHFB 3SYXA 1Z87A 4A6HA 1FHXA 2LULA 1WVHA 4CYEA 1NTYA 2CODA 3A98B 2IFSA 2HTHB 4F7UP 4EKUA 1UEFA 4DX90 3SUZA 1FOEA 1IRSA 3G9WA 2YRYA 1DROA 1V89A 2ADZA 4NSWA 5KQ1A 3HW2B 1V5PA 1J19A 1EGXA 3PSCA 2R0DA 3KSYA 1H4RA 1NU2A 1ZC4B 2COCA 4Z2NA 3D8DA 2GCLA 3O96A 2E2XA 1ZVRA 2CY4A 2P0FA 3ML4A 4D0NB 2K2UA 5HE3A 1E5WA 1X1FA 5HE1A 1FHOA 2JP2A 3OANA 3D8FA 3ZDTA 2UZSA 1I7AA
chains in the Genus database with same CATH superfamily
2GJYA 2K8EA 4KHBB 1W1GA 2DHJA 2DLWA 5C5BA 2I5CA 2KUQA 3SNHA 2HE7A 1J0WA 3BINA 2DX5A 2IYBA 5IRSA 1FAOA 2NMBA 3TW1A 2NZ8B 1DDWA 2ELBA 4HAUB 3PG7A 1Q67A 2LYDA 2GCJA 3M1IB 3NWAA 4NY0A 1MI1A 4ZRIA 1PLSA 1MK9B 2CRFA 2Z0OA 2MWNB 3B77A 3FM8C 1X05A 4HB4B 2BCJA 2D4QA 1FGYA 2RGNB 1DDVA 1WGQA 3P7ZA 2KCJA 4P7IA 1SHCA 1V5UA 1UNRA 1TJ6A 2YS5A 2QKLA 4K81A 1MKEA 1U5EA 2I1KA 2ZPYA 2J0KA 1GC6A 5J3TA 3WA0A 1W1HA 5I2SA 3CXBB 3LJUX 1MIXA 1B55A 1ZSQA 3ODOA 2K00A 2DN6A 5I2MA 5LG4B 2I1JA 2J59M 4H8SA 4MY6A 1XR0B 2DA0A 4HDQA 2P0HA 2LOZA 2M38A 1U5FA 3MPXA 2J0JA 3V5WA 1BWNA 1M7RA 2PZ1A 4GMVA 3DXCA 4ZRKA 5KCVA 4HHVA 3FEHA 4YL8A 3A58A 2CY5A 1DYNA 4KHBA 1BAKA 3HQCA 5GOWB 5DH9B 4QJ3B 1XODA 2D9WA 3ULCA 3PVUA 2AL6A 1M7EA 1MIZB 4GN1A 1ISNA 2L2IA 2J0MA 4KVGB 3PVLA 3D8EA 3KRXA 2K2JA 3WYFB 2RVBB 1WI1A 4A5KA 1XKEA 1K5DB 4L6EA 2DKQA 5DI9B 2LOXA 3QIJA 1OMWA 2YT1A 4QXAB 2EJ8A 2KIEA 2LKOA 3BJIA 3KZ1A 5FI1A 4DBBA 3HSAA 3ZVRA 2YS3A 2RUKB 1DBHA 2ROZB 2Y7BA 4Z2MB 5C6RA 3ULBA 4TKNA 5FI0A 2X18A 4HDOA 4PQ0A 1T77A 2RRFA 3PEGA 1U5DA 1N3HA 2Z4DA 4A6KA 3AU5A 2COFA 4GZUA 2L1CA 4HATB 3P6AA 2D10A 2Z59A 4F7HA 2K49A 2G35A 1P6SA 1AWEA 1P5TA 2N23A 2RNRB 4DX8A 4QJ5B 2CAYA 2Z0QA 1I2HA 1UPRA 2DKPA 2UVMA 1TXDA 1MPHA 4A6FB 4BBKA 3NWDA 2DX1A 1U27A 3SV1A 3F0WA 3GYOA 1LW3A 5J3YA 5JLJB 3DXEA 2P0DA 1MK7B 4K2PA 3AJ4A 2KUPA 2DYQA 3A8PA 2NBVA 1NI2A 3AU4A 2VKIA 2YT0A 3U8ZA 4EJNA 1WJ1A 2Z0PA 3A8QA 1H10A 1K5GB 5CLLB 4F7GA 2Y8GA 3QWMA 1WG7A 1UPQA 2RSGA 1XX0A 3U12A 4GPTB 2AEHA 2DFKA 3TVVA 4HSIA 5EFXA 1Y5OA 4KHOA 1FB8A 3F5RA 4HB2B 4HB3B 1V61A 2FJLA 4PNKA 1PMSA 2ROVA 2M14A 3ODXA 5JHHA 1GC7A 1X11A 3KRWA 5D3XA 5J3QA 3U7DA 2W2XC 4HAWB 3KY9A 1WGUA 4Y94A 1U5GA 2D9YA 4GOUA 1XCGA 2OTXA 2GS0A 2QKMA 3FSSA 2Y8FA 3TO1A 2V76A 1X1GA 3HK0A 1BTKA 2D9VA 2RLOA 5JHGA 2YT2A 2KGXB 5LONB 1U2BA 2W2XD 1EVHA 2DHKA 1V88A 4ZRJA 3NSUA 5HE2A 4CHJA 4A6FA 3GYPA 3VOQA 4XWXA 4C0AA 1X86A 1KZGA 1LB1A 5HE0A 2D9XA 4B6HA 3DXDA 1NTVA 4DXAB 2YF0A 4HAZB 3NWFA 5D3WA 3CIKA 5LOPB 2D11A 1RRPB 1FGZA 1W1DA 1UNQA 4IFSA 2H7EA 4CHMA 2XQNM 2R09A 2COAA 2EMSA 4L1RA 3UZTA 2LG1A 4TYZA 3X23A 1FHWA 3PP2A 3SO6A 3T06A 2MFQA 4CSQA 3TCAA 1EAZA 2R2YA 4OT1A 2OQBA 5CLQB 2Q13A 3TFMA 3PVWA 1Y19B 5D3VA 1U29A 1GG3A 2FJUB 2N0YA 4K17A 1P3RA 2Z13A 5KQ4A 5D27A 4K2OA 1QC6A 1ZC3B 5JP4A 5M4YB 4WJ7A 2DHIA 1UNPA 5DHAB 1WJMA 4OSNA 1AQCA 3PZDA 5C79A 4IOYX 4MT7A 2VRWB 4IAPA 4YONA 3N7CA 4WSFA 2EMTA 4QJ4B 4D6WA 2P8VA 4HAVB 3ODWA 1BTNA 2ELAA 1QQGA 1OY2A 3NW8A 4KAXB 2DYNA 4WVFB 4KHAA 1V5MA 1XD4A 2DTCA 2H7DA 4EMOA 1OQNA 2UZRA 2KR0A 4GMXB 2VSZA 4MK0A 1EF1A 4HAXB 5D3YA 1MAIA 2D2QA 3OHMB 5C16A 3RCPA 2YS1A 2YSZA 1PFJA 5DIFB 1SGHA 2EC1A 3VIAA 1RJ2A 2D9ZA 4HB0B 1KZ7A 2MKRA 4HAYB 5L81A 3DCXA 2I5FA 3MDBC 2YVCA 3QBVB 4DIXA 1KI1B 5C5BB 3IVFA 2MDXA 4GXBA 1ZYIA 2W2WA 1TQZA 1DDMA 1ZM0A 5DHFB 3SYXA 1Z87A 3HIEA 2GUMA 4A6HA 1FHXA 2LULA 1WVHA 4CYEA 1NTYA 2CODA 3A98B 2IFSA 2HTHB 4F7UP 4EKUA 1UEFA 4DX90 3SUZA 2ZKMX 1FOEA 1IRSA 3G9WA 2YRYA 1DROA 1V89A 2ADZA 4NSWA 5KQ1A 3HW2B 1V5PA 4GNKB 1J19A 3FVCA 1EGXA 3PSCA 2R0DA 3KSYA 1H4RA 1NU2A 2Z14A 1ZC4B 2COCA 4Z2NA 3D8DA 2GCLA 3O96A 2E2XA 1ZVRA 2CY4A 2P0FA 3ML4A 4D0NB 2KIGA 2K2UA 5HE3A 1E5WA 1X1FA 5HE1A 1FHOA 2JP2A 3OANA 3D8FA 3ZDTA 2UZSA 1I7AA
chains in the Genus database with same CATH topology
2GJYA 4KHBB 1W1GA 2DHJA 2DLWA 5C5BA 2I5CA 3SNHA 2HE7A 1J0WA 3BINA 2DX5A 2IYBA 1FAOA 2NMBA 3TW1A 2NZ8B 1DDWA 2ELBA 4HAUB 3PG7A 1Q67A 2LYDA 2GCJA 3M1IB 4NY0A 4ZRIA 1PLSA 1MK9B 2CRFA 2Z0OA 2MWNB 3FM8C 1X05A 4HB4B 2BCJA 2D4QA 1FGYA 2RGNB 1DDVA 1WGQA 3P7ZA 2KCJA 4P7IA 1SHCA 1V5UA 1UNRA 1TJ6A 2YS5A 2QKLA 4K81A 1MKEA 1U5EA 2I1KA 2ZPYA 2J0KA 1GC6A 5J3TA 3WA0A 1W1HA 3CXBB 3LJUX 1MIXA 1B55A 3ODOA 1ZSQA 2K00A 2DN6A 2I1JA 2J59M 4H8SA 4MY6A 1XR0B 2DA0A 4HDQA 2P0HA 2LOZA 2M38A 1U5FA 3MPXA 2J0JA 3V5WA 1BWNA 1M7RA 2PZ1A 4GMVA 3DXCA 4ZRKA 5KCVA 4HHVA 3FEHA 4YL8A 2CY5A 1DYNA 1BAKA 3HQCA 5GOWB 5DH9B 1XODA 2D9WA 3ULCA 3PVUA 2AL6A 1M7EA 1MIZB 4GN1A 1ISNA 2L2IA 2J0MA 4KVGB 3PVLA 3D8EA 3KRXA 2K2JA 3WYFB 2RVBB 1WI1A 4A5KA 1XKEA 1K5DB 4L6EA 2DKQA 5DI9B 2LOXA 3QIJA 1OMWA 2YT1A 2EJ8A 2LKOA 3BJIA 3KZ1A 5FI1A 4DBBA 3ZVRA 2YS3A 2RUKB 1DBHA 2ROZB 2Y7BA 4Z2MB 5C6RA 3ULBA 4TKNA 5FI0A 2X18A 4HDOA 4PQ0A 3PEGA 1U5DA 1N3HA 4A6KA 3AU5A 2COFA 4GZUA 2L1CA 4HATB 3P6AA 2D10A 4F7HA 2G35A 1P6SA 1AWEA 1P5TA 2N23A 2RNRB 4DX8A 2CAYA 2Z0QA 1I2HA 1UPRA 2DKPA 2UVMA 1TXDA 1MPHA 4A6FB 4BBKA 2DX1A 1U27A 3SV1A 3F0WA 3GYOA 1LW3A 5J3YA 5JLJB 3DXEA 2P0DA 1MK7B 4K2PA 3AJ4A 2KUPA 2DYQA 3A8PA 1NI2A 3AU4A 2VKIA 2YT0A 3U8ZA 4EJNA 1WJ1A 2Z0PA 3A8QA 1H10A 1K5GB 5CLLB 4F7GA 2Y8GA 3QWMA 1WG7A 1UPQA 2RSGA 1XX0A 4GPTB 2AEHA 2DFKA 3TVVA 5EFXA 1Y5OA 4KHOA 1FB8A 3F5RA 4HB2B 4HB3B 1V61A 2FJLA 4PNKA 1PMSA 2ROVA 2M14A 3ODXA 5JHHA 1GC7A 1X11A 3KRWA 5D3XA 5J3QA 3U7DA 2W2XC 4HAWB 3KY9A 1WGUA 4Y94A 1U5GA 2D9YA 1XCGA 2OTXA 2GS0A 2QKMA 3FSSA 2Y8FA 3TO1A 2V76A 1X1GA 3HK0A 1BTKA 2D9VA 2RLOA 5JHGA 5LONB 2KGXB 1U2BA 2W2XD 1EVHA 2DHKA 1V88A 4ZRJA 3NSUA 5HE2A 4CHJA 4A6FA 3GYPA 3VOQA 4XWXA 4C0AA 1X86A 1KZGA 1LB1A 5HE0A 2D9XA 4B6HA 3DXDA 1NTVA 4DXAB 2YF0A 4HAZB 5D3WA 3CIKA 5LOPB 2D11A 1RRPB 1FGZA 1W1DA 1UNQA 4IFSA 2H7EA 4CHMA 2XQNM 2R09A 2COAA 2EMSA 3UZTA 2LG1A 4TYZA 3X23A 1FHWA 3PP2A 3SO6A 3T06A 2MFQA 3TCAA 1EAZA 2OQBA 5CLQB 2Q13A 3TFMA 3PVWA 1Y19B 5D3VA 1U29A 1GG3A 2N0YA 4K17A 1P3RA 5KQ4A 5D27A 4K2OA 1QC6A 1ZC3B 5JP4A 4WJ7A 2DHIA 1UNPA 5DHAB 1WJMA 1AQCA 3PZDA 5C79A 4IOYX 4MT7A 2VRWB 4IAPA 4YONA 3N7CA 4WSFA 2EMTA 2P8VA 4HAVB 3ODWA 1BTNA 2ELAA 1QQGA 1OY2A 4KAXB 2DYNA 4WVFB 4KHAA 1V5MA 1XD4A 2DTCA 2H7DA 4EMOA 1OQNA 2UZRA 4GMXB 2VSZA 4MK0A 1EF1A 4HAXB 5D3YA 1MAIA 2D2QA 5C16A 3RCPA 2YS1A 2YSZA 1PFJA 5DIFB 1SGHA 2EC1A 3VIAA 1RJ2A 2D9ZA 4HB0B 1KZ7A 2MKRA 4HAYB 5L81A 2I5FA 3MDBC 2YVCA 3QBVB 1KI1B 5C5BB 3IVFA 2MDXA 4GXBA 2W2WA 1TQZA 1DDMA 1ZM0A 5DHFB 3SYXA 1Z87A 4A6HA 1FHXA 2LULA 1WVHA 4CYEA 1NTYA 2CODA 3A98B 2IFSA 2HTHB 4F7UP 4EKUA 1UEFA 4DX90 3SUZA 1FOEA 1IRSA 3G9WA 2YRYA 1DROA 1V89A 2ADZA 4NSWA 5KQ1A 3HW2B 1V5PA 1J19A 1EGXA 3PSCA 2R0DA 3KSYA 1H4RA 1NU2A 1ZC4B 2COCA 4Z2NA 3D8DA 2GCLA 3O96A 2E2XA 1ZVRA 2CY4A 2P0FA 3ML4A 4D0NB 2K2UA 5HE3A 1E5WA 1X1FA 5HE1A 1FHOA 2JP2A 3OANA 3D8FA 3ZDTA 2UZSA 1I7AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GJY A;  4KHB B;  1W1G A;  2DHJ A;  2DLW A;  5C5B A;  2I5C A;  3SNH A;  2HE7 A;  1J0W A;  3BIN A;  2DX5 A;  2IYB A;  1FAO A;  2NMB A;  3TW1 A;  2NZ8 B;  1DDW A;  2ELB A;  4HAU B;  3PG7 A;  1Q67 A;  2LYD A;  2GCJ A;  3M1I B;  4NY0 A;  4ZRI A;  1PLS A;  1MK9 B;  2CRF A;  2Z0O A;  2MWN B;  3FM8 C;  1X05 A;  4HB4 B;  2BCJ A;  2D4Q A;  1FGY A;  2RGN B;  1DDV A;  1WGQ A;  3P7Z A;  2KCJ A;  4P7I A;  1SHC A;  1V5U A;  1UNR A;  1TJ6 A;  2YS5 A;  2QKL A;  4K81 A;  1MKE A;  1U5E A;  2I1K A;  2ZPY A;  2J0K A;  1GC6 A;  5J3T A;  3WA0 A;  1W1H A;  3CXB B;  3LJU X;  1MIX A;  1B55 A;  3ODO A;  1ZSQ A;  2K00 A;  2DN6 A;  2I1J A;  2J59 M;  4H8S A;  4MY6 A;  1XR0 B;  2DA0 A;  4HDQ A;  2P0H A;  2LOZ A;  2M38 A;  1U5F A;  3MPX A;  2J0J A;  3V5W A;  1BWN A;  1M7R A;  2PZ1 A;  4GMV A;  3DXC A;  4ZRK A;  5KCV A;  4HHV A;  3FEH A;  4YL8 A;  2CY5 A;  1DYN A;  1BAK A;  3HQC A;  5GOW B;  5DH9 B;  1XOD A;  2D9W A;  3ULC A;  3PVU A;  2AL6 A;  1M7E A;  1MIZ B;  4GN1 A;  1ISN A;  2L2I A;  2J0M A;  4KVG B;  3PVL A;  3D8E A;  3KRX A;  2K2J A;  3WYF B;  2RVB B;  1WI1 A;  4A5K A;  1XKE A;  1K5D B;  4L6E A;  2DKQ A;  5DI9 B;  2LOX A;  3QIJ A;  1OMW A;  2YT1 A;  2EJ8 A;  2LKO A;  3BJI A;  3KZ1 A;  5FI1 A;  4DBB A;  3ZVR A;  2YS3 A;  2RUK B;  1DBH A;  2ROZ B;  2Y7B A;  4Z2M B;  5C6R A;  3ULB A;  4TKN A;  5FI0 A;  2X18 A;  4HDO A;  4PQ0 A;  3PEG A;  1U5D A;  1N3H A;  4A6K A;  3AU5 A;  2COF A;  4GZU A;  2L1C A;  4HAT B;  3P6A A;  2D10 A;  4F7H A;  2G35 A;  1P6S A;  1AWE A;  1P5T A;  2N23 A;  2RNR B;  4DX8 A;  2CAY A;  2Z0Q A;  1I2H A;  1UPR A;  2DKP A;  2UVM A;  1TXD A;  1MPH A;  4A6F B;  4BBK A;  2DX1 A;  1U27 A;  3SV1 A;  3F0W A;  3GYO A;  1LW3 A;  5J3Y A;  5JLJ B;  3DXE A;  2P0D A;  1MK7 B;  4K2P A;  3AJ4 A;  2KUP A;  2DYQ A;  3A8P A;  1NI2 A;  3AU4 A;  2VKI A;  2YT0 A;  3U8Z A;  4EJN A;  1WJ1 A;  2Z0P A;  3A8Q A;  1H10 A;  1K5G B;  5CLL B;  4F7G A;  2Y8G A;  3QWM A;  1WG7 A;  1UPQ A;  2RSG A;  1XX0 A;  4GPT B;  2AEH A;  2DFK A;  3TVV A;  5EFX A;  1Y5O A;  4KHO A;  1FB8 A;  3F5R A;  4HB2 B;  4HB3 B;  1V61 A;  2FJL A;  4PNK A;  1PMS A;  2ROV A;  2M14 A;  3ODX A;  5JHH A;  1GC7 A;  1X11 A;  3KRW A;  5D3X A;  5J3Q A;  3U7D A;  2W2X C;  4HAW B;  3KY9 A;  1WGU A;  4Y94 A;  1U5G A;  2D9Y A;  1XCG A;  2OTX A;  2GS0 A;  2QKM A;  3FSS A;  2Y8F A;  3TO1 A;  2V76 A;  1X1G A;  3HK0 A;  1BTK A;  2D9V A;  2RLO A;  5JHG A;  5LON B;  2KGX B;  1U2B A;  2W2X D;  1EVH A;  2DHK A;  1V88 A;  4ZRJ A;  3NSU A;  5HE2 A;  4CHJ A;  4A6F A;  3GYP A;  3VOQ A;  4XWX A;  4C0A A;  1X86 A;  1KZG A;  1LB1 A;  5HE0 A;  2D9X A;  4B6H A;  3DXD A;  1NTV A;  4DXA B;  2YF0 A;  4HAZ B;  5D3W A;  3CIK A;  5LOP B;  2D11 A;  1RRP B;  1FGZ A;  1W1D A;  1UNQ A;  4IFS A;  2H7E A;  4CHM A;  2XQN M;  2R09 A;  2COA A;  2EMS A;  3UZT A;  2LG1 A;  4TYZ A;  3X23 A;  1FHW A;  3PP2 A;  3SO6 A;  3T06 A;  2MFQ A;  3TCA A;  1EAZ A;  2OQB A;  5CLQ B;  2Q13 A;  3TFM A;  3PVW A;  1Y19 B;  5D3V A;  1U29 A;  1GG3 A;  2N0Y A;  4K17 A;  1P3R A;  5KQ4 A;  5D27 A;  4K2O A;  1QC6 A;  1ZC3 B;  5JP4 A;  4WJ7 A;  2DHI A;  1UNP A;  5DHA B;  1WJM A;  1AQC A;  3PZD A;  5C79 A;  4IOY X;  4MT7 A;  2VRW B;  4IAP A;  4YON A;  3N7C A;  4WSF A;  2EMT A;  2P8V A;  4HAV B;  3ODW A;  1BTN A;  2ELA A;  1QQG A;  1OY2 A;  4KAX B;  2DYN A;  4WVF B;  4KHA A;  1V5M A;  1XD4 A;  2DTC A;  2H7D A;  4EMO A;  1OQN A;  2UZR A;  4GMX B;  2VSZ A;  4MK0 A;  1EF1 A;  4HAX B;  5D3Y A;  1MAI A;  2D2Q A;  5C16 A;  3RCP A;  2YS1 A;  2YSZ A;  1PFJ A;  5DIF B;  1SGH A;  2EC1 A;  3VIA A;  1RJ2 A;  2D9Z A;  4HB0 B;  1KZ7 A;  2MKR A;  4HAY B;  5L81 A;  2I5F A;  3MDB C;  2YVC A;  3QBV B;  1KI1 B;  5C5B B;  3IVF A;  2MDX A;  4GXB A;  2W2W A;  1TQZ A;  1DDM A;  1ZM0 A;  5DHF B;  3SYX A;  1Z87 A;  4A6H A;  1FHX A;  2LUL A;  1WVH A;  4CYE A;  1NTY A;  2COD A;  3A98 B;  2IFS A;  2HTH B;  4F7U P;  4EKU A;  1UEF A;  4DX9 0;  3SUZ A;  1FOE A;  1IRS A;  3G9W A;  2YRY A;  1DRO A;  1V89 A;  2ADZ A;  4NSW A;  5KQ1 A;  3HW2 B;  1V5P A;  1J19 A;  1EGX A;  3PSC A;  2R0D A;  3KSY A;  1H4R A;  1NU2 A;  1ZC4 B;  2COC A;  4Z2N A;  3D8D A;  2GCL A;  3O96 A;  2E2X A;  1ZVR A;  2CY4 A;  2P0F A;  3ML4 A;  4D0N B;  2K2U A;  5HE3 A;  1E5W A;  1X1F A;  5HE1 A;  1FHO A;  2JP2 A;  3OAN A;  3D8F A;  3ZDT A;  2UZS A;  1I7A A; 
#chains in the Genus database with same CATH topology
 2GJY A;  2K8E A;  4KHB B;  1W1G A;  2DHJ A;  2DLW A;  5C5B A;  2I5C A;  2KUQ A;  3SNH A;  2HE7 A;  1J0W A;  3BIN A;  2DX5 A;  2IYB A;  5IRS A;  1FAO A;  2NMB A;  3TW1 A;  2NZ8 B;  1DDW A;  2ELB A;  4HAU B;  3PG7 A;  1Q67 A;  2LYD A;  2GCJ A;  3M1I B;  3NWA A;  4NY0 A;  1MI1 A;  4ZRI A;  1PLS A;  1MK9 B;  2CRF A;  2Z0O A;  2MWN B;  3B77 A;  3FM8 C;  1X05 A;  4HB4 B;  2BCJ A;  2D4Q A;  1FGY A;  2RGN B;  1DDV A;  1WGQ A;  3P7Z A;  2KCJ A;  4P7I A;  1SHC A;  1V5U A;  1UNR A;  1TJ6 A;  2YS5 A;  2QKL A;  4K81 A;  1MKE A;  1U5E A;  2I1K A;  2ZPY A;  2J0K A;  1GC6 A;  5J3T A;  3WA0 A;  1W1H A;  5I2S A;  3CXB B;  3LJU X;  1MIX A;  1B55 A;  1ZSQ A;  3ODO A;  2K00 A;  2DN6 A;  5I2M A;  5LG4 B;  2I1J A;  2J59 M;  4H8S A;  4MY6 A;  1XR0 B;  2DA0 A;  4HDQ A;  2P0H A;  2LOZ A;  2M38 A;  1U5F A;  3MPX A;  2J0J A;  3V5W A;  1BWN A;  1M7R A;  2PZ1 A;  4GMV A;  3DXC A;  4ZRK A;  5KCV A;  4HHV A;  3FEH A;  4YL8 A;  3A58 A;  2CY5 A;  1DYN A;  4KHB A;  1BAK A;  3HQC A;  5GOW B;  5DH9 B;  4QJ3 B;  1XOD A;  2D9W A;  3ULC A;  3PVU A;  2AL6 A;  1M7E A;  1MIZ B;  4GN1 A;  1ISN A;  2L2I A;  2J0M A;  4KVG B;  3PVL A;  3D8E A;  3KRX A;  2K2J A;  3WYF B;  2RVB B;  1WI1 A;  4A5K A;  1XKE A;  1K5D B;  4L6E A;  2DKQ A;  5DI9 B;  2LOX A;  3QIJ A;  1OMW A;  2YT1 A;  4QXA B;  2EJ8 A;  2KIE A;  2LKO A;  3BJI A;  3KZ1 A;  5FI1 A;  4DBB A;  3HSA A;  3ZVR A;  2YS3 A;  2RUK B;  1DBH A;  2ROZ B;  2Y7B A;  4Z2M B;  5C6R A;  3ULB A;  4TKN A;  5FI0 A;  2X18 A;  4HDO A;  4PQ0 A;  1T77 A;  2RRF A;  3PEG A;  1U5D A;  1N3H A;  2Z4D A;  4A6K A;  3AU5 A;  2COF A;  4GZU A;  2L1C A;  4HAT B;  3P6A A;  2D10 A;  2Z59 A;  4F7H A;  2K49 A;  2G35 A;  1P6S A;  1AWE A;  1P5T A;  2N23 A;  2RNR B;  4DX8 A;  4QJ5 B;  2CAY A;  2Z0Q A;  1I2H A;  1UPR A;  2DKP A;  2UVM A;  1TXD A;  1MPH A;  4A6F B;  4BBK A;  3NWD A;  2DX1 A;  1U27 A;  3SV1 A;  3F0W A;  3GYO A;  1LW3 A;  5J3Y A;  5JLJ B;  3DXE A;  2P0D A;  1MK7 B;  4K2P A;  3AJ4 A;  2KUP A;  2DYQ A;  3A8P A;  2NBV A;  1NI2 A;  3AU4 A;  2VKI A;  2YT0 A;  3U8Z A;  4EJN A;  1WJ1 A;  2Z0P A;  3A8Q A;  1H10 A;  1K5G B;  5CLL B;  4F7G A;  2Y8G A;  3QWM A;  1WG7 A;  1UPQ A;  2RSG A;  1XX0 A;  3U12 A;  4GPT B;  2AEH A;  2DFK A;  3TVV A;  4HSI A;  5EFX A;  1Y5O A;  4KHO A;  1FB8 A;  3F5R A;  4HB2 B;  4HB3 B;  1V61 A;  2FJL A;  4PNK A;  1PMS A;  2ROV A;  2M14 A;  3ODX A;  5JHH A;  1GC7 A;  1X11 A;  3KRW A;  5D3X A;  5J3Q A;  3U7D A;  2W2X C;  4HAW B;  3KY9 A;  1WGU A;  4Y94 A;  1U5G A;  2D9Y A;  4GOU A;  1XCG A;  2OTX A;  2GS0 A;  2QKM A;  3FSS A;  2Y8F A;  3TO1 A;  2V76 A;  1X1G A;  3HK0 A;  1BTK A;  2D9V A;  2RLO A;  5JHG A;  2YT2 A;  2KGX B;  5LON B;  1U2B A;  2W2X D;  1EVH A;  2DHK A;  1V88 A;  4ZRJ A;  3NSU A;  5HE2 A;  4CHJ A;  4A6F A;  3GYP A;  3VOQ A;  4XWX A;  4C0A A;  1X86 A;  1KZG A;  1LB1 A;  5HE0 A;  2D9X A;  4B6H A;  3DXD A;  1NTV A;  4DXA B;  2YF0 A;  4HAZ B;  3NWF A;  5D3W A;  3CIK A;  5LOP B;  2D11 A;  1RRP B;  1FGZ A;  1W1D A;  1UNQ A;  4IFS A;  2H7E A;  4CHM A;  2XQN M;  2R09 A;  2COA A;  2EMS A;  4L1R A;  3UZT A;  2LG1 A;  4TYZ A;  3X23 A;  1FHW A;  3PP2 A;  3SO6 A;  3T06 A;  2MFQ A;  4CSQ A;  3TCA A;  1EAZ A;  2R2Y A;  4OT1 A;  2OQB A;  5CLQ B;  2Q13 A;  3TFM A;  3PVW A;  1Y19 B;  5D3V A;  1U29 A;  1GG3 A;  2FJU B;  2N0Y A;  4K17 A;  1P3R A;  2Z13 A;  5KQ4 A;  5D27 A;  4K2O A;  1QC6 A;  1ZC3 B;  5JP4 A;  5M4Y B;  4WJ7 A;  2DHI A;  1UNP A;  5DHA B;  1WJM A;  4OSN A;  1AQC A;  3PZD A;  5C79 A;  4IOY X;  4MT7 A;  2VRW B;  4IAP A;  4YON A;  3N7C A;  4WSF A;  2EMT A;  4QJ4 B;  4D6W A;  2P8V A;  4HAV B;  3ODW A;  1BTN A;  2ELA A;  1QQG A;  1OY2 A;  3NW8 A;  4KAX B;  2DYN A;  4WVF B;  4KHA A;  1V5M A;  1XD4 A;  2DTC A;  2H7D A;  4EMO A;  1OQN A;  2UZR A;  2KR0 A;  4GMX B;  2VSZ A;  4MK0 A;  1EF1 A;  4HAX B;  5D3Y A;  1MAI A;  2D2Q A;  3OHM B;  5C16 A;  3RCP A;  2YS1 A;  2YSZ A;  1PFJ A;  5DIF B;  1SGH A;  2EC1 A;  3VIA A;  1RJ2 A;  2D9Z A;  4HB0 B;  1KZ7 A;  2MKR A;  4HAY B;  5L81 A;  3DCX A;  2I5F A;  3MDB C;  2YVC A;  3QBV B;  4DIX A;  1KI1 B;  5C5B B;  3IVF A;  2MDX A;  4GXB A;  1ZYI A;  2W2W A;  1TQZ A;  1DDM A;  1ZM0 A;  5DHF B;  3SYX A;  1Z87 A;  3HIE A;  2GUM A;  4A6H A;  1FHX A;  2LUL A;  1WVH A;  4CYE A;  1NTY A;  2COD A;  3A98 B;  2IFS A;  2HTH B;  4F7U P;  4EKU A;  1UEF A;  4DX9 0;  3SUZ A;  2ZKM X;  1FOE A;  1IRS A;  3G9W A;  2YRY A;  1DRO A;  1V89 A;  2ADZ A;  4NSW A;  5KQ1 A;  3HW2 B;  1V5P A;  4GNK B;  1J19 A;  3FVC A;  1EGX A;  3PSC A;  2R0D A;  3KSY A;  1H4R A;  1NU2 A;  2Z14 A;  1ZC4 B;  2COC A;  4Z2N A;  3D8D A;  2GCL A;  3O96 A;  2E2X A;  1ZVR A;  2CY4 A;  2P0F A;  3ML4 A;  4D0N B;  2KIG A;  2K2U A;  5HE3 A;  1E5W A;  1X1F A;  5HE1 A;  1FHO A;  2JP2 A;  3OAN A;  3D8F A;  3ZDT A;  2UZS A;  1I7A A; 
#chains in the Genus database with same CATH homology
 2GJY A;  4KHB B;  1W1G A;  2DHJ A;  2DLW A;  5C5B A;  2I5C A;  3SNH A;  2HE7 A;  1J0W A;  3BIN A;  2DX5 A;  2IYB A;  1FAO A;  2NMB A;  3TW1 A;  2NZ8 B;  1DDW A;  2ELB A;  4HAU B;  3PG7 A;  1Q67 A;  2LYD A;  2GCJ A;  3M1I B;  4NY0 A;  4ZRI A;  1PLS A;  1MK9 B;  2CRF A;  2Z0O A;  2MWN B;  3FM8 C;  1X05 A;  4HB4 B;  2BCJ A;  2D4Q A;  1FGY A;  2RGN B;  1DDV A;  1WGQ A;  3P7Z A;  2KCJ A;  4P7I A;  1SHC A;  1V5U A;  1UNR A;  1TJ6 A;  2YS5 A;  2QKL A;  4K81 A;  1MKE A;  1U5E A;  2I1K A;  2ZPY A;  2J0K A;  1GC6 A;  5J3T A;  3WA0 A;  1W1H A;  3CXB B;  3LJU X;  1MIX A;  1B55 A;  3ODO A;  1ZSQ A;  2K00 A;  2DN6 A;  2I1J A;  2J59 M;  4H8S A;  4MY6 A;  1XR0 B;  2DA0 A;  4HDQ A;  2P0H A;  2LOZ A;  2M38 A;  1U5F A;  3MPX A;  2J0J A;  3V5W A;  1BWN A;  1M7R A;  2PZ1 A;  4GMV A;  3DXC A;  4ZRK A;  5KCV A;  4HHV A;  3FEH A;  4YL8 A;  2CY5 A;  1DYN A;  1BAK A;  3HQC A;  5GOW B;  5DH9 B;  1XOD A;  2D9W A;  3ULC A;  3PVU A;  2AL6 A;  1M7E A;  1MIZ B;  4GN1 A;  1ISN A;  2L2I A;  2J0M A;  4KVG B;  3PVL A;  3D8E A;  3KRX A;  2K2J A;  3WYF B;  2RVB B;  1WI1 A;  4A5K A;  1XKE A;  1K5D B;  4L6E A;  2DKQ A;  5DI9 B;  2LOX A;  3QIJ A;  1OMW A;  2YT1 A;  2EJ8 A;  2LKO A;  3BJI A;  3KZ1 A;  5FI1 A;  4DBB A;  3ZVR A;  2YS3 A;  2RUK B;  1DBH A;  2ROZ B;  2Y7B A;  4Z2M B;  5C6R A;  3ULB A;  4TKN A;  5FI0 A;  2X18 A;  4HDO A;  4PQ0 A;  3PEG A;  1U5D A;  1N3H A;  4A6K A;  3AU5 A;  2COF A;  4GZU A;  2L1C A;  4HAT B;  3P6A A;  2D10 A;  4F7H A;  2G35 A;  1P6S A;  1AWE A;  1P5T A;  2N23 A;  2RNR B;  4DX8 A;  2CAY A;  2Z0Q A;  1I2H A;  1UPR A;  2DKP A;  2UVM A;  1TXD A;  1MPH A;  4A6F B;  4BBK A;  2DX1 A;  1U27 A;  3SV1 A;  3F0W A;  3GYO A;  1LW3 A;  5J3Y A;  5JLJ B;  3DXE A;  2P0D A;  1MK7 B;  4K2P A;  3AJ4 A;  2KUP A;  2DYQ A;  3A8P A;  1NI2 A;  3AU4 A;  2VKI A;  2YT0 A;  3U8Z A;  4EJN A;  1WJ1 A;  2Z0P A;  3A8Q A;  1H10 A;  1K5G B;  5CLL B;  4F7G A;  2Y8G A;  3QWM A;  1WG7 A;  1UPQ A;  2RSG A;  1XX0 A;  4GPT B;  2AEH A;  2DFK A;  3TVV A;  5EFX A;  1Y5O A;  4KHO A;  1FB8 A;  3F5R A;  4HB2 B;  4HB3 B;  1V61 A;  2FJL A;  4PNK A;  1PMS A;  2ROV A;  2M14 A;  3ODX A;  5JHH A;  1GC7 A;  1X11 A;  3KRW A;  5D3X A;  5J3Q A;  3U7D A;  2W2X C;  4HAW B;  3KY9 A;  1WGU A;  4Y94 A;  1U5G A;  2D9Y A;  1XCG A;  2OTX A;  2GS0 A;  2QKM A;  3FSS A;  2Y8F A;  3TO1 A;  2V76 A;  1X1G A;  3HK0 A;  1BTK A;  2D9V A;  2RLO A;  5JHG A;  5LON B;  2KGX B;  1U2B A;  2W2X D;  1EVH A;  2DHK A;  1V88 A;  4ZRJ A;  3NSU A;  5HE2 A;  4CHJ A;  4A6F A;  3GYP A;  3VOQ A;  4XWX A;  4C0A A;  1X86 A;  1KZG A;  1LB1 A;  5HE0 A;  2D9X A;  4B6H A;  3DXD A;  1NTV A;  4DXA B;  2YF0 A;  4HAZ B;  5D3W A;  3CIK A;  5LOP B;  2D11 A;  1RRP B;  1FGZ A;  1W1D A;  1UNQ A;  4IFS A;  2H7E A;  4CHM A;  2XQN M;  2R09 A;  2COA A;  2EMS A;  3UZT A;  2LG1 A;  4TYZ A;  3X23 A;  1FHW A;  3PP2 A;  3SO6 A;  3T06 A;  2MFQ A;  3TCA A;  1EAZ A;  2OQB A;  5CLQ B;  2Q13 A;  3TFM A;  3PVW A;  1Y19 B;  5D3V A;  1U29 A;  1GG3 A;  2N0Y A;  4K17 A;  1P3R A;  5KQ4 A;  5D27 A;  4K2O A;  1QC6 A;  1ZC3 B;  5JP4 A;  4WJ7 A;  2DHI A;  1UNP A;  5DHA B;  1WJM A;  1AQC A;  3PZD A;  5C79 A;  4IOY X;  4MT7 A;  2VRW B;  4IAP A;  4YON A;  3N7C A;  4WSF A;  2EMT A;  2P8V A;  4HAV B;  3ODW A;  1BTN A;  2ELA A;  1QQG A;  1OY2 A;  4KAX B;  2DYN A;  4WVF B;  4KHA A;  1V5M A;  1XD4 A;  2DTC A;  2H7D A;  4EMO A;  1OQN A;  2UZR A;  4GMX B;  2VSZ A;  4MK0 A;  1EF1 A;  4HAX B;  5D3Y A;  1MAI A;  2D2Q A;  5C16 A;  3RCP A;  2YS1 A;  2YSZ A;  1PFJ A;  5DIF B;  1SGH A;  2EC1 A;  3VIA A;  1RJ2 A;  2D9Z A;  4HB0 B;  1KZ7 A;  2MKR A;  4HAY B;  5L81 A;  2I5F A;  3MDB C;  2YVC A;  3QBV B;  1KI1 B;  5C5B B;  3IVF A;  2MDX A;  4GXB A;  2W2W A;  1TQZ A;  1DDM A;  1ZM0 A;  5DHF B;  3SYX A;  1Z87 A;  4A6H A;  1FHX A;  2LUL A;  1WVH A;  4CYE A;  1NTY A;  2COD A;  3A98 B;  2IFS A;  2HTH B;  4F7U P;  4EKU A;  1UEF A;  4DX9 0;  3SUZ A;  1FOE A;  1IRS A;  3G9W A;  2YRY A;  1DRO A;  1V89 A;  2ADZ A;  4NSW A;  5KQ1 A;  3HW2 B;  1V5P A;  1J19 A;  1EGX A;  3PSC A;  2R0D A;  3KSY A;  1H4R A;  1NU2 A;  1ZC4 B;  2COC A;  4Z2N A;  3D8D A;  2GCL A;  3O96 A;  2E2X A;  1ZVR A;  2CY4 A;  2P0F A;  3ML4 A;  4D0N B;  2K2U A;  5HE3 A;  1E5W A;  1X1F A;  5HE1 A;  1FHO A;  2JP2 A;  3OAN A;  3D8F A;  3ZDT A;  2UZS A;  1I7A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...