2DN6A

Solution structure of the ph domain of kiaa0640 protein from human
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
115
structure length
115
Chain Sequence
GSSGSSGVLKQGYMMKKGHRRKNWTERWFVLKPNIISYYVSEDLKDKKGDILLDENCCVESLPDKDGKKCLFLVKCFDKTFEISASDKKKKQEWIQAIHSTIHLLKLGSSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords KIAA0640 protein
publication title Solution structure of the PH domain of KIAA0640 protein from human
rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 16
structure length 115
sequence length 115
ec nomenclature
pdb deposition date 2006-04-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00169 PH PH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2dn6A00
2UZRA 2MDXA 1V61A 4HAUB 2Y7BA 3GYOA 3ODOA 1MK7B 1NTYA 3PVLA 5J3TA 1FOEA 1DDWA 2VKIA 3U8ZA 1UEFA 2DYNA 1U5DA 3ULBA 2VRWB 3T06A 3FM8C 2X18A 2D11A 4GZUA 4EKUA 4F7GA 3ULCA 4CHJA 1MIZB 2DYQA 2KCJA 3LJUX 2LOXA 3X23A 2DX5A 2ADZA 1Y19B 2K2JA 1M7EA 2YT0A 1P3RA 1EAZA 3CXBB 4NSWA 5EFXA 3D8FA 2M14A 3TVVA 3ZVRA 1MKEA 5HE0A 2NZ8B 4A6FA 5KQ4A 1B55A 1RJ2A 1V5UA 1V88A 4KAXB 3O96A 2DA0A 4XWXA 3GYPA 5FI1A 5LOPB 3A98B 5DHFB 4GPTB 4HHVA 1V5MA 2DX1A 1DBHA 4HAVB 4K17A 2YS5A 4HB3B 3PZDA 4ZRKA 2BCJA 2EMSA 2Z0PA 3HQCA 1WGQA 2RGNB 4H8SA 2OTXA 2Y8GA 5KCVA 5HE1A 4Z2MB 3SNHA 5D3VA 4F7UP 3AJ4A 4EMOA 4F7HA 4TYZA 4GMVA 1ISNA 4MY6A 1XX0A 2W2XC 3DXCA 4L6EA 1X86A 2N0YA 5D3WA 2QKMA 3QBVB 3TFMA 2V76A 2UVMA 1BTKA 2MWNB 5C79A 3PVWA 2ELBA 1U29A 2GS0A 1FHWA 2DN6A 1P5TA 3HK0A 1PMSA 2M38A 2EJ8A 1U5EA 1FHXA 4BBKA 1I7AA 5KQ1A 5HE2A 2YT1A 3TW1A 2J59M 4PNKA 4HB4B 2DKPA 5DIFB 2DHKA 2FJLA 4A6KA 2LOZA 3KRWA 3F5RA 2J0JA 2H7DA 2CAYA 1WGUA 3MDBC 4HAWB 5GOWB 1PLSA 2P0FA 2AL6A 1UPQA 2COAA 2RUKB 1V5PA 5L81A 2DTCA 2D4QA 5FI0A 3OANA 1WI1A 1KZGA 2RLOA 3KRXA 1XCGA 2COCA 1QQGA 2NMBA 3G9WA 1TQZA 1FGZA 3D8DA 3CIKA 4Y94A 1GC7A 1H4RA 1Q67A 4A6FB 1U27A 1PFJA 2LG1A 2YRYA 3KY9A 2K00A 3PSCA 4D0NB 3SO6A 1BTNA 1W1DA 1UPRA 2I5FA 2CY5A 1J0WA 2D9ZA 1E5WA 4A5KA 1UNPA 1FAOA 2K2UA 1WG7A 2CRFA 4IAPA 2DHJA 2ZPYA 2LYDA 3NSUA 4HB2B 4B6HA 2MKRA 2RVBB 3N7CA 2DHIA 4EJNA 1NI2A 1N3HA 4KHAA 1MK9B 4GXBA 1KI1B 5DHAB 2RSGA 1QC6A 3VOQA 2JP2A 5DI9B 4HAXB 1XD4A 1FGYA 2D10A 1TJ6A 1J19A 2D9XA 4KHBB 5JHHA 1K5GB 1WVHA 1TXDA 2RNRB 2I1JA 4IFSA 4DX8A 3ML4A 3TCAA 4DXAB 1DYNA 1ZVRA 1X1GA 2DFKA 2I5CA 2QKLA 2DKQA 1OY2A 2H7EA 5D3XA 2UZSA 5LONB 1M7RA 4KHOA 1X11A 1DDVA 3WA0A 4HAZB 5J3QA 2P0HA 2CY4A 2R09A 2XQNM 1U5FA 1WJMA 1FB8A 4HATB 3WYFB 3HW2B 1ZSQA 3ZDTA 3QWMA 4HAYB 1KZ7A 1DDMA 1SGHA 1UNRA 5C5BB 1Z87A 5C16A 1ZM0A 2G35A 4C0AA 3A8PA 1BWNA 4KVGB 5C5BA 2YF0A 3SUZA 2KGXB 4DX90 1I2HA 5C6RA 2D9YA 3PVUA 3PG7A 2YS1A 2EMTA 5CLLB 4ZRJA 2N23A 3KSYA 4GN1A 5D27A 2AEHA 4P7IA 2J0KA 5JLJB 1NU2A 1RRPB 3DXEA 3IVFA 2Z0QA 4MK0A 4TKNA 1SHCA 1U5GA 2VSZA 3A8QA 3V5WA 4DBBA 3SYXA 4WSFA 2HE7A 2DLWA 4IOYX 2Y8FA 1XR0B 4MT7A 1OQNA 1X1FA 4CHMA 5D3YA 1XKEA 3M1IB 5HE3A 5JP4A 2D2QA 2W2XD 3U7DA 1MAIA 1UNQA 2COFA 2E2XA 3P7ZA 4K81A 1Y5OA 3FSSA 2HTHB 4WVFB 1BAKA 4ZRIA 2P8VA 2Q13A 1U2BA 1X05A 2YS3A 4YONA 1K5DB 1MPHA 3VIAA 1NTVA 4GMXB 2W2WA 2J0MA 2ELAA 2GCJA 2GJYA 1XODA 2LULA 1P6SA 2R0DA 4K2OA 2D9VA 3TO1A 3BINA 2KUPA 1OMWA 3PP2A 1LW3A 1FHOA 1LB1A 2MFQA 4CYEA 2ROVA 4PQ0A 3ODWA 2L2IA 1EGXA 3BJIA 2D9WA 3SV1A 3QIJA 3F0WA 2EC1A 3MPXA 1IRSA 3UZTA 3ODXA 4WJ7A 5CLQB 3RCPA 3AU4A 3AU5A 2LKOA 3KZ1A 2YSZA 1V89A 1MIXA 2CODA 2IYBA 3FEHA 2P0DA 4K2PA 1ZC3B 2I1KA 5JHGA 2IFSA 1WJ1A 1GC6A 2GCLA 2OQBA 1AQCA 1GG3A 4HDOA 2ROZB 1H10A 1EVHA 5DH9B 4NY0A 3D8EA 3PEGA 5J3YA 4A6HA 2Z0OA 3DXDA 1W1HA 1ZC4B 4HB0B 2L1CA 4Z2NA 1AWEA 2YVCA 4YL8A 4HDQA 1EF1A 1DROA 3P6AA 1W1GA 2PZ1A
chains in the Genus database with same CATH superfamily
2UZRA 2MDXA 1V61A 4HAUB 2Y7BA 3GYOA 3ODOA 1MK7B 1NTYA 3PVLA 5J3TA 1FOEA 1DDWA 2VKIA 3U8ZA 1UEFA 2DYNA 1U5DA 4OSNA 2VRWB 3T06A 3ULBA 3FM8C 2X18A 2D11A 4GZUA 4EKUA 4F7GA 3ULCA 4CHJA 1MIZB 2DYQA 2KCJA 3LJUX 2LOXA 3X23A 2DX5A 2ADZA 1Y19B 2YT2A 2K2JA 1M7EA 2YT0A 1P3RA 1EAZA 4QJ3B 3CXBB 4NSWA 2KIEA 5EFXA 3D8FA 2M14A 3TVVA 3ZVRA 1MKEA 5HE0A 2NZ8B 4A6FA 5KQ4A 1B55A 1RJ2A 1V5UA 1V88A 4KAXB 3O96A 2DA0A 4XWXA 3GYPA 5FI1A 5LOPB 3A98B 5DHFB 4GPTB 4HHVA 1V5MA 2DX1A 1DBHA 4HAVB 4K17A 2YS5A 2FJUB 4HB3B 3PZDA 4ZRKA 3U12A 2BCJA 2EMSA 2Z0PA 3HQCA 2K49A 1WGQA 2KUQA 2RGNB 4H8SA 2OTXA 2Y8GA 5KCVA 5HE1A 4Z2MB 3SNHA 5D3VA 4F7UP 3AJ4A 4EMOA 4F7HA 4TYZA 4GMVA 1ISNA 4MY6A 1XX0A 2W2XC 3DXCA 4L6EA 1X86A 2N0YA 4KHBA 5D3WA 2QKMA 4CSQA 3QBVB 3TFMA 2V76A 2UVMA 1BTKA 2MWNB 5C79A 3PVWA 2ELBA 1U29A 5IRSA 2GS0A 1FHWA 2DN6A 1P5TA 3NWFA 3HK0A 1PMSA 2M38A 2EJ8A 1U5EA 1FHXA 4BBKA 1I7AA 5KQ1A 5HE2A 2YT1A 3TW1A 3NWDA 4GNKB 2J59M 4PNKA 4HB4B 1ZYIA 2DKPA 5DIFB 2DHKA 2FJLA 3HIEA 4A6KA 2LOZA 3KRWA 3F5RA 2J0JA 2H7DA 2CAYA 1WGUA 3MDBC 4HAWB 5GOWB 1PLSA 4QJ5B 2P0FA 2AL6A 1T77A 1UPQA 3NW8A 2COAA 2RUKB 4OT1A 1V5PA 5L81A 2DTCA 2D4QA 5FI0A 3OANA 1WI1A 1KZGA 2RLOA 3KRXA 1XCGA 2COCA 1QQGA 2NMBA 3G9WA 1TQZA 1FGZA 3D8DA 3NWAA 3CIKA 4Y94A 1GC7A 1H4RA 1Q67A 4A6FB 1U27A 1PFJA 2LG1A 2YRYA 3KY9A 2Z4DA 2K00A 3PSCA 4D0NB 3SO6A 1BTNA 5I2MA 1W1DA 2R2YA 1UPRA 2I5FA 2CY5A 3HSAA 1J0WA 4GOUA 2D9ZA 1E5WA 4A5KA 2GUMA 1UNPA 1FAOA 2K2UA 1WG7A 2CRFA 4IAPA 2DHJA 2ZPYA 2LYDA 3NSUA 4HB2B 4B6HA 2MKRA 2RVBB 3N7CA 2DHIA 4EJNA 1NI2A 1N3HA 4KHAA 1MK9B 4GXBA 1KI1B 5DHAB 2RSGA 1QC6A 3VOQA 2JP2A 5DI9B 4HAXB 1XD4A 1FGYA 2D10A 1TJ6A 2Z14A 1J19A 2D9XA 4KHBB 4QJ4B 4DIXA 5JHHA 1K5GB 1WVHA 1TXDA 2RNRB 2I1JA 4IFSA 4DX8A 3ML4A 3TCAA 4DXAB 1DYNA 1ZVRA 1X1GA 2DFKA 1MI1A 2I5CA 2QKLA 2DKQA 1OY2A 2H7EA 3A58A 5D3XA 2UZSA 5LONB 1M7RA 3OHMB 2NBVA 4KHOA 1X11A 1DDVA 3WA0A 4HAZB 5J3QA 3DCXA 2P0HA 2CY4A 2R09A 2XQNM 1U5FA 1WJMA 1FB8A 4HATB 3WYFB 3HW2B 1ZSQA 3ZDTA 3QWMA 4HAYB 1KZ7A 1DDMA 1SGHA 1UNRA 5C5BB 1Z87A 5C16A 5M4YB 1ZM0A 2G35A 4C0AA 3A8PA 1BWNA 4KVGB 5C5BA 2YF0A 3SUZA 2Z59A 2KGXB 4DX90 5LG4B 1I2HA 2KIGA 2D9YA 5C6RA 3PVUA 3PG7A 2YS1A 2EMTA 2KR0A 5CLLB 4ZRJA 2N23A 3KSYA 4GN1A 5D27A 2AEHA 2RRFA 4P7IA 2J0KA 5JLJB 1NU2A 1RRPB 3DXEA 3IVFA 2Z0QA 4MK0A 4QXAB 4TKNA 1SHCA 1U5GA 2VSZA 3A8QA 3V5WA 5I2SA 4DBBA 3SYXA 4WSFA 2HE7A 2DLWA 4IOYX 2Y8FA 1XR0B 4MT7A 1OQNA 1X1FA 3B77A 4CHMA 5D3YA 1XKEA 3M1IB 2K8EA 5HE3A 5JP4A 2D2QA 2W2XD 3U7DA 1MAIA 2Z13A 1UNQA 2COFA 2E2XA 3P7ZA 4K81A 1Y5OA 3FSSA 2HTHB 4WVFB 1BAKA 4ZRIA 2P8VA 2Q13A 1U2BA 3FVCA 1X05A 2YS3A 4YONA 1K5DB 1MPHA 3VIAA 1NTVA 4GMXB 2W2WA 2J0MA 2ELAA 2GCJA 2GJYA 1XODA 2LULA 1P6SA 2R0DA 4K2OA 2D9VA 3TO1A 3BINA 2KUPA 1OMWA 3PP2A 1LW3A 1FHOA 1LB1A 2MFQA 4CYEA 2ROVA 4PQ0A 3ODWA 2L2IA 1EGXA 3BJIA 2D9WA 3SV1A 3QIJA 3F0WA 2EC1A 3MPXA 1IRSA 3UZTA 3ODXA 4WJ7A 5CLQB 3RCPA 3AU4A 3AU5A 2LKOA 3KZ1A 2YSZA 1V89A 1MIXA 2CODA 2IYBA 3FEHA 2P0DA 4K2PA 1ZC3B 2I1KA 4L1RA 5JHGA 2IFSA 1WJ1A 4HSIA 4D6WA 1GC6A 2GCLA 2OQBA 1AQCA 1GG3A 4HDOA 2ROZB 1H10A 1EVHA 5DH9B 4NY0A 3D8EA 3PEGA 2ZKMX 5J3YA 4A6HA 2Z0OA 3DXDA 1W1HA 1ZC4B 4HB0B 2L1CA 4Z2NA 1AWEA 2YVCA 4YL8A 4HDQA 1EF1A 1DROA 3P6AA 1W1GA 2PZ1A
chains in the Genus database with same CATH topology
2UZRA 2MDXA 1V61A 4HAUB 2Y7BA 3GYOA 3ODOA 1MK7B 1NTYA 3PVLA 5J3TA 1FOEA 1DDWA 2VKIA 3U8ZA 1UEFA 2DYNA 1U5DA 3ULBA 2VRWB 3T06A 3FM8C 2X18A 2D11A 4GZUA 4EKUA 4F7GA 3ULCA 4CHJA 1MIZB 2DYQA 2KCJA 3LJUX 2LOXA 3X23A 2DX5A 2ADZA 1Y19B 2K2JA 1M7EA 2YT0A 1P3RA 1EAZA 3CXBB 4NSWA 5EFXA 3D8FA 2M14A 3TVVA 3ZVRA 1MKEA 5HE0A 2NZ8B 4A6FA 5KQ4A 1B55A 1RJ2A 1V5UA 1V88A 4KAXB 3O96A 2DA0A 4XWXA 3GYPA 5FI1A 5LOPB 3A98B 5DHFB 4GPTB 4HHVA 1V5MA 2DX1A 1DBHA 4HAVB 4K17A 2YS5A 4HB3B 3PZDA 4ZRKA 2BCJA 2EMSA 2Z0PA 3HQCA 1WGQA 2RGNB 4H8SA 2OTXA 2Y8GA 5KCVA 5HE1A 4Z2MB 3SNHA 5D3VA 4F7UP 3AJ4A 4EMOA 4F7HA 4TYZA 4GMVA 1ISNA 4MY6A 1XX0A 2W2XC 3DXCA 4L6EA 1X86A 2N0YA 5D3WA 2QKMA 3QBVB 3TFMA 2V76A 2UVMA 1BTKA 2MWNB 5C79A 3PVWA 2ELBA 1U29A 2GS0A 1FHWA 2DN6A 1P5TA 3HK0A 1PMSA 2M38A 2EJ8A 1U5EA 1FHXA 4BBKA 1I7AA 5KQ1A 5HE2A 2YT1A 3TW1A 2J59M 4PNKA 4HB4B 2DKPA 5DIFB 2DHKA 2FJLA 4A6KA 2LOZA 3KRWA 3F5RA 2J0JA 2H7DA 2CAYA 1WGUA 3MDBC 4HAWB 5GOWB 1PLSA 2P0FA 2AL6A 1UPQA 2COAA 2RUKB 1V5PA 5L81A 2DTCA 2D4QA 5FI0A 3OANA 1WI1A 1KZGA 2RLOA 3KRXA 1XCGA 2COCA 1QQGA 2NMBA 3G9WA 1TQZA 1FGZA 3D8DA 3CIKA 4Y94A 1GC7A 1H4RA 1Q67A 4A6FB 1U27A 1PFJA 2LG1A 2YRYA 3KY9A 2K00A 3PSCA 4D0NB 3SO6A 1BTNA 1W1DA 1UPRA 2I5FA 2CY5A 1J0WA 2D9ZA 1E5WA 4A5KA 1UNPA 1FAOA 2K2UA 1WG7A 2CRFA 4IAPA 2DHJA 2ZPYA 2LYDA 3NSUA 4HB2B 4B6HA 2MKRA 2RVBB 3N7CA 2DHIA 4EJNA 1NI2A 1N3HA 4KHAA 1MK9B 4GXBA 1KI1B 5DHAB 2RSGA 1QC6A 3VOQA 2JP2A 5DI9B 4HAXB 1XD4A 1FGYA 2D10A 1TJ6A 1J19A 2D9XA 4KHBB 5JHHA 1K5GB 1WVHA 1TXDA 2RNRB 2I1JA 4IFSA 4DX8A 3ML4A 3TCAA 4DXAB 1DYNA 1ZVRA 1X1GA 2DFKA 2I5CA 2QKLA 2DKQA 1OY2A 2H7EA 5D3XA 2UZSA 5LONB 1M7RA 4KHOA 1X11A 1DDVA 3WA0A 4HAZB 5J3QA 2P0HA 2CY4A 2R09A 2XQNM 1U5FA 1WJMA 1FB8A 4HATB 3WYFB 3HW2B 1ZSQA 3ZDTA 3QWMA 4HAYB 1KZ7A 1DDMA 1SGHA 1UNRA 5C5BB 1Z87A 5C16A 1ZM0A 2G35A 4C0AA 3A8PA 1BWNA 4KVGB 5C5BA 2YF0A 3SUZA 2KGXB 4DX90 1I2HA 5C6RA 2D9YA 3PVUA 3PG7A 2YS1A 2EMTA 5CLLB 4ZRJA 2N23A 3KSYA 4GN1A 5D27A 2AEHA 4P7IA 2J0KA 5JLJB 1NU2A 1RRPB 3DXEA 3IVFA 2Z0QA 4MK0A 4TKNA 1SHCA 1U5GA 2VSZA 3A8QA 3V5WA 4DBBA 3SYXA 4WSFA 2HE7A 2DLWA 4IOYX 2Y8FA 1XR0B 4MT7A 1OQNA 1X1FA 4CHMA 5D3YA 1XKEA 3M1IB 5HE3A 5JP4A 2D2QA 2W2XD 3U7DA 1MAIA 1UNQA 2COFA 2E2XA 3P7ZA 4K81A 1Y5OA 3FSSA 2HTHB 4WVFB 1BAKA 4ZRIA 2P8VA 2Q13A 1U2BA 1X05A 2YS3A 4YONA 1K5DB 1MPHA 3VIAA 1NTVA 4GMXB 2W2WA 2J0MA 2ELAA 2GCJA 2GJYA 1XODA 2LULA 1P6SA 2R0DA 4K2OA 2D9VA 3TO1A 3BINA 2KUPA 1OMWA 3PP2A 1LW3A 1FHOA 1LB1A 2MFQA 4CYEA 2ROVA 4PQ0A 3ODWA 2L2IA 1EGXA 3BJIA 2D9WA 3SV1A 3QIJA 3F0WA 2EC1A 3MPXA 1IRSA 3UZTA 3ODXA 4WJ7A 5CLQB 3RCPA 3AU4A 3AU5A 2LKOA 3KZ1A 2YSZA 1V89A 1MIXA 2CODA 2IYBA 3FEHA 2P0DA 4K2PA 1ZC3B 2I1KA 5JHGA 2IFSA 1WJ1A 1GC6A 2GCLA 2OQBA 1AQCA 1GG3A 4HDOA 2ROZB 1H10A 1EVHA 5DH9B 4NY0A 3D8EA 3PEGA 5J3YA 4A6HA 2Z0OA 3DXDA 1W1HA 1ZC4B 4HB0B 2L1CA 4Z2NA 1AWEA 2YVCA 4YL8A 4HDQA 1EF1A 1DROA 3P6AA 1W1GA 2PZ1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2UZR A;  2MDX A;  1V61 A;  4HAU B;  2Y7B A;  3GYO A;  3ODO A;  1MK7 B;  1NTY A;  3PVL A;  5J3T A;  1FOE A;  1DDW A;  2VKI A;  3U8Z A;  1UEF A;  2DYN A;  1U5D A;  3ULB A;  2VRW B;  3T06 A;  3FM8 C;  2X18 A;  2D11 A;  4GZU A;  4EKU A;  4F7G A;  3ULC A;  4CHJ A;  1MIZ B;  2DYQ A;  2KCJ A;  3LJU X;  2LOX A;  3X23 A;  2DX5 A;  2ADZ A;  1Y19 B;  2K2J A;  1M7E A;  2YT0 A;  1P3R A;  1EAZ A;  3CXB B;  4NSW A;  5EFX A;  3D8F A;  2M14 A;  3TVV A;  3ZVR A;  1MKE A;  5HE0 A;  2NZ8 B;  4A6F A;  5KQ4 A;  1B55 A;  1RJ2 A;  1V5U A;  1V88 A;  4KAX B;  3O96 A;  2DA0 A;  4XWX A;  3GYP A;  5FI1 A;  5LOP B;  3A98 B;  5DHF B;  4GPT B;  4HHV A;  1V5M A;  2DX1 A;  1DBH A;  4HAV B;  4K17 A;  2YS5 A;  4HB3 B;  3PZD A;  4ZRK A;  2BCJ A;  2EMS A;  2Z0P A;  3HQC A;  1WGQ A;  2RGN B;  4H8S A;  2OTX A;  2Y8G A;  5KCV A;  5HE1 A;  4Z2M B;  3SNH A;  5D3V A;  4F7U P;  3AJ4 A;  4EMO A;  4F7H A;  4TYZ A;  4GMV A;  1ISN A;  4MY6 A;  1XX0 A;  2W2X C;  3DXC A;  4L6E A;  1X86 A;  2N0Y A;  5D3W A;  2QKM A;  3QBV B;  3TFM A;  2V76 A;  2UVM A;  1BTK A;  2MWN B;  5C79 A;  3PVW A;  2ELB A;  1U29 A;  2GS0 A;  1FHW A;  2DN6 A;  1P5T A;  3HK0 A;  1PMS A;  2M38 A;  2EJ8 A;  1U5E A;  1FHX A;  4BBK A;  1I7A A;  5KQ1 A;  5HE2 A;  2YT1 A;  3TW1 A;  2J59 M;  4PNK A;  4HB4 B;  2DKP A;  5DIF B;  2DHK A;  2FJL A;  4A6K A;  2LOZ A;  3KRW A;  3F5R A;  2J0J A;  2H7D A;  2CAY A;  1WGU A;  3MDB C;  4HAW B;  5GOW B;  1PLS A;  2P0F A;  2AL6 A;  1UPQ A;  2COA A;  2RUK B;  1V5P A;  5L81 A;  2DTC A;  2D4Q A;  5FI0 A;  3OAN A;  1WI1 A;  1KZG A;  2RLO A;  3KRX A;  1XCG A;  2COC A;  1QQG A;  2NMB A;  3G9W A;  1TQZ A;  1FGZ A;  3D8D A;  3CIK A;  4Y94 A;  1GC7 A;  1H4R A;  1Q67 A;  4A6F B;  1U27 A;  1PFJ A;  2LG1 A;  2YRY A;  3KY9 A;  2K00 A;  3PSC A;  4D0N B;  3SO6 A;  1BTN A;  1W1D A;  1UPR A;  2I5F A;  2CY5 A;  1J0W A;  2D9Z A;  1E5W A;  4A5K A;  1UNP A;  1FAO A;  2K2U A;  1WG7 A;  2CRF A;  4IAP A;  2DHJ A;  2ZPY A;  2LYD A;  3NSU A;  4HB2 B;  4B6H A;  2MKR A;  2RVB B;  3N7C A;  2DHI A;  4EJN A;  1NI2 A;  1N3H A;  4KHA A;  1MK9 B;  4GXB A;  1KI1 B;  5DHA B;  2RSG A;  1QC6 A;  3VOQ A;  2JP2 A;  5DI9 B;  4HAX B;  1XD4 A;  1FGY A;  2D10 A;  1TJ6 A;  1J19 A;  2D9X A;  4KHB B;  5JHH A;  1K5G B;  1WVH A;  1TXD A;  2RNR B;  2I1J A;  4IFS A;  4DX8 A;  3ML4 A;  3TCA A;  4DXA B;  1DYN A;  1ZVR A;  1X1G A;  2DFK A;  2I5C A;  2QKL A;  2DKQ A;  1OY2 A;  2H7E A;  5D3X A;  2UZS A;  5LON B;  1M7R A;  4KHO A;  1X11 A;  1DDV A;  3WA0 A;  4HAZ B;  5J3Q A;  2P0H A;  2CY4 A;  2R09 A;  2XQN M;  1U5F A;  1WJM A;  1FB8 A;  4HAT B;  3WYF B;  3HW2 B;  1ZSQ A;  3ZDT A;  3QWM A;  4HAY B;  1KZ7 A;  1DDM A;  1SGH A;  1UNR A;  5C5B B;  1Z87 A;  5C16 A;  1ZM0 A;  2G35 A;  4C0A A;  3A8P A;  1BWN A;  4KVG B;  5C5B A;  2YF0 A;  3SUZ A;  2KGX B;  4DX9 0;  1I2H A;  5C6R A;  2D9Y A;  3PVU A;  3PG7 A;  2YS1 A;  2EMT A;  5CLL B;  4ZRJ A;  2N23 A;  3KSY A;  4GN1 A;  5D27 A;  2AEH A;  4P7I A;  2J0K A;  5JLJ B;  1NU2 A;  1RRP B;  3DXE A;  3IVF A;  2Z0Q A;  4MK0 A;  4TKN A;  1SHC A;  1U5G A;  2VSZ A;  3A8Q A;  3V5W A;  4DBB A;  3SYX A;  4WSF A;  2HE7 A;  2DLW A;  4IOY X;  2Y8F A;  1XR0 B;  4MT7 A;  1OQN A;  1X1F A;  4CHM A;  5D3Y A;  1XKE A;  3M1I B;  5HE3 A;  5JP4 A;  2D2Q A;  2W2X D;  3U7D A;  1MAI A;  1UNQ A;  2COF A;  2E2X A;  3P7Z A;  4K81 A;  1Y5O A;  3FSS A;  2HTH B;  4WVF B;  1BAK A;  4ZRI A;  2P8V A;  2Q13 A;  1U2B A;  1X05 A;  2YS3 A;  4YON A;  1K5D B;  1MPH A;  3VIA A;  1NTV A;  4GMX B;  2W2W A;  2J0M A;  2ELA A;  2GCJ A;  2GJY A;  1XOD A;  2LUL A;  1P6S A;  2R0D A;  4K2O A;  2D9V A;  3TO1 A;  3BIN A;  2KUP A;  1OMW A;  3PP2 A;  1LW3 A;  1FHO A;  1LB1 A;  2MFQ A;  4CYE A;  2ROV A;  4PQ0 A;  3ODW A;  2L2I A;  1EGX A;  3BJI A;  2D9W A;  3SV1 A;  3QIJ A;  3F0W A;  2EC1 A;  3MPX A;  1IRS A;  3UZT A;  3ODX A;  4WJ7 A;  5CLQ B;  3RCP A;  3AU4 A;  3AU5 A;  2LKO A;  3KZ1 A;  2YSZ A;  1V89 A;  1MIX A;  2COD A;  2IYB A;  3FEH A;  2P0D A;  4K2P A;  1ZC3 B;  2I1K A;  5JHG A;  2IFS A;  1WJ1 A;  1GC6 A;  2GCL A;  2OQB A;  1AQC A;  1GG3 A;  4HDO A;  2ROZ B;  1H10 A;  1EVH A;  5DH9 B;  4NY0 A;  3D8E A;  3PEG A;  5J3Y A;  4A6H A;  2Z0O A;  3DXD A;  1W1H A;  1ZC4 B;  4HB0 B;  2L1C A;  4Z2N A;  1AWE A;  2YVC A;  4YL8 A;  4HDQ A;  1EF1 A;  1DRO A;  3P6A A;  1W1G A;  2PZ1 A; 
#chains in the Genus database with same CATH topology
 2UZR A;  2MDX A;  1V61 A;  4HAU B;  2Y7B A;  3GYO A;  3ODO A;  1MK7 B;  1NTY A;  3PVL A;  5J3T A;  1FOE A;  1DDW A;  2VKI A;  3U8Z A;  1UEF A;  2DYN A;  1U5D A;  4OSN A;  2VRW B;  3T06 A;  3ULB A;  3FM8 C;  2X18 A;  2D11 A;  4GZU A;  4EKU A;  4F7G A;  3ULC A;  4CHJ A;  1MIZ B;  2DYQ A;  2KCJ A;  3LJU X;  2LOX A;  3X23 A;  2DX5 A;  2ADZ A;  1Y19 B;  2YT2 A;  2K2J A;  1M7E A;  2YT0 A;  1P3R A;  1EAZ A;  4QJ3 B;  3CXB B;  4NSW A;  2KIE A;  5EFX A;  3D8F A;  2M14 A;  3TVV A;  3ZVR A;  1MKE A;  5HE0 A;  2NZ8 B;  4A6F A;  5KQ4 A;  1B55 A;  1RJ2 A;  1V5U A;  1V88 A;  4KAX B;  3O96 A;  2DA0 A;  4XWX A;  3GYP A;  5FI1 A;  5LOP B;  3A98 B;  5DHF B;  4GPT B;  4HHV A;  1V5M A;  2DX1 A;  1DBH A;  4HAV B;  4K17 A;  2YS5 A;  2FJU B;  4HB3 B;  3PZD A;  4ZRK A;  3U12 A;  2BCJ A;  2EMS A;  2Z0P A;  3HQC A;  2K49 A;  1WGQ A;  2KUQ A;  2RGN B;  4H8S A;  2OTX A;  2Y8G A;  5KCV A;  5HE1 A;  4Z2M B;  3SNH A;  5D3V A;  4F7U P;  3AJ4 A;  4EMO A;  4F7H A;  4TYZ A;  4GMV A;  1ISN A;  4MY6 A;  1XX0 A;  2W2X C;  3DXC A;  4L6E A;  1X86 A;  2N0Y A;  4KHB A;  5D3W A;  2QKM A;  4CSQ A;  3QBV B;  3TFM A;  2V76 A;  2UVM A;  1BTK A;  2MWN B;  5C79 A;  3PVW A;  2ELB A;  1U29 A;  5IRS A;  2GS0 A;  1FHW A;  2DN6 A;  1P5T A;  3NWF A;  3HK0 A;  1PMS A;  2M38 A;  2EJ8 A;  1U5E A;  1FHX A;  4BBK A;  1I7A A;  5KQ1 A;  5HE2 A;  2YT1 A;  3TW1 A;  3NWD A;  4GNK B;  2J59 M;  4PNK A;  4HB4 B;  1ZYI A;  2DKP A;  5DIF B;  2DHK A;  2FJL A;  3HIE A;  4A6K A;  2LOZ A;  3KRW A;  3F5R A;  2J0J A;  2H7D A;  2CAY A;  1WGU A;  3MDB C;  4HAW B;  5GOW B;  1PLS A;  4QJ5 B;  2P0F A;  2AL6 A;  1T77 A;  1UPQ A;  3NW8 A;  2COA A;  2RUK B;  4OT1 A;  1V5P A;  5L81 A;  2DTC A;  2D4Q A;  5FI0 A;  3OAN A;  1WI1 A;  1KZG A;  2RLO A;  3KRX A;  1XCG A;  2COC A;  1QQG A;  2NMB A;  3G9W A;  1TQZ A;  1FGZ A;  3D8D A;  3NWA A;  3CIK A;  4Y94 A;  1GC7 A;  1H4R A;  1Q67 A;  4A6F B;  1U27 A;  1PFJ A;  2LG1 A;  2YRY A;  3KY9 A;  2Z4D A;  2K00 A;  3PSC A;  4D0N B;  3SO6 A;  1BTN A;  5I2M A;  1W1D A;  2R2Y A;  1UPR A;  2I5F A;  2CY5 A;  3HSA A;  1J0W A;  4GOU A;  2D9Z A;  1E5W A;  4A5K A;  2GUM A;  1UNP A;  1FAO A;  2K2U A;  1WG7 A;  2CRF A;  4IAP A;  2DHJ A;  2ZPY A;  2LYD A;  3NSU A;  4HB2 B;  4B6H A;  2MKR A;  2RVB B;  3N7C A;  2DHI A;  4EJN A;  1NI2 A;  1N3H A;  4KHA A;  1MK9 B;  4GXB A;  1KI1 B;  5DHA B;  2RSG A;  1QC6 A;  3VOQ A;  2JP2 A;  5DI9 B;  4HAX B;  1XD4 A;  1FGY A;  2D10 A;  1TJ6 A;  2Z14 A;  1J19 A;  2D9X A;  4KHB B;  4QJ4 B;  4DIX A;  5JHH A;  1K5G B;  1WVH A;  1TXD A;  2RNR B;  2I1J A;  4IFS A;  4DX8 A;  3ML4 A;  3TCA A;  4DXA B;  1DYN A;  1ZVR A;  1X1G A;  2DFK A;  1MI1 A;  2I5C A;  2QKL A;  2DKQ A;  1OY2 A;  2H7E A;  3A58 A;  5D3X A;  2UZS A;  5LON B;  1M7R A;  3OHM B;  2NBV A;  4KHO A;  1X11 A;  1DDV A;  3WA0 A;  4HAZ B;  5J3Q A;  3DCX A;  2P0H A;  2CY4 A;  2R09 A;  2XQN M;  1U5F A;  1WJM A;  1FB8 A;  4HAT B;  3WYF B;  3HW2 B;  1ZSQ A;  3ZDT A;  3QWM A;  4HAY B;  1KZ7 A;  1DDM A;  1SGH A;  1UNR A;  5C5B B;  1Z87 A;  5C16 A;  5M4Y B;  1ZM0 A;  2G35 A;  4C0A A;  3A8P A;  1BWN A;  4KVG B;  5C5B A;  2YF0 A;  3SUZ A;  2Z59 A;  2KGX B;  4DX9 0;  5LG4 B;  1I2H A;  2KIG A;  2D9Y A;  5C6R A;  3PVU A;  3PG7 A;  2YS1 A;  2EMT A;  2KR0 A;  5CLL B;  4ZRJ A;  2N23 A;  3KSY A;  4GN1 A;  5D27 A;  2AEH A;  2RRF A;  4P7I A;  2J0K A;  5JLJ B;  1NU2 A;  1RRP B;  3DXE A;  3IVF A;  2Z0Q A;  4MK0 A;  4QXA B;  4TKN A;  1SHC A;  1U5G A;  2VSZ A;  3A8Q A;  3V5W A;  5I2S A;  4DBB A;  3SYX A;  4WSF A;  2HE7 A;  2DLW A;  4IOY X;  2Y8F A;  1XR0 B;  4MT7 A;  1OQN A;  1X1F A;  3B77 A;  4CHM A;  5D3Y A;  1XKE A;  3M1I B;  2K8E A;  5HE3 A;  5JP4 A;  2D2Q A;  2W2X D;  3U7D A;  1MAI A;  2Z13 A;  1UNQ A;  2COF A;  2E2X A;  3P7Z A;  4K81 A;  1Y5O A;  3FSS A;  2HTH B;  4WVF B;  1BAK A;  4ZRI A;  2P8V A;  2Q13 A;  1U2B A;  3FVC A;  1X05 A;  2YS3 A;  4YON A;  1K5D B;  1MPH A;  3VIA A;  1NTV A;  4GMX B;  2W2W A;  2J0M A;  2ELA A;  2GCJ A;  2GJY A;  1XOD A;  2LUL A;  1P6S A;  2R0D A;  4K2O A;  2D9V A;  3TO1 A;  3BIN A;  2KUP A;  1OMW A;  3PP2 A;  1LW3 A;  1FHO A;  1LB1 A;  2MFQ A;  4CYE A;  2ROV A;  4PQ0 A;  3ODW A;  2L2I A;  1EGX A;  3BJI A;  2D9W A;  3SV1 A;  3QIJ A;  3F0W A;  2EC1 A;  3MPX A;  1IRS A;  3UZT A;  3ODX A;  4WJ7 A;  5CLQ B;  3RCP A;  3AU4 A;  3AU5 A;  2LKO A;  3KZ1 A;  2YSZ A;  1V89 A;  1MIX A;  2COD A;  2IYB A;  3FEH A;  2P0D A;  4K2P A;  1ZC3 B;  2I1K A;  4L1R A;  5JHG A;  2IFS A;  1WJ1 A;  4HSI A;  4D6W A;  1GC6 A;  2GCL A;  2OQB A;  1AQC A;  1GG3 A;  4HDO A;  2ROZ B;  1H10 A;  1EVH A;  5DH9 B;  4NY0 A;  3D8E A;  3PEG A;  2ZKM X;  5J3Y A;  4A6H A;  2Z0O A;  3DXD A;  1W1H A;  1ZC4 B;  4HB0 B;  2L1C A;  4Z2N A;  1AWE A;  2YVC A;  4YL8 A;  4HDQ A;  1EF1 A;  1DRO A;  3P6A A;  1W1G A;  2PZ1 A; 
#chains in the Genus database with same CATH homology
 2UZR A;  2MDX A;  1V61 A;  4HAU B;  2Y7B A;  3GYO A;  3ODO A;  1MK7 B;  1NTY A;  3PVL A;  5J3T A;  1FOE A;  1DDW A;  2VKI A;  3U8Z A;  1UEF A;  2DYN A;  1U5D A;  3ULB A;  2VRW B;  3T06 A;  3FM8 C;  2X18 A;  2D11 A;  4GZU A;  4EKU A;  4F7G A;  3ULC A;  4CHJ A;  1MIZ B;  2DYQ A;  2KCJ A;  3LJU X;  2LOX A;  3X23 A;  2DX5 A;  2ADZ A;  1Y19 B;  2K2J A;  1M7E A;  2YT0 A;  1P3R A;  1EAZ A;  3CXB B;  4NSW A;  5EFX A;  3D8F A;  2M14 A;  3TVV A;  3ZVR A;  1MKE A;  5HE0 A;  2NZ8 B;  4A6F A;  5KQ4 A;  1B55 A;  1RJ2 A;  1V5U A;  1V88 A;  4KAX B;  3O96 A;  2DA0 A;  4XWX A;  3GYP A;  5FI1 A;  5LOP B;  3A98 B;  5DHF B;  4GPT B;  4HHV A;  1V5M A;  2DX1 A;  1DBH A;  4HAV B;  4K17 A;  2YS5 A;  4HB3 B;  3PZD A;  4ZRK A;  2BCJ A;  2EMS A;  2Z0P A;  3HQC A;  1WGQ A;  2RGN B;  4H8S A;  2OTX A;  2Y8G A;  5KCV A;  5HE1 A;  4Z2M B;  3SNH A;  5D3V A;  4F7U P;  3AJ4 A;  4EMO A;  4F7H A;  4TYZ A;  4GMV A;  1ISN A;  4MY6 A;  1XX0 A;  2W2X C;  3DXC A;  4L6E A;  1X86 A;  2N0Y A;  5D3W A;  2QKM A;  3QBV B;  3TFM A;  2V76 A;  2UVM A;  1BTK A;  2MWN B;  5C79 A;  3PVW A;  2ELB A;  1U29 A;  2GS0 A;  1FHW A;  2DN6 A;  1P5T A;  3HK0 A;  1PMS A;  2M38 A;  2EJ8 A;  1U5E A;  1FHX A;  4BBK A;  1I7A A;  5KQ1 A;  5HE2 A;  2YT1 A;  3TW1 A;  2J59 M;  4PNK A;  4HB4 B;  2DKP A;  5DIF B;  2DHK A;  2FJL A;  4A6K A;  2LOZ A;  3KRW A;  3F5R A;  2J0J A;  2H7D A;  2CAY A;  1WGU A;  3MDB C;  4HAW B;  5GOW B;  1PLS A;  2P0F A;  2AL6 A;  1UPQ A;  2COA A;  2RUK B;  1V5P A;  5L81 A;  2DTC A;  2D4Q A;  5FI0 A;  3OAN A;  1WI1 A;  1KZG A;  2RLO A;  3KRX A;  1XCG A;  2COC A;  1QQG A;  2NMB A;  3G9W A;  1TQZ A;  1FGZ A;  3D8D A;  3CIK A;  4Y94 A;  1GC7 A;  1H4R A;  1Q67 A;  4A6F B;  1U27 A;  1PFJ A;  2LG1 A;  2YRY A;  3KY9 A;  2K00 A;  3PSC A;  4D0N B;  3SO6 A;  1BTN A;  1W1D A;  1UPR A;  2I5F A;  2CY5 A;  1J0W A;  2D9Z A;  1E5W A;  4A5K A;  1UNP A;  1FAO A;  2K2U A;  1WG7 A;  2CRF A;  4IAP A;  2DHJ A;  2ZPY A;  2LYD A;  3NSU A;  4HB2 B;  4B6H A;  2MKR A;  2RVB B;  3N7C A;  2DHI A;  4EJN A;  1NI2 A;  1N3H A;  4KHA A;  1MK9 B;  4GXB A;  1KI1 B;  5DHA B;  2RSG A;  1QC6 A;  3VOQ A;  2JP2 A;  5DI9 B;  4HAX B;  1XD4 A;  1FGY A;  2D10 A;  1TJ6 A;  1J19 A;  2D9X A;  4KHB B;  5JHH A;  1K5G B;  1WVH A;  1TXD A;  2RNR B;  2I1J A;  4IFS A;  4DX8 A;  3ML4 A;  3TCA A;  4DXA B;  1DYN A;  1ZVR A;  1X1G A;  2DFK A;  2I5C A;  2QKL A;  2DKQ A;  1OY2 A;  2H7E A;  5D3X A;  2UZS A;  5LON B;  1M7R A;  4KHO A;  1X11 A;  1DDV A;  3WA0 A;  4HAZ B;  5J3Q A;  2P0H A;  2CY4 A;  2R09 A;  2XQN M;  1U5F A;  1WJM A;  1FB8 A;  4HAT B;  3WYF B;  3HW2 B;  1ZSQ A;  3ZDT A;  3QWM A;  4HAY B;  1KZ7 A;  1DDM A;  1SGH A;  1UNR A;  5C5B B;  1Z87 A;  5C16 A;  1ZM0 A;  2G35 A;  4C0A A;  3A8P A;  1BWN A;  4KVG B;  5C5B A;  2YF0 A;  3SUZ A;  2KGX B;  4DX9 0;  1I2H A;  5C6R A;  2D9Y A;  3PVU A;  3PG7 A;  2YS1 A;  2EMT A;  5CLL B;  4ZRJ A;  2N23 A;  3KSY A;  4GN1 A;  5D27 A;  2AEH A;  4P7I A;  2J0K A;  5JLJ B;  1NU2 A;  1RRP B;  3DXE A;  3IVF A;  2Z0Q A;  4MK0 A;  4TKN A;  1SHC A;  1U5G A;  2VSZ A;  3A8Q A;  3V5W A;  4DBB A;  3SYX A;  4WSF A;  2HE7 A;  2DLW A;  4IOY X;  2Y8F A;  1XR0 B;  4MT7 A;  1OQN A;  1X1F A;  4CHM A;  5D3Y A;  1XKE A;  3M1I B;  5HE3 A;  5JP4 A;  2D2Q A;  2W2X D;  3U7D A;  1MAI A;  1UNQ A;  2COF A;  2E2X A;  3P7Z A;  4K81 A;  1Y5O A;  3FSS A;  2HTH B;  4WVF B;  1BAK A;  4ZRI A;  2P8V A;  2Q13 A;  1U2B A;  1X05 A;  2YS3 A;  4YON A;  1K5D B;  1MPH A;  3VIA A;  1NTV A;  4GMX B;  2W2W A;  2J0M A;  2ELA A;  2GCJ A;  2GJY A;  1XOD A;  2LUL A;  1P6S A;  2R0D A;  4K2O A;  2D9V A;  3TO1 A;  3BIN A;  2KUP A;  1OMW A;  3PP2 A;  1LW3 A;  1FHO A;  1LB1 A;  2MFQ A;  4CYE A;  2ROV A;  4PQ0 A;  3ODW A;  2L2I A;  1EGX A;  3BJI A;  2D9W A;  3SV1 A;  3QIJ A;  3F0W A;  2EC1 A;  3MPX A;  1IRS A;  3UZT A;  3ODX A;  4WJ7 A;  5CLQ B;  3RCP A;  3AU4 A;  3AU5 A;  2LKO A;  3KZ1 A;  2YSZ A;  1V89 A;  1MIX A;  2COD A;  2IYB A;  3FEH A;  2P0D A;  4K2P A;  1ZC3 B;  2I1K A;  5JHG A;  2IFS A;  1WJ1 A;  1GC6 A;  2GCL A;  2OQB A;  1AQC A;  1GG3 A;  4HDO A;  2ROZ B;  1H10 A;  1EVH A;  5DH9 B;  4NY0 A;  3D8E A;  3PEG A;  5J3Y A;  4A6H A;  2Z0O A;  3DXD A;  1W1H A;  1ZC4 B;  4HB0 B;  2L1C A;  4Z2N A;  1AWE A;  2YVC A;  4YL8 A;  4HDQ A;  1EF1 A;  1DRO A;  3P6A A;  1W1G A;  2PZ1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...