2L2IA

Nmr structure of the complex between the tfb1 subunit of tfiih and the activation domain of eklf
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
115
structure length
115
Chain Sequence
PSHSGAAIFEKVSGIIAINEDVSPAELTWRSTDGDKVHTVVLSTIDKLQATPASSEKMMLRLIGKVDESKKRKDNEGNEVVPKPQRHMFSFNNRTVMDNIKMTLQQIISRYKDAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RNA polymerase II transcription factor B subunit 1
publication title NMR Structure of the complex between the Tfb1 subunit of TFIIH and the activation domain of EKLF
rcsb
source organism Saccharomyces cerevisiae s288c
molecule tags Transcription
total genus 16
structure length 115
sequence length 115
ec nomenclature
pdb deposition date 2010-08-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08567 PH_TFIIH TFIIH p62 subunit, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2l2iA00
5DHFB 2D11A 2IFSA 1BTKA 2DYNA 2DN6A 5C5BA 1XX0A 3TW1A 3CXBB 3A8PA 1MPHA 2ELBA 2DKQA 3PVWA 2P0HA 2RGNB 3DXEA 3UZTA 4K17A 5JP4A 5J3QA 1X05A 4A6KA 3TO1A 1Y19B 1ZC4B 5C6RA 2LG1A 1DDMA 1V89A 2YT0A 2MWNB 2UZSA 3V5WA 2EJ8A 3SYXA 4KAXB 2MFQA 4KHBB 1EF1A 2D9ZA 3MDBC 3ODWA 1FHWA 2D9YA 3PEGA 1V5PA 1FGYA 1MIZB 4HAXB 4TYZA 3SO6A 1Q67A 1E5WA 4HATB 2DTCA 2COAA 2QKMA 2BCJA 2DKPA 1MK9B 4CYEA 3QWMA 5DIFB 4Z2NA 1Z87A 2I5CA 1WGQA 5D3YA 5KCVA 5L81A 3DXCA 2LOZA 4C0AA 4DX90 1W1DA 2CRFA 2Y8GA 3GYPA 3P6AA 1OMWA 4HDOA 1FAOA 3PZDA 1XODA 2I1KA 3P7ZA 5FI0A 4K81A 2LYDA 2J0MA 4A5KA 5JLJB 3WA0A 4HB4B 1KZ7A 1B55A 4HB3B 4DXAB 1U5GA 2PZ1A 1NTYA 3TVVA 5FI1A 3MPXA 1ZSQA 4HDQA 4WVFB 2EMSA 2CY5A 4L6EA 4TKNA 4KHAA 4F7UP 5KQ4A 1FGZA 5D3XA 1J0WA 2H7DA 2P8VA 5DHAB 5LONB 4WJ7A 1FHOA 3IVFA 3U7DA 2VSZA 1NU2A 3WYFB 1ZC3B 2I1JA 2R09A 1X1FA 3F5RA 4IFSA 1TXDA 4KHOA 2EC1A 2OTXA 2DHJA 1U5EA 2ROVA 4GXBA 1P6SA 4GN1A 1KI1B 2K2UA 3PSCA 2NZ8B 3ODOA 4MT7A 4EJNA 1DDWA 4CHMA 2Y7BA 4BBKA 2LULA 4EMOA 2YF0A 4F7GA 4HHVA 4F7HA 3KRXA 4WSFA 3TCAA 2X18A 2GCLA 1LW3A 4HAZB 2YS5A 1OQNA 3D8DA 3PP2A 2DYQA 3GYOA 2YRYA 1V88A 1RRPB 4GZUA 4B6HA 1P3RA 5KQ1A 1K5GB 1V5UA 5HE1A 4XWXA 2M14A 1UNRA 3AJ4A 1QQGA 2N0YA 1FOEA 2I5FA 2YS3A 3BINA 3KY9A 4A6FB 1NTVA 4HAWB 2DX1A 1DYNA 1MK7B 1U2BA 3OANA 2ADZA 5C5BB 5C79A 5D3WA 4PQ0A 1X11A 2MDXA 3ULBA 2COFA 5EFXA 1XKEA 1AQCA 4KVGB 3QBVB 3LJUX 1UNPA 2M38A 5J3YA 1FHXA 1X86A 2K2JA 1PLSA 2LKOA 5CLQB 2FJLA 1IRSA 2UVMA 3KSYA 2P0DA 5J3TA 1XR0B 3F0WA 1X1GA 3D8FA 3KZ1A 4Y94A 2K00A 3SUZA 4IAPA 2RNRB 3SNHA 3QIJA 1RJ2A 2DX5A 1K5DB 5CLLB 1WG7A 1DDVA 1J19A 2XQNM 2L1CA 1DBHA 2IYBA 3VOQA 1QC6A 5HE3A 3ULCA 4HB2B 4ZRJA 5GOWB 4HAVB 2N23A 1WGUA 5DH9B 2CODA 1XD4A 3RCPA 1BTNA 1BWNA 1WJ1A 1V61A 3O96A 2DHIA 3FEHA 1P5TA 2MKRA 4MK0A 5D3VA 5HE0A 1WI1A 4CHJA 3ZDTA 2JP2A 1MIXA 2HTHB 1MKEA 1TQZA 2W2XD 4ZRIA 3TFMA 1SGHA 1UPQA 1M7RA 4HAYB 2GJYA 3ZVRA 2Y8FA 4H8SA 4DX8A 2ELAA 2GS0A 2G35A 2GCJA 4ZRKA 3BJIA 1U5DA 2W2WA 4DBBA 2Z0PA 2YS1A 3CIKA 5DI9B 5LOPB 4NY0A 1UNQA 4YL8A 2KCJA 4IOYX 4EKUA 1WJMA 1GC7A 2AL6A 2QKLA 1M7EA 1EGXA 3HW2B 1U29A 3HQCA 3A8QA 3PG7A 2ZPYA 1SHCA 2Z0QA 4K2PA 2YVCA 4GPTB 2D9XA 2RSGA 2HE7A 2KGXB 2DFKA 1ZM0A 1GC6A 1WVHA 2DA0A 2E2XA 2DHKA 4MY6A 4HB0B 2YT1A 3U8ZA 2VRWB 2LOXA 2W2XC 1H4RA 3VIAA 2P0FA 4YONA 1U5FA 1ZVRA 1PFJA 3ODXA 2RUKB 1EAZA 2CY4A 4A6HA 2UZRA 1LB1A 2YSZA 3T06A 2Z0OA 2DLWA 2OQBA 3A98B 3X23A 3SV1A 3FM8C 3ML4A 1OY2A 2Q13A 2V76A 3NSUA 4GMVA 3AU4A 1XCGA 4GMXB 1BAKA 4HAUB 3D8EA 5HE2A 1TJ6A 1NI2A 2H7EA 2L2IA 1Y5OA 5JHHA 1GG3A 4NSWA 4P7IA 1W1GA 3G9WA 3AU5A 4PNKA 2D4QA 1KZGA 2J0JA 3N7CA 3DXDA 1I2HA 3HK0A 1MAIA 2D10A 2D9WA 2CAYA 1N3HA 3PVLA 1I7AA 1UEFA 4K2OA 1W1HA 2D2QA 1H10A 1V5MA 2J59M 2AEHA 4D0NB 2VKIA 3M1IB 1DROA 1FB8A 3PVUA 2RLOA 1EVHA 1UPRA 2ROZB 1ISNA 3KRWA 2R0DA 5C16A 4Z2MB 1U27A 2KUPA 3FSSA 2D9VA 5D27A 2EMTA 5JHGA 2NMBA 2COCA 2RVBB 1AWEA 4A6FA 1PMSA 2J0KA
chains in the Genus database with same CATH superfamily
5DHFB 2D11A 2IFSA 1BTKA 2DYNA 2DN6A 5C5BA 1XX0A 2KIGA 3TW1A 3CXBB 3A8PA 1MPHA 4QXAB 2ELBA 4L1RA 2DKQA 3PVWA 2RGNB 2P0HA 3DXEA 3UZTA 4K17A 5JP4A 5J3QA 1X05A 4A6KA 3TO1A 1Y19B 1ZC4B 5C6RA 2LG1A 1DDMA 1V89A 2YT0A 2MWNB 2UZSA 3V5WA 2EJ8A 3SYXA 4KAXB 2MFQA 4KHBB 1EF1A 2D9ZA 3MDBC 3ODWA 1FHWA 2D9YA 3PEGA 1V5PA 1FGYA 1MIZB 4HAXB 4TYZA 3SO6A 1Q67A 1E5WA 2RRFA 4HATB 2DTCA 2COAA 2QKMA 2BCJA 2DKPA 1MK9B 4OT1A 4CYEA 3QWMA 5DIFB 4Z2NA 1Z87A 2I5CA 1WGQA 5D3YA 5KCVA 5L81A 3DXCA 2LOZA 4C0AA 4DX90 1W1DA 2CRFA 4HSIA 2Y8GA 3GYPA 3P6AA 1MI1A 1OMWA 4HDOA 1FAOA 3PZDA 1XODA 2I1KA 3P7ZA 5FI0A 4K81A 2LYDA 2J0MA 4A5KA 5JLJB 3WA0A 4HB4B 1KZ7A 1B55A 4HB3B 4DXAB 1U5GA 2PZ1A 1NTYA 3TVVA 5FI1A 4GNKB 3MPXA 3U12A 1ZSQA 4HDQA 4WVFB 2EMSA 2CY5A 4L6EA 4TKNA 4KHAA 4F7UP 5KQ4A 1FGZA 5D3XA 1J0WA 2H7DA 2P8VA 5DHAB 5LONB 4WJ7A 1FHOA 3IVFA 3U7DA 2VSZA 1NU2A 3WYFB 1ZC3B 2I1JA 2R09A 1X1FA 3F5RA 4IFSA 1TXDA 4KHOA 2EC1A 2OTXA 2DHJA 2Z13A 1U5EA 2ROVA 4GXBA 1P6SA 4GN1A 1KI1B 2K8EA 2K2UA 3PSCA 2NZ8B 3ODOA 4MT7A 4EJNA 1DDWA 4CHMA 2Y7BA 4BBKA 2LULA 4EMOA 2KUQA 2YF0A 4F7GA 4HHVA 4F7HA 3KRXA 4WSFA 3TCAA 2X18A 2GCLA 1LW3A 4HAZB 2YS5A 1OQNA 3D8DA 3PP2A 2DYQA 3GYOA 2YRYA 1V88A 1RRPB 4GZUA 4B6HA 1P3RA 5KQ1A 1K5GB 1V5UA 5HE1A 4XWXA 2M14A 3AJ4A 1UNRA 2K49A 1QQGA 2N0YA 1FOEA 2I5FA 5LG4B 2YS3A 3BINA 3KY9A 4A6FB 1NTVA 4HAWB 2DX1A 1DYNA 3HIEA 1MK7B 1U2BA 3OANA 2ADZA 5C5BB 5C79A 5D3WA 4PQ0A 1X11A 2MDXA 3ULBA 2COFA 5EFXA 1XKEA 1AQCA 4KVGB 3QBVB 3LJUX 1UNPA 2M38A 5J3YA 1FHXA 1X86A 2K2JA 1PLSA 2LKOA 5CLQB 2FJLA 3DCXA 1IRSA 2UVMA 3KSYA 2P0DA 5J3TA 1XR0B 3F0WA 1X1GA 3D8FA 3KZ1A 4Y94A 2K00A 3SUZA 3OHMB 4IAPA 2RNRB 3SNHA 3QIJA 1RJ2A 2DX5A 1K5DB 5CLLB 1WG7A 1DDVA 1J19A 2XQNM 2L1CA 1DBHA 2IYBA 3VOQA 1QC6A 5HE3A 3ULCA 4HB2B 4ZRJA 5GOWB 4HAVB 2N23A 2Z14A 1WGUA 2KR0A 5DH9B 2CODA 1XD4A 3RCPA 1BTNA 1BWNA 1WJ1A 1V61A 3O96A 2DHIA 3FEHA 1P5TA 2MKRA 4MK0A 5D3VA 5HE0A 1WI1A 4CHJA 3ZDTA 2JP2A 2KIEA 1MIXA 2HTHB 4QJ3B 1MKEA 1TQZA 2W2XD 4ZRIA 3TFMA 1SGHA 1UPQA 1M7RA 4HAYB 2GJYA 3ZVRA 2YT2A 2Y8FA 3HSAA 4H8SA 4DX8A 2ELAA 2GS0A 2G35A 2GCJA 4ZRKA 3BJIA 1U5DA 2W2WA 4DBBA 2Z0PA 2YS1A 3CIKA 5DI9B 5LOPB 4NY0A 1UNQA 4YL8A 2KCJA 4IOYX 4EKUA 1WJMA 1GC7A 2AL6A 4GOUA 2QKLA 1M7EA 4KHBA 1EGXA 3HW2B 1U29A 3HQCA 3A8QA 3PG7A 2ZPYA 2Z59A 1SHCA 2Z0QA 4K2PA 2YVCA 4GPTB 2D9XA 2Z4DA 2RSGA 2HE7A 2KGXB 2DFKA 5I2MA 4DIXA 1ZM0A 1GC6A 1WVHA 2DA0A 4OSNA 2E2XA 2DHKA 4MY6A 3NW8A 4HB0B 2GUMA 2YT1A 3U8ZA 5I2SA 2VRWB 2LOXA 2W2XC 1ZYIA 1H4RA 3VIAA 4QJ5B 2P0FA 4YONA 1U5FA 2NBVA 1ZVRA 1PFJA 3ODXA 2RUKB 2FJUB 1EAZA 2CY4A 4A6HA 2UZRA 1LB1A 2YSZA 3T06A 2Z0OA 4QJ4B 2DLWA 2OQBA 3A98B 3X23A 3SV1A 3FM8C 3ML4A 1OY2A 2Q13A 2V76A 3NSUA 4GMVA 3AU4A 1XCGA 4GMXB 1BAKA 4HAUB 3D8EA 5HE2A 1TJ6A 1NI2A 2H7EA 2L2IA 1Y5OA 5JHHA 1GG3A 4NSWA 4P7IA 2ZKMX 1W1GA 3G9WA 3AU5A 3NWAA 4PNKA 2D4QA 4D6WA 3A58A 1KZGA 2J0JA 3N7CA 3DXDA 1I2HA 3HK0A 1MAIA 2D10A 2D9WA 2CAYA 1N3HA 3PVLA 1I7AA 3NWDA 3NWFA 1UEFA 4K2OA 1W1HA 2D2QA 1H10A 1V5MA 5IRSA 2J59M 2AEHA 4CSQA 4D0NB 2VKIA 3B77A 5M4YB 3M1IB 1DROA 1FB8A 3PVUA 2RLOA 1EVHA 1UPRA 2ROZB 1ISNA 1T77A 3KRWA 2R0DA 5C16A 4Z2MB 1U27A 2KUPA 3FSSA 3FVCA 2D9VA 5D27A 2EMTA 2R2YA 5JHGA 2NMBA 2COCA 2RVBB 1AWEA 4A6FA 1PMSA 2J0KA
chains in the Genus database with same CATH topology
5DHFB 2D11A 2IFSA 1BTKA 2DYNA 2DN6A 5C5BA 1XX0A 3TW1A 3CXBB 3A8PA 1MPHA 2ELBA 2DKQA 3PVWA 2P0HA 2RGNB 3DXEA 3UZTA 4K17A 5JP4A 5J3QA 1X05A 4A6KA 3TO1A 1Y19B 1ZC4B 5C6RA 2LG1A 1DDMA 1V89A 2YT0A 2MWNB 2UZSA 3V5WA 2EJ8A 3SYXA 4KAXB 2MFQA 4KHBB 1EF1A 2D9ZA 3MDBC 3ODWA 1FHWA 2D9YA 3PEGA 1V5PA 1FGYA 1MIZB 4HAXB 4TYZA 3SO6A 1Q67A 1E5WA 4HATB 2DTCA 2COAA 2QKMA 2BCJA 2DKPA 1MK9B 4CYEA 3QWMA 5DIFB 4Z2NA 1Z87A 2I5CA 1WGQA 5D3YA 5KCVA 5L81A 3DXCA 2LOZA 4C0AA 4DX90 1W1DA 2CRFA 2Y8GA 3GYPA 3P6AA 1OMWA 4HDOA 1FAOA 3PZDA 1XODA 2I1KA 3P7ZA 5FI0A 4K81A 2LYDA 2J0MA 4A5KA 5JLJB 3WA0A 4HB4B 1KZ7A 1B55A 4HB3B 4DXAB 1U5GA 2PZ1A 1NTYA 3TVVA 5FI1A 3MPXA 1ZSQA 4HDQA 4WVFB 2EMSA 2CY5A 4L6EA 4TKNA 4KHAA 4F7UP 5KQ4A 1FGZA 5D3XA 1J0WA 2H7DA 2P8VA 5DHAB 5LONB 4WJ7A 1FHOA 3IVFA 3U7DA 2VSZA 1NU2A 3WYFB 1ZC3B 2I1JA 2R09A 1X1FA 3F5RA 4IFSA 1TXDA 4KHOA 2EC1A 2OTXA 2DHJA 1U5EA 2ROVA 4GXBA 1P6SA 4GN1A 1KI1B 2K2UA 3PSCA 2NZ8B 3ODOA 4MT7A 4EJNA 1DDWA 4CHMA 2Y7BA 4BBKA 2LULA 4EMOA 2YF0A 4F7GA 4HHVA 4F7HA 3KRXA 4WSFA 3TCAA 2X18A 2GCLA 1LW3A 4HAZB 2YS5A 1OQNA 3D8DA 3PP2A 2DYQA 3GYOA 2YRYA 1V88A 1RRPB 4GZUA 4B6HA 1P3RA 5KQ1A 1K5GB 1V5UA 5HE1A 4XWXA 2M14A 1UNRA 3AJ4A 1QQGA 2N0YA 1FOEA 2I5FA 2YS3A 3BINA 3KY9A 4A6FB 1NTVA 4HAWB 2DX1A 1DYNA 1MK7B 1U2BA 3OANA 2ADZA 5C5BB 5C79A 5D3WA 4PQ0A 1X11A 2MDXA 3ULBA 2COFA 5EFXA 1XKEA 1AQCA 4KVGB 3QBVB 3LJUX 1UNPA 2M38A 5J3YA 1FHXA 1X86A 2K2JA 1PLSA 2LKOA 5CLQB 2FJLA 1IRSA 2UVMA 3KSYA 2P0DA 5J3TA 1XR0B 3F0WA 1X1GA 3D8FA 3KZ1A 4Y94A 2K00A 3SUZA 4IAPA 2RNRB 3SNHA 3QIJA 1RJ2A 2DX5A 1K5DB 5CLLB 1WG7A 1DDVA 1J19A 2XQNM 2L1CA 1DBHA 2IYBA 3VOQA 1QC6A 5HE3A 3ULCA 4HB2B 4ZRJA 5GOWB 4HAVB 2N23A 1WGUA 5DH9B 2CODA 1XD4A 3RCPA 1BTNA 1BWNA 1WJ1A 1V61A 3O96A 2DHIA 3FEHA 1P5TA 2MKRA 4MK0A 5D3VA 5HE0A 1WI1A 4CHJA 3ZDTA 2JP2A 1MIXA 2HTHB 1MKEA 1TQZA 2W2XD 4ZRIA 3TFMA 1SGHA 1UPQA 1M7RA 4HAYB 2GJYA 3ZVRA 2Y8FA 4H8SA 4DX8A 2ELAA 2GS0A 2G35A 2GCJA 4ZRKA 3BJIA 1U5DA 2W2WA 4DBBA 2Z0PA 2YS1A 3CIKA 5DI9B 5LOPB 4NY0A 1UNQA 4YL8A 2KCJA 4IOYX 4EKUA 1WJMA 1GC7A 2AL6A 2QKLA 1M7EA 1EGXA 3HW2B 1U29A 3HQCA 3A8QA 3PG7A 2ZPYA 1SHCA 2Z0QA 4K2PA 2YVCA 4GPTB 2D9XA 2RSGA 2HE7A 2KGXB 2DFKA 1ZM0A 1GC6A 1WVHA 2DA0A 2E2XA 2DHKA 4MY6A 4HB0B 2YT1A 3U8ZA 2VRWB 2LOXA 2W2XC 1H4RA 3VIAA 2P0FA 4YONA 1U5FA 1ZVRA 1PFJA 3ODXA 2RUKB 1EAZA 2CY4A 4A6HA 2UZRA 1LB1A 2YSZA 3T06A 2Z0OA 2DLWA 2OQBA 3A98B 3X23A 3SV1A 3FM8C 3ML4A 1OY2A 2Q13A 2V76A 3NSUA 4GMVA 3AU4A 1XCGA 4GMXB 1BAKA 4HAUB 3D8EA 5HE2A 1TJ6A 1NI2A 2H7EA 2L2IA 1Y5OA 5JHHA 1GG3A 4NSWA 4P7IA 1W1GA 3G9WA 3AU5A 4PNKA 2D4QA 1KZGA 2J0JA 3N7CA 3DXDA 1I2HA 3HK0A 1MAIA 2D10A 2D9WA 2CAYA 1N3HA 3PVLA 1I7AA 1UEFA 4K2OA 1W1HA 2D2QA 1H10A 1V5MA 2J59M 2AEHA 4D0NB 2VKIA 3M1IB 1DROA 1FB8A 3PVUA 2RLOA 1EVHA 1UPRA 2ROZB 1ISNA 3KRWA 2R0DA 5C16A 4Z2MB 1U27A 2KUPA 3FSSA 2D9VA 5D27A 2EMTA 5JHGA 2NMBA 2COCA 2RVBB 1AWEA 4A6FA 1PMSA 2J0KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5DHF B;  2D11 A;  2IFS A;  1BTK A;  2DYN A;  2DN6 A;  5C5B A;  1XX0 A;  3TW1 A;  3CXB B;  3A8P A;  1MPH A;  2ELB A;  2DKQ A;  3PVW A;  2P0H A;  2RGN B;  3DXE A;  3UZT A;  4K17 A;  5JP4 A;  5J3Q A;  1X05 A;  4A6K A;  3TO1 A;  1Y19 B;  1ZC4 B;  5C6R A;  2LG1 A;  1DDM A;  1V89 A;  2YT0 A;  2MWN B;  2UZS A;  3V5W A;  2EJ8 A;  3SYX A;  4KAX B;  2MFQ A;  4KHB B;  1EF1 A;  2D9Z A;  3MDB C;  3ODW A;  1FHW A;  2D9Y A;  3PEG A;  1V5P A;  1FGY A;  1MIZ B;  4HAX B;  4TYZ A;  3SO6 A;  1Q67 A;  1E5W A;  4HAT B;  2DTC A;  2COA A;  2QKM A;  2BCJ A;  2DKP A;  1MK9 B;  4CYE A;  3QWM A;  5DIF B;  4Z2N A;  1Z87 A;  2I5C A;  1WGQ A;  5D3Y A;  5KCV A;  5L81 A;  3DXC A;  2LOZ A;  4C0A A;  4DX9 0;  1W1D A;  2CRF A;  2Y8G A;  3GYP A;  3P6A A;  1OMW A;  4HDO A;  1FAO A;  3PZD A;  1XOD A;  2I1K A;  3P7Z A;  5FI0 A;  4K81 A;  2LYD A;  2J0M A;  4A5K A;  5JLJ B;  3WA0 A;  4HB4 B;  1KZ7 A;  1B55 A;  4HB3 B;  4DXA B;  1U5G A;  2PZ1 A;  1NTY A;  3TVV A;  5FI1 A;  3MPX A;  1ZSQ A;  4HDQ A;  4WVF B;  2EMS A;  2CY5 A;  4L6E A;  4TKN A;  4KHA A;  4F7U P;  5KQ4 A;  1FGZ A;  5D3X A;  1J0W A;  2H7D A;  2P8V A;  5DHA B;  5LON B;  4WJ7 A;  1FHO A;  3IVF A;  3U7D A;  2VSZ A;  1NU2 A;  3WYF B;  1ZC3 B;  2I1J A;  2R09 A;  1X1F A;  3F5R A;  4IFS A;  1TXD A;  4KHO A;  2EC1 A;  2OTX A;  2DHJ A;  1U5E A;  2ROV A;  4GXB A;  1P6S A;  4GN1 A;  1KI1 B;  2K2U A;  3PSC A;  2NZ8 B;  3ODO A;  4MT7 A;  4EJN A;  1DDW A;  4CHM A;  2Y7B A;  4BBK A;  2LUL A;  4EMO A;  2YF0 A;  4F7G A;  4HHV A;  4F7H A;  3KRX A;  4WSF A;  3TCA A;  2X18 A;  2GCL A;  1LW3 A;  4HAZ B;  2YS5 A;  1OQN A;  3D8D A;  3PP2 A;  2DYQ A;  3GYO A;  2YRY A;  1V88 A;  1RRP B;  4GZU A;  4B6H A;  1P3R A;  5KQ1 A;  1K5G B;  1V5U A;  5HE1 A;  4XWX A;  2M14 A;  1UNR A;  3AJ4 A;  1QQG A;  2N0Y A;  1FOE A;  2I5F A;  2YS3 A;  3BIN A;  3KY9 A;  4A6F B;  1NTV A;  4HAW B;  2DX1 A;  1DYN A;  1MK7 B;  1U2B A;  3OAN A;  2ADZ A;  5C5B B;  5C79 A;  5D3W A;  4PQ0 A;  1X11 A;  2MDX A;  3ULB A;  2COF A;  5EFX A;  1XKE A;  1AQC A;  4KVG B;  3QBV B;  3LJU X;  1UNP A;  2M38 A;  5J3Y A;  1FHX A;  1X86 A;  2K2J A;  1PLS A;  2LKO A;  5CLQ B;  2FJL A;  1IRS A;  2UVM A;  3KSY A;  2P0D A;  5J3T A;  1XR0 B;  3F0W A;  1X1G A;  3D8F A;  3KZ1 A;  4Y94 A;  2K00 A;  3SUZ A;  4IAP A;  2RNR B;  3SNH A;  3QIJ A;  1RJ2 A;  2DX5 A;  1K5D B;  5CLL B;  1WG7 A;  1DDV A;  1J19 A;  2XQN M;  2L1C A;  1DBH A;  2IYB A;  3VOQ A;  1QC6 A;  5HE3 A;  3ULC A;  4HB2 B;  4ZRJ A;  5GOW B;  4HAV B;  2N23 A;  1WGU A;  5DH9 B;  2COD A;  1XD4 A;  3RCP A;  1BTN A;  1BWN A;  1WJ1 A;  1V61 A;  3O96 A;  2DHI A;  3FEH A;  1P5T A;  2MKR A;  4MK0 A;  5D3V A;  5HE0 A;  1WI1 A;  4CHJ A;  3ZDT A;  2JP2 A;  1MIX A;  2HTH B;  1MKE A;  1TQZ A;  2W2X D;  4ZRI A;  3TFM A;  1SGH A;  1UPQ A;  1M7R A;  4HAY B;  2GJY A;  3ZVR A;  2Y8F A;  4H8S A;  4DX8 A;  2ELA A;  2GS0 A;  2G35 A;  2GCJ A;  4ZRK A;  3BJI A;  1U5D A;  2W2W A;  4DBB A;  2Z0P A;  2YS1 A;  3CIK A;  5DI9 B;  5LOP B;  4NY0 A;  1UNQ A;  4YL8 A;  2KCJ A;  4IOY X;  4EKU A;  1WJM A;  1GC7 A;  2AL6 A;  2QKL A;  1M7E A;  1EGX A;  3HW2 B;  1U29 A;  3HQC A;  3A8Q A;  3PG7 A;  2ZPY A;  1SHC A;  2Z0Q A;  4K2P A;  2YVC A;  4GPT B;  2D9X A;  2RSG A;  2HE7 A;  2KGX B;  2DFK A;  1ZM0 A;  1GC6 A;  1WVH A;  2DA0 A;  2E2X A;  2DHK A;  4MY6 A;  4HB0 B;  2YT1 A;  3U8Z A;  2VRW B;  2LOX A;  2W2X C;  1H4R A;  3VIA A;  2P0F A;  4YON A;  1U5F A;  1ZVR A;  1PFJ A;  3ODX A;  2RUK B;  1EAZ A;  2CY4 A;  4A6H A;  2UZR A;  1LB1 A;  2YSZ A;  3T06 A;  2Z0O A;  2DLW A;  2OQB A;  3A98 B;  3X23 A;  3SV1 A;  3FM8 C;  3ML4 A;  1OY2 A;  2Q13 A;  2V76 A;  3NSU A;  4GMV A;  3AU4 A;  1XCG A;  4GMX B;  1BAK A;  4HAU B;  3D8E A;  5HE2 A;  1TJ6 A;  1NI2 A;  2H7E A;  2L2I A;  1Y5O A;  5JHH A;  1GG3 A;  4NSW A;  4P7I A;  1W1G A;  3G9W A;  3AU5 A;  4PNK A;  2D4Q A;  1KZG A;  2J0J A;  3N7C A;  3DXD A;  1I2H A;  3HK0 A;  1MAI A;  2D10 A;  2D9W A;  2CAY A;  1N3H A;  3PVL A;  1I7A A;  1UEF A;  4K2O A;  1W1H A;  2D2Q A;  1H10 A;  1V5M A;  2J59 M;  2AEH A;  4D0N B;  2VKI A;  3M1I B;  1DRO A;  1FB8 A;  3PVU A;  2RLO A;  1EVH A;  1UPR A;  2ROZ B;  1ISN A;  3KRW A;  2R0D A;  5C16 A;  4Z2M B;  1U27 A;  2KUP A;  3FSS A;  2D9V A;  5D27 A;  2EMT A;  5JHG A;  2NMB A;  2COC A;  2RVB B;  1AWE A;  4A6F A;  1PMS A;  2J0K A; 
#chains in the Genus database with same CATH topology
 5DHF B;  2D11 A;  2IFS A;  1BTK A;  2DYN A;  2DN6 A;  5C5B A;  1XX0 A;  2KIG A;  3TW1 A;  3CXB B;  3A8P A;  1MPH A;  4QXA B;  2ELB A;  4L1R A;  2DKQ A;  3PVW A;  2RGN B;  2P0H A;  3DXE A;  3UZT A;  4K17 A;  5JP4 A;  5J3Q A;  1X05 A;  4A6K A;  3TO1 A;  1Y19 B;  1ZC4 B;  5C6R A;  2LG1 A;  1DDM A;  1V89 A;  2YT0 A;  2MWN B;  2UZS A;  3V5W A;  2EJ8 A;  3SYX A;  4KAX B;  2MFQ A;  4KHB B;  1EF1 A;  2D9Z A;  3MDB C;  3ODW A;  1FHW A;  2D9Y A;  3PEG A;  1V5P A;  1FGY A;  1MIZ B;  4HAX B;  4TYZ A;  3SO6 A;  1Q67 A;  1E5W A;  2RRF A;  4HAT B;  2DTC A;  2COA A;  2QKM A;  2BCJ A;  2DKP A;  1MK9 B;  4OT1 A;  4CYE A;  3QWM A;  5DIF B;  4Z2N A;  1Z87 A;  2I5C A;  1WGQ A;  5D3Y A;  5KCV A;  5L81 A;  3DXC A;  2LOZ A;  4C0A A;  4DX9 0;  1W1D A;  2CRF A;  4HSI A;  2Y8G A;  3GYP A;  3P6A A;  1MI1 A;  1OMW A;  4HDO A;  1FAO A;  3PZD A;  1XOD A;  2I1K A;  3P7Z A;  5FI0 A;  4K81 A;  2LYD A;  2J0M A;  4A5K A;  5JLJ B;  3WA0 A;  4HB4 B;  1KZ7 A;  1B55 A;  4HB3 B;  4DXA B;  1U5G A;  2PZ1 A;  1NTY A;  3TVV A;  5FI1 A;  4GNK B;  3MPX A;  3U12 A;  1ZSQ A;  4HDQ A;  4WVF B;  2EMS A;  2CY5 A;  4L6E A;  4TKN A;  4KHA A;  4F7U P;  5KQ4 A;  1FGZ A;  5D3X A;  1J0W A;  2H7D A;  2P8V A;  5DHA B;  5LON B;  4WJ7 A;  1FHO A;  3IVF A;  3U7D A;  2VSZ A;  1NU2 A;  3WYF B;  1ZC3 B;  2I1J A;  2R09 A;  1X1F A;  3F5R A;  4IFS A;  1TXD A;  4KHO A;  2EC1 A;  2OTX A;  2DHJ A;  2Z13 A;  1U5E A;  2ROV A;  4GXB A;  1P6S A;  4GN1 A;  1KI1 B;  2K8E A;  2K2U A;  3PSC A;  2NZ8 B;  3ODO A;  4MT7 A;  4EJN A;  1DDW A;  4CHM A;  2Y7B A;  4BBK A;  2LUL A;  4EMO A;  2KUQ A;  2YF0 A;  4F7G A;  4HHV A;  4F7H A;  3KRX A;  4WSF A;  3TCA A;  2X18 A;  2GCL A;  1LW3 A;  4HAZ B;  2YS5 A;  1OQN A;  3D8D A;  3PP2 A;  2DYQ A;  3GYO A;  2YRY A;  1V88 A;  1RRP B;  4GZU A;  4B6H A;  1P3R A;  5KQ1 A;  1K5G B;  1V5U A;  5HE1 A;  4XWX A;  2M14 A;  3AJ4 A;  1UNR A;  2K49 A;  1QQG A;  2N0Y A;  1FOE A;  2I5F A;  5LG4 B;  2YS3 A;  3BIN A;  3KY9 A;  4A6F B;  1NTV A;  4HAW B;  2DX1 A;  1DYN A;  3HIE A;  1MK7 B;  1U2B A;  3OAN A;  2ADZ A;  5C5B B;  5C79 A;  5D3W A;  4PQ0 A;  1X11 A;  2MDX A;  3ULB A;  2COF A;  5EFX A;  1XKE A;  1AQC A;  4KVG B;  3QBV B;  3LJU X;  1UNP A;  2M38 A;  5J3Y A;  1FHX A;  1X86 A;  2K2J A;  1PLS A;  2LKO A;  5CLQ B;  2FJL A;  3DCX A;  1IRS A;  2UVM A;  3KSY A;  2P0D A;  5J3T A;  1XR0 B;  3F0W A;  1X1G A;  3D8F A;  3KZ1 A;  4Y94 A;  2K00 A;  3SUZ A;  3OHM B;  4IAP A;  2RNR B;  3SNH A;  3QIJ A;  1RJ2 A;  2DX5 A;  1K5D B;  5CLL B;  1WG7 A;  1DDV A;  1J19 A;  2XQN M;  2L1C A;  1DBH A;  2IYB A;  3VOQ A;  1QC6 A;  5HE3 A;  3ULC A;  4HB2 B;  4ZRJ A;  5GOW B;  4HAV B;  2N23 A;  2Z14 A;  1WGU A;  2KR0 A;  5DH9 B;  2COD A;  1XD4 A;  3RCP A;  1BTN A;  1BWN A;  1WJ1 A;  1V61 A;  3O96 A;  2DHI A;  3FEH A;  1P5T A;  2MKR A;  4MK0 A;  5D3V A;  5HE0 A;  1WI1 A;  4CHJ A;  3ZDT A;  2JP2 A;  2KIE A;  1MIX A;  2HTH B;  4QJ3 B;  1MKE A;  1TQZ A;  2W2X D;  4ZRI A;  3TFM A;  1SGH A;  1UPQ A;  1M7R A;  4HAY B;  2GJY A;  3ZVR A;  2YT2 A;  2Y8F A;  3HSA A;  4H8S A;  4DX8 A;  2ELA A;  2GS0 A;  2G35 A;  2GCJ A;  4ZRK A;  3BJI A;  1U5D A;  2W2W A;  4DBB A;  2Z0P A;  2YS1 A;  3CIK A;  5DI9 B;  5LOP B;  4NY0 A;  1UNQ A;  4YL8 A;  2KCJ A;  4IOY X;  4EKU A;  1WJM A;  1GC7 A;  2AL6 A;  4GOU A;  2QKL A;  1M7E A;  4KHB A;  1EGX A;  3HW2 B;  1U29 A;  3HQC A;  3A8Q A;  3PG7 A;  2ZPY A;  2Z59 A;  1SHC A;  2Z0Q A;  4K2P A;  2YVC A;  4GPT B;  2D9X A;  2Z4D A;  2RSG A;  2HE7 A;  2KGX B;  2DFK A;  5I2M A;  4DIX A;  1ZM0 A;  1GC6 A;  1WVH A;  2DA0 A;  4OSN A;  2E2X A;  2DHK A;  4MY6 A;  3NW8 A;  4HB0 B;  2GUM A;  2YT1 A;  3U8Z A;  5I2S A;  2VRW B;  2LOX A;  2W2X C;  1ZYI A;  1H4R A;  3VIA A;  4QJ5 B;  2P0F A;  4YON A;  1U5F A;  2NBV A;  1ZVR A;  1PFJ A;  3ODX A;  2RUK B;  2FJU B;  1EAZ A;  2CY4 A;  4A6H A;  2UZR A;  1LB1 A;  2YSZ A;  3T06 A;  2Z0O A;  4QJ4 B;  2DLW A;  2OQB A;  3A98 B;  3X23 A;  3SV1 A;  3FM8 C;  3ML4 A;  1OY2 A;  2Q13 A;  2V76 A;  3NSU A;  4GMV A;  3AU4 A;  1XCG A;  4GMX B;  1BAK A;  4HAU B;  3D8E A;  5HE2 A;  1TJ6 A;  1NI2 A;  2H7E A;  2L2I A;  1Y5O A;  5JHH A;  1GG3 A;  4NSW A;  4P7I A;  2ZKM X;  1W1G A;  3G9W A;  3AU5 A;  3NWA A;  4PNK A;  2D4Q A;  4D6W A;  3A58 A;  1KZG A;  2J0J A;  3N7C A;  3DXD A;  1I2H A;  3HK0 A;  1MAI A;  2D10 A;  2D9W A;  2CAY A;  1N3H A;  3PVL A;  1I7A A;  3NWD A;  3NWF A;  1UEF A;  4K2O A;  1W1H A;  2D2Q A;  1H10 A;  1V5M A;  5IRS A;  2J59 M;  2AEH A;  4CSQ A;  4D0N B;  2VKI A;  3B77 A;  5M4Y B;  3M1I B;  1DRO A;  1FB8 A;  3PVU A;  2RLO A;  1EVH A;  1UPR A;  2ROZ B;  1ISN A;  1T77 A;  3KRW A;  2R0D A;  5C16 A;  4Z2M B;  1U27 A;  2KUP A;  3FSS A;  3FVC A;  2D9V A;  5D27 A;  2EMT A;  2R2Y A;  5JHG A;  2NMB A;  2COC A;  2RVB B;  1AWE A;  4A6F A;  1PMS A;  2J0K A; 
#chains in the Genus database with same CATH homology
 5DHF B;  2D11 A;  2IFS A;  1BTK A;  2DYN A;  2DN6 A;  5C5B A;  1XX0 A;  3TW1 A;  3CXB B;  3A8P A;  1MPH A;  2ELB A;  2DKQ A;  3PVW A;  2P0H A;  2RGN B;  3DXE A;  3UZT A;  4K17 A;  5JP4 A;  5J3Q A;  1X05 A;  4A6K A;  3TO1 A;  1Y19 B;  1ZC4 B;  5C6R A;  2LG1 A;  1DDM A;  1V89 A;  2YT0 A;  2MWN B;  2UZS A;  3V5W A;  2EJ8 A;  3SYX A;  4KAX B;  2MFQ A;  4KHB B;  1EF1 A;  2D9Z A;  3MDB C;  3ODW A;  1FHW A;  2D9Y A;  3PEG A;  1V5P A;  1FGY A;  1MIZ B;  4HAX B;  4TYZ A;  3SO6 A;  1Q67 A;  1E5W A;  4HAT B;  2DTC A;  2COA A;  2QKM A;  2BCJ A;  2DKP A;  1MK9 B;  4CYE A;  3QWM A;  5DIF B;  4Z2N A;  1Z87 A;  2I5C A;  1WGQ A;  5D3Y A;  5KCV A;  5L81 A;  3DXC A;  2LOZ A;  4C0A A;  4DX9 0;  1W1D A;  2CRF A;  2Y8G A;  3GYP A;  3P6A A;  1OMW A;  4HDO A;  1FAO A;  3PZD A;  1XOD A;  2I1K A;  3P7Z A;  5FI0 A;  4K81 A;  2LYD A;  2J0M A;  4A5K A;  5JLJ B;  3WA0 A;  4HB4 B;  1KZ7 A;  1B55 A;  4HB3 B;  4DXA B;  1U5G A;  2PZ1 A;  1NTY A;  3TVV A;  5FI1 A;  3MPX A;  1ZSQ A;  4HDQ A;  4WVF B;  2EMS A;  2CY5 A;  4L6E A;  4TKN A;  4KHA A;  4F7U P;  5KQ4 A;  1FGZ A;  5D3X A;  1J0W A;  2H7D A;  2P8V A;  5DHA B;  5LON B;  4WJ7 A;  1FHO A;  3IVF A;  3U7D A;  2VSZ A;  1NU2 A;  3WYF B;  1ZC3 B;  2I1J A;  2R09 A;  1X1F A;  3F5R A;  4IFS A;  1TXD A;  4KHO A;  2EC1 A;  2OTX A;  2DHJ A;  1U5E A;  2ROV A;  4GXB A;  1P6S A;  4GN1 A;  1KI1 B;  2K2U A;  3PSC A;  2NZ8 B;  3ODO A;  4MT7 A;  4EJN A;  1DDW A;  4CHM A;  2Y7B A;  4BBK A;  2LUL A;  4EMO A;  2YF0 A;  4F7G A;  4HHV A;  4F7H A;  3KRX A;  4WSF A;  3TCA A;  2X18 A;  2GCL A;  1LW3 A;  4HAZ B;  2YS5 A;  1OQN A;  3D8D A;  3PP2 A;  2DYQ A;  3GYO A;  2YRY A;  1V88 A;  1RRP B;  4GZU A;  4B6H A;  1P3R A;  5KQ1 A;  1K5G B;  1V5U A;  5HE1 A;  4XWX A;  2M14 A;  1UNR A;  3AJ4 A;  1QQG A;  2N0Y A;  1FOE A;  2I5F A;  2YS3 A;  3BIN A;  3KY9 A;  4A6F B;  1NTV A;  4HAW B;  2DX1 A;  1DYN A;  1MK7 B;  1U2B A;  3OAN A;  2ADZ A;  5C5B B;  5C79 A;  5D3W A;  4PQ0 A;  1X11 A;  2MDX A;  3ULB A;  2COF A;  5EFX A;  1XKE A;  1AQC A;  4KVG B;  3QBV B;  3LJU X;  1UNP A;  2M38 A;  5J3Y A;  1FHX A;  1X86 A;  2K2J A;  1PLS A;  2LKO A;  5CLQ B;  2FJL A;  1IRS A;  2UVM A;  3KSY A;  2P0D A;  5J3T A;  1XR0 B;  3F0W A;  1X1G A;  3D8F A;  3KZ1 A;  4Y94 A;  2K00 A;  3SUZ A;  4IAP A;  2RNR B;  3SNH A;  3QIJ A;  1RJ2 A;  2DX5 A;  1K5D B;  5CLL B;  1WG7 A;  1DDV A;  1J19 A;  2XQN M;  2L1C A;  1DBH A;  2IYB A;  3VOQ A;  1QC6 A;  5HE3 A;  3ULC A;  4HB2 B;  4ZRJ A;  5GOW B;  4HAV B;  2N23 A;  1WGU A;  5DH9 B;  2COD A;  1XD4 A;  3RCP A;  1BTN A;  1BWN A;  1WJ1 A;  1V61 A;  3O96 A;  2DHI A;  3FEH A;  1P5T A;  2MKR A;  4MK0 A;  5D3V A;  5HE0 A;  1WI1 A;  4CHJ A;  3ZDT A;  2JP2 A;  1MIX A;  2HTH B;  1MKE A;  1TQZ A;  2W2X D;  4ZRI A;  3TFM A;  1SGH A;  1UPQ A;  1M7R A;  4HAY B;  2GJY A;  3ZVR A;  2Y8F A;  4H8S A;  4DX8 A;  2ELA A;  2GS0 A;  2G35 A;  2GCJ A;  4ZRK A;  3BJI A;  1U5D A;  2W2W A;  4DBB A;  2Z0P A;  2YS1 A;  3CIK A;  5DI9 B;  5LOP B;  4NY0 A;  1UNQ A;  4YL8 A;  2KCJ A;  4IOY X;  4EKU A;  1WJM A;  1GC7 A;  2AL6 A;  2QKL A;  1M7E A;  1EGX A;  3HW2 B;  1U29 A;  3HQC A;  3A8Q A;  3PG7 A;  2ZPY A;  1SHC A;  2Z0Q A;  4K2P A;  2YVC A;  4GPT B;  2D9X A;  2RSG A;  2HE7 A;  2KGX B;  2DFK A;  1ZM0 A;  1GC6 A;  1WVH A;  2DA0 A;  2E2X A;  2DHK A;  4MY6 A;  4HB0 B;  2YT1 A;  3U8Z A;  2VRW B;  2LOX A;  2W2X C;  1H4R A;  3VIA A;  2P0F A;  4YON A;  1U5F A;  1ZVR A;  1PFJ A;  3ODX A;  2RUK B;  1EAZ A;  2CY4 A;  4A6H A;  2UZR A;  1LB1 A;  2YSZ A;  3T06 A;  2Z0O A;  2DLW A;  2OQB A;  3A98 B;  3X23 A;  3SV1 A;  3FM8 C;  3ML4 A;  1OY2 A;  2Q13 A;  2V76 A;  3NSU A;  4GMV A;  3AU4 A;  1XCG A;  4GMX B;  1BAK A;  4HAU B;  3D8E A;  5HE2 A;  1TJ6 A;  1NI2 A;  2H7E A;  2L2I A;  1Y5O A;  5JHH A;  1GG3 A;  4NSW A;  4P7I A;  1W1G A;  3G9W A;  3AU5 A;  4PNK A;  2D4Q A;  1KZG A;  2J0J A;  3N7C A;  3DXD A;  1I2H A;  3HK0 A;  1MAI A;  2D10 A;  2D9W A;  2CAY A;  1N3H A;  3PVL A;  1I7A A;  1UEF A;  4K2O A;  1W1H A;  2D2Q A;  1H10 A;  1V5M A;  2J59 M;  2AEH A;  4D0N B;  2VKI A;  3M1I B;  1DRO A;  1FB8 A;  3PVU A;  2RLO A;  1EVH A;  1UPR A;  2ROZ B;  1ISN A;  3KRW A;  2R0D A;  5C16 A;  4Z2M B;  1U27 A;  2KUP A;  3FSS A;  2D9V A;  5D27 A;  2EMT A;  5JHG A;  2NMB A;  2COC A;  2RVB B;  1AWE A;  4A6F A;  1PMS A;  2J0K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...