2L2IA

Nmr structure of the complex between the tfb1 subunit of tfiih and the activation domain of eklf
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
115
structure length
115
Chain Sequence
PSHSGAAIFEKVSGIIAINEDVSPAELTWRSTDGDKVHTVVLSTIDKLQATPASSEKMMLRLIGKVDESKKRKDNEGNEVVPKPQRHMFSFNNRTVMDNIKMTLQQIISRYKDAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords RNA polymerase II transcription factor B subunit 1
publication title NMR Structure of the complex between the Tfb1 subunit of TFIIH and the activation domain of EKLF
rcsb
source organism Saccharomyces cerevisiae s288c
total genus 16
structure length 115
sequence length 115
ec nomenclature
pdb deposition date 2010-08-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08567 PH_TFIIH TFIIH p62 subunit, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2l2iA00
1U29A 1MK9B 1DDWA 2LYDA 3PZDA 5JP4A 3UZTA 1MPHA 2N23A 1SHCA 1EVHA 1WJMA 2VRWB 3MDBC 1DDVA 3U8ZA 4ZRJA 3RCPA 2RGNB 1MK7B 4K81A 2COAA 2CY4A 2GS0A 3NSUA 3LJUX 3F0WA 5FI0A 1FGZA 5C16A 1EF1A 1P5TA 3T06A 3D8EA 4HB0B 2CODA 3A8PA 4EKUA 2D9XA 4C0AA 1WVHA 1TJ6A 3QIJA 1RJ2A 3AJ4A 2I5CA 2Y8GA 3P7ZA 1X11A 4MY6A 2DFKA 4A6FB 5KCVA 5LONB 1FHWA 2LOXA 2PZ1A 1AWEA 1FAOA 5JHGA 1V5MA 2MFQA 3D8FA 4NSWA 3AU5A 4Y94A 3G9WA 2YRYA 5D27A 5EFXA 2KCJA 3HK0A 4K2OA 4MK0A 5DHFB 2GCJA 3ULCA 2P0FA 5J3TA 1UEFA 4XWXA 1ZC3B 4DXAB 2D9VA 3TO1A 1J0WA 3PEGA 3SUZA 2X18A 4YL8A 1XX0A 2J59M 4TYZA 2ELBA 2DKPA 2I5FA 3KZ1A 2QKLA 5D3WA 2N0YA 2E2XA 1PLSA 2LULA 1FHXA 1OY2A 5D3YA 1V88A 5C6RA 4CYEA 3BINA 3N7CA 1V5PA 2YS1A 3WYFB 4GMVA 5C5BA 2YSZA 2Y7BA 2LG1A 4DBBA 4EJNA 4GPTB 3ODOA 1V61A 2COCA 2VKIA 4YONA 5DHAB 1OMWA 4HAYB 2DX5A 5CLLB 4HAZB 1Y19B 2OTXA 4K2PA 2Z0OA 4F7HA 2QKMA 3FM8C 4PQ0A 1WG7A 1BTKA 1MKEA 2H7EA 2RNRB 1Z87A 5D3VA 1U2BA 2DTCA 1XODA 1WGUA 1MAIA 5HE2A 4F7GA 3FEHA 5DH9B 4K17A 2EJ8A 4HDOA 3A98B 2UZSA 1K5DB 2IFSA 1KZ7A 2HE7A 2D9YA 2EC1A 1XD4A 2Z0QA 3KSYA 2COFA 1IRSA 2J0JA 2EMTA 4CHJA 1WJ1A 1EAZA 4IFSA 2BCJA 2KUPA 5DIFB 1XR0B 1SGHA 4MT7A 1U27A 2AEHA 4KHOA 2I1JA 5LOPB 2DN6A 5JLJB 1PMSA 1DBHA 1TXDA 1OQNA 4F7UP 1GC6A 4CHMA 4DX90 5J3QA 2RVBB 1XKEA 4Z2NA 3P6AA 2D10A 2LKOA 5HE0A 1P3RA 4KAXB 2YS3A 4HAVB 4HAXB 2M14A 4EMOA 1ZM0A 4GXBA 2M38A 1FB8A 4KHAA 1V5UA 1M7EA 5J3YA 5C79A 1DDMA 2W2WA 3WA0A 3A8QA 2DHKA 3DXCA 4Z2MB 1X86A 1ZVRA 1MIZB 1Q67A 2UZRA 5HE3A 2K2UA 2W2XC 2MDXA 4A6KA 4HB4B 4H8SA 1GG3A 1U5DA 4A6FA 2H7DA 1RRPB 1UNQA 3OANA 3CIKA 5KQ1A 3SV1A 2ROZB 2G35A 1ZC4B 2D4QA 3SYXA 3DXEA 5D3XA 2P0HA 3FSSA 4WJ7A 2ZPYA 3GYPA 1ZSQA 4ZRKA 1B55A 2ROVA 2L1CA 3PSCA 2AL6A 1FOEA 1V89A 2DX1A 2K00A 5L81A 1UPRA 2R0DA 2CRFA 4BBKA 1KI1B 1KZGA 3F5RA 3KRXA 4P7IA 1H10A 1DROA 2V76A 1GC7A 2ELAA 2P0DA 1H4RA 1AQCA 3DXDA 3AU4A 2YT0A 4NY0A 1N3HA 2D2QA 2IYBA 2RUKB 2J0MA 4A5KA 3KY9A 3IVFA 4HDQA 4KHBB 2JP2A 2D11A 1X1FA 1LW3A 4WVFB 4HB2B 1UNRA 4PNKA 2XQNM 2KGXB 1NU2A 4HAWB 2NMBA 3PP2A 4DX8A 1E5WA 2DHIA 3O96A 3TFMA 1XCGA 1QC6A 3U7DA 3TVVA 3HW2B 2R09A 3PVUA 2YS5A 1MIXA 1PFJA 2DKQA 3ODXA 1FHOA 3GYOA 3HQCA 3ML4A 1DYNA 1I2HA 1NI2A 2I1KA 3X23A 1W1DA 5DI9B 2RSGA 4A6HA 1U5EA 2YT1A 2ADZA 5FI1A 2MKRA 4D0NB 4WSFA 2D9ZA 4IOYX 4GMXB 1Y5OA 1P6SA 2Q13A 2OQBA 2Z0PA 4B6HA 2J0KA 4ZRIA 4HAUB 5C5BB 2DYNA 3SNHA 3D8DA 1TQZA 2CY5A 2YVCA 3TW1A 1BAKA 2VSZA 1ISNA 3QWMA 1U5GA 2GCLA 1M7RA 1FGYA 1X1GA 4IAPA 4TKNA 3ZVRA 1X05A 1NTVA 2FJLA 3M1IB 3ULBA 2MWNB 2LOZA 1U5FA 4GN1A 3KRWA 1BTNA 3ZDTA 1I7AA 1EGXA 5KQ4A 2DLWA 2YF0A 3VOQA 2L2IA 2P8VA 1W1GA 1W1HA 3BJIA 2Y8FA 3VIAA 4HATB 1UNPA 3PVWA 2DA0A 1LB1A 2RLOA 1J19A 1WI1A 3QBVB 5CLQB 3PG7A 3MPXA 2UVMA 4HB3B 2HTHB 2EMSA 1K5GB 1BWNA 2CAYA 4HHVA 4L6EA 1UPQA 3V5WA 1QQGA 2K2JA 3TCAA 2D9WA 5JHHA 5HE1A 3SO6A 2W2XD 4GZUA 3PVLA 2GJYA 2DHJA 3ODWA 2NZ8B 3CXBB 5GOWB 1WGQA 2DYQA 1NTYA 4KVGB
chains in the Genus database with same CATH superfamily
4CSQA 1U29A 1MK9B 1DDWA 2LYDA 3PZDA 5JP4A 3UZTA 1MPHA 2R2YA 2N23A 1SHCA 1EVHA 1WJMA 2VRWB 3MDBC 1DDVA 3U8ZA 4ZRJA 3RCPA 2RGNB 1MK7B 4K81A 2COAA 2CY4A 2GS0A 3NSUA 3U12A 3LJUX 3F0WA 5FI0A 1MI1A 1FGZA 5C16A 1EF1A 1P5TA 3T06A 3D8EA 4HB0B 2CODA 3A8PA 2KR0A 4EKUA 2D9XA 4C0AA 1WVHA 4KHBA 1TJ6A 3QIJA 1RJ2A 3AJ4A 2I5CA 3NWAA 2Y8GA 3P7ZA 1X11A 4MY6A 2DFKA 4A6FB 5KCVA 5LONB 5I2MA 1FHWA 2LOXA 2PZ1A 1AWEA 4GOUA 1FAOA 5JHGA 1V5MA 2MFQA 3D8FA 4NSWA 3AU5A 4Y94A 3G9WA 2YRYA 3A58A 5D27A 5EFXA 2KCJA 3HK0A 4K2OA 4MK0A 5DHFB 2GCJA 3ULCA 2P0FA 5J3TA 1UEFA 4XWXA 1ZC3B 4DXAB 2D9VA 3TO1A 1J0WA 3PEGA 3SUZA 2X18A 4YL8A 1XX0A 2J59M 4TYZA 2ELBA 2DKPA 2I5FA 3KZ1A 2QKLA 5D3WA 2N0YA 2E2XA 1PLSA 2LULA 3DCXA 1FHXA 1OY2A 5D3YA 1V88A 5C6RA 4CYEA 3BINA 3N7CA 1V5PA 2YS1A 2Z14A 3WYFB 4GMVA 5C5BA 2YSZA 2Y7BA 2LG1A 4DBBA 4EJNA 4GPTB 3ODOA 1V61A 2COCA 2VKIA 4YONA 5DHAB 1OMWA 4HAYB 2DX5A 5CLLB 4HAZB 1Y19B 2OTXA 4K2PA 2Z0OA 4F7HA 2QKMA 3FM8C 4PQ0A 1WG7A 1BTKA 1MKEA 2H7EA 2RNRB 1Z87A 2KIEA 5D3VA 1U2BA 2DTCA 2KUQA 2Z13A 1XODA 1WGUA 1MAIA 5HE2A 4F7GA 3FEHA 5DH9B 4L1RA 4K17A 2EJ8A 4HDOA 2K8EA 3A98B 2UZSA 1K5DB 2IFSA 1KZ7A 2HE7A 2D9YA 2EC1A 1XD4A 2Z0QA 2COFA 2J0JA 1IRSA 3KSYA 2EMTA 4CHJA 1T77A 1WJ1A 1EAZA 2K49A 2BCJA 4IFSA 2KUPA 5DIFB 1XR0B 1SGHA 4MT7A 1U27A 2AEHA 4KHOA 2I1JA 5LOPB 2DN6A 5JLJB 1PMSA 1DBHA 1TXDA 1OQNA 4F7UP 1GC6A 4CHMA 4DX90 4QJ5B 5J3QA 2RVBB 1XKEA 4Z2NA 3P6AA 2D10A 2LKOA 5HE0A 1P3RA 4KAXB 2YS3A 4HAVB 4HAXB 2M14A 4EMOA 1ZM0A 4GXBA 2M38A 1FB8A 4KHAA 3FVCA 1V5UA 1M7EA 5J3YA 5C79A 1DDMA 2W2WA 4HSIA 2FJUB 3WA0A 3A8QA 2DHKA 3DXCA 4Z2MB 1X86A 1ZVRA 1MIZB 4OSNA 1Q67A 2UZRA 5M4YB 5HE3A 5I2SA 2K2UA 2W2XC 2MDXA 4A6KA 4HB4B 4H8SA 1GG3A 1U5DA 4A6FA 2H7DA 1RRPB 1UNQA 3OANA 3CIKA 5KQ1A 3SV1A 2ROZB 2G35A 1ZC4B 2D4QA 3HSAA 2YT2A 3SYXA 3DXEA 5D3XA 2P0HA 3FSSA 4WJ7A 2ZPYA 3GYPA 1ZSQA 4ZRKA 1B55A 2ROVA 3NWFA 2L1CA 3PSCA 2AL6A 1FOEA 1V89A 2DX1A 2K00A 5L81A 1UPRA 2R0DA 2CRFA 4QJ3B 4BBKA 1KI1B 1KZGA 3F5RA 3KRXA 3HIEA 4DIXA 4P7IA 1H10A 1DROA 2V76A 4QJ4B 1GC7A 2ELAA 2P0DA 1H4RA 1AQCA 3DXDA 3AU4A 2YT0A 4NY0A 1N3HA 2D2QA 2IYBA 2RUKB 2J0MA 4A5KA 4QXAB 3KY9A 3IVFA 4HDQA 4KHBB 2JP2A 2D11A 1X1FA 1LW3A 4WVFB 4HB2B 1UNRA 4PNKA 2XQNM 2KGXB 1NU2A 4HAWB 2NMBA 3PP2A 4DX8A 1E5WA 2DHIA 3O96A 3TFMA 1XCGA 1QC6A 3U7DA 3TVVA 3HW2B 2R09A 3PVUA 2YS5A 1MIXA 1PFJA 2DKQA 2GUMA 3ODXA 1FHOA 3GYOA 3HQCA 3ML4A 1DYNA 1I2HA 1NI2A 2I1KA 3NW8A 3X23A 1W1DA 5DI9B 2RSGA 4A6HA 1U5EA 2YT1A 2ADZA 3NWDA 5FI1A 2MKRA 4D0NB 4OT1A 4WSFA 4D6WA 2D9ZA 4IOYX 4GMXB 1Y5OA 1P6SA 2Q13A 1ZYIA 2OQBA 2Z0PA 4B6HA 2J0KA 5IRSA 4ZRIA 4HAUB 5C5BB 2DYNA 3SNHA 3D8DA 1TQZA 2CY5A 5LG4B 2YVCA 3TW1A 1BAKA 2VSZA 1ISNA 3QWMA 1U5GA 2ZKMX 2GCLA 1M7RA 1FGYA 1X1GA 4IAPA 4TKNA 3ZVRA 1X05A 1NTVA 2FJLA 3M1IB 3ULBA 2MWNB 2LOZA 1U5FA 4GN1A 3KRWA 1BTNA 3ZDTA 1I7AA 1EGXA 5KQ4A 2DLWA 2YF0A 3VOQA 2L2IA 3OHMB 2P8VA 3B77A 1W1GA 1W1HA 3BJIA 2KIGA 2Y8FA 3VIAA 4HATB 1UNPA 3PVWA 2DA0A 1LB1A 2RLOA 1J19A 1WI1A 3QBVB 5CLQB 3PG7A 3MPXA 2RRFA 2UVMA 4HB3B 2HTHB 2EMSA 1K5GB 1BWNA 2CAYA 2NBVA 4HHVA 4L6EA 1UPQA 3V5WA 1QQGA 2K2JA 3TCAA 2D9WA 5JHHA 5HE1A 3SO6A 2W2XD 4GNKB 4GZUA 3PVLA 2GJYA 2DHJA 3ODWA 2NZ8B 3CXBB 5GOWB 1WGQA 2Z59A 2Z4DA 2DYQA 1NTYA 4KVGB
chains in the Genus database with same CATH topology
1U29A 1MK9B 1DDWA 2LYDA 3PZDA 5JP4A 3UZTA 1MPHA 2N23A 1SHCA 1EVHA 1WJMA 2VRWB 3MDBC 1DDVA 3U8ZA 4ZRJA 3RCPA 2RGNB 1MK7B 4K81A 2COAA 2CY4A 2GS0A 3NSUA 3LJUX 3F0WA 5FI0A 1FGZA 5C16A 1EF1A 1P5TA 3T06A 3D8EA 4HB0B 2CODA 3A8PA 4EKUA 2D9XA 4C0AA 1WVHA 1TJ6A 3QIJA 1RJ2A 3AJ4A 2I5CA 2Y8GA 3P7ZA 1X11A 4MY6A 2DFKA 4A6FB 5KCVA 5LONB 1FHWA 2LOXA 2PZ1A 1AWEA 1FAOA 5JHGA 1V5MA 2MFQA 3D8FA 4NSWA 3AU5A 4Y94A 3G9WA 2YRYA 5D27A 5EFXA 2KCJA 3HK0A 4K2OA 4MK0A 5DHFB 2GCJA 3ULCA 2P0FA 5J3TA 1UEFA 4XWXA 1ZC3B 4DXAB 2D9VA 3TO1A 1J0WA 3PEGA 3SUZA 2X18A 4YL8A 1XX0A 2J59M 4TYZA 2ELBA 2DKPA 2I5FA 3KZ1A 2QKLA 5D3WA 2N0YA 2E2XA 1PLSA 2LULA 1FHXA 1OY2A 5D3YA 1V88A 5C6RA 4CYEA 3BINA 3N7CA 1V5PA 2YS1A 3WYFB 4GMVA 5C5BA 2YSZA 2Y7BA 2LG1A 4DBBA 4EJNA 4GPTB 3ODOA 1V61A 2COCA 2VKIA 4YONA 5DHAB 1OMWA 4HAYB 2DX5A 5CLLB 4HAZB 1Y19B 2OTXA 4K2PA 2Z0OA 4F7HA 2QKMA 3FM8C 4PQ0A 1WG7A 1BTKA 1MKEA 2H7EA 2RNRB 1Z87A 5D3VA 1U2BA 2DTCA 1XODA 1WGUA 1MAIA 5HE2A 4F7GA 3FEHA 5DH9B 4K17A 2EJ8A 4HDOA 3A98B 2UZSA 1K5DB 2IFSA 1KZ7A 2HE7A 2D9YA 2EC1A 1XD4A 2Z0QA 3KSYA 2COFA 1IRSA 2J0JA 2EMTA 4CHJA 1WJ1A 1EAZA 4IFSA 2BCJA 2KUPA 5DIFB 1XR0B 1SGHA 4MT7A 1U27A 2AEHA 4KHOA 2I1JA 5LOPB 2DN6A 5JLJB 1PMSA 1DBHA 1TXDA 1OQNA 4F7UP 1GC6A 4CHMA 4DX90 5J3QA 2RVBB 1XKEA 4Z2NA 3P6AA 2D10A 2LKOA 5HE0A 1P3RA 4KAXB 2YS3A 4HAVB 4HAXB 2M14A 4EMOA 1ZM0A 4GXBA 2M38A 1FB8A 4KHAA 1V5UA 1M7EA 5J3YA 5C79A 1DDMA 2W2WA 3WA0A 3A8QA 2DHKA 3DXCA 4Z2MB 1X86A 1ZVRA 1MIZB 1Q67A 2UZRA 5HE3A 2K2UA 2W2XC 2MDXA 4A6KA 4HB4B 4H8SA 1GG3A 1U5DA 4A6FA 2H7DA 1RRPB 1UNQA 3OANA 3CIKA 5KQ1A 3SV1A 2ROZB 2G35A 1ZC4B 2D4QA 3SYXA 3DXEA 5D3XA 2P0HA 3FSSA 4WJ7A 2ZPYA 3GYPA 1ZSQA 4ZRKA 1B55A 2ROVA 2L1CA 3PSCA 2AL6A 1FOEA 1V89A 2DX1A 2K00A 5L81A 1UPRA 2R0DA 2CRFA 4BBKA 1KI1B 1KZGA 3F5RA 3KRXA 4P7IA 1H10A 1DROA 2V76A 1GC7A 2ELAA 2P0DA 1H4RA 1AQCA 3DXDA 3AU4A 2YT0A 4NY0A 1N3HA 2D2QA 2IYBA 2RUKB 2J0MA 4A5KA 3KY9A 3IVFA 4HDQA 4KHBB 2JP2A 2D11A 1X1FA 1LW3A 4WVFB 4HB2B 1UNRA 4PNKA 2XQNM 2KGXB 1NU2A 4HAWB 2NMBA 3PP2A 4DX8A 1E5WA 2DHIA 3O96A 3TFMA 1XCGA 1QC6A 3U7DA 3TVVA 3HW2B 2R09A 3PVUA 2YS5A 1MIXA 1PFJA 2DKQA 3ODXA 1FHOA 3GYOA 3HQCA 3ML4A 1DYNA 1I2HA 1NI2A 2I1KA 3X23A 1W1DA 5DI9B 2RSGA 4A6HA 1U5EA 2YT1A 2ADZA 5FI1A 2MKRA 4D0NB 4WSFA 2D9ZA 4IOYX 4GMXB 1Y5OA 1P6SA 2Q13A 2OQBA 2Z0PA 4B6HA 2J0KA 4ZRIA 4HAUB 5C5BB 2DYNA 3SNHA 3D8DA 1TQZA 2CY5A 2YVCA 3TW1A 1BAKA 2VSZA 1ISNA 3QWMA 1U5GA 2GCLA 1M7RA 1FGYA 1X1GA 4IAPA 4TKNA 3ZVRA 1X05A 1NTVA 2FJLA 3M1IB 3ULBA 2MWNB 2LOZA 1U5FA 4GN1A 3KRWA 1BTNA 3ZDTA 1I7AA 1EGXA 5KQ4A 2DLWA 2YF0A 3VOQA 2L2IA 2P8VA 1W1GA 1W1HA 3BJIA 2Y8FA 3VIAA 4HATB 1UNPA 3PVWA 2DA0A 1LB1A 2RLOA 1J19A 1WI1A 3QBVB 5CLQB 3PG7A 3MPXA 2UVMA 4HB3B 2HTHB 2EMSA 1K5GB 1BWNA 2CAYA 4HHVA 4L6EA 1UPQA 3V5WA 1QQGA 2K2JA 3TCAA 2D9WA 5JHHA 5HE1A 3SO6A 2W2XD 4GZUA 3PVLA 2GJYA 2DHJA 3ODWA 2NZ8B 3CXBB 5GOWB 1WGQA 2DYQA 1NTYA 4KVGB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1U29 A;  1MK9 B;  1DDW A;  2LYD A;  3PZD A;  5JP4 A;  3UZT A;  1MPH A;  2N23 A;  1SHC A;  1EVH A;  1WJM A;  2VRW B;  3MDB C;  1DDV A;  3U8Z A;  4ZRJ A;  3RCP A;  2RGN B;  1MK7 B;  4K81 A;  2COA A;  2CY4 A;  2GS0 A;  3NSU A;  3LJU X;  3F0W A;  5FI0 A;  1FGZ A;  5C16 A;  1EF1 A;  1P5T A;  3T06 A;  3D8E A;  4HB0 B;  2COD A;  3A8P A;  4EKU A;  2D9X A;  4C0A A;  1WVH A;  1TJ6 A;  3QIJ A;  1RJ2 A;  3AJ4 A;  2I5C A;  2Y8G A;  3P7Z A;  1X11 A;  4MY6 A;  2DFK A;  4A6F B;  5KCV A;  5LON B;  1FHW A;  2LOX A;  2PZ1 A;  1AWE A;  1FAO A;  5JHG A;  1V5M A;  2MFQ A;  3D8F A;  4NSW A;  3AU5 A;  4Y94 A;  3G9W A;  2YRY A;  5D27 A;  5EFX A;  2KCJ A;  3HK0 A;  4K2O A;  4MK0 A;  5DHF B;  2GCJ A;  3ULC A;  2P0F A;  5J3T A;  1UEF A;  4XWX A;  1ZC3 B;  4DXA B;  2D9V A;  3TO1 A;  1J0W A;  3PEG A;  3SUZ A;  2X18 A;  4YL8 A;  1XX0 A;  2J59 M;  4TYZ A;  2ELB A;  2DKP A;  2I5F A;  3KZ1 A;  2QKL A;  5D3W A;  2N0Y A;  2E2X A;  1PLS A;  2LUL A;  1FHX A;  1OY2 A;  5D3Y A;  1V88 A;  5C6R A;  4CYE A;  3BIN A;  3N7C A;  1V5P A;  2YS1 A;  3WYF B;  4GMV A;  5C5B A;  2YSZ A;  2Y7B A;  2LG1 A;  4DBB A;  4EJN A;  4GPT B;  3ODO A;  1V61 A;  2COC A;  2VKI A;  4YON A;  5DHA B;  1OMW A;  4HAY B;  2DX5 A;  5CLL B;  4HAZ B;  1Y19 B;  2OTX A;  4K2P A;  2Z0O A;  4F7H A;  2QKM A;  3FM8 C;  4PQ0 A;  1WG7 A;  1BTK A;  1MKE A;  2H7E A;  2RNR B;  1Z87 A;  5D3V A;  1U2B A;  2DTC A;  1XOD A;  1WGU A;  1MAI A;  5HE2 A;  4F7G A;  3FEH A;  5DH9 B;  4K17 A;  2EJ8 A;  4HDO A;  3A98 B;  2UZS A;  1K5D B;  2IFS A;  1KZ7 A;  2HE7 A;  2D9Y A;  2EC1 A;  1XD4 A;  2Z0Q A;  3KSY A;  2COF A;  1IRS A;  2J0J A;  2EMT A;  4CHJ A;  1WJ1 A;  1EAZ A;  4IFS A;  2BCJ A;  2KUP A;  5DIF B;  1XR0 B;  1SGH A;  4MT7 A;  1U27 A;  2AEH A;  4KHO A;  2I1J A;  5LOP B;  2DN6 A;  5JLJ B;  1PMS A;  1DBH A;  1TXD A;  1OQN A;  4F7U P;  1GC6 A;  4CHM A;  4DX9 0;  5J3Q A;  2RVB B;  1XKE A;  4Z2N A;  3P6A A;  2D10 A;  2LKO A;  5HE0 A;  1P3R A;  4KAX B;  2YS3 A;  4HAV B;  4HAX B;  2M14 A;  4EMO A;  1ZM0 A;  4GXB A;  2M38 A;  1FB8 A;  4KHA A;  1V5U A;  1M7E A;  5J3Y A;  5C79 A;  1DDM A;  2W2W A;  3WA0 A;  3A8Q A;  2DHK A;  3DXC A;  4Z2M B;  1X86 A;  1ZVR A;  1MIZ B;  1Q67 A;  2UZR A;  5HE3 A;  2K2U A;  2W2X C;  2MDX A;  4A6K A;  4HB4 B;  4H8S A;  1GG3 A;  1U5D A;  4A6F A;  2H7D A;  1RRP B;  1UNQ A;  3OAN A;  3CIK A;  5KQ1 A;  3SV1 A;  2ROZ B;  2G35 A;  1ZC4 B;  2D4Q A;  3SYX A;  3DXE A;  5D3X A;  2P0H A;  3FSS A;  4WJ7 A;  2ZPY A;  3GYP A;  1ZSQ A;  4ZRK A;  1B55 A;  2ROV A;  2L1C A;  3PSC A;  2AL6 A;  1FOE A;  1V89 A;  2DX1 A;  2K00 A;  5L81 A;  1UPR A;  2R0D A;  2CRF A;  4BBK A;  1KI1 B;  1KZG A;  3F5R A;  3KRX A;  4P7I A;  1H10 A;  1DRO A;  2V76 A;  1GC7 A;  2ELA A;  2P0D A;  1H4R A;  1AQC A;  3DXD A;  3AU4 A;  2YT0 A;  4NY0 A;  1N3H A;  2D2Q A;  2IYB A;  2RUK B;  2J0M A;  4A5K A;  3KY9 A;  3IVF A;  4HDQ A;  4KHB B;  2JP2 A;  2D11 A;  1X1F A;  1LW3 A;  4WVF B;  4HB2 B;  1UNR A;  4PNK A;  2XQN M;  2KGX B;  1NU2 A;  4HAW B;  2NMB A;  3PP2 A;  4DX8 A;  1E5W A;  2DHI A;  3O96 A;  3TFM A;  1XCG A;  1QC6 A;  3U7D A;  3TVV A;  3HW2 B;  2R09 A;  3PVU A;  2YS5 A;  1MIX A;  1PFJ A;  2DKQ A;  3ODX A;  1FHO A;  3GYO A;  3HQC A;  3ML4 A;  1DYN A;  1I2H A;  1NI2 A;  2I1K A;  3X23 A;  1W1D A;  5DI9 B;  2RSG A;  4A6H A;  1U5E A;  2YT1 A;  2ADZ A;  5FI1 A;  2MKR A;  4D0N B;  4WSF A;  2D9Z A;  4IOY X;  4GMX B;  1Y5O A;  1P6S A;  2Q13 A;  2OQB A;  2Z0P A;  4B6H A;  2J0K A;  4ZRI A;  4HAU B;  5C5B B;  2DYN A;  3SNH A;  3D8D A;  1TQZ A;  2CY5 A;  2YVC A;  3TW1 A;  1BAK A;  2VSZ A;  1ISN A;  3QWM A;  1U5G A;  2GCL A;  1M7R A;  1FGY A;  1X1G A;  4IAP A;  4TKN A;  3ZVR A;  1X05 A;  1NTV A;  2FJL A;  3M1I B;  3ULB A;  2MWN B;  2LOZ A;  1U5F A;  4GN1 A;  3KRW A;  1BTN A;  3ZDT A;  1I7A A;  1EGX A;  5KQ4 A;  2DLW A;  2YF0 A;  3VOQ A;  2L2I A;  2P8V A;  1W1G A;  1W1H A;  3BJI A;  2Y8F A;  3VIA A;  4HAT B;  1UNP A;  3PVW A;  2DA0 A;  1LB1 A;  2RLO A;  1J19 A;  1WI1 A;  3QBV B;  5CLQ B;  3PG7 A;  3MPX A;  2UVM A;  4HB3 B;  2HTH B;  2EMS A;  1K5G B;  1BWN A;  2CAY A;  4HHV A;  4L6E A;  1UPQ A;  3V5W A;  1QQG A;  2K2J A;  3TCA A;  2D9W A;  5JHH A;  5HE1 A;  3SO6 A;  2W2X D;  4GZU A;  3PVL A;  2GJY A;  2DHJ A;  3ODW A;  2NZ8 B;  3CXB B;  5GOW B;  1WGQ A;  2DYQ A;  1NTY A;  4KVG B; 
#chains in the Genus database with same CATH topology
 4CSQ A;  1U29 A;  1MK9 B;  1DDW A;  2LYD A;  3PZD A;  5JP4 A;  3UZT A;  1MPH A;  2R2Y A;  2N23 A;  1SHC A;  1EVH A;  1WJM A;  2VRW B;  3MDB C;  1DDV A;  3U8Z A;  4ZRJ A;  3RCP A;  2RGN B;  1MK7 B;  4K81 A;  2COA A;  2CY4 A;  2GS0 A;  3NSU A;  3U12 A;  3LJU X;  3F0W A;  5FI0 A;  1MI1 A;  1FGZ A;  5C16 A;  1EF1 A;  1P5T A;  3T06 A;  3D8E A;  4HB0 B;  2COD A;  3A8P A;  2KR0 A;  4EKU A;  2D9X A;  4C0A A;  1WVH A;  4KHB A;  1TJ6 A;  3QIJ A;  1RJ2 A;  3AJ4 A;  2I5C A;  3NWA A;  2Y8G A;  3P7Z A;  1X11 A;  4MY6 A;  2DFK A;  4A6F B;  5KCV A;  5LON B;  5I2M A;  1FHW A;  2LOX A;  2PZ1 A;  1AWE A;  4GOU A;  1FAO A;  5JHG A;  1V5M A;  2MFQ A;  3D8F A;  4NSW A;  3AU5 A;  4Y94 A;  3G9W A;  2YRY A;  3A58 A;  5D27 A;  5EFX A;  2KCJ A;  3HK0 A;  4K2O A;  4MK0 A;  5DHF B;  2GCJ A;  3ULC A;  2P0F A;  5J3T A;  1UEF A;  4XWX A;  1ZC3 B;  4DXA B;  2D9V A;  3TO1 A;  1J0W A;  3PEG A;  3SUZ A;  2X18 A;  4YL8 A;  1XX0 A;  2J59 M;  4TYZ A;  2ELB A;  2DKP A;  2I5F A;  3KZ1 A;  2QKL A;  5D3W A;  2N0Y A;  2E2X A;  1PLS A;  2LUL A;  3DCX A;  1FHX A;  1OY2 A;  5D3Y A;  1V88 A;  5C6R A;  4CYE A;  3BIN A;  3N7C A;  1V5P A;  2YS1 A;  2Z14 A;  3WYF B;  4GMV A;  5C5B A;  2YSZ A;  2Y7B A;  2LG1 A;  4DBB A;  4EJN A;  4GPT B;  3ODO A;  1V61 A;  2COC A;  2VKI A;  4YON A;  5DHA B;  1OMW A;  4HAY B;  2DX5 A;  5CLL B;  4HAZ B;  1Y19 B;  2OTX A;  4K2P A;  2Z0O A;  4F7H A;  2QKM A;  3FM8 C;  4PQ0 A;  1WG7 A;  1BTK A;  1MKE A;  2H7E A;  2RNR B;  1Z87 A;  2KIE A;  5D3V A;  1U2B A;  2DTC A;  2KUQ A;  2Z13 A;  1XOD A;  1WGU A;  1MAI A;  5HE2 A;  4F7G A;  3FEH A;  5DH9 B;  4L1R A;  4K17 A;  2EJ8 A;  4HDO A;  2K8E A;  3A98 B;  2UZS A;  1K5D B;  2IFS A;  1KZ7 A;  2HE7 A;  2D9Y A;  2EC1 A;  1XD4 A;  2Z0Q A;  2COF A;  2J0J A;  1IRS A;  3KSY A;  2EMT A;  4CHJ A;  1T77 A;  1WJ1 A;  1EAZ A;  2K49 A;  2BCJ A;  4IFS A;  2KUP A;  5DIF B;  1XR0 B;  1SGH A;  4MT7 A;  1U27 A;  2AEH A;  4KHO A;  2I1J A;  5LOP B;  2DN6 A;  5JLJ B;  1PMS A;  1DBH A;  1TXD A;  1OQN A;  4F7U P;  1GC6 A;  4CHM A;  4DX9 0;  4QJ5 B;  5J3Q A;  2RVB B;  1XKE A;  4Z2N A;  3P6A A;  2D10 A;  2LKO A;  5HE0 A;  1P3R A;  4KAX B;  2YS3 A;  4HAV B;  4HAX B;  2M14 A;  4EMO A;  1ZM0 A;  4GXB A;  2M38 A;  1FB8 A;  4KHA A;  3FVC A;  1V5U A;  1M7E A;  5J3Y A;  5C79 A;  1DDM A;  2W2W A;  4HSI A;  2FJU B;  3WA0 A;  3A8Q A;  2DHK A;  3DXC A;  4Z2M B;  1X86 A;  1ZVR A;  1MIZ B;  4OSN A;  1Q67 A;  2UZR A;  5M4Y B;  5HE3 A;  5I2S A;  2K2U A;  2W2X C;  2MDX A;  4A6K A;  4HB4 B;  4H8S A;  1GG3 A;  1U5D A;  4A6F A;  2H7D A;  1RRP B;  1UNQ A;  3OAN A;  3CIK A;  5KQ1 A;  3SV1 A;  2ROZ B;  2G35 A;  1ZC4 B;  2D4Q A;  3HSA A;  2YT2 A;  3SYX A;  3DXE A;  5D3X A;  2P0H A;  3FSS A;  4WJ7 A;  2ZPY A;  3GYP A;  1ZSQ A;  4ZRK A;  1B55 A;  2ROV A;  3NWF A;  2L1C A;  3PSC A;  2AL6 A;  1FOE A;  1V89 A;  2DX1 A;  2K00 A;  5L81 A;  1UPR A;  2R0D A;  2CRF A;  4QJ3 B;  4BBK A;  1KI1 B;  1KZG A;  3F5R A;  3KRX A;  3HIE A;  4DIX A;  4P7I A;  1H10 A;  1DRO A;  2V76 A;  4QJ4 B;  1GC7 A;  2ELA A;  2P0D A;  1H4R A;  1AQC A;  3DXD A;  3AU4 A;  2YT0 A;  4NY0 A;  1N3H A;  2D2Q A;  2IYB A;  2RUK B;  2J0M A;  4A5K A;  4QXA B;  3KY9 A;  3IVF A;  4HDQ A;  4KHB B;  2JP2 A;  2D11 A;  1X1F A;  1LW3 A;  4WVF B;  4HB2 B;  1UNR A;  4PNK A;  2XQN M;  2KGX B;  1NU2 A;  4HAW B;  2NMB A;  3PP2 A;  4DX8 A;  1E5W A;  2DHI A;  3O96 A;  3TFM A;  1XCG A;  1QC6 A;  3U7D A;  3TVV A;  3HW2 B;  2R09 A;  3PVU A;  2YS5 A;  1MIX A;  1PFJ A;  2DKQ A;  2GUM A;  3ODX A;  1FHO A;  3GYO A;  3HQC A;  3ML4 A;  1DYN A;  1I2H A;  1NI2 A;  2I1K A;  3NW8 A;  3X23 A;  1W1D A;  5DI9 B;  2RSG A;  4A6H A;  1U5E A;  2YT1 A;  2ADZ A;  3NWD A;  5FI1 A;  2MKR A;  4D0N B;  4OT1 A;  4WSF A;  4D6W A;  2D9Z A;  4IOY X;  4GMX B;  1Y5O A;  1P6S A;  2Q13 A;  1ZYI A;  2OQB A;  2Z0P A;  4B6H A;  2J0K A;  5IRS A;  4ZRI A;  4HAU B;  5C5B B;  2DYN A;  3SNH A;  3D8D A;  1TQZ A;  2CY5 A;  5LG4 B;  2YVC A;  3TW1 A;  1BAK A;  2VSZ A;  1ISN A;  3QWM A;  1U5G A;  2ZKM X;  2GCL A;  1M7R A;  1FGY A;  1X1G A;  4IAP A;  4TKN A;  3ZVR A;  1X05 A;  1NTV A;  2FJL A;  3M1I B;  3ULB A;  2MWN B;  2LOZ A;  1U5F A;  4GN1 A;  3KRW A;  1BTN A;  3ZDT A;  1I7A A;  1EGX A;  5KQ4 A;  2DLW A;  2YF0 A;  3VOQ A;  2L2I A;  3OHM B;  2P8V A;  3B77 A;  1W1G A;  1W1H A;  3BJI A;  2KIG A;  2Y8F A;  3VIA A;  4HAT B;  1UNP A;  3PVW A;  2DA0 A;  1LB1 A;  2RLO A;  1J19 A;  1WI1 A;  3QBV B;  5CLQ B;  3PG7 A;  3MPX A;  2RRF A;  2UVM A;  4HB3 B;  2HTH B;  2EMS A;  1K5G B;  1BWN A;  2CAY A;  2NBV A;  4HHV A;  4L6E A;  1UPQ A;  3V5W A;  1QQG A;  2K2J A;  3TCA A;  2D9W A;  5JHH A;  5HE1 A;  3SO6 A;  2W2X D;  4GNK B;  4GZU A;  3PVL A;  2GJY A;  2DHJ A;  3ODW A;  2NZ8 B;  3CXB B;  5GOW B;  1WGQ A;  2Z59 A;  2Z4D A;  2DYQ A;  1NTY A;  4KVG B; 
#chains in the Genus database with same CATH homology
 1U29 A;  1MK9 B;  1DDW A;  2LYD A;  3PZD A;  5JP4 A;  3UZT A;  1MPH A;  2N23 A;  1SHC A;  1EVH A;  1WJM A;  2VRW B;  3MDB C;  1DDV A;  3U8Z A;  4ZRJ A;  3RCP A;  2RGN B;  1MK7 B;  4K81 A;  2COA A;  2CY4 A;  2GS0 A;  3NSU A;  3LJU X;  3F0W A;  5FI0 A;  1FGZ A;  5C16 A;  1EF1 A;  1P5T A;  3T06 A;  3D8E A;  4HB0 B;  2COD A;  3A8P A;  4EKU A;  2D9X A;  4C0A A;  1WVH A;  1TJ6 A;  3QIJ A;  1RJ2 A;  3AJ4 A;  2I5C A;  2Y8G A;  3P7Z A;  1X11 A;  4MY6 A;  2DFK A;  4A6F B;  5KCV A;  5LON B;  1FHW A;  2LOX A;  2PZ1 A;  1AWE A;  1FAO A;  5JHG A;  1V5M A;  2MFQ A;  3D8F A;  4NSW A;  3AU5 A;  4Y94 A;  3G9W A;  2YRY A;  5D27 A;  5EFX A;  2KCJ A;  3HK0 A;  4K2O A;  4MK0 A;  5DHF B;  2GCJ A;  3ULC A;  2P0F A;  5J3T A;  1UEF A;  4XWX A;  1ZC3 B;  4DXA B;  2D9V A;  3TO1 A;  1J0W A;  3PEG A;  3SUZ A;  2X18 A;  4YL8 A;  1XX0 A;  2J59 M;  4TYZ A;  2ELB A;  2DKP A;  2I5F A;  3KZ1 A;  2QKL A;  5D3W A;  2N0Y A;  2E2X A;  1PLS A;  2LUL A;  1FHX A;  1OY2 A;  5D3Y A;  1V88 A;  5C6R A;  4CYE A;  3BIN A;  3N7C A;  1V5P A;  2YS1 A;  3WYF B;  4GMV A;  5C5B A;  2YSZ A;  2Y7B A;  2LG1 A;  4DBB A;  4EJN A;  4GPT B;  3ODO A;  1V61 A;  2COC A;  2VKI A;  4YON A;  5DHA B;  1OMW A;  4HAY B;  2DX5 A;  5CLL B;  4HAZ B;  1Y19 B;  2OTX A;  4K2P A;  2Z0O A;  4F7H A;  2QKM A;  3FM8 C;  4PQ0 A;  1WG7 A;  1BTK A;  1MKE A;  2H7E A;  2RNR B;  1Z87 A;  5D3V A;  1U2B A;  2DTC A;  1XOD A;  1WGU A;  1MAI A;  5HE2 A;  4F7G A;  3FEH A;  5DH9 B;  4K17 A;  2EJ8 A;  4HDO A;  3A98 B;  2UZS A;  1K5D B;  2IFS A;  1KZ7 A;  2HE7 A;  2D9Y A;  2EC1 A;  1XD4 A;  2Z0Q A;  3KSY A;  2COF A;  1IRS A;  2J0J A;  2EMT A;  4CHJ A;  1WJ1 A;  1EAZ A;  4IFS A;  2BCJ A;  2KUP A;  5DIF B;  1XR0 B;  1SGH A;  4MT7 A;  1U27 A;  2AEH A;  4KHO A;  2I1J A;  5LOP B;  2DN6 A;  5JLJ B;  1PMS A;  1DBH A;  1TXD A;  1OQN A;  4F7U P;  1GC6 A;  4CHM A;  4DX9 0;  5J3Q A;  2RVB B;  1XKE A;  4Z2N A;  3P6A A;  2D10 A;  2LKO A;  5HE0 A;  1P3R A;  4KAX B;  2YS3 A;  4HAV B;  4HAX B;  2M14 A;  4EMO A;  1ZM0 A;  4GXB A;  2M38 A;  1FB8 A;  4KHA A;  1V5U A;  1M7E A;  5J3Y A;  5C79 A;  1DDM A;  2W2W A;  3WA0 A;  3A8Q A;  2DHK A;  3DXC A;  4Z2M B;  1X86 A;  1ZVR A;  1MIZ B;  1Q67 A;  2UZR A;  5HE3 A;  2K2U A;  2W2X C;  2MDX A;  4A6K A;  4HB4 B;  4H8S A;  1GG3 A;  1U5D A;  4A6F A;  2H7D A;  1RRP B;  1UNQ A;  3OAN A;  3CIK A;  5KQ1 A;  3SV1 A;  2ROZ B;  2G35 A;  1ZC4 B;  2D4Q A;  3SYX A;  3DXE A;  5D3X A;  2P0H A;  3FSS A;  4WJ7 A;  2ZPY A;  3GYP A;  1ZSQ A;  4ZRK A;  1B55 A;  2ROV A;  2L1C A;  3PSC A;  2AL6 A;  1FOE A;  1V89 A;  2DX1 A;  2K00 A;  5L81 A;  1UPR A;  2R0D A;  2CRF A;  4BBK A;  1KI1 B;  1KZG A;  3F5R A;  3KRX A;  4P7I A;  1H10 A;  1DRO A;  2V76 A;  1GC7 A;  2ELA A;  2P0D A;  1H4R A;  1AQC A;  3DXD A;  3AU4 A;  2YT0 A;  4NY0 A;  1N3H A;  2D2Q A;  2IYB A;  2RUK B;  2J0M A;  4A5K A;  3KY9 A;  3IVF A;  4HDQ A;  4KHB B;  2JP2 A;  2D11 A;  1X1F A;  1LW3 A;  4WVF B;  4HB2 B;  1UNR A;  4PNK A;  2XQN M;  2KGX B;  1NU2 A;  4HAW B;  2NMB A;  3PP2 A;  4DX8 A;  1E5W A;  2DHI A;  3O96 A;  3TFM A;  1XCG A;  1QC6 A;  3U7D A;  3TVV A;  3HW2 B;  2R09 A;  3PVU A;  2YS5 A;  1MIX A;  1PFJ A;  2DKQ A;  3ODX A;  1FHO A;  3GYO A;  3HQC A;  3ML4 A;  1DYN A;  1I2H A;  1NI2 A;  2I1K A;  3X23 A;  1W1D A;  5DI9 B;  2RSG A;  4A6H A;  1U5E A;  2YT1 A;  2ADZ A;  5FI1 A;  2MKR A;  4D0N B;  4WSF A;  2D9Z A;  4IOY X;  4GMX B;  1Y5O A;  1P6S A;  2Q13 A;  2OQB A;  2Z0P A;  4B6H A;  2J0K A;  4ZRI A;  4HAU B;  5C5B B;  2DYN A;  3SNH A;  3D8D A;  1TQZ A;  2CY5 A;  2YVC A;  3TW1 A;  1BAK A;  2VSZ A;  1ISN A;  3QWM A;  1U5G A;  2GCL A;  1M7R A;  1FGY A;  1X1G A;  4IAP A;  4TKN A;  3ZVR A;  1X05 A;  1NTV A;  2FJL A;  3M1I B;  3ULB A;  2MWN B;  2LOZ A;  1U5F A;  4GN1 A;  3KRW A;  1BTN A;  3ZDT A;  1I7A A;  1EGX A;  5KQ4 A;  2DLW A;  2YF0 A;  3VOQ A;  2L2I A;  2P8V A;  1W1G A;  1W1H A;  3BJI A;  2Y8F A;  3VIA A;  4HAT B;  1UNP A;  3PVW A;  2DA0 A;  1LB1 A;  2RLO A;  1J19 A;  1WI1 A;  3QBV B;  5CLQ B;  3PG7 A;  3MPX A;  2UVM A;  4HB3 B;  2HTH B;  2EMS A;  1K5G B;  1BWN A;  2CAY A;  4HHV A;  4L6E A;  1UPQ A;  3V5W A;  1QQG A;  2K2J A;  3TCA A;  2D9W A;  5JHH A;  5HE1 A;  3SO6 A;  2W2X D;  4GZU A;  3PVL A;  2GJY A;  2DHJ A;  3ODW A;  2NZ8 B;  3CXB B;  5GOW B;  1WGQ A;  2DYQ A;  1NTY A;  4KVG B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...