2L2IA

Nmr structure of the complex between the tfb1 subunit of tfiih and the activation domain of eklf
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
115
structure length
115
Chain Sequence
b'PSHSGAAIFEKVSGIIAINEDVSPAELTWRSTDGDKVHTVVLSTIDKLQATPASSEKMMLRLIGKVDESKKRKDNEGNEVVPKPQRHMFSFNNRTVMDNIKMTLQQIISRYKDAD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RNA polymerase II transcription factor B subunit 1
publication title NMR Structure of the complex between the Tfb1 subunit of TFIIH and the activation domain of EKLF
rcsb
source organism Saccharomyces cerevisiae s288c
molecule tags Transcription
total genus 16
structure length 115
sequence length 115
ec nomenclature
pdb deposition date 2010-08-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08567 PH_TFIIH TFIIH p62 subunit, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2l2iA00
1BAKA 4GN1A 1X1GA 1WJ1A 4HDQA 2AL6A 1Y19B 2MFQA 1KI1B 1MIZB 2GCJA 2J59M 5GOWB 5KQ4A 3NSUA 3M1IB 1I2HA 2ROZB 4NSWA 1ZC4B 4F7UP 2FJLA 1EAZA 1GG3A 4HHVA 1V5MA 2COCA 4HB2B 1W1DA 2UZRA 4DX90 3DXDA 2EMSA 4ZRKA 5JHHA 1X86A 2D10A 5HE0A 2IYBA 3O96A 2I1JA 1Q67A 4CYEA 5D3VA 1MPHA 3FM8C 1K5GB 2DHIA 2M38A 2Z0PA 2RSGA 1E5WA 3F5RA 3PEGA 4H8SA 4CHMA 4HAUB 2ADZA 1DDMA 1J19A 1NTYA 2P8VA 4HAZB 3SNHA 4F7GA 5DHAB 2HTHB 4K2OA 3P7ZA 2KCJA 4HAVB 5KQ1A 1K5DB 1XCGA 1XX0A 1B55A 3QWMA 4WJ7A 2J0JA 5D3YA 1XR0B 2D9WA 1WGUA 2P0HA 1BTNA 3FSSA 3PSCA 1U29A 2YS5A 3KRXA 3D8DA 2W2WA 2W2XC 3LJUX 2ELBA 4GMXB 2N0YA 3OANA 4KVGB 3SYXA 5FI0A 3T06A 2DA0A 5FI1A 1I7AA 3BINA 2RVBB 3AJ4A 1OY2A 2K00A 2DTCA 1TQZA 2Y8GA 1XODA 1TXDA 4Y94A 1MK7B 2QKLA 2YS1A 4GXBA 1RJ2A 4XWXA 4K17A 4CHJA 3TFMA 3D8FA 4K2PA 2YS3A 2NZ8B 2D9VA 1GC6A 2OTXA 4KAXB 1UEFA 1SGHA 3ZDTA 4ZRIA 1QQGA 3ML4A 1V89A 1ZVRA 2VRWB 1DDVA 1V61A 5CLQB 1AWEA 1DYNA 2DHJA 2NMBA 3KZ1A 1W1GA 1U5EA 1UNRA 1DBHA 5J3QA 1EGXA 4YL8A 2R0DA 2CY4A 3G9WA 3ODWA 4HAXB 3QIJA 1DDWA 4B6HA 1U2BA 2LOZA 4BBKA 4WVFB 1P5TA 1UPQA 4A6FB 4GMVA 1Y5OA 3U8ZA 1FGYA 4PQ0A 1U5GA 4DBBA 3TW1A 5C16A 2ELAA 3BJIA 3HW2B 3ZVRA 2DX5A 2AEHA 3SV1A 3N7CA 2RGNB 5LONB 1BTKA 3HQCA 4L6EA 3PVWA 1SHCA 5HE1A 1GC7A 2DKQA 3V5WA 1FHWA 2LYDA 1ZC3B 3TCAA 1H4RA 4NY0A 2DX1A 2MDXA 1XKEA 3MDBC 3CXBB 1WGQA 1WVHA 2UZSA 1UPRA 4DXAB 1XD4A 1U27A 1V5PA 3DXEA 2W2XD 3GYOA 4TKNA 1U5DA 2R09A 3D8EA 2DHKA 5KCVA 1V88A 4EMOA 1UNQA 2ZPYA 4MY6A 5C5BB 4GPTB 1ISNA 2L2IA 2D9YA 4PNKA 4YONA 1DROA 4A6FA 1P6SA 2YRYA 1LB1A 1PMSA 1PLSA 1NI2A 1J0WA 3PG7A 2HE7A 3RCPA 1KZGA 1V5UA 3KRWA 5LOPB 3A98B 5DHFB 2DN6A 2E2XA 5EFXA 2GCLA 1X1FA 1PFJA 4KHBB 4EKUA 1LW3A 3A8PA 4HB4B 2V76A 4HDOA 1OMWA 2JP2A 4GZUA 3DXCA 1EF1A 3PVUA 2COAA 2XQNM 2MWNB 2YVCA 2H7DA 2YT1A 1N3HA 5C5BA 5JP4A 1H10A 2PZ1A 5DIFB 4DX8A 2D9XA 2YSZA 2K2JA 2X18A 4A5KA 1KZ7A 1FHOA 2MKRA 1ZM0A 3U7DA 2DKPA 4HB3B 2BCJA 2RLOA 4IAPA 4ZRJA 5JHGA 3ODOA 2GS0A 3X23A 5J3TA 2YF0A 4EJNA 3HK0A 4C0AA 1FAOA 2VKIA 2Q13A 3SUZA 3KSYA 2RUKB 1OQNA 2N23A 2D9ZA 2YT0A 3F0WA 2G35A 2Z0OA 2M14A 5D3WA 2EC1A 1WJMA 4D0NB 3AU4A 1X11A 3P6AA 3PVLA 5DH9B 2P0FA 4MK0A 4HAWB 3IVFA 2LULA 3PZDA 1NU2A 1AQCA 1WI1A 1P3RA 1X05A 3ODXA 2QKMA 5C79A 4MT7A 3AU5A 4F7HA 3QBVB 2CODA 4A6HA 2KGXB 2IFSA 2I5CA 2CAYA 3WA0A 1M7RA 2LG1A 3VIAA 3ULCA 1TJ6A 4P7IA 3FEHA 3TVVA 1WG7A 3VOQA 1EVHA 2VSZA 3ULBA 4KHOA 3UZTA 4Z2MB 2DYNA 2LKOA 2DYQA 2DFKA 4K81A 2EJ8A 1FB8A 1IRSA 1U5FA 2LOXA 4IFSA 1FOEA 2I5FA 4TYZA 3TO1A 2EMTA 5D27A 2I1KA 2Y8FA 4Z2NA 2RNRB 1FGZA 4HAYB 5J3YA 3MPXA 1MK9B 1Z87A 3KY9A 1FHXA 3A8QA 2L1CA 2D11A 2D4QA 3GYPA 5CLLB 2KUPA 1UNPA 3WYFB 2D2QA 5C6RA 1QC6A 1MIXA 2P0DA 2COFA 5HE3A 1NTVA 1ZSQA 1M7EA 3CIKA 2ROVA 4WSFA 2K2UA 4IOYX 5DI9B 4KHAA 1MKEA 2GJYA 2H7EA 4HATB 4HB0B 1MAIA 5L81A 2CRFA 2CY5A 2OQBA 5HE2A 2J0KA 3PP2A 1W1HA 5JLJB 3SO6A 2Y7BA 2Z0QA 2UVMA 1RRPB 2DLWA 5D3XA 1BWNA 4A6KA 2J0MA
chains in the Genus database with same CATH superfamily
1BAKA 4GN1A 1X1GA 4GOUA 1WJ1A 4HDQA 2AL6A 1Y19B 2MFQA 1KI1B 1MIZB 2GCJA 2J59M 4HSIA 5GOWB 5KQ4A 3NSUA 3M1IB 1I2HA 2ROZB 4NSWA 1ZC4B 4F7UP 2FJLA 1EAZA 1GG3A 4HHVA 1V5MA 2COCA 4HB2B 1W1DA 2UZRA 4DX90 3DXDA 2EMSA 4ZRKA 5JHHA 1X86A 2D10A 5HE0A 2IYBA 3O96A 3DCXA 2I1JA 1Q67A 4CYEA 5D3VA 1MPHA 3FM8C 1K5GB 2DHIA 5I2MA 2M38A 2Z0PA 2RSGA 1E5WA 3F5RA 3PEGA 4H8SA 4CHMA 4HAUB 2ADZA 1DDMA 1J19A 1NTYA 2P8VA 4HAZB 3SNHA 4F7GA 5DHAB 2HTHB 4K2OA 3P7ZA 2KCJA 4HAVB 5KQ1A 1K5DB 1XCGA 1XX0A 3A58A 1B55A 3QWMA 4WJ7A 2J0JA 5D3YA 1XR0B 2D9WA 2KIGA 4CSQA 1WGUA 2P0HA 1BTNA 3FSSA 3PSCA 1U29A 2YS5A 3KRXA 3D8DA 2W2WA 2W2XC 3LJUX 2ELBA 4GMXB 2N0YA 3OANA 2KIEA 4KVGB 3NW8A 3SYXA 5FI0A 3T06A 2DA0A 5FI1A 1I7AA 3BINA 2RVBB 3AJ4A 1OY2A 2K00A 2DTCA 1TQZA 2Y8GA 1XODA 1TXDA 4Y94A 1MK7B 3HIEA 2QKLA 2YS1A 4GXBA 1RJ2A 4XWXA 4K17A 4CHJA 3TFMA 3D8FA 4K2PA 2YS3A 2NZ8B 2D9VA 1GC6A 2OTXA 4OSNA 4KAXB 1UEFA 1SGHA 3ZDTA 4ZRIA 1QQGA 3ML4A 1V89A 1ZVRA 2VRWB 1DDVA 1V61A 5CLQB 1AWEA 1DYNA 2DHJA 2NMBA 3KZ1A 1W1GA 5IRSA 1U5EA 1UNRA 1DBHA 5J3QA 1EGXA 4YL8A 3B77A 2R0DA 2CY4A 3G9WA 3ODWA 4HAXB 3QIJA 1DDWA 3NWFA 4B6HA 1U2BA 2LOZA 2Z59A 4BBKA 4WVFB 1P5TA 1UPQA 4A6FB 4GMVA 1Y5OA 3U8ZA 1FGYA 4PQ0A 1U5GA 4DBBA 3TW1A 5C16A 4DIXA 2ELAA 3BJIA 3HW2B 3ZVRA 3NWDA 2DX5A 2AEHA 3SV1A 3N7CA 2RGNB 5LONB 1BTKA 3HQCA 4L6EA 3PVWA 3HSAA 1SHCA 5HE1A 1GC7A 2DKQA 3V5WA 1FHWA 2LYDA 1ZC3B 3TCAA 1H4RA 5M4YB 4QXAB 4NY0A 2DX1A 2Z13A 2MDXA 1XKEA 3MDBC 3CXBB 4L1RA 1WGQA 1WVHA 2UZSA 1UPRA 4DXAB 1XD4A 1U27A 1V5PA 3DXEA 2W2XD 3GYOA 4GNKB 4TKNA 2R2YA 1U5DA 2R09A 3D8EA 2DHKA 5KCVA 4D6WA 1V88A 4EMOA 1UNQA 2ZPYA 4MY6A 5C5BB 4GPTB 1ISNA 2L2IA 2D9YA 4PNKA 4YONA 2Z14A 1DROA 4A6FA 2NBVA 1P6SA 2YRYA 1LB1A 1PMSA 1PLSA 1NI2A 1J0WA 3PG7A 2HE7A 3RCPA 1KZGA 1V5UA 3KRWA 5LOPB 3A98B 5DHFB 3FVCA 2DN6A 2FJUB 2E2XA 5EFXA 2GCLA 1X1FA 1PFJA 4KHBB 4EKUA 1LW3A 2K8EA 3A8PA 4HB4B 2V76A 4HDOA 1OMWA 2JP2A 4GZUA 3DXCA 1EF1A 3PVUA 2COAA 2XQNM 2MWNB 2YVCA 2H7DA 2YT1A 1N3HA 5C5BA 5JP4A 1H10A 2PZ1A 5DIFB 4DX8A 2D9XA 2YSZA 2K2JA 2X18A 4A5KA 1T77A 4QJ4B 1KZ7A 1FHOA 2MKRA 1ZM0A 3U7DA 2DKPA 4HB3B 2BCJA 2RLOA 4IAPA 4ZRJA 5JHGA 3ODOA 2RRFA 2GS0A 3X23A 5J3TA 2YF0A 4QJ3B 4EJNA 3HK0A 4C0AA 1FAOA 2VKIA 2Q13A 3SUZA 3KSYA 2RUKB 1OQNA 2GUMA 2N23A 2D9ZA 2YT0A 3F0WA 4KHBA 2G35A 2Z0OA 2M14A 5D3WA 2EC1A 1WJMA 4D0NB 3AU4A 1X11A 3P6AA 3PVLA 5DH9B 2P0FA 4MK0A 4HAWB 3IVFA 2LULA 3PZDA 1NU2A 1AQCA 1WI1A 1P3RA 1X05A 3ODXA 2QKMA 5C79A 4MT7A 3AU5A 4F7HA 3QBVB 2CODA 3U12A 4A6HA 2KGXB 2IFSA 2I5CA 2CAYA 3WA0A 1M7RA 2LG1A 3VIAA 3ULCA 1TJ6A 4P7IA 3FEHA 3TVVA 1WG7A 3VOQA 1EVHA 2VSZA 3ULBA 2ZKMX 4KHOA 2KR0A 3UZTA 4Z2MB 2DYNA 2LKOA 2DYQA 3NWAA 2DFKA 4K81A 2EJ8A 2YT2A 1FB8A 1IRSA 1U5FA 2LOXA 4IFSA 1FOEA 2I5FA 4TYZA 3TO1A 2EMTA 5D27A 2I1KA 5LG4B 2Y8FA 4Z2NA 2RNRB 1FGZA 4HAYB 5J3YA 3MPXA 1MK9B 3OHMB 1Z87A 3KY9A 1FHXA 2Z4DA 3A8QA 2L1CA 2D11A 2D4QA 3GYPA 5CLLB 2KUPA 1UNPA 3WYFB 2D2QA 5C6RA 1QC6A 1MIXA 2P0DA 2COFA 5HE3A 1NTVA 4QJ5B 1ZSQA 1M7EA 3CIKA 2ROVA 4WSFA 2K2UA 4IOYX 1ZYIA 5DI9B 4KHAA 1MKEA 1MI1A 2GJYA 2H7EA 4HATB 1MAIA 4HB0B 5L81A 2CRFA 2CY5A 2OQBA 2KUQA 5HE2A 2J0KA 3PP2A 1W1HA 5JLJB 4OT1A 3SO6A 2Y7BA 2Z0QA 2UVMA 1RRPB 2DLWA 5D3XA 1BWNA 5I2SA 2K49A 4A6KA 2J0MA
chains in the Genus database with same CATH topology
1BAKA 4GN1A 1X1GA 1WJ1A 4HDQA 2AL6A 1Y19B 2MFQA 1KI1B 1MIZB 2GCJA 2J59M 5GOWB 5KQ4A 3NSUA 3M1IB 1I2HA 2ROZB 4NSWA 1ZC4B 4F7UP 2FJLA 1EAZA 1GG3A 4HHVA 1V5MA 2COCA 4HB2B 1W1DA 2UZRA 4DX90 3DXDA 2EMSA 4ZRKA 5JHHA 1X86A 2D10A 5HE0A 2IYBA 3O96A 2I1JA 1Q67A 4CYEA 5D3VA 1MPHA 3FM8C 1K5GB 2DHIA 2M38A 2Z0PA 2RSGA 1E5WA 3F5RA 3PEGA 4H8SA 4CHMA 4HAUB 2ADZA 1DDMA 1J19A 1NTYA 2P8VA 4HAZB 3SNHA 4F7GA 5DHAB 2HTHB 4K2OA 3P7ZA 2KCJA 4HAVB 5KQ1A 1K5DB 1XCGA 1XX0A 1B55A 3QWMA 4WJ7A 2J0JA 5D3YA 1XR0B 2D9WA 1WGUA 2P0HA 1BTNA 3FSSA 3PSCA 1U29A 2YS5A 3KRXA 3D8DA 2W2WA 2W2XC 3LJUX 2ELBA 4GMXB 2N0YA 3OANA 4KVGB 3SYXA 5FI0A 3T06A 2DA0A 5FI1A 1I7AA 3BINA 2RVBB 3AJ4A 1OY2A 2K00A 2DTCA 1TQZA 2Y8GA 1XODA 1TXDA 4Y94A 1MK7B 2QKLA 2YS1A 4GXBA 1RJ2A 4XWXA 4K17A 4CHJA 3TFMA 3D8FA 4K2PA 2YS3A 2NZ8B 2D9VA 1GC6A 2OTXA 4KAXB 1UEFA 1SGHA 3ZDTA 4ZRIA 1QQGA 3ML4A 1V89A 1ZVRA 2VRWB 1DDVA 1V61A 5CLQB 1AWEA 1DYNA 2DHJA 2NMBA 3KZ1A 1W1GA 1U5EA 1UNRA 1DBHA 5J3QA 1EGXA 4YL8A 2R0DA 2CY4A 3G9WA 3ODWA 4HAXB 3QIJA 1DDWA 4B6HA 1U2BA 2LOZA 4BBKA 4WVFB 1P5TA 1UPQA 4A6FB 4GMVA 1Y5OA 3U8ZA 1FGYA 4PQ0A 1U5GA 4DBBA 3TW1A 5C16A 2ELAA 3BJIA 3HW2B 3ZVRA 2DX5A 2AEHA 3SV1A 3N7CA 2RGNB 5LONB 1BTKA 3HQCA 4L6EA 3PVWA 1SHCA 5HE1A 1GC7A 2DKQA 3V5WA 1FHWA 2LYDA 1ZC3B 3TCAA 1H4RA 4NY0A 2DX1A 2MDXA 1XKEA 3MDBC 3CXBB 1WGQA 1WVHA 2UZSA 1UPRA 4DXAB 1XD4A 1U27A 1V5PA 3DXEA 2W2XD 3GYOA 4TKNA 1U5DA 2R09A 3D8EA 2DHKA 5KCVA 1V88A 4EMOA 1UNQA 2ZPYA 4MY6A 5C5BB 4GPTB 1ISNA 2L2IA 2D9YA 4PNKA 4YONA 1DROA 4A6FA 1P6SA 2YRYA 1LB1A 1PMSA 1PLSA 1NI2A 1J0WA 3PG7A 2HE7A 3RCPA 1KZGA 1V5UA 3KRWA 5LOPB 3A98B 5DHFB 2DN6A 2E2XA 5EFXA 2GCLA 1X1FA 1PFJA 4KHBB 4EKUA 1LW3A 3A8PA 4HB4B 2V76A 4HDOA 1OMWA 2JP2A 4GZUA 3DXCA 1EF1A 3PVUA 2COAA 2XQNM 2MWNB 2YVCA 2H7DA 2YT1A 1N3HA 5C5BA 5JP4A 1H10A 2PZ1A 5DIFB 4DX8A 2D9XA 2YSZA 2K2JA 2X18A 4A5KA 1KZ7A 1FHOA 2MKRA 1ZM0A 3U7DA 2DKPA 4HB3B 2BCJA 2RLOA 4IAPA 4ZRJA 5JHGA 3ODOA 2GS0A 3X23A 5J3TA 2YF0A 4EJNA 3HK0A 4C0AA 1FAOA 2VKIA 2Q13A 3SUZA 3KSYA 2RUKB 1OQNA 2N23A 2D9ZA 2YT0A 3F0WA 2G35A 2Z0OA 2M14A 5D3WA 2EC1A 1WJMA 4D0NB 3AU4A 1X11A 3P6AA 3PVLA 5DH9B 2P0FA 4MK0A 4HAWB 3IVFA 2LULA 3PZDA 1NU2A 1AQCA 1WI1A 1P3RA 1X05A 3ODXA 2QKMA 5C79A 4MT7A 3AU5A 4F7HA 3QBVB 2CODA 4A6HA 2KGXB 2IFSA 2I5CA 2CAYA 3WA0A 1M7RA 2LG1A 3VIAA 3ULCA 1TJ6A 4P7IA 3FEHA 3TVVA 1WG7A 3VOQA 1EVHA 2VSZA 3ULBA 4KHOA 3UZTA 4Z2MB 2DYNA 2LKOA 2DYQA 2DFKA 4K81A 2EJ8A 1FB8A 1IRSA 1U5FA 2LOXA 4IFSA 1FOEA 2I5FA 4TYZA 3TO1A 2EMTA 5D27A 2I1KA 2Y8FA 4Z2NA 2RNRB 1FGZA 4HAYB 5J3YA 3MPXA 1MK9B 1Z87A 3KY9A 1FHXA 3A8QA 2L1CA 2D11A 2D4QA 3GYPA 5CLLB 2KUPA 1UNPA 3WYFB 2D2QA 5C6RA 1QC6A 1MIXA 2P0DA 2COFA 5HE3A 1NTVA 1ZSQA 1M7EA 3CIKA 2ROVA 4WSFA 2K2UA 4IOYX 5DI9B 4KHAA 1MKEA 2GJYA 2H7EA 4HATB 4HB0B 1MAIA 5L81A 2CRFA 2CY5A 2OQBA 5HE2A 2J0KA 3PP2A 1W1HA 5JLJB 3SO6A 2Y7BA 2Z0QA 2UVMA 1RRPB 2DLWA 5D3XA 1BWNA 4A6KA 2J0MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BAK A;  4GN1 A;  1X1G A;  1WJ1 A;  4HDQ A;  2AL6 A;  1Y19 B;  2MFQ A;  1KI1 B;  1MIZ B;  2GCJ A;  2J59 M;  5GOW B;  5KQ4 A;  3NSU A;  3M1I B;  1I2H A;  2ROZ B;  4NSW A;  1ZC4 B;  4F7U P;  2FJL A;  1EAZ A;  1GG3 A;  4HHV A;  1V5M A;  2COC A;  4HB2 B;  1W1D A;  2UZR A;  4DX9 0;  3DXD A;  2EMS A;  4ZRK A;  5JHH A;  1X86 A;  2D10 A;  5HE0 A;  2IYB A;  3O96 A;  2I1J A;  1Q67 A;  4CYE A;  5D3V A;  1MPH A;  3FM8 C;  1K5G B;  2DHI A;  2M38 A;  2Z0P A;  2RSG A;  1E5W A;  3F5R A;  3PEG A;  4H8S A;  4CHM A;  4HAU B;  2ADZ A;  1DDM A;  1J19 A;  1NTY A;  2P8V A;  4HAZ B;  3SNH A;  4F7G A;  5DHA B;  2HTH B;  4K2O A;  3P7Z A;  2KCJ A;  4HAV B;  5KQ1 A;  1K5D B;  1XCG A;  1XX0 A;  1B55 A;  3QWM A;  4WJ7 A;  2J0J A;  5D3Y A;  1XR0 B;  2D9W A;  1WGU A;  2P0H A;  1BTN A;  3FSS A;  3PSC A;  1U29 A;  2YS5 A;  3KRX A;  3D8D A;  2W2W A;  2W2X C;  3LJU X;  2ELB A;  4GMX B;  2N0Y A;  3OAN A;  4KVG B;  3SYX A;  5FI0 A;  3T06 A;  2DA0 A;  5FI1 A;  1I7A A;  3BIN A;  2RVB B;  3AJ4 A;  1OY2 A;  2K00 A;  2DTC A;  1TQZ A;  2Y8G A;  1XOD A;  1TXD A;  4Y94 A;  1MK7 B;  2QKL A;  2YS1 A;  4GXB A;  1RJ2 A;  4XWX A;  4K17 A;  4CHJ A;  3TFM A;  3D8F A;  4K2P A;  2YS3 A;  2NZ8 B;  2D9V A;  1GC6 A;  2OTX A;  4KAX B;  1UEF A;  1SGH A;  3ZDT A;  4ZRI A;  1QQG A;  3ML4 A;  1V89 A;  1ZVR A;  2VRW B;  1DDV A;  1V61 A;  5CLQ B;  1AWE A;  1DYN A;  2DHJ A;  2NMB A;  3KZ1 A;  1W1G A;  1U5E A;  1UNR A;  1DBH A;  5J3Q A;  1EGX A;  4YL8 A;  2R0D A;  2CY4 A;  3G9W A;  3ODW A;  4HAX B;  3QIJ A;  1DDW A;  4B6H A;  1U2B A;  2LOZ A;  4BBK A;  4WVF B;  1P5T A;  1UPQ A;  4A6F B;  4GMV A;  1Y5O A;  3U8Z A;  1FGY A;  4PQ0 A;  1U5G A;  4DBB A;  3TW1 A;  5C16 A;  2ELA A;  3BJI A;  3HW2 B;  3ZVR A;  2DX5 A;  2AEH A;  3SV1 A;  3N7C A;  2RGN B;  5LON B;  1BTK A;  3HQC A;  4L6E A;  3PVW A;  1SHC A;  5HE1 A;  1GC7 A;  2DKQ A;  3V5W A;  1FHW A;  2LYD A;  1ZC3 B;  3TCA A;  1H4R A;  4NY0 A;  2DX1 A;  2MDX A;  1XKE A;  3MDB C;  3CXB B;  1WGQ A;  1WVH A;  2UZS A;  1UPR A;  4DXA B;  1XD4 A;  1U27 A;  1V5P A;  3DXE A;  2W2X D;  3GYO A;  4TKN A;  1U5D A;  2R09 A;  3D8E A;  2DHK A;  5KCV A;  1V88 A;  4EMO A;  1UNQ A;  2ZPY A;  4MY6 A;  5C5B B;  4GPT B;  1ISN A;  2L2I A;  2D9Y A;  4PNK A;  4YON A;  1DRO A;  4A6F A;  1P6S A;  2YRY A;  1LB1 A;  1PMS A;  1PLS A;  1NI2 A;  1J0W A;  3PG7 A;  2HE7 A;  3RCP A;  1KZG A;  1V5U A;  3KRW A;  5LOP B;  3A98 B;  5DHF B;  2DN6 A;  2E2X A;  5EFX A;  2GCL A;  1X1F A;  1PFJ A;  4KHB B;  4EKU A;  1LW3 A;  3A8P A;  4HB4 B;  2V76 A;  4HDO A;  1OMW A;  2JP2 A;  4GZU A;  3DXC A;  1EF1 A;  3PVU A;  2COA A;  2XQN M;  2MWN B;  2YVC A;  2H7D A;  2YT1 A;  1N3H A;  5C5B A;  5JP4 A;  1H10 A;  2PZ1 A;  5DIF B;  4DX8 A;  2D9X A;  2YSZ A;  2K2J A;  2X18 A;  4A5K A;  1KZ7 A;  1FHO A;  2MKR A;  1ZM0 A;  3U7D A;  2DKP A;  4HB3 B;  2BCJ A;  2RLO A;  4IAP A;  4ZRJ A;  5JHG A;  3ODO A;  2GS0 A;  3X23 A;  5J3T A;  2YF0 A;  4EJN A;  3HK0 A;  4C0A A;  1FAO A;  2VKI A;  2Q13 A;  3SUZ A;  3KSY A;  2RUK B;  1OQN A;  2N23 A;  2D9Z A;  2YT0 A;  3F0W A;  2G35 A;  2Z0O A;  2M14 A;  5D3W A;  2EC1 A;  1WJM A;  4D0N B;  3AU4 A;  1X11 A;  3P6A A;  3PVL A;  5DH9 B;  2P0F A;  4MK0 A;  4HAW B;  3IVF A;  2LUL A;  3PZD A;  1NU2 A;  1AQC A;  1WI1 A;  1P3R A;  1X05 A;  3ODX A;  2QKM A;  5C79 A;  4MT7 A;  3AU5 A;  4F7H A;  3QBV B;  2COD A;  4A6H A;  2KGX B;  2IFS A;  2I5C A;  2CAY A;  3WA0 A;  1M7R A;  2LG1 A;  3VIA A;  3ULC A;  1TJ6 A;  4P7I A;  3FEH A;  3TVV A;  1WG7 A;  3VOQ A;  1EVH A;  2VSZ A;  3ULB A;  4KHO A;  3UZT A;  4Z2M B;  2DYN A;  2LKO A;  2DYQ A;  2DFK A;  4K81 A;  2EJ8 A;  1FB8 A;  1IRS A;  1U5F A;  2LOX A;  4IFS A;  1FOE A;  2I5F A;  4TYZ A;  3TO1 A;  2EMT A;  5D27 A;  2I1K A;  2Y8F A;  4Z2N A;  2RNR B;  1FGZ A;  4HAY B;  5J3Y A;  3MPX A;  1MK9 B;  1Z87 A;  3KY9 A;  1FHX A;  3A8Q A;  2L1C A;  2D11 A;  2D4Q A;  3GYP A;  5CLL B;  2KUP A;  1UNP A;  3WYF B;  2D2Q A;  5C6R A;  1QC6 A;  1MIX A;  2P0D A;  2COF A;  5HE3 A;  1NTV A;  1ZSQ A;  1M7E A;  3CIK A;  2ROV A;  4WSF A;  2K2U A;  4IOY X;  5DI9 B;  4KHA A;  1MKE A;  2GJY A;  2H7E A;  4HAT B;  4HB0 B;  1MAI A;  5L81 A;  2CRF A;  2CY5 A;  2OQB A;  5HE2 A;  2J0K A;  3PP2 A;  1W1H A;  5JLJ B;  3SO6 A;  2Y7B A;  2Z0Q A;  2UVM A;  1RRP B;  2DLW A;  5D3X A;  1BWN A;  4A6K A;  2J0M A; 
#chains in the Genus database with same CATH topology
 1BAK A;  4GN1 A;  1X1G A;  4GOU A;  1WJ1 A;  4HDQ A;  2AL6 A;  1Y19 B;  2MFQ A;  1KI1 B;  1MIZ B;  2GCJ A;  2J59 M;  4HSI A;  5GOW B;  5KQ4 A;  3NSU A;  3M1I B;  1I2H A;  2ROZ B;  4NSW A;  1ZC4 B;  4F7U P;  2FJL A;  1EAZ A;  1GG3 A;  4HHV A;  1V5M A;  2COC A;  4HB2 B;  1W1D A;  2UZR A;  4DX9 0;  3DXD A;  2EMS A;  4ZRK A;  5JHH A;  1X86 A;  2D10 A;  5HE0 A;  2IYB A;  3O96 A;  3DCX A;  2I1J A;  1Q67 A;  4CYE A;  5D3V A;  1MPH A;  3FM8 C;  1K5G B;  2DHI A;  5I2M A;  2M38 A;  2Z0P A;  2RSG A;  1E5W A;  3F5R A;  3PEG A;  4H8S A;  4CHM A;  4HAU B;  2ADZ A;  1DDM A;  1J19 A;  1NTY A;  2P8V A;  4HAZ B;  3SNH A;  4F7G A;  5DHA B;  2HTH B;  4K2O A;  3P7Z A;  2KCJ A;  4HAV B;  5KQ1 A;  1K5D B;  1XCG A;  1XX0 A;  3A58 A;  1B55 A;  3QWM A;  4WJ7 A;  2J0J A;  5D3Y A;  1XR0 B;  2D9W A;  2KIG A;  4CSQ A;  1WGU A;  2P0H A;  1BTN A;  3FSS A;  3PSC A;  1U29 A;  2YS5 A;  3KRX A;  3D8D A;  2W2W A;  2W2X C;  3LJU X;  2ELB A;  4GMX B;  2N0Y A;  3OAN A;  2KIE A;  4KVG B;  3NW8 A;  3SYX A;  5FI0 A;  3T06 A;  2DA0 A;  5FI1 A;  1I7A A;  3BIN A;  2RVB B;  3AJ4 A;  1OY2 A;  2K00 A;  2DTC A;  1TQZ A;  2Y8G A;  1XOD A;  1TXD A;  4Y94 A;  1MK7 B;  3HIE A;  2QKL A;  2YS1 A;  4GXB A;  1RJ2 A;  4XWX A;  4K17 A;  4CHJ A;  3TFM A;  3D8F A;  4K2P A;  2YS3 A;  2NZ8 B;  2D9V A;  1GC6 A;  2OTX A;  4OSN A;  4KAX B;  1UEF A;  1SGH A;  3ZDT A;  4ZRI A;  1QQG A;  3ML4 A;  1V89 A;  1ZVR A;  2VRW B;  1DDV A;  1V61 A;  5CLQ B;  1AWE A;  1DYN A;  2DHJ A;  2NMB A;  3KZ1 A;  1W1G A;  5IRS A;  1U5E A;  1UNR A;  1DBH A;  5J3Q A;  1EGX A;  4YL8 A;  3B77 A;  2R0D A;  2CY4 A;  3G9W A;  3ODW A;  4HAX B;  3QIJ A;  1DDW A;  3NWF A;  4B6H A;  1U2B A;  2LOZ A;  2Z59 A;  4BBK A;  4WVF B;  1P5T A;  1UPQ A;  4A6F B;  4GMV A;  1Y5O A;  3U8Z A;  1FGY A;  4PQ0 A;  1U5G A;  4DBB A;  3TW1 A;  5C16 A;  4DIX A;  2ELA A;  3BJI A;  3HW2 B;  3ZVR A;  3NWD A;  2DX5 A;  2AEH A;  3SV1 A;  3N7C A;  2RGN B;  5LON B;  1BTK A;  3HQC A;  4L6E A;  3PVW A;  3HSA A;  1SHC A;  5HE1 A;  1GC7 A;  2DKQ A;  3V5W A;  1FHW A;  2LYD A;  1ZC3 B;  3TCA A;  1H4R A;  5M4Y B;  4QXA B;  4NY0 A;  2DX1 A;  2Z13 A;  2MDX A;  1XKE A;  3MDB C;  3CXB B;  4L1R A;  1WGQ A;  1WVH A;  2UZS A;  1UPR A;  4DXA B;  1XD4 A;  1U27 A;  1V5P A;  3DXE A;  2W2X D;  3GYO A;  4GNK B;  4TKN A;  2R2Y A;  1U5D A;  2R09 A;  3D8E A;  2DHK A;  5KCV A;  4D6W A;  1V88 A;  4EMO A;  1UNQ A;  2ZPY A;  4MY6 A;  5C5B B;  4GPT B;  1ISN A;  2L2I A;  2D9Y A;  4PNK A;  4YON A;  2Z14 A;  1DRO A;  4A6F A;  2NBV A;  1P6S A;  2YRY A;  1LB1 A;  1PMS A;  1PLS A;  1NI2 A;  1J0W A;  3PG7 A;  2HE7 A;  3RCP A;  1KZG A;  1V5U A;  3KRW A;  5LOP B;  3A98 B;  5DHF B;  3FVC A;  2DN6 A;  2FJU B;  2E2X A;  5EFX A;  2GCL A;  1X1F A;  1PFJ A;  4KHB B;  4EKU A;  1LW3 A;  2K8E A;  3A8P A;  4HB4 B;  2V76 A;  4HDO A;  1OMW A;  2JP2 A;  4GZU A;  3DXC A;  1EF1 A;  3PVU A;  2COA A;  2XQN M;  2MWN B;  2YVC A;  2H7D A;  2YT1 A;  1N3H A;  5C5B A;  5JP4 A;  1H10 A;  2PZ1 A;  5DIF B;  4DX8 A;  2D9X A;  2YSZ A;  2K2J A;  2X18 A;  4A5K A;  1T77 A;  4QJ4 B;  1KZ7 A;  1FHO A;  2MKR A;  1ZM0 A;  3U7D A;  2DKP A;  4HB3 B;  2BCJ A;  2RLO A;  4IAP A;  4ZRJ A;  5JHG A;  3ODO A;  2RRF A;  2GS0 A;  3X23 A;  5J3T A;  2YF0 A;  4QJ3 B;  4EJN A;  3HK0 A;  4C0A A;  1FAO A;  2VKI A;  2Q13 A;  3SUZ A;  3KSY A;  2RUK B;  1OQN A;  2GUM A;  2N23 A;  2D9Z A;  2YT0 A;  3F0W A;  4KHB A;  2G35 A;  2Z0O A;  2M14 A;  5D3W A;  2EC1 A;  1WJM A;  4D0N B;  3AU4 A;  1X11 A;  3P6A A;  3PVL A;  5DH9 B;  2P0F A;  4MK0 A;  4HAW B;  3IVF A;  2LUL A;  3PZD A;  1NU2 A;  1AQC A;  1WI1 A;  1P3R A;  1X05 A;  3ODX A;  2QKM A;  5C79 A;  4MT7 A;  3AU5 A;  4F7H A;  3QBV B;  2COD A;  3U12 A;  4A6H A;  2KGX B;  2IFS A;  2I5C A;  2CAY A;  3WA0 A;  1M7R A;  2LG1 A;  3VIA A;  3ULC A;  1TJ6 A;  4P7I A;  3FEH A;  3TVV A;  1WG7 A;  3VOQ A;  1EVH A;  2VSZ A;  3ULB A;  2ZKM X;  4KHO A;  2KR0 A;  3UZT A;  4Z2M B;  2DYN A;  2LKO A;  2DYQ A;  3NWA A;  2DFK A;  4K81 A;  2EJ8 A;  2YT2 A;  1FB8 A;  1IRS A;  1U5F A;  2LOX A;  4IFS A;  1FOE A;  2I5F A;  4TYZ A;  3TO1 A;  2EMT A;  5D27 A;  2I1K A;  5LG4 B;  2Y8F A;  4Z2N A;  2RNR B;  1FGZ A;  4HAY B;  5J3Y A;  3MPX A;  1MK9 B;  3OHM B;  1Z87 A;  3KY9 A;  1FHX A;  2Z4D A;  3A8Q A;  2L1C A;  2D11 A;  2D4Q A;  3GYP A;  5CLL B;  2KUP A;  1UNP A;  3WYF B;  2D2Q A;  5C6R A;  1QC6 A;  1MIX A;  2P0D A;  2COF A;  5HE3 A;  1NTV A;  4QJ5 B;  1ZSQ A;  1M7E A;  3CIK A;  2ROV A;  4WSF A;  2K2U A;  4IOY X;  1ZYI A;  5DI9 B;  4KHA A;  1MKE A;  1MI1 A;  2GJY A;  2H7E A;  4HAT B;  1MAI A;  4HB0 B;  5L81 A;  2CRF A;  2CY5 A;  2OQB A;  2KUQ A;  5HE2 A;  2J0K A;  3PP2 A;  1W1H A;  5JLJ B;  4OT1 A;  3SO6 A;  2Y7B A;  2Z0Q A;  2UVM A;  1RRP B;  2DLW A;  5D3X A;  1BWN A;  5I2S A;  2K49 A;  4A6K A;  2J0M A; 
#chains in the Genus database with same CATH homology
 1BAK A;  4GN1 A;  1X1G A;  1WJ1 A;  4HDQ A;  2AL6 A;  1Y19 B;  2MFQ A;  1KI1 B;  1MIZ B;  2GCJ A;  2J59 M;  5GOW B;  5KQ4 A;  3NSU A;  3M1I B;  1I2H A;  2ROZ B;  4NSW A;  1ZC4 B;  4F7U P;  2FJL A;  1EAZ A;  1GG3 A;  4HHV A;  1V5M A;  2COC A;  4HB2 B;  1W1D A;  2UZR A;  4DX9 0;  3DXD A;  2EMS A;  4ZRK A;  5JHH A;  1X86 A;  2D10 A;  5HE0 A;  2IYB A;  3O96 A;  2I1J A;  1Q67 A;  4CYE A;  5D3V A;  1MPH A;  3FM8 C;  1K5G B;  2DHI A;  2M38 A;  2Z0P A;  2RSG A;  1E5W A;  3F5R A;  3PEG A;  4H8S A;  4CHM A;  4HAU B;  2ADZ A;  1DDM A;  1J19 A;  1NTY A;  2P8V A;  4HAZ B;  3SNH A;  4F7G A;  5DHA B;  2HTH B;  4K2O A;  3P7Z A;  2KCJ A;  4HAV B;  5KQ1 A;  1K5D B;  1XCG A;  1XX0 A;  1B55 A;  3QWM A;  4WJ7 A;  2J0J A;  5D3Y A;  1XR0 B;  2D9W A;  1WGU A;  2P0H A;  1BTN A;  3FSS A;  3PSC A;  1U29 A;  2YS5 A;  3KRX A;  3D8D A;  2W2W A;  2W2X C;  3LJU X;  2ELB A;  4GMX B;  2N0Y A;  3OAN A;  4KVG B;  3SYX A;  5FI0 A;  3T06 A;  2DA0 A;  5FI1 A;  1I7A A;  3BIN A;  2RVB B;  3AJ4 A;  1OY2 A;  2K00 A;  2DTC A;  1TQZ A;  2Y8G A;  1XOD A;  1TXD A;  4Y94 A;  1MK7 B;  2QKL A;  2YS1 A;  4GXB A;  1RJ2 A;  4XWX A;  4K17 A;  4CHJ A;  3TFM A;  3D8F A;  4K2P A;  2YS3 A;  2NZ8 B;  2D9V A;  1GC6 A;  2OTX A;  4KAX B;  1UEF A;  1SGH A;  3ZDT A;  4ZRI A;  1QQG A;  3ML4 A;  1V89 A;  1ZVR A;  2VRW B;  1DDV A;  1V61 A;  5CLQ B;  1AWE A;  1DYN A;  2DHJ A;  2NMB A;  3KZ1 A;  1W1G A;  1U5E A;  1UNR A;  1DBH A;  5J3Q A;  1EGX A;  4YL8 A;  2R0D A;  2CY4 A;  3G9W A;  3ODW A;  4HAX B;  3QIJ A;  1DDW A;  4B6H A;  1U2B A;  2LOZ A;  4BBK A;  4WVF B;  1P5T A;  1UPQ A;  4A6F B;  4GMV A;  1Y5O A;  3U8Z A;  1FGY A;  4PQ0 A;  1U5G A;  4DBB A;  3TW1 A;  5C16 A;  2ELA A;  3BJI A;  3HW2 B;  3ZVR A;  2DX5 A;  2AEH A;  3SV1 A;  3N7C A;  2RGN B;  5LON B;  1BTK A;  3HQC A;  4L6E A;  3PVW A;  1SHC A;  5HE1 A;  1GC7 A;  2DKQ A;  3V5W A;  1FHW A;  2LYD A;  1ZC3 B;  3TCA A;  1H4R A;  4NY0 A;  2DX1 A;  2MDX A;  1XKE A;  3MDB C;  3CXB B;  1WGQ A;  1WVH A;  2UZS A;  1UPR A;  4DXA B;  1XD4 A;  1U27 A;  1V5P A;  3DXE A;  2W2X D;  3GYO A;  4TKN A;  1U5D A;  2R09 A;  3D8E A;  2DHK A;  5KCV A;  1V88 A;  4EMO A;  1UNQ A;  2ZPY A;  4MY6 A;  5C5B B;  4GPT B;  1ISN A;  2L2I A;  2D9Y A;  4PNK A;  4YON A;  1DRO A;  4A6F A;  1P6S A;  2YRY A;  1LB1 A;  1PMS A;  1PLS A;  1NI2 A;  1J0W A;  3PG7 A;  2HE7 A;  3RCP A;  1KZG A;  1V5U A;  3KRW A;  5LOP B;  3A98 B;  5DHF B;  2DN6 A;  2E2X A;  5EFX A;  2GCL A;  1X1F A;  1PFJ A;  4KHB B;  4EKU A;  1LW3 A;  3A8P A;  4HB4 B;  2V76 A;  4HDO A;  1OMW A;  2JP2 A;  4GZU A;  3DXC A;  1EF1 A;  3PVU A;  2COA A;  2XQN M;  2MWN B;  2YVC A;  2H7D A;  2YT1 A;  1N3H A;  5C5B A;  5JP4 A;  1H10 A;  2PZ1 A;  5DIF B;  4DX8 A;  2D9X A;  2YSZ A;  2K2J A;  2X18 A;  4A5K A;  1KZ7 A;  1FHO A;  2MKR A;  1ZM0 A;  3U7D A;  2DKP A;  4HB3 B;  2BCJ A;  2RLO A;  4IAP A;  4ZRJ A;  5JHG A;  3ODO A;  2GS0 A;  3X23 A;  5J3T A;  2YF0 A;  4EJN A;  3HK0 A;  4C0A A;  1FAO A;  2VKI A;  2Q13 A;  3SUZ A;  3KSY A;  2RUK B;  1OQN A;  2N23 A;  2D9Z A;  2YT0 A;  3F0W A;  2G35 A;  2Z0O A;  2M14 A;  5D3W A;  2EC1 A;  1WJM A;  4D0N B;  3AU4 A;  1X11 A;  3P6A A;  3PVL A;  5DH9 B;  2P0F A;  4MK0 A;  4HAW B;  3IVF A;  2LUL A;  3PZD A;  1NU2 A;  1AQC A;  1WI1 A;  1P3R A;  1X05 A;  3ODX A;  2QKM A;  5C79 A;  4MT7 A;  3AU5 A;  4F7H A;  3QBV B;  2COD A;  4A6H A;  2KGX B;  2IFS A;  2I5C A;  2CAY A;  3WA0 A;  1M7R A;  2LG1 A;  3VIA A;  3ULC A;  1TJ6 A;  4P7I A;  3FEH A;  3TVV A;  1WG7 A;  3VOQ A;  1EVH A;  2VSZ A;  3ULB A;  4KHO A;  3UZT A;  4Z2M B;  2DYN A;  2LKO A;  2DYQ A;  2DFK A;  4K81 A;  2EJ8 A;  1FB8 A;  1IRS A;  1U5F A;  2LOX A;  4IFS A;  1FOE A;  2I5F A;  4TYZ A;  3TO1 A;  2EMT A;  5D27 A;  2I1K A;  2Y8F A;  4Z2N A;  2RNR B;  1FGZ A;  4HAY B;  5J3Y A;  3MPX A;  1MK9 B;  1Z87 A;  3KY9 A;  1FHX A;  3A8Q A;  2L1C A;  2D11 A;  2D4Q A;  3GYP A;  5CLL B;  2KUP A;  1UNP A;  3WYF B;  2D2Q A;  5C6R A;  1QC6 A;  1MIX A;  2P0D A;  2COF A;  5HE3 A;  1NTV A;  1ZSQ A;  1M7E A;  3CIK A;  2ROV A;  4WSF A;  2K2U A;  4IOY X;  5DI9 B;  4KHA A;  1MKE A;  2GJY A;  2H7E A;  4HAT B;  4HB0 B;  1MAI A;  5L81 A;  2CRF A;  2CY5 A;  2OQB A;  5HE2 A;  2J0K A;  3PP2 A;  1W1H A;  5JLJ B;  3SO6 A;  2Y7B A;  2Z0Q A;  2UVM A;  1RRP B;  2DLW A;  5D3X A;  1BWN A;  4A6K A;  2J0M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...