2L2IA

Nmr structure of the complex between the tfb1 subunit of tfiih and the activation domain of eklf
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
115
structure length
115
Chain Sequence
PSHSGAAIFEKVSGIIAINEDVSPAELTWRSTDGDKVHTVVLSTIDKLQATPASSEKMMLRLIGKVDESKKRKDNEGNEVVPKPQRHMFSFNNRTVMDNIKMTLQQIISRYKDAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title NMR Structure of the complex between the Tfb1 subunit of TFIIH and the activation domain of EKLF
rcsb
source organism Saccharomyces cerevisiae s288c
molecule tags Transcription
molecule keywords RNA polymerase II transcription factor B subunit 1
total genus 16
structure length 115
sequence length 115
ec nomenclature
pdb deposition date 2010-08-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08567 PH_TFIIH TFIIH p62 subunit, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2l2iA00
5DHFB 1TJ6A 3PG7A 3VOQA 2CAYA 3ODOA 1XR0B 3UZTA 1N3HA 2EJ8A 5D3XA 4YL8A 4K2OA 2J0JA 3PEGA 4HAWB 4GN1A 4HATB 4HDQA 1M7EA 3PVLA 2DLWA 2QKLA 1X86A 2DX1A 4K81A 1BWNA 1FHWA 2NMBA 4KVGB 2VRWB 4DX90 1W1GA 4EJNA 5KCVA 1X05A 2KUPA 2G35A 2Y8FA 2HTHB 1XODA 3VIAA 1PLSA 3KRXA 4F7HA 2V76A 1QQGA 2OTXA 2LG1A 1BTNA 2YVCA 1KZGA 1U5DA 3D8EA 1XX0A 2GCJA 3TCAA 5HE0A 3ULBA 2N0YA 5J3QA 5CLQB 2UZRA 3FSSA 1EAZA 2JP2A 2AEHA 2RUKB 5D3VA 1IRSA 3WYFB 5D3WA 4KAXB 2K00A 2DTCA 1NU2A 4KHOA 1MK9B 3WA0A 2Q13A 2DFKA 1EGXA 4HAUB 3PP2A 2RSGA 1RJ2A 2YS5A 1OY2A 3DXEA 1U27A 2GCLA 1W1DA 1FHOA 1WI1A 2L1CA 2BCJA 3QIJA 2Z0QA 5LONB 2P0DA 4GZUA 2GS0A 2J0MA 4HDOA 1DDVA 4WJ7A 1WGUA 4PNKA 4HB3B 4D0NB 3X23A 4DXAB 2W2XD 5HE1A 4B6HA 1K5GB 3OANA 5J3TA 1P3RA 1P6SA 2EMTA 2H7DA 3LJUX 1WGQA 1UNRA 2D10A 1NTYA 1Y19B 2D9YA 2QKMA 4A6HA 3T06A 4HB2B 2D9ZA 3ZDTA 3ZVRA 2I5FA 5JHGA 3TW1A 4HAZB 1Q67A 3G9WA 1V89A 5C5BB 2DHJA 1MIZB 2R09A 1RRPB 2J59M 1MKEA 1K5DB 5DIFB 1H4RA 1BAKA 3O96A 3IVFA 3SNHA 2GJYA 2OQBA 4GMXB 3KY9A 1WJMA 2KCJA 2L2IA 2AL6A 3AJ4A 1PMSA 2UVMA 1BTKA 2DX5A 5L81A 3P6AA 4Y94A 1X11A 2LYDA 2P8VA 3KSYA 1TQZA 2D9WA 2RGNB 2P0FA 2YRYA 2K2JA 1V5PA 1U5GA 4KHBB 1TXDA 2Y7BA 1DYNA 4TKNA 4ZRJA 1DDMA 2VKIA 4K2PA 1ISNA 2MDXA 3FEHA 4IAPA 1WG7A 4YONA 2MKRA 2Z0PA 3PZDA 2ROVA 3D8FA 2CODA 1ZC3B 4A6FA 1GC6A 4TYZA 3HQCA 2YT0A 4HAXB 3A98B 2LOZA 1V5UA 2M14A 4HAVB 4CHMA 2CY4A 2DKPA 4NSWA 1U2BA 1MK7B 5GOWB 1UPQA 4A5KA 1SGHA 3U8ZA 4MK0A 4L6EA 1M7RA 1U5FA 3DXCA 3SYXA 5HE2A 5C79A 3F0WA 1LW3A 1UPRA 1MPHA 3A8QA 1H10A 2YS3A 4ZRKA 3SO6A 4A6KA 3PVUA 2I5CA 5D3YA 1B55A 2D9VA 5FI0A 1MIXA 3PSCA 2LKOA 5C16A 1GC7A 2ZPYA 3GYPA 4IFSA 2J0KA 2DN6A 4HB0B 2PZ1A 2Z0OA 4WSFA 1FB8A 1I7AA 2YS1A 2DA0A 3AU4A 4MY6A 3D8DA 4DBBA 2COFA 3SV1A 1I2HA 2D4QA 5FI1A 4C0AA 2YF0A 3TO1A 3NSUA 4Z2MB 3TVVA 2CY5A 3HK0A 2DYNA 2LULA 1Y5OA 4P7IA 4Z2NA 5C6RA 3M1IB 2RVBB 2EC1A 3ML4A 2IFSA 2XQNM 4PQ0A 1QC6A 1DROA 2YSZA 1UNQA 1KZ7A 2W2XC 1FOEA 1EVHA 1FGZA 3PVWA 1ZM0A 1KI1B 1FGYA 4DX8A 4KHAA 3F5RA 3KZ1A 5DHAB 1NTVA 2H7EA 4A6FB 1J19A 1U29A 5KQ4A 3P7ZA 2LOXA 3MPXA 2RNRB 3CXBB 2I1JA 5JP4A 2COCA 2D11A 3HW2B 4H8SA 1E5WA 1OQNA 1X1FA 1GG3A 5EFXA 2ELAA 3KRWA 4F7GA 2X18A 4HAYB 1FHXA 4IOYX 1U5EA 3N7CA 3QWMA 5LOPB 2MWNB 5D27A 1ZSQA 2UZSA 4WVFB 5HE3A 1WVHA 2RLOA 3A8PA 2P0HA 2N23A 1W1HA 3DXDA 1MAIA 3ODXA 2HE7A 2D9XA 2ELBA 2I1KA 3ODWA 4K17A 1ZVRA 2DHKA 2KGXB 3U7DA 2ADZA 1XKEA 4NY0A 5KQ1A 5C5BA 1V88A 2K2UA 3CIKA 1AQCA 1OMWA 4GXBA 4EMOA 4F7UP 1WJ1A 4CYEA 2NZ8B 2ROZB 3RCPA 1ZC4B 5DH9B 1PFJA 2DKQA 2MFQA 2IYBA 5JHHA 2YT1A 4GMVA 3SUZA 1XCGA 2CRFA 2Y8GA 5J3YA 5DI9B 1V5MA 5JLJB 3GYOA 3ULCA 3BJIA 5CLLB 3QBVB 2VSZA 3BINA 4CHJA 1NI2A 2DYQA 1X1GA 1SHCA 3TFMA 2M38A 4GPTB 1UEFA 2COAA 1LB1A 4MT7A 1V61A 4BBKA 3FM8C 1UNPA 2D2QA 2EMSA 1AWEA 4HHVA 1DBHA 2R0DA 1DDWA 1FAOA 1XD4A 4HB4B 3MDBC 1EF1A 2FJLA 1J0WA 4ZRIA 1Z87A 2W2WA 3V5WA 2DHIA 3AU5A 1P5TA 4XWXA 4EKUA 2E2XA
chains in the Genus database with same CATH superfamily
5DHFB 1TJ6A 3PG7A 3VOQA 2CAYA 3ODOA 1XR0B 3UZTA 1N3HA 2EJ8A 5D3XA 4YL8A 4K2OA 2J0JA 3PEGA 4HAWB 4GN1A 4HATB 4HDQA 1M7EA 3PVLA 2DLWA 2QKLA 1X86A 2DX1A 2KUQA 4K81A 1BWNA 1FHWA 2NMBA 4KVGB 2VRWB 4DX90 1W1GA 4EJNA 5KCVA 1X05A 2KUPA 2G35A 2Y8FA 2HTHB 1XODA 3VIAA 1PLSA 3KRXA 4F7HA 2V76A 1QQGA 5LG4B 2OTXA 2LG1A 1BTNA 2YVCA 1KZGA 1U5DA 3D8EA 1XX0A 2GCJA 3TCAA 5HE0A 3ULBA 2N0YA 5J3QA 5CLQB 2UZRA 3FSSA 2Z59A 1EAZA 2JP2A 2AEHA 2RUKB 5D3VA 1IRSA 4OT1A 3WYFB 5D3WA 4KAXB 2K00A 2DTCA 1NU2A 4KHOA 1MK9B 3WA0A 2Q13A 2DFKA 1EGXA 4HAUB 4KHBA 3PP2A 2RSGA 1RJ2A 2YS5A 1OY2A 3DXEA 1U27A 2GCLA 1W1DA 2R2YA 1FHOA 1WI1A 2L1CA 2BCJA 3QIJA 2Z0QA 5LONB 2FJUB 2P0DA 4GZUA 2GS0A 2J0MA 4HDOA 1DDVA 5I2MA 4WJ7A 1WGUA 4PNKA 4HB3B 4D0NB 5IRSA 3X23A 4DXAB 2W2XD 3B77A 5HE1A 4B6HA 1K5GB 3OANA 5J3TA 1P3RA 1P6SA 2EMTA 2H7DA 3LJUX 1WGQA 1UNRA 2D10A 1NTYA 1Y19B 2D9YA 2QKMA 3DCXA 3T06A 4HB2B 2D9ZA 4A6HA 3ZDTA 3ZVRA 2I5FA 5JHGA 3TW1A 4HAZB 1Q67A 3G9WA 1V89A 5C5BB 2DHJA 1MIZB 2R09A 1RRPB 2J59M 1MKEA 1K5DB 5DIFB 1H4RA 1BAKA 2K49A 2ZKMX 3O96A 3IVFA 3SNHA 2GJYA 2OQBA 4GMXB 3KY9A 1WJMA 2KCJA 2L2IA 3NWFA 2AL6A 3AJ4A 1PMSA 2UVMA 1BTKA 2DX5A 5L81A 3P6AA 4Y94A 1X11A 2LYDA 2P8VA 3KSYA 1TQZA 2D9WA 2RGNB 2P0FA 2YRYA 2K2JA 1V5PA 1U5GA 4KHBB 1TXDA 2Y7BA 1DYNA 4TKNA 4ZRJA 1DDMA 2VKIA 3HSAA 1ISNA 4K2PA 2MDXA 3FEHA 4IAPA 1WG7A 2KIGA 4YONA 2MKRA 2Z0PA 3PZDA 4HSIA 2ROVA 3D8FA 2CODA 1ZC3B 4A6FA 1GC6A 4TYZA 3HQCA 2YT0A 4HAXB 3A98B 2LOZA 1V5UA 2M14A 4HAVB 4CHMA 2CY4A 2DKPA 4NSWA 1U2BA 1MK7B 5GOWB 1UPQA 4A5KA 1SGHA 3U8ZA 4MK0A 4L6EA 2Z13A 1M7RA 4D6WA 1U5FA 3DXCA 3SYXA 5HE2A 5C79A 3F0WA 1LW3A 2K8EA 1UPRA 1MPHA 3A8QA 2KIEA 1H10A 2YS3A 4ZRKA 3SO6A 4A6KA 3PVUA 4QXAB 2YT2A 2KR0A 2I5CA 5D3YA 1B55A 2D9VA 5FI0A 1MIXA 3PSCA 2LKOA 5C16A 3U12A 1GC7A 2ZPYA 3GYPA 4IFSA 2J0KA 2DN6A 4HB0B 2PZ1A 2Z0OA 4WSFA 1FB8A 1I7AA 2YS1A 2DA0A 3OHMB 3AU4A 4MY6A 3D8DA 4DBBA 2COFA 3SV1A 1I2HA 2NBVA 2D4QA 5FI1A 4C0AA 2Z14A 2YF0A 3TO1A 3NSUA 4Z2MB 3TVVA 3A58A 2CY5A 3HK0A 2DYNA 2LULA 1Y5OA 4P7IA 4Z2NA 5C6RA 3M1IB 2RVBB 2EC1A 3ML4A 5M4YB 2IFSA 2XQNM 4PQ0A 1QC6A 1DROA 2YSZA 1UNQA 1KZ7A 2W2XC 1FOEA 1EVHA 1FGZA 3PVWA 1ZM0A 1KI1B 1FGYA 4DX8A 4KHAA 3F5RA 3KZ1A 5DHAB 1NTVA 2H7EA 4A6FB 1J19A 1U29A 5KQ4A 3P7ZA 3NWAA 4QJ4B 2LOXA 3MPXA 2RNRB 3CXBB 2I1JA 5JP4A 2COCA 2D11A 3HW2B 4L1RA 4H8SA 1E5WA 1OQNA 1X1FA 1GG3A 5EFXA 2ELAA 3KRWA 4F7GA 2X18A 4HAYB 1FHXA 4IOYX 4GOUA 1U5EA 3N7CA 3QWMA 5LOPB 2MWNB 5D27A 1ZSQA 4CSQA 2UZSA 4WVFB 5HE3A 1WVHA 2RLOA 3A8PA 2P0HA 2N23A 1W1HA 3DXDA 1ZYIA 1MAIA 3ODXA 2HE7A 2D9XA 2ELBA 2I1KA 3ODWA 4K17A 1ZVRA 2DHKA 2KGXB 3U7DA 2ADZA 3FVCA 1XKEA 4NY0A 5KQ1A 4QJ3B 5C5BA 1V88A 2K2UA 3CIKA 1AQCA 1OMWA 4GXBA 4EMOA 4F7UP 1WJ1A 4CYEA 2Z4DA 2NZ8B 2ROZB 3RCPA 1ZC4B 5DH9B 1PFJA 2DKQA 2MFQA 2IYBA 5JHHA 2YT1A 4GMVA 3SUZA 3NWDA 1XCGA 2CRFA 2Y8GA 5J3YA 5DI9B 1V5MA 4QJ5B 5JLJB 3GYOA 3ULCA 3NW8A 3BJIA 5CLLB 3QBVB 5I2SA 2VSZA 2RRFA 3BINA 4CHJA 1NI2A 2DYQA 1X1GA 1SHCA 3TFMA 2M38A 4GPTB 1UEFA 3HIEA 2COAA 1LB1A 4MT7A 1T77A 1V61A 4BBKA 3FM8C 1UNPA 2D2QA 2EMSA 2GUMA 1AWEA 4HHVA 1DBHA 2R0DA 1DDWA 4DIXA 1FAOA 1XD4A 4OSNA 4HB4B 3MDBC 1EF1A 2FJLA 1J0WA 4ZRIA 1Z87A 2W2WA 3V5WA 1MI1A 2DHIA 4GNKB 3AU5A 1P5TA 4XWXA 4EKUA 2E2XA
chains in the Genus database with same CATH topology
5DHFB 1TJ6A 3PG7A 3VOQA 2CAYA 3ODOA 1XR0B 3UZTA 1N3HA 2EJ8A 5D3XA 4YL8A 4K2OA 2J0JA 3PEGA 4HAWB 4GN1A 4HATB 4HDQA 1M7EA 3PVLA 2DLWA 2QKLA 1X86A 2DX1A 4K81A 1BWNA 1FHWA 2NMBA 4KVGB 2VRWB 4DX90 1W1GA 4EJNA 5KCVA 1X05A 2KUPA 2G35A 2Y8FA 2HTHB 1XODA 3VIAA 1PLSA 3KRXA 4F7HA 2V76A 1QQGA 2OTXA 2LG1A 1BTNA 2YVCA 1KZGA 1U5DA 3D8EA 1XX0A 2GCJA 3TCAA 5HE0A 3ULBA 2N0YA 5J3QA 5CLQB 2UZRA 3FSSA 1EAZA 2JP2A 2AEHA 2RUKB 5D3VA 1IRSA 3WYFB 5D3WA 4KAXB 2K00A 2DTCA 1NU2A 4KHOA 1MK9B 3WA0A 2Q13A 2DFKA 1EGXA 4HAUB 3PP2A 2RSGA 1RJ2A 2YS5A 1OY2A 3DXEA 1U27A 2GCLA 1W1DA 1FHOA 1WI1A 2L1CA 2BCJA 3QIJA 2Z0QA 5LONB 2P0DA 4GZUA 2GS0A 2J0MA 4HDOA 1DDVA 4WJ7A 1WGUA 4PNKA 4HB3B 4D0NB 3X23A 4DXAB 2W2XD 5HE1A 4B6HA 1K5GB 3OANA 5J3TA 1P3RA 1P6SA 2EMTA 2H7DA 3LJUX 1WGQA 1UNRA 2D10A 1NTYA 1Y19B 2D9YA 2QKMA 4A6HA 3T06A 4HB2B 2D9ZA 3ZDTA 3ZVRA 2I5FA 5JHGA 3TW1A 4HAZB 1Q67A 3G9WA 1V89A 5C5BB 2DHJA 1MIZB 2R09A 1RRPB 2J59M 1MKEA 1K5DB 5DIFB 1H4RA 1BAKA 3O96A 3IVFA 3SNHA 2GJYA 2OQBA 4GMXB 3KY9A 1WJMA 2KCJA 2L2IA 2AL6A 3AJ4A 1PMSA 2UVMA 1BTKA 2DX5A 5L81A 3P6AA 4Y94A 1X11A 2LYDA 2P8VA 3KSYA 1TQZA 2D9WA 2RGNB 2P0FA 2YRYA 2K2JA 1V5PA 1U5GA 4KHBB 1TXDA 2Y7BA 1DYNA 4TKNA 4ZRJA 1DDMA 2VKIA 4K2PA 1ISNA 2MDXA 3FEHA 4IAPA 1WG7A 4YONA 2MKRA 2Z0PA 3PZDA 2ROVA 3D8FA 2CODA 1ZC3B 4A6FA 1GC6A 4TYZA 3HQCA 2YT0A 4HAXB 3A98B 2LOZA 1V5UA 2M14A 4HAVB 4CHMA 2CY4A 2DKPA 4NSWA 1U2BA 1MK7B 5GOWB 1UPQA 4A5KA 1SGHA 3U8ZA 4MK0A 4L6EA 1M7RA 1U5FA 3DXCA 3SYXA 5HE2A 5C79A 3F0WA 1LW3A 1UPRA 1MPHA 3A8QA 1H10A 2YS3A 4ZRKA 3SO6A 4A6KA 3PVUA 2I5CA 5D3YA 1B55A 2D9VA 5FI0A 1MIXA 3PSCA 2LKOA 5C16A 1GC7A 2ZPYA 3GYPA 4IFSA 2J0KA 2DN6A 4HB0B 2PZ1A 2Z0OA 4WSFA 1FB8A 1I7AA 2YS1A 2DA0A 3AU4A 4MY6A 3D8DA 4DBBA 2COFA 3SV1A 1I2HA 2D4QA 5FI1A 4C0AA 2YF0A 3TO1A 3NSUA 4Z2MB 3TVVA 2CY5A 3HK0A 2DYNA 2LULA 1Y5OA 4P7IA 4Z2NA 5C6RA 3M1IB 2RVBB 2EC1A 3ML4A 2IFSA 2XQNM 4PQ0A 1QC6A 1DROA 2YSZA 1UNQA 1KZ7A 2W2XC 1FOEA 1EVHA 1FGZA 3PVWA 1ZM0A 1KI1B 1FGYA 4DX8A 4KHAA 3F5RA 3KZ1A 5DHAB 1NTVA 2H7EA 4A6FB 1J19A 1U29A 5KQ4A 3P7ZA 2LOXA 3MPXA 2RNRB 3CXBB 2I1JA 5JP4A 2COCA 2D11A 3HW2B 4H8SA 1E5WA 1OQNA 1X1FA 1GG3A 5EFXA 2ELAA 3KRWA 4F7GA 2X18A 4HAYB 1FHXA 4IOYX 1U5EA 3N7CA 3QWMA 5LOPB 2MWNB 5D27A 1ZSQA 2UZSA 4WVFB 5HE3A 1WVHA 2RLOA 3A8PA 2P0HA 2N23A 1W1HA 3DXDA 1MAIA 3ODXA 2HE7A 2D9XA 2ELBA 2I1KA 3ODWA 4K17A 1ZVRA 2DHKA 2KGXB 3U7DA 2ADZA 1XKEA 4NY0A 5KQ1A 5C5BA 1V88A 2K2UA 3CIKA 1AQCA 1OMWA 4GXBA 4EMOA 4F7UP 1WJ1A 4CYEA 2NZ8B 2ROZB 3RCPA 1ZC4B 5DH9B 1PFJA 2DKQA 2MFQA 2IYBA 5JHHA 2YT1A 4GMVA 3SUZA 1XCGA 2CRFA 2Y8GA 5J3YA 5DI9B 1V5MA 5JLJB 3GYOA 3ULCA 3BJIA 5CLLB 3QBVB 2VSZA 3BINA 4CHJA 1NI2A 2DYQA 1X1GA 1SHCA 3TFMA 2M38A 4GPTB 1UEFA 2COAA 1LB1A 4MT7A 1V61A 4BBKA 3FM8C 1UNPA 2D2QA 2EMSA 1AWEA 4HHVA 1DBHA 2R0DA 1DDWA 1FAOA 1XD4A 4HB4B 3MDBC 1EF1A 2FJLA 1J0WA 4ZRIA 1Z87A 2W2WA 3V5WA 2DHIA 3AU5A 1P5TA 4XWXA 4EKUA 2E2XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5DHF B;  1TJ6 A;  3PG7 A;  3VOQ A;  2CAY A;  3ODO A;  1XR0 B;  3UZT A;  1N3H A;  2EJ8 A;  5D3X A;  4YL8 A;  4K2O A;  2J0J A;  3PEG A;  4HAW B;  4GN1 A;  4HAT B;  4HDQ A;  1M7E A;  3PVL A;  2DLW A;  2QKL A;  1X86 A;  2DX1 A;  4K81 A;  1BWN A;  1FHW A;  2NMB A;  4KVG B;  2VRW B;  4DX9 0;  1W1G A;  4EJN A;  5KCV A;  1X05 A;  2KUP A;  2G35 A;  2Y8F A;  2HTH B;  1XOD A;  3VIA A;  1PLS A;  3KRX A;  4F7H A;  2V76 A;  1QQG A;  2OTX A;  2LG1 A;  1BTN A;  2YVC A;  1KZG A;  1U5D A;  3D8E A;  1XX0 A;  2GCJ A;  3TCA A;  5HE0 A;  3ULB A;  2N0Y A;  5J3Q A;  5CLQ B;  2UZR A;  3FSS A;  1EAZ A;  2JP2 A;  2AEH A;  2RUK B;  5D3V A;  1IRS A;  3WYF B;  5D3W A;  4KAX B;  2K00 A;  2DTC A;  1NU2 A;  4KHO A;  1MK9 B;  3WA0 A;  2Q13 A;  2DFK A;  1EGX A;  4HAU B;  3PP2 A;  2RSG A;  1RJ2 A;  2YS5 A;  1OY2 A;  3DXE A;  1U27 A;  2GCL A;  1W1D A;  1FHO A;  1WI1 A;  2L1C A;  2BCJ A;  3QIJ A;  2Z0Q A;  5LON B;  2P0D A;  4GZU A;  2GS0 A;  2J0M A;  4HDO A;  1DDV A;  4WJ7 A;  1WGU A;  4PNK A;  4HB3 B;  4D0N B;  3X23 A;  4DXA B;  2W2X D;  5HE1 A;  4B6H A;  1K5G B;  3OAN A;  5J3T A;  1P3R A;  1P6S A;  2EMT A;  2H7D A;  3LJU X;  1WGQ A;  1UNR A;  2D10 A;  1NTY A;  1Y19 B;  2D9Y A;  2QKM A;  4A6H A;  3T06 A;  4HB2 B;  2D9Z A;  3ZDT A;  3ZVR A;  2I5F A;  5JHG A;  3TW1 A;  4HAZ B;  1Q67 A;  3G9W A;  1V89 A;  5C5B B;  2DHJ A;  1MIZ B;  2R09 A;  1RRP B;  2J59 M;  1MKE A;  1K5D B;  5DIF B;  1H4R A;  1BAK A;  3O96 A;  3IVF A;  3SNH A;  2GJY A;  2OQB A;  4GMX B;  3KY9 A;  1WJM A;  2KCJ A;  2L2I A;  2AL6 A;  3AJ4 A;  1PMS A;  2UVM A;  1BTK A;  2DX5 A;  5L81 A;  3P6A A;  4Y94 A;  1X11 A;  2LYD A;  2P8V A;  3KSY A;  1TQZ A;  2D9W A;  2RGN B;  2P0F A;  2YRY A;  2K2J A;  1V5P A;  1U5G A;  4KHB B;  1TXD A;  2Y7B A;  1DYN A;  4TKN A;  4ZRJ A;  1DDM A;  2VKI A;  4K2P A;  1ISN A;  2MDX A;  3FEH A;  4IAP A;  1WG7 A;  4YON A;  2MKR A;  2Z0P A;  3PZD A;  2ROV A;  3D8F A;  2COD A;  1ZC3 B;  4A6F A;  1GC6 A;  4TYZ A;  3HQC A;  2YT0 A;  4HAX B;  3A98 B;  2LOZ A;  1V5U A;  2M14 A;  4HAV B;  4CHM A;  2CY4 A;  2DKP A;  4NSW A;  1U2B A;  1MK7 B;  5GOW B;  1UPQ A;  4A5K A;  1SGH A;  3U8Z A;  4MK0 A;  4L6E A;  1M7R A;  1U5F A;  3DXC A;  3SYX A;  5HE2 A;  5C79 A;  3F0W A;  1LW3 A;  1UPR A;  1MPH A;  3A8Q A;  1H10 A;  2YS3 A;  4ZRK A;  3SO6 A;  4A6K A;  3PVU A;  2I5C A;  5D3Y A;  1B55 A;  2D9V A;  5FI0 A;  1MIX A;  3PSC A;  2LKO A;  5C16 A;  1GC7 A;  2ZPY A;  3GYP A;  4IFS A;  2J0K A;  2DN6 A;  4HB0 B;  2PZ1 A;  2Z0O A;  4WSF A;  1FB8 A;  1I7A A;  2YS1 A;  2DA0 A;  3AU4 A;  4MY6 A;  3D8D A;  4DBB A;  2COF A;  3SV1 A;  1I2H A;  2D4Q A;  5FI1 A;  4C0A A;  2YF0 A;  3TO1 A;  3NSU A;  4Z2M B;  3TVV A;  2CY5 A;  3HK0 A;  2DYN A;  2LUL A;  1Y5O A;  4P7I A;  4Z2N A;  5C6R A;  3M1I B;  2RVB B;  2EC1 A;  3ML4 A;  2IFS A;  2XQN M;  4PQ0 A;  1QC6 A;  1DRO A;  2YSZ A;  1UNQ A;  1KZ7 A;  2W2X C;  1FOE A;  1EVH A;  1FGZ A;  3PVW A;  1ZM0 A;  1KI1 B;  1FGY A;  4DX8 A;  4KHA A;  3F5R A;  3KZ1 A;  5DHA B;  1NTV A;  2H7E A;  4A6F B;  1J19 A;  1U29 A;  5KQ4 A;  3P7Z A;  2LOX A;  3MPX A;  2RNR B;  3CXB B;  2I1J A;  5JP4 A;  2COC A;  2D11 A;  3HW2 B;  4H8S A;  1E5W A;  1OQN A;  1X1F A;  1GG3 A;  5EFX A;  2ELA A;  3KRW A;  4F7G A;  2X18 A;  4HAY B;  1FHX A;  4IOY X;  1U5E A;  3N7C A;  3QWM A;  5LOP B;  2MWN B;  5D27 A;  1ZSQ A;  2UZS A;  4WVF B;  5HE3 A;  1WVH A;  2RLO A;  3A8P A;  2P0H A;  2N23 A;  1W1H A;  3DXD A;  1MAI A;  3ODX A;  2HE7 A;  2D9X A;  2ELB A;  2I1K A;  3ODW A;  4K17 A;  1ZVR A;  2DHK A;  2KGX B;  3U7D A;  2ADZ A;  1XKE A;  4NY0 A;  5KQ1 A;  5C5B A;  1V88 A;  2K2U A;  3CIK A;  1AQC A;  1OMW A;  4GXB A;  4EMO A;  4F7U P;  1WJ1 A;  4CYE A;  2NZ8 B;  2ROZ B;  3RCP A;  1ZC4 B;  5DH9 B;  1PFJ A;  2DKQ A;  2MFQ A;  2IYB A;  5JHH A;  2YT1 A;  4GMV A;  3SUZ A;  1XCG A;  2CRF A;  2Y8G A;  5J3Y A;  5DI9 B;  1V5M A;  5JLJ B;  3GYO A;  3ULC A;  3BJI A;  5CLL B;  3QBV B;  2VSZ A;  3BIN A;  4CHJ A;  1NI2 A;  2DYQ A;  1X1G A;  1SHC A;  3TFM A;  2M38 A;  4GPT B;  1UEF A;  2COA A;  1LB1 A;  4MT7 A;  1V61 A;  4BBK A;  3FM8 C;  1UNP A;  2D2Q A;  2EMS A;  1AWE A;  4HHV A;  1DBH A;  2R0D A;  1DDW A;  1FAO A;  1XD4 A;  4HB4 B;  3MDB C;  1EF1 A;  2FJL A;  1J0W A;  4ZRI A;  1Z87 A;  2W2W A;  3V5W A;  2DHI A;  3AU5 A;  1P5T A;  4XWX A;  4EKU A;  2E2X A; 
#chains in the Genus database with same CATH topology
 5DHF B;  1TJ6 A;  3PG7 A;  3VOQ A;  2CAY A;  3ODO A;  1XR0 B;  3UZT A;  1N3H A;  2EJ8 A;  5D3X A;  4YL8 A;  4K2O A;  2J0J A;  3PEG A;  4HAW B;  4GN1 A;  4HAT B;  4HDQ A;  1M7E A;  3PVL A;  2DLW A;  2QKL A;  1X86 A;  2DX1 A;  2KUQ A;  4K81 A;  1BWN A;  1FHW A;  2NMB A;  4KVG B;  2VRW B;  4DX9 0;  1W1G A;  4EJN A;  5KCV A;  1X05 A;  2KUP A;  2G35 A;  2Y8F A;  2HTH B;  1XOD A;  3VIA A;  1PLS A;  3KRX A;  4F7H A;  2V76 A;  1QQG A;  5LG4 B;  2OTX A;  2LG1 A;  1BTN A;  2YVC A;  1KZG A;  1U5D A;  3D8E A;  1XX0 A;  2GCJ A;  3TCA A;  5HE0 A;  3ULB A;  2N0Y A;  5J3Q A;  5CLQ B;  2UZR A;  3FSS A;  2Z59 A;  1EAZ A;  2JP2 A;  2AEH A;  2RUK B;  5D3V A;  1IRS A;  4OT1 A;  3WYF B;  5D3W A;  4KAX B;  2K00 A;  2DTC A;  1NU2 A;  4KHO A;  1MK9 B;  3WA0 A;  2Q13 A;  2DFK A;  1EGX A;  4HAU B;  4KHB A;  3PP2 A;  2RSG A;  1RJ2 A;  2YS5 A;  1OY2 A;  3DXE A;  1U27 A;  2GCL A;  1W1D A;  2R2Y A;  1FHO A;  1WI1 A;  2L1C A;  2BCJ A;  3QIJ A;  2Z0Q A;  5LON B;  2FJU B;  2P0D A;  4GZU A;  2GS0 A;  2J0M A;  4HDO A;  1DDV A;  5I2M A;  4WJ7 A;  1WGU A;  4PNK A;  4HB3 B;  4D0N B;  5IRS A;  3X23 A;  4DXA B;  2W2X D;  3B77 A;  5HE1 A;  4B6H A;  1K5G B;  3OAN A;  5J3T A;  1P3R A;  1P6S A;  2EMT A;  2H7D A;  3LJU X;  1WGQ A;  1UNR A;  2D10 A;  1NTY A;  1Y19 B;  2D9Y A;  2QKM A;  3DCX A;  3T06 A;  4HB2 B;  2D9Z A;  4A6H A;  3ZDT A;  3ZVR A;  2I5F A;  5JHG A;  3TW1 A;  4HAZ B;  1Q67 A;  3G9W A;  1V89 A;  5C5B B;  2DHJ A;  1MIZ B;  2R09 A;  1RRP B;  2J59 M;  1MKE A;  1K5D B;  5DIF B;  1H4R A;  1BAK A;  2K49 A;  2ZKM X;  3O96 A;  3IVF A;  3SNH A;  2GJY A;  2OQB A;  4GMX B;  3KY9 A;  1WJM A;  2KCJ A;  2L2I A;  3NWF A;  2AL6 A;  3AJ4 A;  1PMS A;  2UVM A;  1BTK A;  2DX5 A;  5L81 A;  3P6A A;  4Y94 A;  1X11 A;  2LYD A;  2P8V A;  3KSY A;  1TQZ A;  2D9W A;  2RGN B;  2P0F A;  2YRY A;  2K2J A;  1V5P A;  1U5G A;  4KHB B;  1TXD A;  2Y7B A;  1DYN A;  4TKN A;  4ZRJ A;  1DDM A;  2VKI A;  3HSA A;  1ISN A;  4K2P A;  2MDX A;  3FEH A;  4IAP A;  1WG7 A;  2KIG A;  4YON A;  2MKR A;  2Z0P A;  3PZD A;  4HSI A;  2ROV A;  3D8F A;  2COD A;  1ZC3 B;  4A6F A;  1GC6 A;  4TYZ A;  3HQC A;  2YT0 A;  4HAX B;  3A98 B;  2LOZ A;  1V5U A;  2M14 A;  4HAV B;  4CHM A;  2CY4 A;  2DKP A;  4NSW A;  1U2B A;  1MK7 B;  5GOW B;  1UPQ A;  4A5K A;  1SGH A;  3U8Z A;  4MK0 A;  4L6E A;  2Z13 A;  1M7R A;  4D6W A;  1U5F A;  3DXC A;  3SYX A;  5HE2 A;  5C79 A;  3F0W A;  1LW3 A;  2K8E A;  1UPR A;  1MPH A;  3A8Q A;  2KIE A;  1H10 A;  2YS3 A;  4ZRK A;  3SO6 A;  4A6K A;  3PVU A;  4QXA B;  2YT2 A;  2KR0 A;  2I5C A;  5D3Y A;  1B55 A;  2D9V A;  5FI0 A;  1MIX A;  3PSC A;  2LKO A;  5C16 A;  3U12 A;  1GC7 A;  2ZPY A;  3GYP A;  4IFS A;  2J0K A;  2DN6 A;  4HB0 B;  2PZ1 A;  2Z0O A;  4WSF A;  1FB8 A;  1I7A A;  2YS1 A;  2DA0 A;  3OHM B;  3AU4 A;  4MY6 A;  3D8D A;  4DBB A;  2COF A;  3SV1 A;  1I2H A;  2NBV A;  2D4Q A;  5FI1 A;  4C0A A;  2Z14 A;  2YF0 A;  3TO1 A;  3NSU A;  4Z2M B;  3TVV A;  3A58 A;  2CY5 A;  3HK0 A;  2DYN A;  2LUL A;  1Y5O A;  4P7I A;  4Z2N A;  5C6R A;  3M1I B;  2RVB B;  2EC1 A;  3ML4 A;  5M4Y B;  2IFS A;  2XQN M;  4PQ0 A;  1QC6 A;  1DRO A;  2YSZ A;  1UNQ A;  1KZ7 A;  2W2X C;  1FOE A;  1EVH A;  1FGZ A;  3PVW A;  1ZM0 A;  1KI1 B;  1FGY A;  4DX8 A;  4KHA A;  3F5R A;  3KZ1 A;  5DHA B;  1NTV A;  2H7E A;  4A6F B;  1J19 A;  1U29 A;  5KQ4 A;  3P7Z A;  3NWA A;  4QJ4 B;  2LOX A;  3MPX A;  2RNR B;  3CXB B;  2I1J A;  5JP4 A;  2COC A;  2D11 A;  3HW2 B;  4L1R A;  4H8S A;  1E5W A;  1OQN A;  1X1F A;  1GG3 A;  5EFX A;  2ELA A;  3KRW A;  4F7G A;  2X18 A;  4HAY B;  1FHX A;  4IOY X;  4GOU A;  1U5E A;  3N7C A;  3QWM A;  5LOP B;  2MWN B;  5D27 A;  1ZSQ A;  4CSQ A;  2UZS A;  4WVF B;  5HE3 A;  1WVH A;  2RLO A;  3A8P A;  2P0H A;  2N23 A;  1W1H A;  3DXD A;  1ZYI A;  1MAI A;  3ODX A;  2HE7 A;  2D9X A;  2ELB A;  2I1K A;  3ODW A;  4K17 A;  1ZVR A;  2DHK A;  2KGX B;  3U7D A;  2ADZ A;  3FVC A;  1XKE A;  4NY0 A;  5KQ1 A;  4QJ3 B;  5C5B A;  1V88 A;  2K2U A;  3CIK A;  1AQC A;  1OMW A;  4GXB A;  4EMO A;  4F7U P;  1WJ1 A;  4CYE A;  2Z4D A;  2NZ8 B;  2ROZ B;  3RCP A;  1ZC4 B;  5DH9 B;  1PFJ A;  2DKQ A;  2MFQ A;  2IYB A;  5JHH A;  2YT1 A;  4GMV A;  3SUZ A;  3NWD A;  1XCG A;  2CRF A;  2Y8G A;  5J3Y A;  5DI9 B;  1V5M A;  4QJ5 B;  5JLJ B;  3GYO A;  3ULC A;  3NW8 A;  3BJI A;  5CLL B;  3QBV B;  5I2S A;  2VSZ A;  2RRF A;  3BIN A;  4CHJ A;  1NI2 A;  2DYQ A;  1X1G A;  1SHC A;  3TFM A;  2M38 A;  4GPT B;  1UEF A;  3HIE A;  2COA A;  1LB1 A;  4MT7 A;  1T77 A;  1V61 A;  4BBK A;  3FM8 C;  1UNP A;  2D2Q A;  2EMS A;  2GUM A;  1AWE A;  4HHV A;  1DBH A;  2R0D A;  1DDW A;  4DIX A;  1FAO A;  1XD4 A;  4OSN A;  4HB4 B;  3MDB C;  1EF1 A;  2FJL A;  1J0W A;  4ZRI A;  1Z87 A;  2W2W A;  3V5W A;  1MI1 A;  2DHI A;  4GNK B;  3AU5 A;  1P5T A;  4XWX A;  4EKU A;  2E2X A; 
#chains in the Genus database with same CATH homology
 5DHF B;  1TJ6 A;  3PG7 A;  3VOQ A;  2CAY A;  3ODO A;  1XR0 B;  3UZT A;  1N3H A;  2EJ8 A;  5D3X A;  4YL8 A;  4K2O A;  2J0J A;  3PEG A;  4HAW B;  4GN1 A;  4HAT B;  4HDQ A;  1M7E A;  3PVL A;  2DLW A;  2QKL A;  1X86 A;  2DX1 A;  4K81 A;  1BWN A;  1FHW A;  2NMB A;  4KVG B;  2VRW B;  4DX9 0;  1W1G A;  4EJN A;  5KCV A;  1X05 A;  2KUP A;  2G35 A;  2Y8F A;  2HTH B;  1XOD A;  3VIA A;  1PLS A;  3KRX A;  4F7H A;  2V76 A;  1QQG A;  2OTX A;  2LG1 A;  1BTN A;  2YVC A;  1KZG A;  1U5D A;  3D8E A;  1XX0 A;  2GCJ A;  3TCA A;  5HE0 A;  3ULB A;  2N0Y A;  5J3Q A;  5CLQ B;  2UZR A;  3FSS A;  1EAZ A;  2JP2 A;  2AEH A;  2RUK B;  5D3V A;  1IRS A;  3WYF B;  5D3W A;  4KAX B;  2K00 A;  2DTC A;  1NU2 A;  4KHO A;  1MK9 B;  3WA0 A;  2Q13 A;  2DFK A;  1EGX A;  4HAU B;  3PP2 A;  2RSG A;  1RJ2 A;  2YS5 A;  1OY2 A;  3DXE A;  1U27 A;  2GCL A;  1W1D A;  1FHO A;  1WI1 A;  2L1C A;  2BCJ A;  3QIJ A;  2Z0Q A;  5LON B;  2P0D A;  4GZU A;  2GS0 A;  2J0M A;  4HDO A;  1DDV A;  4WJ7 A;  1WGU A;  4PNK A;  4HB3 B;  4D0N B;  3X23 A;  4DXA B;  2W2X D;  5HE1 A;  4B6H A;  1K5G B;  3OAN A;  5J3T A;  1P3R A;  1P6S A;  2EMT A;  2H7D A;  3LJU X;  1WGQ A;  1UNR A;  2D10 A;  1NTY A;  1Y19 B;  2D9Y A;  2QKM A;  4A6H A;  3T06 A;  4HB2 B;  2D9Z A;  3ZDT A;  3ZVR A;  2I5F A;  5JHG A;  3TW1 A;  4HAZ B;  1Q67 A;  3G9W A;  1V89 A;  5C5B B;  2DHJ A;  1MIZ B;  2R09 A;  1RRP B;  2J59 M;  1MKE A;  1K5D B;  5DIF B;  1H4R A;  1BAK A;  3O96 A;  3IVF A;  3SNH A;  2GJY A;  2OQB A;  4GMX B;  3KY9 A;  1WJM A;  2KCJ A;  2L2I A;  2AL6 A;  3AJ4 A;  1PMS A;  2UVM A;  1BTK A;  2DX5 A;  5L81 A;  3P6A A;  4Y94 A;  1X11 A;  2LYD A;  2P8V A;  3KSY A;  1TQZ A;  2D9W A;  2RGN B;  2P0F A;  2YRY A;  2K2J A;  1V5P A;  1U5G A;  4KHB B;  1TXD A;  2Y7B A;  1DYN A;  4TKN A;  4ZRJ A;  1DDM A;  2VKI A;  4K2P A;  1ISN A;  2MDX A;  3FEH A;  4IAP A;  1WG7 A;  4YON A;  2MKR A;  2Z0P A;  3PZD A;  2ROV A;  3D8F A;  2COD A;  1ZC3 B;  4A6F A;  1GC6 A;  4TYZ A;  3HQC A;  2YT0 A;  4HAX B;  3A98 B;  2LOZ A;  1V5U A;  2M14 A;  4HAV B;  4CHM A;  2CY4 A;  2DKP A;  4NSW A;  1U2B A;  1MK7 B;  5GOW B;  1UPQ A;  4A5K A;  1SGH A;  3U8Z A;  4MK0 A;  4L6E A;  1M7R A;  1U5F A;  3DXC A;  3SYX A;  5HE2 A;  5C79 A;  3F0W A;  1LW3 A;  1UPR A;  1MPH A;  3A8Q A;  1H10 A;  2YS3 A;  4ZRK A;  3SO6 A;  4A6K A;  3PVU A;  2I5C A;  5D3Y A;  1B55 A;  2D9V A;  5FI0 A;  1MIX A;  3PSC A;  2LKO A;  5C16 A;  1GC7 A;  2ZPY A;  3GYP A;  4IFS A;  2J0K A;  2DN6 A;  4HB0 B;  2PZ1 A;  2Z0O A;  4WSF A;  1FB8 A;  1I7A A;  2YS1 A;  2DA0 A;  3AU4 A;  4MY6 A;  3D8D A;  4DBB A;  2COF A;  3SV1 A;  1I2H A;  2D4Q A;  5FI1 A;  4C0A A;  2YF0 A;  3TO1 A;  3NSU A;  4Z2M B;  3TVV A;  2CY5 A;  3HK0 A;  2DYN A;  2LUL A;  1Y5O A;  4P7I A;  4Z2N A;  5C6R A;  3M1I B;  2RVB B;  2EC1 A;  3ML4 A;  2IFS A;  2XQN M;  4PQ0 A;  1QC6 A;  1DRO A;  2YSZ A;  1UNQ A;  1KZ7 A;  2W2X C;  1FOE A;  1EVH A;  1FGZ A;  3PVW A;  1ZM0 A;  1KI1 B;  1FGY A;  4DX8 A;  4KHA A;  3F5R A;  3KZ1 A;  5DHA B;  1NTV A;  2H7E A;  4A6F B;  1J19 A;  1U29 A;  5KQ4 A;  3P7Z A;  2LOX A;  3MPX A;  2RNR B;  3CXB B;  2I1J A;  5JP4 A;  2COC A;  2D11 A;  3HW2 B;  4H8S A;  1E5W A;  1OQN A;  1X1F A;  1GG3 A;  5EFX A;  2ELA A;  3KRW A;  4F7G A;  2X18 A;  4HAY B;  1FHX A;  4IOY X;  1U5E A;  3N7C A;  3QWM A;  5LOP B;  2MWN B;  5D27 A;  1ZSQ A;  2UZS A;  4WVF B;  5HE3 A;  1WVH A;  2RLO A;  3A8P A;  2P0H A;  2N23 A;  1W1H A;  3DXD A;  1MAI A;  3ODX A;  2HE7 A;  2D9X A;  2ELB A;  2I1K A;  3ODW A;  4K17 A;  1ZVR A;  2DHK A;  2KGX B;  3U7D A;  2ADZ A;  1XKE A;  4NY0 A;  5KQ1 A;  5C5B A;  1V88 A;  2K2U A;  3CIK A;  1AQC A;  1OMW A;  4GXB A;  4EMO A;  4F7U P;  1WJ1 A;  4CYE A;  2NZ8 B;  2ROZ B;  3RCP A;  1ZC4 B;  5DH9 B;  1PFJ A;  2DKQ A;  2MFQ A;  2IYB A;  5JHH A;  2YT1 A;  4GMV A;  3SUZ A;  1XCG A;  2CRF A;  2Y8G A;  5J3Y A;  5DI9 B;  1V5M A;  5JLJ B;  3GYO A;  3ULC A;  3BJI A;  5CLL B;  3QBV B;  2VSZ A;  3BIN A;  4CHJ A;  1NI2 A;  2DYQ A;  1X1G A;  1SHC A;  3TFM A;  2M38 A;  4GPT B;  1UEF A;  2COA A;  1LB1 A;  4MT7 A;  1V61 A;  4BBK A;  3FM8 C;  1UNP A;  2D2Q A;  2EMS A;  1AWE A;  4HHV A;  1DBH A;  2R0D A;  1DDW A;  1FAO A;  1XD4 A;  4HB4 B;  3MDB C;  1EF1 A;  2FJL A;  1J0W A;  4ZRI A;  1Z87 A;  2W2W A;  3V5W A;  2DHI A;  3AU5 A;  1P5T A;  4XWX A;  4EKU A;  2E2X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...