4DX90

Icap1 in complex with integrin beta 1 cytoplasmic tail
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
137
structure length
110
Chain Sequence
b'CAEFRIKYVGAIGPLDLINYIDVAQQDGKLPFVPPEEEFIMGVSKYGIKVSTLHRHALYLIIRMVCYDDGLGAKSLLALKTSLWVYQCNSLEQAQAICKVLSTAFDSVLT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Integrin beta-1-binding protein 1
publication title Mechanism for KRIT1 Release of ICAP1-Mediated Suppression of Integrin Activation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 16
structure length 110
sequence length 137
chains with identical sequence 1, 2, 3, 4, 5, A, C, E, G, I, K, M, O, Q, S, U, W, Y, a, c, e, g, i, k, m, o, q, s, u, w, y
ec nomenclature
pdb deposition date 2012-02-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 4dx9000
2DHJA 2ELAA 4HAUB 4CYEA 1MPHA 3AJ4A 1H10A 4MT7A 4HDOA 2YF0A 3KZ1A 5D3XA 4GZUA 1OY2A 1GC6A 3QWMA 1Y19B 1W1GA 5J3YA 1ZC4B 5LOPB 2UVMA 2IFSA 3TO1A 1PMSA 4YL8A 1U27A 4A5KA 3FSSA 2R09A 5FI0A 2QKLA 1PFJA 2GCJA 5D3YA 2P0DA 2GCLA 1UNQA 2EMSA 1TQZA 2VKIA 2DFKA 5LONB 2OQBA 1FHOA 3HQCA 4KHAA 3KSYA 2N23A 2BCJA 1PLSA 4CHMA 2P0FA 2X18A 1IRSA 1BAKA 2MFQA 5D3WA 1J19A 1P3RA 2LG1A 4KAXB 1M7RA 5JHGA 1UPQA 2K2JA 3PEGA 1BTKA 3ODWA 4GMVA 1V5MA 4ZRKA 1OMWA 5GOWB 4A6HA 1GC7A 5HE0A 1Y5OA 2RVBB 2ROVA 4A6FB 2DA0A 2LOXA 4F7GA 3T06A 1ZM0A 4WVFB 2MDXA 2UZRA 2LULA 1XD4A 5KCVA 2KUPA 2YT1A 1WJ1A 2VSZA 2K00A 5C16A 4Y94A 4Z2NA 3D8EA 3PZDA 3SYXA 5C5BA 3CXBB 3PP2A 5DI9B 1LB1A 1QC6A 2YS5A 1N3HA 3AU5A 2DHKA 1V61A 2DTCA 2DX5A 4ZRJA 4GMXB 4WJ7A 2AL6A 2DX1A 1FGZA 5KQ1A 3ODOA 3VIAA 2COFA 2Y8GA 2EMTA 2MWNB 1ZVRA 4L6EA 2D9ZA 3NSUA 3P7ZA 4HDQA 5CLQB 2YSZA 5C79A 1LW3A 1XKEA 4MK0A 2GS0A 3U7DA 3D8DA 4HHVA 2Y8FA 1FHXA 1NU2A 4YONA 2YRYA 3HW2B 1FGYA 1AWEA 4K2OA 3TVVA 1I2HA 3PVUA 3ML4A 1EVHA 2YS1A 1RRPB 3WA0A 2HE7A 2CRFA 3MDBC 2YS3A 1W1HA 3TFMA 1UNRA 2OTXA 1BWNA 3SV1A 3MPXA 1UEFA 2RGNB 2DKPA 2Z0QA 1U29A 1EAZA 1P5TA 2RNRB 4DBBA 2LOZA 3BJIA 2XQNM 1UNPA 4F7UP 2DKQA 2J59M 4TKNA 1V5UA 1MAIA 1KZ7A 1NTVA 4H8SA 5C6RA 2L1CA 1I7AA 5JP4A 2K2UA 2E2XA 2CAYA 1Z87A 5CLLB 3TCAA 4EMOA 1WG7A 3V5WA 2D10A 2JP2A 2MKRA 1RJ2A 5DIFB 2J0KA 3A8PA 2I1JA 3PVLA 4HAZB 4K2PA 2HTHB 1OQNA 3OANA 1SGHA 4GPTB 4EKUA 3ZDTA 4KHOA 1U5DA 1MK9B 1FB8A 2D9VA 3RCPA 2L2IA 4NY0A 1KI1B 1TXDA 1X05A 3N7CA 3QIJA 4GN1A 3ULCA 4HAXB 2N0YA 3IVFA 2LYDA 1GG3A 1X11A 2IYBA 3G9WA 1X1GA 1WGQA 1V89A 3FEHA 1DBHA 4IOYX 4CHJA 3X23A 3DXCA 2CODA 3M1IB 3LJUX 2DHIA 4XWXA 2V76A 3P6AA 2AEHA 3AU4A 2CY4A 4D0NB 1J0WA 1U5EA 1QQGA 5JHHA 1EGXA 3KRWA 4GXBA 2D11A 2EJ8A 3GYPA 1WI1A 2RUKB 5C5BB 1ISNA 1NTYA 1MIXA 1TJ6A 3PVWA 3PG7A 4KHBB 3QBVB 2Q13A 1XX0A 4DX90 1BTNA 2CY5A 3F0WA 5DH9B 4HB2B 5D3VA 4HAWB 2W2WA 4IFSA 2ZPYA 3TW1A 4C0AA 2FJLA 3A98B 2KCJA 1AQCA 4DX8A 2R0DA 4K81A 4Z2MB 1ZC3B 3SO6A 5HE2A 4PQ0A 1DYNA 3KY9A 3UZTA 2NZ8B 4HB4B 2RLOA 4F7HA 3CIKA 2LKOA 5DHAB 2M38A 2W2XD 1MKEA 2D9XA 2Z0OA 3D8FA 2ROZB 2Y7BA 2D9WA 1FAOA 1K5DB 4K17A 4ZRIA 1MIZB 3WYFB 3HK0A 1V5PA 2ADZA 2DN6A 3O96A 3SNHA 1X86A 3ZVRA 5KQ4A 2DYNA 5FI1A 5J3TA 5DHFB 1FOEA 1DDVA 4WSFA 1XR0B 1WJMA 1U2BA 1DDMA 1WGUA 2DYQA 2GJYA 5JLJB 2J0JA 2G35A 1EF1A 4TYZA 4HAVB 4HB3B 4A6FA 4KVGB 2I5FA 3BINA 1DROA 2YVCA 1SHCA 1XCGA 3VOQA 5L81A 2P0HA 2DLWA 4A6KA 3ULBA 2ELBA 2H7EA 2Z0PA 2RSGA 1XODA 3PSCA 4NSWA 3U8ZA 3DXDA 1H4RA 3DXEA 2COAA 2W2XC 1ZSQA 5HE3A 1UPRA 1B55A 1KZGA 2J0MA 2D2QA 1W1DA 5J3QA 2UZSA 3ODXA 1NI2A 1Q67A 4EJNA 1WVHA 1X1FA 4B6HA 2P8VA 3F5RA 3GYOA 2QKMA 4IAPA 3KRXA 2D4QA 4HATB 1MK7B 2I5CA 1E5WA 2EC1A 4HB0B 1U5GA 1V88A 5EFXA 5HE1A 2NMBA 3A8QA 2D9YA 1K5GB 3SUZA 1P6SA 2H7DA 2COCA 4HAYB 1U5FA 4BBKA 4MY6A 4P7IA 2I1KA 1FHWA 5D27A 1M7EA 2VRWB 4DXAB 3FM8C 2KGXB 1DDWA 2PZ1A 2YT0A 2M14A 4PNKA
chains in the Genus database with same CATH superfamily
2DHJA 2ELAA 4HAUB 4CYEA 1MPHA 3AJ4A 1H10A 4MT7A 2ZKMX 4HDOA 2YF0A 3KZ1A 5D3XA 4GZUA 1OY2A 1GC6A 3QWMA 1Y19B 1W1GA 5J3YA 1ZC4B 5LOPB 2UVMA 2IFSA 3TO1A 1PMSA 4QJ3B 4YL8A 1U27A 4A5KA 3NW8A 4L1RA 3FSSA 2R09A 5FI0A 2QKLA 1PFJA 2GCJA 5D3YA 2P0DA 2GCLA 1UNQA 2EMSA 1TQZA 2VKIA 2DFKA 5LONB 2OQBA 4GNKB 1FHOA 3HQCA 4KHAA 3KSYA 2N23A 2BCJA 3FVCA 1PLSA 4CHMA 2P0FA 2X18A 2GUMA 1IRSA 1BAKA 2MFQA 2FJUB 5D3WA 1J19A 1P3RA 2LG1A 4KAXB 1M7RA 5JHGA 1UPQA 2K2JA 3PEGA 1BTKA 3ODWA 4GMVA 1V5MA 4ZRKA 1OMWA 5GOWB 4A6HA 1GC7A 5HE0A 1Y5OA 2RVBB 2ROVA 4A6FB 2DA0A 2LOXA 4F7GA 3T06A 1ZM0A 4WVFB 2MDXA 2UZRA 2LULA 2Z4DA 1XD4A 5KCVA 2KUPA 2YT1A 1WJ1A 2VSZA 2K00A 5C16A 4Y94A 2Z14A 4Z2NA 3D8EA 3PZDA 3SYXA 4OSNA 5C5BA 3CXBB 3PP2A 5DI9B 1LB1A 1QC6A 2YS5A 4KHBA 1N3HA 2R2YA 3AU5A 2DHKA 1V61A 2DTCA 2KIGA 2DX5A 4ZRJA 4GMXB 4WJ7A 2AL6A 2DX1A 1FGZA 5KQ1A 3ODOA 3VIAA 4OT1A 4DIXA 2COFA 2Y8GA 2EMTA 2MWNB 1ZVRA 4L6EA 2D9ZA 3NSUA 3P7ZA 5IRSA 4HDQA 5CLQB 2YSZA 5C79A 1LW3A 1XKEA 4MK0A 2GS0A 3U7DA 3D8DA 4HHVA 3U12A 2Y8FA 1FHXA 1NU2A 4YONA 2YRYA 3HW2B 1FGYA 1AWEA 4K2OA 3TVVA 1I2HA 3PVUA 3ML4A 1EVHA 2YS1A 1RRPB 3WA0A 2HE7A 2CRFA 3MDBC 2YS3A 1W1HA 3TFMA 1UNRA 2OTXA 1BWNA 3SV1A 3MPXA 1UEFA 2RGNB 2DKPA 2Z0QA 1U29A 1EAZA 1P5TA 3HSAA 2RNRB 4DBBA 2LOZA 3BJIA 2XQNM 1UNPA 5I2SA 4F7UP 2DKQA 2J59M 4TKNA 1V5UA 1MAIA 1KZ7A 1NTVA 4H8SA 4QJ4B 2YT2A 5C6RA 2L1CA 1I7AA 5JP4A 2K2UA 2E2XA 2CAYA 1Z87A 5CLLB 3TCAA 4EMOA 1WG7A 3V5WA 2D10A 2JP2A 2MKRA 1RJ2A 5DIFB 2J0KA 3A8PA 2I1JA 3PVLA 4HAZB 4K2PA 2HTHB 1OQNA 3OANA 1SGHA 4GPTB 4EKUA 3ZDTA 4KHOA 1U5DA 1MK9B 1FB8A 2D9VA 3RCPA 2L2IA 4NY0A 1KI1B 1TXDA 1X05A 3N7CA 3QIJA 4GN1A 3B77A 3ULCA 4HAXB 2N0YA 2LYDA 3IVFA 1GG3A 1X11A 2IYBA 3G9WA 1X1GA 1WGQA 1V89A 2Z13A 3FEHA 1DBHA 4IOYX 4CHJA 3X23A 2KR0A 3HIEA 3DXCA 2CODA 3M1IB 3LJUX 2DHIA 4XWXA 2V76A 3P6AA 2AEHA 3A58A 3AU4A 2CY4A 4D0NB 1J0WA 1U5EA 1QQGA 5JHHA 1EGXA 3KRWA 4GXBA 2D11A 2EJ8A 3GYPA 1WI1A 3NWDA 4HSIA 2RUKB 4D6WA 5I2MA 1ZYIA 5C5BB 1ISNA 1NTYA 1MIXA 1TJ6A 3PVWA 3PG7A 4CSQA 4KHBB 3QBVB 2Q13A 1XX0A 4DX90 1BTNA 2CY5A 3F0WA 5DH9B 4HB2B 5D3VA 4GOUA 4HAWB 3NWAA 2W2WA 4IFSA 2ZPYA 3TW1A 4C0AA 2FJLA 3A98B 2K8EA 2KCJA 1AQCA 4DX8A 2R0DA 4K81A 5LG4B 4Z2MB 1ZC3B 3SO6A 5HE2A 4PQ0A 2RRFA 1DYNA 2K49A 2KUQA 3KY9A 3UZTA 2NZ8B 4HB4B 2RLOA 4F7HA 2Z59A 3CIKA 2LKOA 5DHAB 2M38A 2W2XD 1MKEA 2KIEA 2D9XA 2Z0OA 3D8FA 2ROZB 2Y7BA 2D9WA 1FAOA 1K5DB 4K17A 4ZRIA 1MIZB 3WYFB 3HK0A 1V5PA 4QJ5B 2ADZA 2DN6A 3O96A 3SNHA 1X86A 3ZVRA 5KQ4A 2DYNA 5FI1A 5J3TA 5DHFB 1FOEA 1DDVA 4WSFA 1XR0B 1WJMA 1U2BA 1DDMA 1WGUA 2DYQA 2GJYA 5JLJB 2J0JA 2G35A 1EF1A 4TYZA 4HAVB 4HB3B 4A6FA 4KVGB 2I5FA 3BINA 1DROA 2YVCA 1SHCA 1XCGA 3VOQA 5L81A 2P0HA 2DLWA 4A6KA 3ULBA 2ELBA 2H7EA 2Z0PA 2RSGA 3NWFA 1XODA 3PSCA 4NSWA 3U8ZA 3DXDA 1H4RA 3DXEA 2COAA 2W2XC 1ZSQA 5HE3A 1UPRA 1B55A 1KZGA 2J0MA 2D2QA 1W1DA 5J3QA 2UZSA 3ODXA 1NI2A 1Q67A 4EJNA 1WVHA 1T77A 1X1FA 4B6HA 2P8VA 3F5RA 3GYOA 2QKMA 4IAPA 3KRXA 2D4QA 4HATB 1MK7B 2I5CA 1E5WA 1MI1A 2EC1A 4HB0B 1U5GA 1V88A 4QXAB 5EFXA 5HE1A 2NMBA 3A8QA 5M4YB 2D9YA 1K5GB 3SUZA 1P6SA 3OHMB 2H7DA 2COCA 4HAYB 1U5FA 4BBKA 4MY6A 2NBVA 4P7IA 2I1KA 3DCXA 1FHWA 5D27A 1M7EA 2VRWB 4DXAB 3FM8C 2KGXB 1DDWA 2PZ1A 2YT0A 2M14A 4PNKA
chains in the Genus database with same CATH topology
2DHJA 2ELAA 4HAUB 4CYEA 1MPHA 3AJ4A 1H10A 4MT7A 4HDOA 2YF0A 3KZ1A 5D3XA 4GZUA 1OY2A 1GC6A 3QWMA 1Y19B 1W1GA 5J3YA 1ZC4B 5LOPB 2UVMA 2IFSA 3TO1A 1PMSA 4YL8A 1U27A 4A5KA 3FSSA 2R09A 5FI0A 2QKLA 1PFJA 2GCJA 5D3YA 2P0DA 2GCLA 1UNQA 2EMSA 1TQZA 2VKIA 2DFKA 5LONB 2OQBA 1FHOA 3HQCA 4KHAA 3KSYA 2N23A 2BCJA 1PLSA 4CHMA 2P0FA 2X18A 1IRSA 1BAKA 2MFQA 5D3WA 1J19A 1P3RA 2LG1A 4KAXB 1M7RA 5JHGA 1UPQA 2K2JA 3PEGA 1BTKA 3ODWA 4GMVA 1V5MA 4ZRKA 1OMWA 5GOWB 4A6HA 1GC7A 5HE0A 1Y5OA 2RVBB 2ROVA 4A6FB 2DA0A 2LOXA 4F7GA 3T06A 1ZM0A 4WVFB 2MDXA 2UZRA 2LULA 1XD4A 5KCVA 2KUPA 2YT1A 1WJ1A 2VSZA 2K00A 5C16A 4Y94A 4Z2NA 3D8EA 3PZDA 3SYXA 5C5BA 3CXBB 3PP2A 5DI9B 1LB1A 1QC6A 2YS5A 1N3HA 3AU5A 2DHKA 1V61A 2DTCA 2DX5A 4ZRJA 4GMXB 4WJ7A 2AL6A 2DX1A 1FGZA 5KQ1A 3ODOA 3VIAA 2COFA 2Y8GA 2EMTA 2MWNB 1ZVRA 4L6EA 2D9ZA 3NSUA 3P7ZA 4HDQA 5CLQB 2YSZA 5C79A 1LW3A 1XKEA 4MK0A 2GS0A 3U7DA 3D8DA 4HHVA 2Y8FA 1FHXA 1NU2A 4YONA 2YRYA 3HW2B 1FGYA 1AWEA 4K2OA 3TVVA 1I2HA 3PVUA 3ML4A 1EVHA 2YS1A 1RRPB 3WA0A 2HE7A 2CRFA 3MDBC 2YS3A 1W1HA 3TFMA 1UNRA 2OTXA 1BWNA 3SV1A 3MPXA 1UEFA 2RGNB 2DKPA 2Z0QA 1U29A 1EAZA 1P5TA 2RNRB 4DBBA 2LOZA 3BJIA 2XQNM 1UNPA 4F7UP 2DKQA 2J59M 4TKNA 1V5UA 1MAIA 1KZ7A 1NTVA 4H8SA 5C6RA 2L1CA 1I7AA 5JP4A 2K2UA 2E2XA 2CAYA 1Z87A 5CLLB 3TCAA 4EMOA 1WG7A 3V5WA 2D10A 2JP2A 2MKRA 1RJ2A 5DIFB 2J0KA 3A8PA 2I1JA 3PVLA 4HAZB 4K2PA 2HTHB 1OQNA 3OANA 1SGHA 4GPTB 4EKUA 3ZDTA 4KHOA 1U5DA 1MK9B 1FB8A 2D9VA 3RCPA 2L2IA 4NY0A 1KI1B 1TXDA 1X05A 3N7CA 3QIJA 4GN1A 3ULCA 4HAXB 2N0YA 3IVFA 2LYDA 1GG3A 1X11A 2IYBA 3G9WA 1X1GA 1WGQA 1V89A 3FEHA 1DBHA 4IOYX 4CHJA 3X23A 3DXCA 2CODA 3M1IB 3LJUX 2DHIA 4XWXA 2V76A 3P6AA 2AEHA 3AU4A 2CY4A 4D0NB 1J0WA 1U5EA 1QQGA 5JHHA 1EGXA 3KRWA 4GXBA 2D11A 2EJ8A 3GYPA 1WI1A 2RUKB 5C5BB 1ISNA 1NTYA 1MIXA 1TJ6A 3PVWA 3PG7A 4KHBB 3QBVB 2Q13A 1XX0A 4DX90 1BTNA 2CY5A 3F0WA 5DH9B 4HB2B 5D3VA 4HAWB 2W2WA 4IFSA 2ZPYA 3TW1A 4C0AA 2FJLA 3A98B 2KCJA 1AQCA 4DX8A 2R0DA 4K81A 4Z2MB 1ZC3B 3SO6A 5HE2A 4PQ0A 1DYNA 3KY9A 3UZTA 2NZ8B 4HB4B 2RLOA 4F7HA 3CIKA 2LKOA 5DHAB 2M38A 2W2XD 1MKEA 2D9XA 2Z0OA 3D8FA 2ROZB 2Y7BA 2D9WA 1FAOA 1K5DB 4K17A 4ZRIA 1MIZB 3WYFB 3HK0A 1V5PA 2ADZA 2DN6A 3O96A 3SNHA 1X86A 3ZVRA 5KQ4A 2DYNA 5FI1A 5J3TA 5DHFB 1FOEA 1DDVA 4WSFA 1XR0B 1WJMA 1U2BA 1DDMA 1WGUA 2DYQA 2GJYA 5JLJB 2J0JA 2G35A 1EF1A 4TYZA 4HAVB 4HB3B 4A6FA 4KVGB 2I5FA 3BINA 1DROA 2YVCA 1SHCA 1XCGA 3VOQA 5L81A 2P0HA 2DLWA 4A6KA 3ULBA 2ELBA 2H7EA 2Z0PA 2RSGA 1XODA 3PSCA 4NSWA 3U8ZA 3DXDA 1H4RA 3DXEA 2COAA 2W2XC 1ZSQA 5HE3A 1UPRA 1B55A 1KZGA 2J0MA 2D2QA 1W1DA 5J3QA 2UZSA 3ODXA 1NI2A 1Q67A 4EJNA 1WVHA 1X1FA 4B6HA 2P8VA 3F5RA 3GYOA 2QKMA 4IAPA 3KRXA 2D4QA 4HATB 1MK7B 2I5CA 1E5WA 2EC1A 4HB0B 1U5GA 1V88A 5EFXA 5HE1A 2NMBA 3A8QA 2D9YA 1K5GB 3SUZA 1P6SA 2H7DA 2COCA 4HAYB 1U5FA 4BBKA 4MY6A 4P7IA 2I1KA 1FHWA 5D27A 1M7EA 2VRWB 4DXAB 3FM8C 2KGXB 1DDWA 2PZ1A 2YT0A 2M14A 4PNKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DHJ A;  2ELA A;  4HAU B;  4CYE A;  1MPH A;  3AJ4 A;  1H10 A;  4MT7 A;  4HDO A;  2YF0 A;  3KZ1 A;  5D3X A;  4GZU A;  1OY2 A;  1GC6 A;  3QWM A;  1Y19 B;  1W1G A;  5J3Y A;  1ZC4 B;  5LOP B;  2UVM A;  2IFS A;  3TO1 A;  1PMS A;  4YL8 A;  1U27 A;  4A5K A;  3FSS A;  2R09 A;  5FI0 A;  2QKL A;  1PFJ A;  2GCJ A;  5D3Y A;  2P0D A;  2GCL A;  1UNQ A;  2EMS A;  1TQZ A;  2VKI A;  2DFK A;  5LON B;  2OQB A;  1FHO A;  3HQC A;  4KHA A;  3KSY A;  2N23 A;  2BCJ A;  1PLS A;  4CHM A;  2P0F A;  2X18 A;  1IRS A;  1BAK A;  2MFQ A;  5D3W A;  1J19 A;  1P3R A;  2LG1 A;  4KAX B;  1M7R A;  5JHG A;  1UPQ A;  2K2J A;  3PEG A;  1BTK A;  3ODW A;  4GMV A;  1V5M A;  4ZRK A;  1OMW A;  5GOW B;  4A6H A;  1GC7 A;  5HE0 A;  1Y5O A;  2RVB B;  2ROV A;  4A6F B;  2DA0 A;  2LOX A;  4F7G A;  3T06 A;  1ZM0 A;  4WVF B;  2MDX A;  2UZR A;  2LUL A;  1XD4 A;  5KCV A;  2KUP A;  2YT1 A;  1WJ1 A;  2VSZ A;  2K00 A;  5C16 A;  4Y94 A;  4Z2N A;  3D8E A;  3PZD A;  3SYX A;  5C5B A;  3CXB B;  3PP2 A;  5DI9 B;  1LB1 A;  1QC6 A;  2YS5 A;  1N3H A;  3AU5 A;  2DHK A;  1V61 A;  2DTC A;  2DX5 A;  4ZRJ A;  4GMX B;  4WJ7 A;  2AL6 A;  2DX1 A;  1FGZ A;  5KQ1 A;  3ODO A;  3VIA A;  2COF A;  2Y8G A;  2EMT A;  2MWN B;  1ZVR A;  4L6E A;  2D9Z A;  3NSU A;  3P7Z A;  4HDQ A;  5CLQ B;  2YSZ A;  5C79 A;  1LW3 A;  1XKE A;  4MK0 A;  2GS0 A;  3U7D A;  3D8D A;  4HHV A;  2Y8F A;  1FHX A;  1NU2 A;  4YON A;  2YRY A;  3HW2 B;  1FGY A;  1AWE A;  4K2O A;  3TVV A;  1I2H A;  3PVU A;  3ML4 A;  1EVH A;  2YS1 A;  1RRP B;  3WA0 A;  2HE7 A;  2CRF A;  3MDB C;  2YS3 A;  1W1H A;  3TFM A;  1UNR A;  2OTX A;  1BWN A;  3SV1 A;  3MPX A;  1UEF A;  2RGN B;  2DKP A;  2Z0Q A;  1U29 A;  1EAZ A;  1P5T A;  2RNR B;  4DBB A;  2LOZ A;  3BJI A;  2XQN M;  1UNP A;  4F7U P;  2DKQ A;  2J59 M;  4TKN A;  1V5U A;  1MAI A;  1KZ7 A;  1NTV A;  4H8S A;  5C6R A;  2L1C A;  1I7A A;  5JP4 A;  2K2U A;  2E2X A;  2CAY A;  1Z87 A;  5CLL B;  3TCA A;  4EMO A;  1WG7 A;  3V5W A;  2D10 A;  2JP2 A;  2MKR A;  1RJ2 A;  5DIF B;  2J0K A;  3A8P A;  2I1J A;  3PVL A;  4HAZ B;  4K2P A;  2HTH B;  1OQN A;  3OAN A;  1SGH A;  4GPT B;  4EKU A;  3ZDT A;  4KHO A;  1U5D A;  1MK9 B;  1FB8 A;  2D9V A;  3RCP A;  2L2I A;  4NY0 A;  1KI1 B;  1TXD A;  1X05 A;  3N7C A;  3QIJ A;  4GN1 A;  3ULC A;  4HAX B;  2N0Y A;  3IVF A;  2LYD A;  1GG3 A;  1X11 A;  2IYB A;  3G9W A;  1X1G A;  1WGQ A;  1V89 A;  3FEH A;  1DBH A;  4IOY X;  4CHJ A;  3X23 A;  3DXC A;  2COD A;  3M1I B;  3LJU X;  2DHI A;  4XWX A;  2V76 A;  3P6A A;  2AEH A;  3AU4 A;  2CY4 A;  4D0N B;  1J0W A;  1U5E A;  1QQG A;  5JHH A;  1EGX A;  3KRW A;  4GXB A;  2D11 A;  2EJ8 A;  3GYP A;  1WI1 A;  2RUK B;  5C5B B;  1ISN A;  1NTY A;  1MIX A;  1TJ6 A;  3PVW A;  3PG7 A;  4KHB B;  3QBV B;  2Q13 A;  1XX0 A;  4DX9 0;  1BTN A;  2CY5 A;  3F0W A;  5DH9 B;  4HB2 B;  5D3V A;  4HAW B;  2W2W A;  4IFS A;  2ZPY A;  3TW1 A;  4C0A A;  2FJL A;  3A98 B;  2KCJ A;  1AQC A;  4DX8 A;  2R0D A;  4K81 A;  4Z2M B;  1ZC3 B;  3SO6 A;  5HE2 A;  4PQ0 A;  1DYN A;  3KY9 A;  3UZT A;  2NZ8 B;  4HB4 B;  2RLO A;  4F7H A;  3CIK A;  2LKO A;  5DHA B;  2M38 A;  2W2X D;  1MKE A;  2D9X A;  2Z0O A;  3D8F A;  2ROZ B;  2Y7B A;  2D9W A;  1FAO A;  1K5D B;  4K17 A;  4ZRI A;  1MIZ B;  3WYF B;  3HK0 A;  1V5P A;  2ADZ A;  2DN6 A;  3O96 A;  3SNH A;  1X86 A;  3ZVR A;  5KQ4 A;  2DYN A;  5FI1 A;  5J3T A;  5DHF B;  1FOE A;  1DDV A;  4WSF A;  1XR0 B;  1WJM A;  1U2B A;  1DDM A;  1WGU A;  2DYQ A;  2GJY A;  5JLJ B;  2J0J A;  2G35 A;  1EF1 A;  4TYZ A;  4HAV B;  4HB3 B;  4A6F A;  4KVG B;  2I5F A;  3BIN A;  1DRO A;  2YVC A;  1SHC A;  1XCG A;  3VOQ A;  5L81 A;  2P0H A;  2DLW A;  4A6K A;  3ULB A;  2ELB A;  2H7E A;  2Z0P A;  2RSG A;  1XOD A;  3PSC A;  4NSW A;  3U8Z A;  3DXD A;  1H4R A;  3DXE A;  2COA A;  2W2X C;  1ZSQ A;  5HE3 A;  1UPR A;  1B55 A;  1KZG A;  2J0M A;  2D2Q A;  1W1D A;  5J3Q A;  2UZS A;  3ODX A;  1NI2 A;  1Q67 A;  4EJN A;  1WVH A;  1X1F A;  4B6H A;  2P8V A;  3F5R A;  3GYO A;  2QKM A;  4IAP A;  3KRX A;  2D4Q A;  4HAT B;  1MK7 B;  2I5C A;  1E5W A;  2EC1 A;  4HB0 B;  1U5G A;  1V88 A;  5EFX A;  5HE1 A;  2NMB A;  3A8Q A;  2D9Y A;  1K5G B;  3SUZ A;  1P6S A;  2H7D A;  2COC A;  4HAY B;  1U5F A;  4BBK A;  4MY6 A;  4P7I A;  2I1K A;  1FHW A;  5D27 A;  1M7E A;  2VRW B;  4DXA B;  3FM8 C;  2KGX B;  1DDW A;  2PZ1 A;  2YT0 A;  2M14 A;  4PNK A; 
#chains in the Genus database with same CATH topology
 2DHJ A;  2ELA A;  4HAU B;  4CYE A;  1MPH A;  3AJ4 A;  1H10 A;  4MT7 A;  2ZKM X;  4HDO A;  2YF0 A;  3KZ1 A;  5D3X A;  4GZU A;  1OY2 A;  1GC6 A;  3QWM A;  1Y19 B;  1W1G A;  5J3Y A;  1ZC4 B;  5LOP B;  2UVM A;  2IFS A;  3TO1 A;  1PMS A;  4QJ3 B;  4YL8 A;  1U27 A;  4A5K A;  3NW8 A;  4L1R A;  3FSS A;  2R09 A;  5FI0 A;  2QKL A;  1PFJ A;  2GCJ A;  5D3Y A;  2P0D A;  2GCL A;  1UNQ A;  2EMS A;  1TQZ A;  2VKI A;  2DFK A;  5LON B;  2OQB A;  4GNK B;  1FHO A;  3HQC A;  4KHA A;  3KSY A;  2N23 A;  2BCJ A;  3FVC A;  1PLS A;  4CHM A;  2P0F A;  2X18 A;  2GUM A;  1IRS A;  1BAK A;  2MFQ A;  2FJU B;  5D3W A;  1J19 A;  1P3R A;  2LG1 A;  4KAX B;  1M7R A;  5JHG A;  1UPQ A;  2K2J A;  3PEG A;  1BTK A;  3ODW A;  4GMV A;  1V5M A;  4ZRK A;  1OMW A;  5GOW B;  4A6H A;  1GC7 A;  5HE0 A;  1Y5O A;  2RVB B;  2ROV A;  4A6F B;  2DA0 A;  2LOX A;  4F7G A;  3T06 A;  1ZM0 A;  4WVF B;  2MDX A;  2UZR A;  2LUL A;  2Z4D A;  1XD4 A;  5KCV A;  2KUP A;  2YT1 A;  1WJ1 A;  2VSZ A;  2K00 A;  5C16 A;  4Y94 A;  2Z14 A;  4Z2N A;  3D8E A;  3PZD A;  3SYX A;  4OSN A;  5C5B A;  3CXB B;  3PP2 A;  5DI9 B;  1LB1 A;  1QC6 A;  2YS5 A;  4KHB A;  1N3H A;  2R2Y A;  3AU5 A;  2DHK A;  1V61 A;  2DTC A;  2KIG A;  2DX5 A;  4ZRJ A;  4GMX B;  4WJ7 A;  2AL6 A;  2DX1 A;  1FGZ A;  5KQ1 A;  3ODO A;  3VIA A;  4OT1 A;  4DIX A;  2COF A;  2Y8G A;  2EMT A;  2MWN B;  1ZVR A;  4L6E A;  2D9Z A;  3NSU A;  3P7Z A;  5IRS A;  4HDQ A;  5CLQ B;  2YSZ A;  5C79 A;  1LW3 A;  1XKE A;  4MK0 A;  2GS0 A;  3U7D A;  3D8D A;  4HHV A;  3U12 A;  2Y8F A;  1FHX A;  1NU2 A;  4YON A;  2YRY A;  3HW2 B;  1FGY A;  1AWE A;  4K2O A;  3TVV A;  1I2H A;  3PVU A;  3ML4 A;  1EVH A;  2YS1 A;  1RRP B;  3WA0 A;  2HE7 A;  2CRF A;  3MDB C;  2YS3 A;  1W1H A;  3TFM A;  1UNR A;  2OTX A;  1BWN A;  3SV1 A;  3MPX A;  1UEF A;  2RGN B;  2DKP A;  2Z0Q A;  1U29 A;  1EAZ A;  1P5T A;  3HSA A;  2RNR B;  4DBB A;  2LOZ A;  3BJI A;  2XQN M;  1UNP A;  5I2S A;  4F7U P;  2DKQ A;  2J59 M;  4TKN A;  1V5U A;  1MAI A;  1KZ7 A;  1NTV A;  4H8S A;  4QJ4 B;  2YT2 A;  5C6R A;  2L1C A;  1I7A A;  5JP4 A;  2K2U A;  2E2X A;  2CAY A;  1Z87 A;  5CLL B;  3TCA A;  4EMO A;  1WG7 A;  3V5W A;  2D10 A;  2JP2 A;  2MKR A;  1RJ2 A;  5DIF B;  2J0K A;  3A8P A;  2I1J A;  3PVL A;  4HAZ B;  4K2P A;  2HTH B;  1OQN A;  3OAN A;  1SGH A;  4GPT B;  4EKU A;  3ZDT A;  4KHO A;  1U5D A;  1MK9 B;  1FB8 A;  2D9V A;  3RCP A;  2L2I A;  4NY0 A;  1KI1 B;  1TXD A;  1X05 A;  3N7C A;  3QIJ A;  4GN1 A;  3B77 A;  3ULC A;  4HAX B;  2N0Y A;  2LYD A;  3IVF A;  1GG3 A;  1X11 A;  2IYB A;  3G9W A;  1X1G A;  1WGQ A;  1V89 A;  2Z13 A;  3FEH A;  1DBH A;  4IOY X;  4CHJ A;  3X23 A;  2KR0 A;  3HIE A;  3DXC A;  2COD A;  3M1I B;  3LJU X;  2DHI A;  4XWX A;  2V76 A;  3P6A A;  2AEH A;  3A58 A;  3AU4 A;  2CY4 A;  4D0N B;  1J0W A;  1U5E A;  1QQG A;  5JHH A;  1EGX A;  3KRW A;  4GXB A;  2D11 A;  2EJ8 A;  3GYP A;  1WI1 A;  3NWD A;  4HSI A;  2RUK B;  4D6W A;  5I2M A;  1ZYI A;  5C5B B;  1ISN A;  1NTY A;  1MIX A;  1TJ6 A;  3PVW A;  3PG7 A;  4CSQ A;  4KHB B;  3QBV B;  2Q13 A;  1XX0 A;  4DX9 0;  1BTN A;  2CY5 A;  3F0W A;  5DH9 B;  4HB2 B;  5D3V A;  4GOU A;  4HAW B;  3NWA A;  2W2W A;  4IFS A;  2ZPY A;  3TW1 A;  4C0A A;  2FJL A;  3A98 B;  2K8E A;  2KCJ A;  1AQC A;  4DX8 A;  2R0D A;  4K81 A;  5LG4 B;  4Z2M B;  1ZC3 B;  3SO6 A;  5HE2 A;  4PQ0 A;  2RRF A;  1DYN A;  2K49 A;  2KUQ A;  3KY9 A;  3UZT A;  2NZ8 B;  4HB4 B;  2RLO A;  4F7H A;  2Z59 A;  3CIK A;  2LKO A;  5DHA B;  2M38 A;  2W2X D;  1MKE A;  2KIE A;  2D9X A;  2Z0O A;  3D8F A;  2ROZ B;  2Y7B A;  2D9W A;  1FAO A;  1K5D B;  4K17 A;  4ZRI A;  1MIZ B;  3WYF B;  3HK0 A;  1V5P A;  4QJ5 B;  2ADZ A;  2DN6 A;  3O96 A;  3SNH A;  1X86 A;  3ZVR A;  5KQ4 A;  2DYN A;  5FI1 A;  5J3T A;  5DHF B;  1FOE A;  1DDV A;  4WSF A;  1XR0 B;  1WJM A;  1U2B A;  1DDM A;  1WGU A;  2DYQ A;  2GJY A;  5JLJ B;  2J0J A;  2G35 A;  1EF1 A;  4TYZ A;  4HAV B;  4HB3 B;  4A6F A;  4KVG B;  2I5F A;  3BIN A;  1DRO A;  2YVC A;  1SHC A;  1XCG A;  3VOQ A;  5L81 A;  2P0H A;  2DLW A;  4A6K A;  3ULB A;  2ELB A;  2H7E A;  2Z0P A;  2RSG A;  3NWF A;  1XOD A;  3PSC A;  4NSW A;  3U8Z A;  3DXD A;  1H4R A;  3DXE A;  2COA A;  2W2X C;  1ZSQ A;  5HE3 A;  1UPR A;  1B55 A;  1KZG A;  2J0M A;  2D2Q A;  1W1D A;  5J3Q A;  2UZS A;  3ODX A;  1NI2 A;  1Q67 A;  4EJN A;  1WVH A;  1T77 A;  1X1F A;  4B6H A;  2P8V A;  3F5R A;  3GYO A;  2QKM A;  4IAP A;  3KRX A;  2D4Q A;  4HAT B;  1MK7 B;  2I5C A;  1E5W A;  1MI1 A;  2EC1 A;  4HB0 B;  1U5G A;  1V88 A;  4QXA B;  5EFX A;  5HE1 A;  2NMB A;  3A8Q A;  5M4Y B;  2D9Y A;  1K5G B;  3SUZ A;  1P6S A;  3OHM B;  2H7D A;  2COC A;  4HAY B;  1U5F A;  4BBK A;  4MY6 A;  2NBV A;  4P7I A;  2I1K A;  3DCX A;  1FHW A;  5D27 A;  1M7E A;  2VRW B;  4DXA B;  3FM8 C;  2KGX B;  1DDW A;  2PZ1 A;  2YT0 A;  2M14 A;  4PNK A; 
#chains in the Genus database with same CATH homology
 2DHJ A;  2ELA A;  4HAU B;  4CYE A;  1MPH A;  3AJ4 A;  1H10 A;  4MT7 A;  4HDO A;  2YF0 A;  3KZ1 A;  5D3X A;  4GZU A;  1OY2 A;  1GC6 A;  3QWM A;  1Y19 B;  1W1G A;  5J3Y A;  1ZC4 B;  5LOP B;  2UVM A;  2IFS A;  3TO1 A;  1PMS A;  4YL8 A;  1U27 A;  4A5K A;  3FSS A;  2R09 A;  5FI0 A;  2QKL A;  1PFJ A;  2GCJ A;  5D3Y A;  2P0D A;  2GCL A;  1UNQ A;  2EMS A;  1TQZ A;  2VKI A;  2DFK A;  5LON B;  2OQB A;  1FHO A;  3HQC A;  4KHA A;  3KSY A;  2N23 A;  2BCJ A;  1PLS A;  4CHM A;  2P0F A;  2X18 A;  1IRS A;  1BAK A;  2MFQ A;  5D3W A;  1J19 A;  1P3R A;  2LG1 A;  4KAX B;  1M7R A;  5JHG A;  1UPQ A;  2K2J A;  3PEG A;  1BTK A;  3ODW A;  4GMV A;  1V5M A;  4ZRK A;  1OMW A;  5GOW B;  4A6H A;  1GC7 A;  5HE0 A;  1Y5O A;  2RVB B;  2ROV A;  4A6F B;  2DA0 A;  2LOX A;  4F7G A;  3T06 A;  1ZM0 A;  4WVF B;  2MDX A;  2UZR A;  2LUL A;  1XD4 A;  5KCV A;  2KUP A;  2YT1 A;  1WJ1 A;  2VSZ A;  2K00 A;  5C16 A;  4Y94 A;  4Z2N A;  3D8E A;  3PZD A;  3SYX A;  5C5B A;  3CXB B;  3PP2 A;  5DI9 B;  1LB1 A;  1QC6 A;  2YS5 A;  1N3H A;  3AU5 A;  2DHK A;  1V61 A;  2DTC A;  2DX5 A;  4ZRJ A;  4GMX B;  4WJ7 A;  2AL6 A;  2DX1 A;  1FGZ A;  5KQ1 A;  3ODO A;  3VIA A;  2COF A;  2Y8G A;  2EMT A;  2MWN B;  1ZVR A;  4L6E A;  2D9Z A;  3NSU A;  3P7Z A;  4HDQ A;  5CLQ B;  2YSZ A;  5C79 A;  1LW3 A;  1XKE A;  4MK0 A;  2GS0 A;  3U7D A;  3D8D A;  4HHV A;  2Y8F A;  1FHX A;  1NU2 A;  4YON A;  2YRY A;  3HW2 B;  1FGY A;  1AWE A;  4K2O A;  3TVV A;  1I2H A;  3PVU A;  3ML4 A;  1EVH A;  2YS1 A;  1RRP B;  3WA0 A;  2HE7 A;  2CRF A;  3MDB C;  2YS3 A;  1W1H A;  3TFM A;  1UNR A;  2OTX A;  1BWN A;  3SV1 A;  3MPX A;  1UEF A;  2RGN B;  2DKP A;  2Z0Q A;  1U29 A;  1EAZ A;  1P5T A;  2RNR B;  4DBB A;  2LOZ A;  3BJI A;  2XQN M;  1UNP A;  4F7U P;  2DKQ A;  2J59 M;  4TKN A;  1V5U A;  1MAI A;  1KZ7 A;  1NTV A;  4H8S A;  5C6R A;  2L1C A;  1I7A A;  5JP4 A;  2K2U A;  2E2X A;  2CAY A;  1Z87 A;  5CLL B;  3TCA A;  4EMO A;  1WG7 A;  3V5W A;  2D10 A;  2JP2 A;  2MKR A;  1RJ2 A;  5DIF B;  2J0K A;  3A8P A;  2I1J A;  3PVL A;  4HAZ B;  4K2P A;  2HTH B;  1OQN A;  3OAN A;  1SGH A;  4GPT B;  4EKU A;  3ZDT A;  4KHO A;  1U5D A;  1MK9 B;  1FB8 A;  2D9V A;  3RCP A;  2L2I A;  4NY0 A;  1KI1 B;  1TXD A;  1X05 A;  3N7C A;  3QIJ A;  4GN1 A;  3ULC A;  4HAX B;  2N0Y A;  3IVF A;  2LYD A;  1GG3 A;  1X11 A;  2IYB A;  3G9W A;  1X1G A;  1WGQ A;  1V89 A;  3FEH A;  1DBH A;  4IOY X;  4CHJ A;  3X23 A;  3DXC A;  2COD A;  3M1I B;  3LJU X;  2DHI A;  4XWX A;  2V76 A;  3P6A A;  2AEH A;  3AU4 A;  2CY4 A;  4D0N B;  1J0W A;  1U5E A;  1QQG A;  5JHH A;  1EGX A;  3KRW A;  4GXB A;  2D11 A;  2EJ8 A;  3GYP A;  1WI1 A;  2RUK B;  5C5B B;  1ISN A;  1NTY A;  1MIX A;  1TJ6 A;  3PVW A;  3PG7 A;  4KHB B;  3QBV B;  2Q13 A;  1XX0 A;  4DX9 0;  1BTN A;  2CY5 A;  3F0W A;  5DH9 B;  4HB2 B;  5D3V A;  4HAW B;  2W2W A;  4IFS A;  2ZPY A;  3TW1 A;  4C0A A;  2FJL A;  3A98 B;  2KCJ A;  1AQC A;  4DX8 A;  2R0D A;  4K81 A;  4Z2M B;  1ZC3 B;  3SO6 A;  5HE2 A;  4PQ0 A;  1DYN A;  3KY9 A;  3UZT A;  2NZ8 B;  4HB4 B;  2RLO A;  4F7H A;  3CIK A;  2LKO A;  5DHA B;  2M38 A;  2W2X D;  1MKE A;  2D9X A;  2Z0O A;  3D8F A;  2ROZ B;  2Y7B A;  2D9W A;  1FAO A;  1K5D B;  4K17 A;  4ZRI A;  1MIZ B;  3WYF B;  3HK0 A;  1V5P A;  2ADZ A;  2DN6 A;  3O96 A;  3SNH A;  1X86 A;  3ZVR A;  5KQ4 A;  2DYN A;  5FI1 A;  5J3T A;  5DHF B;  1FOE A;  1DDV A;  4WSF A;  1XR0 B;  1WJM A;  1U2B A;  1DDM A;  1WGU A;  2DYQ A;  2GJY A;  5JLJ B;  2J0J A;  2G35 A;  1EF1 A;  4TYZ A;  4HAV B;  4HB3 B;  4A6F A;  4KVG B;  2I5F A;  3BIN A;  1DRO A;  2YVC A;  1SHC A;  1XCG A;  3VOQ A;  5L81 A;  2P0H A;  2DLW A;  4A6K A;  3ULB A;  2ELB A;  2H7E A;  2Z0P A;  2RSG A;  1XOD A;  3PSC A;  4NSW A;  3U8Z A;  3DXD A;  1H4R A;  3DXE A;  2COA A;  2W2X C;  1ZSQ A;  5HE3 A;  1UPR A;  1B55 A;  1KZG A;  2J0M A;  2D2Q A;  1W1D A;  5J3Q A;  2UZS A;  3ODX A;  1NI2 A;  1Q67 A;  4EJN A;  1WVH A;  1X1F A;  4B6H A;  2P8V A;  3F5R A;  3GYO A;  2QKM A;  4IAP A;  3KRX A;  2D4Q A;  4HAT B;  1MK7 B;  2I5C A;  1E5W A;  2EC1 A;  4HB0 B;  1U5G A;  1V88 A;  5EFX A;  5HE1 A;  2NMB A;  3A8Q A;  2D9Y A;  1K5G B;  3SUZ A;  1P6S A;  2H7D A;  2COC A;  4HAY B;  1U5F A;  4BBK A;  4MY6 A;  4P7I A;  2I1K A;  1FHW A;  5D27 A;  1M7E A;  2VRW B;  4DXA B;  3FM8 C;  2KGX B;  1DDW A;  2PZ1 A;  2YT0 A;  2M14 A;  4PNK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...