2DN6A

Solution structure of the ph domain of kiaa0640 protein from human
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
115
structure length
115
Chain Sequence
GSSGSSGVLKQGYMMKKGHRRKNWTERWFVLKPNIISYYVSEDLKDKKGDILLDENCCVESLPDKDGKKCLFLVKCFDKTFEISASDKKKKQEWIQAIHSTIHLLKLGSSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the PH domain of KIAA0640 protein from human
rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords KIAA0640 protein
total genus 16
structure length 115
sequence length 115
ec nomenclature
pdb deposition date 2006-04-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00169 PH PH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2dn6A00
5J3QA 5JHHA 1W1GA 3PVWA 4DBBA 2PZ1A 2J0MA 2P0HA 4CHMA 5DHAB 2JP2A 2W2XC 1W1HA 1GC7A 2LOXA 5D27A 2D9XA 1B55A 2M14A 1MIXA 4K2PA 4KHBB 3ODOA 3QWMA 1DDWA 2I5FA 1KZGA 2I1JA 3VOQA 2I5CA 4A6FB 2UVMA 1MAIA 5FI0A 1U27A 4ZRIA 5KCVA 1UNPA 2RNRB 4WVFB 3P6AA 1PFJA 1M7RA 3TCAA 4HDOA 3WYFB 1DDMA 3V5WA 5LOPB 3D8DA 5CLQB 5J3YA 1FHOA 2DN6A 2COCA 2AEHA 2H7EA 5C6RA 1N3HA 1FAOA 3HW2B 1V61A 2YS1A 1OY2A 3DXDA 4GN1A 2E2XA 2FJLA 4WSFA 1BTKA 4HAYB 3T06A 2N0YA 2R0DA 1I7AA 2Y8FA 1ISNA 4XWXA 2J59M 1X1GA 2LYDA 1MK7B 3N7CA 4K17A 4MT7A 1X1FA 5L81A 1XR0B 3BJIA 2Y8GA 2RGNB 2ROZB 2ADZA 5KQ1A 1FGYA 2HE7A 1IRSA 5CLLB 4P7IA 1P6SA 2DX5A 1PLSA 5JP4A 2P8VA 1J0WA 4Y94A 5C5BA 4EKUA 5FI1A 3TW1A 3U8ZA 2LULA 4HAZB 1U5EA 3HQCA 1SGHA 1WVHA 1WGUA 3ZDTA 1NTVA 3P7ZA 2K2UA 4F7GA 2Z0OA 2W2WA 3FSSA 2YT0A 1K5DB 2D9WA 3KSYA 2MKRA 2HTHB 4BBKA 1P3RA 1UNRA 4KAXB 4HAWB 1EAZA 3ML4A 2DHJA 1EGXA 3KRXA 3VIAA 3FEHA 3KZ1A 2J0KA 1TJ6A 2ROVA 4IAPA 1V5PA 2OQBA 2Y7BA 4HHVA 5LONB 4MK0A 4Z2NA 1WG7A 4ZRJA 4K2OA 2D11A 2ELAA 2P0DA 4DX8A 1ZC4B 4HAUB 1SHCA 3DXCA 3OANA 1UPQA 3SO6A 1MKEA 5GOWB 3PZDA 1GG3A 4A6KA 2VKIA 1RRPB 2N23A 1P5TA 4GMVA 2D9VA 3ULCA 1U5DA 1MPHA 2DHKA 1ZSQA 4DXAB 3PP2A 2AL6A 3AU5A 3PEGA 5D3WA 4A6FA 2L1CA 1V88A 4WJ7A 5C79A 4YONA 1UNQA 1OQNA 1Q67A 2NMBA 1MK9B 3SV1A 2YVCA 3LJUX 4PQ0A 4Z2MB 1DBHA 1DDVA 3DXEA 4IFSA 5JHGA 2CAYA 3AJ4A 3FM8C 5HE1A 2LG1A 3PSCA 2YS3A 1DYNA 4HB4B 1K5GB 2OTXA 1WGQA 2LKOA 3SNHA 2COAA 1E5WA 3TO1A 1XCGA 3SUZA 1UEFA 3NSUA 1KI1B 5JLJB 2GCLA 1BWNA 1ZC3B 3ULBA 1KZ7A 2D9YA 3ODXA 4A5KA 3D8EA 2DHIA 4GZUA 1WJ1A 1W1DA 3AU4A 5C16A 1TQZA 1U2BA 3QBVB 3UZTA 2RVBB 3O96A 4F7HA 2LOZA 5KQ4A 2VSZA 2RSGA 3CIKA 1H10A 4EJNA 2EMSA 1OMWA 1FGZA 1XX0A 3IVFA 1MIZB 4HDQA 5HE3A 1BAKA 4KVGB 5J3TA 4GMXB 2BCJA 2YF0A 1U5GA 3MDBC 1V89A 2L2IA 2MDXA 4K81A 5DH9B 1EF1A 2VRWB 4F7UP 4HATB 3KY9A 3QIJA 3PVUA 2K2JA 3CXBB 1XD4A 4ZRKA 1Z87A 2ELBA 4MY6A 4GPTB 2DFKA 4HAXB 3F0WA 4IOYX 4CHJA 2KCJA 4A6HA 2YRYA 1X11A 2DKQA 2D9ZA 4D0NB 4HB0B 4YL8A 4PNKA 4HB2B 1Y19B 1ZVRA 2I1KA 4H8SA 2QKLA 2IYBA 2RLOA 3D8FA 2DX1A 3F5RA 3PVLA 2R09A 1NTYA 4CYEA 1LB1A 2YSZA 4L6EA 2CODA 2CRFA 5D3XA 1TXDA 3ZVRA 3U7DA 2CY4A 1J19A 4TYZA 2M38A 3A8PA 4KHAA 3GYOA 2MWNB 4NSWA 2IFSA 2RUKB 4DX90 1XKEA 2P0FA 3SYXA 2X18A 1QC6A 1M7EA 5D3VA 1U29A 1DROA 1FHXA 1QQGA 2XQNM 1U5FA 2G35A 2D2QA 4HB3B 1NI2A 2ZPYA 1RJ2A 2YT1A 2NZ8B 5D3YA 3WA0A 4KHOA 1XODA 2CY5A 2DTCA 2KGXB 1X05A 1I2HA 5EFXA 2W2XD 3KRWA 1BTNA 1V5UA 1GC6A 1FB8A 3ODWA 3PG7A 2GJYA 1ZM0A 2UZSA 5HE2A 4EMOA 2K00A 2QKMA 1X86A 2YS5A 1H4RA 5DI9B 3TVVA 4B6HA 2Q13A 1V5MA 3M1IB 2GS0A 3A98B 4C0AA 2EJ8A 3X23A 2Z0PA 2UZRA 2GCJA 2D10A 4GXBA 3BINA 5C5BB 1WJMA 1NU2A 2DLWA 4HAVB 3RCPA 2H7DA 2MFQA 1UPRA 2DYNA 4NY0A 1FHWA 5DIFB 2V76A 2DYQA 2DA0A 3HK0A 1EVHA 2COFA 5DHFB 3A8QA 4TKNA 1AQCA 5HE0A 2EC1A 1LW3A 2DKPA 3MPXA 3TFMA 2EMTA 2KUPA 1FOEA 1WI1A 2Z0QA 1AWEA 3GYPA 1Y5OA 1PMSA 2D4QA 2J0JA 3G9WA
chains in the Genus database with same CATH superfamily
5J3QA 5JHHA 1W1GA 3PVWA 4DBBA 2PZ1A 2J0MA 2P0HA 4CHMA 5DHAB 2JP2A 2W2XC 1W1HA 1GC7A 2LOXA 5D27A 2D9XA 1B55A 4QJ4B 2M14A 3NW8A 1MIXA 4K2PA 4KHBB 3ODOA 3QWMA 1DDWA 2I5FA 1KZGA 4CSQA 2I1JA 3VOQA 2I5CA 4A6FB 2Z4DA 2UVMA 1MAIA 5FI0A 1U27A 4ZRIA 5KCVA 1UNPA 2RNRB 4WVFB 3P6AA 1PFJA 1M7RA 3TCAA 4HDOA 5I2MA 3WYFB 1DDMA 3V5WA 5LOPB 3D8DA 5CLQB 5J3YA 1FHOA 2DN6A 2COCA 2AEHA 1MI1A 2H7EA 5C6RA 1N3HA 1FAOA 3HW2B 1V61A 3DCXA 2YS1A 1OY2A 3DXDA 3HSAA 4GN1A 2E2XA 2FJLA 4GNKB 4WSFA 1BTKA 4HAYB 3T06A 2N0YA 2KUQA 2R0DA 1I7AA 2Y8FA 1ISNA 4XWXA 2J59M 1X1GA 3FVCA 2LYDA 1MK7B 3N7CA 4K17A 4MT7A 1X1FA 5L81A 1XR0B 3BJIA 2Y8GA 2RGNB 2ROZB 2ADZA 5KQ1A 1FGYA 2HE7A 1IRSA 5CLLB 4P7IA 1P6SA 2DX5A 1PLSA 5JP4A 2P8VA 1J0WA 2ZKMX 4Y94A 5C5BA 4EKUA 5FI1A 3TW1A 3U8ZA 2LULA 4HAZB 2KIGA 1U5EA 3HQCA 1SGHA 1WVHA 1WGUA 3ZDTA 1NTVA 3P7ZA 2K2UA 4F7GA 2Z0OA 2W2WA 3FSSA 2YT0A 1K5DB 2D9WA 3KSYA 2MKRA 2HTHB 4BBKA 1P3RA 1UNRA 4KAXB 4HAWB 1EAZA 3ML4A 2DHJA 1EGXA 3KRXA 3VIAA 3FEHA 3KZ1A 2J0KA 1TJ6A 2ROVA 4IAPA 1ZYIA 1V5PA 2OQBA 2Y7BA 4HHVA 5LONB 4MK0A 4Z2NA 1WG7A 4ZRJA 4K2OA 2D11A 2ELAA 2P0DA 2Z59A 4DX8A 1ZC4B 4HAUB 1SHCA 3DXCA 3OANA 1UPQA 3SO6A 1MKEA 5GOWB 2YT2A 3PZDA 1GG3A 4A6KA 2VKIA 2K49A 1RRPB 2N23A 1P5TA 4GMVA 2D9VA 3ULCA 1U5DA 1MPHA 2DHKA 1ZSQA 3U12A 2Z14A 4DXAB 3PP2A 2AL6A 3AU5A 5IRSA 3PEGA 5D3WA 4A6FA 2L1CA 1V88A 4WJ7A 5C79A 4YONA 1UNQA 1OQNA 1Q67A 4D6WA 2NMBA 1MK9B 5M4YB 4HSIA 3SV1A 5I2SA 2YVCA 3LJUX 4PQ0A 4Z2MB 1DBHA 1DDVA 3DXEA 4IFSA 5JHGA 2CAYA 1T77A 3AJ4A 3FM8C 4L1RA 5HE1A 2LG1A 3PSCA 2YS3A 1DYNA 4HB4B 1K5GB 2OTXA 1WGQA 2LKOA 3SNHA 2COAA 4GOUA 5LG4B 1E5WA 4KHBA 3TO1A 1XCGA 3SUZA 1UEFA 3NSUA 2RRFA 1KI1B 5JLJB 2GCLA 1BWNA 1ZC3B 3ULBA 1KZ7A 2D9YA 3ODXA 4A5KA 3D8EA 2DHIA 4GZUA 1WJ1A 1W1DA 3AU4A 5C16A 1TQZA 1U2BA 3QBVB 3UZTA 2RVBB 3O96A 4F7HA 3NWFA 2LOZA 5KQ4A 2VSZA 2RSGA 3CIKA 1H10A 4EJNA 2EMSA 4QJ3B 1OMWA 1FGZA 1XX0A 3IVFA 1MIZB 4HDQA 5HE3A 1BAKA 4KVGB 5J3TA 4GMXB 2BCJA 2YF0A 2GUMA 1U5GA 3MDBC 2R2YA 1V89A 2L2IA 2MDXA 4K81A 5DH9B 1EF1A 2VRWB 4F7UP 4HATB 3KY9A 3QIJA 3HIEA 3PVUA 2K2JA 3CXBB 1XD4A 4ZRKA 1Z87A 3NWAA 2ELBA 4MY6A 4GPTB 2DFKA 4HAXB 3F0WA 4IOYX 4CHJA 2KCJA 4A6HA 2FJUB 2YRYA 1X11A 2DKQA 2D9ZA 4D0NB 4HB0B 4YL8A 4PNKA 4HB2B 1Y19B 1ZVRA 2I1KA 4H8SA 2QKLA 2IYBA 2RLOA 3D8FA 2DX1A 3F5RA 3PVLA 2R09A 1NTYA 4CYEA 1LB1A 2YSZA 4L6EA 2CODA 2CRFA 5D3XA 1TXDA 3ZVRA 3U7DA 2CY4A 1J19A 4TYZA 2M38A 3A8PA 4KHAA 3GYOA 2MWNB 4NSWA 2IFSA 2RUKB 4DX90 1XKEA 2P0FA 3SYXA 2X18A 1QC6A 2K8EA 1M7EA 5D3VA 1U29A 3A58A 1DROA 1FHXA 1QQGA 2Z13A 2XQNM 1U5FA 2G35A 2D2QA 4HB3B 1NI2A 3OHMB 2ZPYA 1RJ2A 2YT1A 2NZ8B 5D3YA 3WA0A 4QJ5B 4KHOA 1XODA 2CY5A 2DTCA 2KGXB 1X05A 3NWDA 1I2HA 4OSNA 5EFXA 2W2XD 3KRWA 1BTNA 1V5UA 1GC6A 4DIXA 1FB8A 3ODWA 3PG7A 2GJYA 1ZM0A 2UZSA 5HE2A 4EMOA 2K00A 2QKMA 1X86A 2YS5A 1H4RA 5DI9B 3TVVA 4B6HA 2Q13A 1V5MA 3M1IB 2GS0A 3A98B 4C0AA 2EJ8A 3X23A 2Z0PA 2UZRA 2GCJA 2D10A 4GXBA 3BINA 3B77A 5C5BB 1WJMA 1NU2A 2DLWA 4HAVB 3RCPA 2H7DA 2MFQA 1UPRA 2DYNA 2KIEA 4NY0A 1FHWA 5DIFB 2V76A 4QXAB 2DYQA 2DA0A 2KR0A 3HK0A 1EVHA 4OT1A 2COFA 5DHFB 3A8QA 4TKNA 1AQCA 5HE0A 2EC1A 1LW3A 2DKPA 3MPXA 3TFMA 2EMTA 2NBVA 2KUPA 1FOEA 1WI1A 2Z0QA 1AWEA 3GYPA 1Y5OA 1PMSA 2D4QA 2J0JA 3G9WA
chains in the Genus database with same CATH topology
5J3QA 5JHHA 1W1GA 3PVWA 4DBBA 2PZ1A 2J0MA 2P0HA 4CHMA 5DHAB 2JP2A 2W2XC 1W1HA 1GC7A 2LOXA 5D27A 2D9XA 1B55A 2M14A 1MIXA 4K2PA 4KHBB 3ODOA 3QWMA 1DDWA 2I5FA 1KZGA 2I1JA 3VOQA 2I5CA 4A6FB 2UVMA 1MAIA 5FI0A 1U27A 4ZRIA 5KCVA 1UNPA 2RNRB 4WVFB 3P6AA 1PFJA 1M7RA 3TCAA 4HDOA 3WYFB 1DDMA 3V5WA 5LOPB 3D8DA 5CLQB 5J3YA 1FHOA 2DN6A 2COCA 2AEHA 2H7EA 5C6RA 1N3HA 1FAOA 3HW2B 1V61A 2YS1A 1OY2A 3DXDA 4GN1A 2E2XA 2FJLA 4WSFA 1BTKA 4HAYB 3T06A 2N0YA 2R0DA 1I7AA 2Y8FA 1ISNA 4XWXA 2J59M 1X1GA 2LYDA 1MK7B 3N7CA 4K17A 4MT7A 1X1FA 5L81A 1XR0B 3BJIA 2Y8GA 2RGNB 2ROZB 2ADZA 5KQ1A 1FGYA 2HE7A 1IRSA 5CLLB 4P7IA 1P6SA 2DX5A 1PLSA 5JP4A 2P8VA 1J0WA 4Y94A 5C5BA 4EKUA 5FI1A 3TW1A 3U8ZA 2LULA 4HAZB 1U5EA 3HQCA 1SGHA 1WVHA 1WGUA 3ZDTA 1NTVA 3P7ZA 2K2UA 4F7GA 2Z0OA 2W2WA 3FSSA 2YT0A 1K5DB 2D9WA 3KSYA 2MKRA 2HTHB 4BBKA 1P3RA 1UNRA 4KAXB 4HAWB 1EAZA 3ML4A 2DHJA 1EGXA 3KRXA 3VIAA 3FEHA 3KZ1A 2J0KA 1TJ6A 2ROVA 4IAPA 1V5PA 2OQBA 2Y7BA 4HHVA 5LONB 4MK0A 4Z2NA 1WG7A 4ZRJA 4K2OA 2D11A 2ELAA 2P0DA 4DX8A 1ZC4B 4HAUB 1SHCA 3DXCA 3OANA 1UPQA 3SO6A 1MKEA 5GOWB 3PZDA 1GG3A 4A6KA 2VKIA 1RRPB 2N23A 1P5TA 4GMVA 2D9VA 3ULCA 1U5DA 1MPHA 2DHKA 1ZSQA 4DXAB 3PP2A 2AL6A 3AU5A 3PEGA 5D3WA 4A6FA 2L1CA 1V88A 4WJ7A 5C79A 4YONA 1UNQA 1OQNA 1Q67A 2NMBA 1MK9B 3SV1A 2YVCA 3LJUX 4PQ0A 4Z2MB 1DBHA 1DDVA 3DXEA 4IFSA 5JHGA 2CAYA 3AJ4A 3FM8C 5HE1A 2LG1A 3PSCA 2YS3A 1DYNA 4HB4B 1K5GB 2OTXA 1WGQA 2LKOA 3SNHA 2COAA 1E5WA 3TO1A 1XCGA 3SUZA 1UEFA 3NSUA 1KI1B 5JLJB 2GCLA 1BWNA 1ZC3B 3ULBA 1KZ7A 2D9YA 3ODXA 4A5KA 3D8EA 2DHIA 4GZUA 1WJ1A 1W1DA 3AU4A 5C16A 1TQZA 1U2BA 3QBVB 3UZTA 2RVBB 3O96A 4F7HA 2LOZA 5KQ4A 2VSZA 2RSGA 3CIKA 1H10A 4EJNA 2EMSA 1OMWA 1FGZA 1XX0A 3IVFA 1MIZB 4HDQA 5HE3A 1BAKA 4KVGB 5J3TA 4GMXB 2BCJA 2YF0A 1U5GA 3MDBC 1V89A 2L2IA 2MDXA 4K81A 5DH9B 1EF1A 2VRWB 4F7UP 4HATB 3KY9A 3QIJA 3PVUA 2K2JA 3CXBB 1XD4A 4ZRKA 1Z87A 2ELBA 4MY6A 4GPTB 2DFKA 4HAXB 3F0WA 4IOYX 4CHJA 2KCJA 4A6HA 2YRYA 1X11A 2DKQA 2D9ZA 4D0NB 4HB0B 4YL8A 4PNKA 4HB2B 1Y19B 1ZVRA 2I1KA 4H8SA 2QKLA 2IYBA 2RLOA 3D8FA 2DX1A 3F5RA 3PVLA 2R09A 1NTYA 4CYEA 1LB1A 2YSZA 4L6EA 2CODA 2CRFA 5D3XA 1TXDA 3ZVRA 3U7DA 2CY4A 1J19A 4TYZA 2M38A 3A8PA 4KHAA 3GYOA 2MWNB 4NSWA 2IFSA 2RUKB 4DX90 1XKEA 2P0FA 3SYXA 2X18A 1QC6A 1M7EA 5D3VA 1U29A 1DROA 1FHXA 1QQGA 2XQNM 1U5FA 2G35A 2D2QA 4HB3B 1NI2A 2ZPYA 1RJ2A 2YT1A 2NZ8B 5D3YA 3WA0A 4KHOA 1XODA 2CY5A 2DTCA 2KGXB 1X05A 1I2HA 5EFXA 2W2XD 3KRWA 1BTNA 1V5UA 1GC6A 1FB8A 3ODWA 3PG7A 2GJYA 1ZM0A 2UZSA 5HE2A 4EMOA 2K00A 2QKMA 1X86A 2YS5A 1H4RA 5DI9B 3TVVA 4B6HA 2Q13A 1V5MA 3M1IB 2GS0A 3A98B 4C0AA 2EJ8A 3X23A 2Z0PA 2UZRA 2GCJA 2D10A 4GXBA 3BINA 5C5BB 1WJMA 1NU2A 2DLWA 4HAVB 3RCPA 2H7DA 2MFQA 1UPRA 2DYNA 4NY0A 1FHWA 5DIFB 2V76A 2DYQA 2DA0A 3HK0A 1EVHA 2COFA 5DHFB 3A8QA 4TKNA 1AQCA 5HE0A 2EC1A 1LW3A 2DKPA 3MPXA 3TFMA 2EMTA 2KUPA 1FOEA 1WI1A 2Z0QA 1AWEA 3GYPA 1Y5OA 1PMSA 2D4QA 2J0JA 3G9WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5J3Q A;  5JHH A;  1W1G A;  3PVW A;  4DBB A;  2PZ1 A;  2J0M A;  2P0H A;  4CHM A;  5DHA B;  2JP2 A;  2W2X C;  1W1H A;  1GC7 A;  2LOX A;  5D27 A;  2D9X A;  1B55 A;  2M14 A;  1MIX A;  4K2P A;  4KHB B;  3ODO A;  3QWM A;  1DDW A;  2I5F A;  1KZG A;  2I1J A;  3VOQ A;  2I5C A;  4A6F B;  2UVM A;  1MAI A;  5FI0 A;  1U27 A;  4ZRI A;  5KCV A;  1UNP A;  2RNR B;  4WVF B;  3P6A A;  1PFJ A;  1M7R A;  3TCA A;  4HDO A;  3WYF B;  1DDM A;  3V5W A;  5LOP B;  3D8D A;  5CLQ B;  5J3Y A;  1FHO A;  2DN6 A;  2COC A;  2AEH A;  2H7E A;  5C6R A;  1N3H A;  1FAO A;  3HW2 B;  1V61 A;  2YS1 A;  1OY2 A;  3DXD A;  4GN1 A;  2E2X A;  2FJL A;  4WSF A;  1BTK A;  4HAY B;  3T06 A;  2N0Y A;  2R0D A;  1I7A A;  2Y8F A;  1ISN A;  4XWX A;  2J59 M;  1X1G A;  2LYD A;  1MK7 B;  3N7C A;  4K17 A;  4MT7 A;  1X1F A;  5L81 A;  1XR0 B;  3BJI A;  2Y8G A;  2RGN B;  2ROZ B;  2ADZ A;  5KQ1 A;  1FGY A;  2HE7 A;  1IRS A;  5CLL B;  4P7I A;  1P6S A;  2DX5 A;  1PLS A;  5JP4 A;  2P8V A;  1J0W A;  4Y94 A;  5C5B A;  4EKU A;  5FI1 A;  3TW1 A;  3U8Z A;  2LUL A;  4HAZ B;  1U5E A;  3HQC A;  1SGH A;  1WVH A;  1WGU A;  3ZDT A;  1NTV A;  3P7Z A;  2K2U A;  4F7G A;  2Z0O A;  2W2W A;  3FSS A;  2YT0 A;  1K5D B;  2D9W A;  3KSY A;  2MKR A;  2HTH B;  4BBK A;  1P3R A;  1UNR A;  4KAX B;  4HAW B;  1EAZ A;  3ML4 A;  2DHJ A;  1EGX A;  3KRX A;  3VIA A;  3FEH A;  3KZ1 A;  2J0K A;  1TJ6 A;  2ROV A;  4IAP A;  1V5P A;  2OQB A;  2Y7B A;  4HHV A;  5LON B;  4MK0 A;  4Z2N A;  1WG7 A;  4ZRJ A;  4K2O A;  2D11 A;  2ELA A;  2P0D A;  4DX8 A;  1ZC4 B;  4HAU B;  1SHC A;  3DXC A;  3OAN A;  1UPQ A;  3SO6 A;  1MKE A;  5GOW B;  3PZD A;  1GG3 A;  4A6K A;  2VKI A;  1RRP B;  2N23 A;  1P5T A;  4GMV A;  2D9V A;  3ULC A;  1U5D A;  1MPH A;  2DHK A;  1ZSQ A;  4DXA B;  3PP2 A;  2AL6 A;  3AU5 A;  3PEG A;  5D3W A;  4A6F A;  2L1C A;  1V88 A;  4WJ7 A;  5C79 A;  4YON A;  1UNQ A;  1OQN A;  1Q67 A;  2NMB A;  1MK9 B;  3SV1 A;  2YVC A;  3LJU X;  4PQ0 A;  4Z2M B;  1DBH A;  1DDV A;  3DXE A;  4IFS A;  5JHG A;  2CAY A;  3AJ4 A;  3FM8 C;  5HE1 A;  2LG1 A;  3PSC A;  2YS3 A;  1DYN A;  4HB4 B;  1K5G B;  2OTX A;  1WGQ A;  2LKO A;  3SNH A;  2COA A;  1E5W A;  3TO1 A;  1XCG A;  3SUZ A;  1UEF A;  3NSU A;  1KI1 B;  5JLJ B;  2GCL A;  1BWN A;  1ZC3 B;  3ULB A;  1KZ7 A;  2D9Y A;  3ODX A;  4A5K A;  3D8E A;  2DHI A;  4GZU A;  1WJ1 A;  1W1D A;  3AU4 A;  5C16 A;  1TQZ A;  1U2B A;  3QBV B;  3UZT A;  2RVB B;  3O96 A;  4F7H A;  2LOZ A;  5KQ4 A;  2VSZ A;  2RSG A;  3CIK A;  1H10 A;  4EJN A;  2EMS A;  1OMW A;  1FGZ A;  1XX0 A;  3IVF A;  1MIZ B;  4HDQ A;  5HE3 A;  1BAK A;  4KVG B;  5J3T A;  4GMX B;  2BCJ A;  2YF0 A;  1U5G A;  3MDB C;  1V89 A;  2L2I A;  2MDX A;  4K81 A;  5DH9 B;  1EF1 A;  2VRW B;  4F7U P;  4HAT B;  3KY9 A;  3QIJ A;  3PVU A;  2K2J A;  3CXB B;  1XD4 A;  4ZRK A;  1Z87 A;  2ELB A;  4MY6 A;  4GPT B;  2DFK A;  4HAX B;  3F0W A;  4IOY X;  4CHJ A;  2KCJ A;  4A6H A;  2YRY A;  1X11 A;  2DKQ A;  2D9Z A;  4D0N B;  4HB0 B;  4YL8 A;  4PNK A;  4HB2 B;  1Y19 B;  1ZVR A;  2I1K A;  4H8S A;  2QKL A;  2IYB A;  2RLO A;  3D8F A;  2DX1 A;  3F5R A;  3PVL A;  2R09 A;  1NTY A;  4CYE A;  1LB1 A;  2YSZ A;  4L6E A;  2COD A;  2CRF A;  5D3X A;  1TXD A;  3ZVR A;  3U7D A;  2CY4 A;  1J19 A;  4TYZ A;  2M38 A;  3A8P A;  4KHA A;  3GYO A;  2MWN B;  4NSW A;  2IFS A;  2RUK B;  4DX9 0;  1XKE A;  2P0F A;  3SYX A;  2X18 A;  1QC6 A;  1M7E A;  5D3V A;  1U29 A;  1DRO A;  1FHX A;  1QQG A;  2XQN M;  1U5F A;  2G35 A;  2D2Q A;  4HB3 B;  1NI2 A;  2ZPY A;  1RJ2 A;  2YT1 A;  2NZ8 B;  5D3Y A;  3WA0 A;  4KHO A;  1XOD A;  2CY5 A;  2DTC A;  2KGX B;  1X05 A;  1I2H A;  5EFX A;  2W2X D;  3KRW A;  1BTN A;  1V5U A;  1GC6 A;  1FB8 A;  3ODW A;  3PG7 A;  2GJY A;  1ZM0 A;  2UZS A;  5HE2 A;  4EMO A;  2K00 A;  2QKM A;  1X86 A;  2YS5 A;  1H4R A;  5DI9 B;  3TVV A;  4B6H A;  2Q13 A;  1V5M A;  3M1I B;  2GS0 A;  3A98 B;  4C0A A;  2EJ8 A;  3X23 A;  2Z0P A;  2UZR A;  2GCJ A;  2D10 A;  4GXB A;  3BIN A;  5C5B B;  1WJM A;  1NU2 A;  2DLW A;  4HAV B;  3RCP A;  2H7D A;  2MFQ A;  1UPR A;  2DYN A;  4NY0 A;  1FHW A;  5DIF B;  2V76 A;  2DYQ A;  2DA0 A;  3HK0 A;  1EVH A;  2COF A;  5DHF B;  3A8Q A;  4TKN A;  1AQC A;  5HE0 A;  2EC1 A;  1LW3 A;  2DKP A;  3MPX A;  3TFM A;  2EMT A;  2KUP A;  1FOE A;  1WI1 A;  2Z0Q A;  1AWE A;  3GYP A;  1Y5O A;  1PMS A;  2D4Q A;  2J0J A;  3G9W A; 
#chains in the Genus database with same CATH topology
 5J3Q A;  5JHH A;  1W1G A;  3PVW A;  4DBB A;  2PZ1 A;  2J0M A;  2P0H A;  4CHM A;  5DHA B;  2JP2 A;  2W2X C;  1W1H A;  1GC7 A;  2LOX A;  5D27 A;  2D9X A;  1B55 A;  4QJ4 B;  2M14 A;  3NW8 A;  1MIX A;  4K2P A;  4KHB B;  3ODO A;  3QWM A;  1DDW A;  2I5F A;  1KZG A;  4CSQ A;  2I1J A;  3VOQ A;  2I5C A;  4A6F B;  2Z4D A;  2UVM A;  1MAI A;  5FI0 A;  1U27 A;  4ZRI A;  5KCV A;  1UNP A;  2RNR B;  4WVF B;  3P6A A;  1PFJ A;  1M7R A;  3TCA A;  4HDO A;  5I2M A;  3WYF B;  1DDM A;  3V5W A;  5LOP B;  3D8D A;  5CLQ B;  5J3Y A;  1FHO A;  2DN6 A;  2COC A;  2AEH A;  1MI1 A;  2H7E A;  5C6R A;  1N3H A;  1FAO A;  3HW2 B;  1V61 A;  3DCX A;  2YS1 A;  1OY2 A;  3DXD A;  3HSA A;  4GN1 A;  2E2X A;  2FJL A;  4GNK B;  4WSF A;  1BTK A;  4HAY B;  3T06 A;  2N0Y A;  2KUQ A;  2R0D A;  1I7A A;  2Y8F A;  1ISN A;  4XWX A;  2J59 M;  1X1G A;  3FVC A;  2LYD A;  1MK7 B;  3N7C A;  4K17 A;  4MT7 A;  1X1F A;  5L81 A;  1XR0 B;  3BJI A;  2Y8G A;  2RGN B;  2ROZ B;  2ADZ A;  5KQ1 A;  1FGY A;  2HE7 A;  1IRS A;  5CLL B;  4P7I A;  1P6S A;  2DX5 A;  1PLS A;  5JP4 A;  2P8V A;  1J0W A;  2ZKM X;  4Y94 A;  5C5B A;  4EKU A;  5FI1 A;  3TW1 A;  3U8Z A;  2LUL A;  4HAZ B;  2KIG A;  1U5E A;  3HQC A;  1SGH A;  1WVH A;  1WGU A;  3ZDT A;  1NTV A;  3P7Z A;  2K2U A;  4F7G A;  2Z0O A;  2W2W A;  3FSS A;  2YT0 A;  1K5D B;  2D9W A;  3KSY A;  2MKR A;  2HTH B;  4BBK A;  1P3R A;  1UNR A;  4KAX B;  4HAW B;  1EAZ A;  3ML4 A;  2DHJ A;  1EGX A;  3KRX A;  3VIA A;  3FEH A;  3KZ1 A;  2J0K A;  1TJ6 A;  2ROV A;  4IAP A;  1ZYI A;  1V5P A;  2OQB A;  2Y7B A;  4HHV A;  5LON B;  4MK0 A;  4Z2N A;  1WG7 A;  4ZRJ A;  4K2O A;  2D11 A;  2ELA A;  2P0D A;  2Z59 A;  4DX8 A;  1ZC4 B;  4HAU B;  1SHC A;  3DXC A;  3OAN A;  1UPQ A;  3SO6 A;  1MKE A;  5GOW B;  2YT2 A;  3PZD A;  1GG3 A;  4A6K A;  2VKI A;  2K49 A;  1RRP B;  2N23 A;  1P5T A;  4GMV A;  2D9V A;  3ULC A;  1U5D A;  1MPH A;  2DHK A;  1ZSQ A;  3U12 A;  2Z14 A;  4DXA B;  3PP2 A;  2AL6 A;  3AU5 A;  5IRS A;  3PEG A;  5D3W A;  4A6F A;  2L1C A;  1V88 A;  4WJ7 A;  5C79 A;  4YON A;  1UNQ A;  1OQN A;  1Q67 A;  4D6W A;  2NMB A;  1MK9 B;  5M4Y B;  4HSI A;  3SV1 A;  5I2S A;  2YVC A;  3LJU X;  4PQ0 A;  4Z2M B;  1DBH A;  1DDV A;  3DXE A;  4IFS A;  5JHG A;  2CAY A;  1T77 A;  3AJ4 A;  3FM8 C;  4L1R A;  5HE1 A;  2LG1 A;  3PSC A;  2YS3 A;  1DYN A;  4HB4 B;  1K5G B;  2OTX A;  1WGQ A;  2LKO A;  3SNH A;  2COA A;  4GOU A;  5LG4 B;  1E5W A;  4KHB A;  3TO1 A;  1XCG A;  3SUZ A;  1UEF A;  3NSU A;  2RRF A;  1KI1 B;  5JLJ B;  2GCL A;  1BWN A;  1ZC3 B;  3ULB A;  1KZ7 A;  2D9Y A;  3ODX A;  4A5K A;  3D8E A;  2DHI A;  4GZU A;  1WJ1 A;  1W1D A;  3AU4 A;  5C16 A;  1TQZ A;  1U2B A;  3QBV B;  3UZT A;  2RVB B;  3O96 A;  4F7H A;  3NWF A;  2LOZ A;  5KQ4 A;  2VSZ A;  2RSG A;  3CIK A;  1H10 A;  4EJN A;  2EMS A;  4QJ3 B;  1OMW A;  1FGZ A;  1XX0 A;  3IVF A;  1MIZ B;  4HDQ A;  5HE3 A;  1BAK A;  4KVG B;  5J3T A;  4GMX B;  2BCJ A;  2YF0 A;  2GUM A;  1U5G A;  3MDB C;  2R2Y A;  1V89 A;  2L2I A;  2MDX A;  4K81 A;  5DH9 B;  1EF1 A;  2VRW B;  4F7U P;  4HAT B;  3KY9 A;  3QIJ A;  3HIE A;  3PVU A;  2K2J A;  3CXB B;  1XD4 A;  4ZRK A;  1Z87 A;  3NWA A;  2ELB A;  4MY6 A;  4GPT B;  2DFK A;  4HAX B;  3F0W A;  4IOY X;  4CHJ A;  2KCJ A;  4A6H A;  2FJU B;  2YRY A;  1X11 A;  2DKQ A;  2D9Z A;  4D0N B;  4HB0 B;  4YL8 A;  4PNK A;  4HB2 B;  1Y19 B;  1ZVR A;  2I1K A;  4H8S A;  2QKL A;  2IYB A;  2RLO A;  3D8F A;  2DX1 A;  3F5R A;  3PVL A;  2R09 A;  1NTY A;  4CYE A;  1LB1 A;  2YSZ A;  4L6E A;  2COD A;  2CRF A;  5D3X A;  1TXD A;  3ZVR A;  3U7D A;  2CY4 A;  1J19 A;  4TYZ A;  2M38 A;  3A8P A;  4KHA A;  3GYO A;  2MWN B;  4NSW A;  2IFS A;  2RUK B;  4DX9 0;  1XKE A;  2P0F A;  3SYX A;  2X18 A;  1QC6 A;  2K8E A;  1M7E A;  5D3V A;  1U29 A;  3A58 A;  1DRO A;  1FHX A;  1QQG A;  2Z13 A;  2XQN M;  1U5F A;  2G35 A;  2D2Q A;  4HB3 B;  1NI2 A;  3OHM B;  2ZPY A;  1RJ2 A;  2YT1 A;  2NZ8 B;  5D3Y A;  3WA0 A;  4QJ5 B;  4KHO A;  1XOD A;  2CY5 A;  2DTC A;  2KGX B;  1X05 A;  3NWD A;  1I2H A;  4OSN A;  5EFX A;  2W2X D;  3KRW A;  1BTN A;  1V5U A;  1GC6 A;  4DIX A;  1FB8 A;  3ODW A;  3PG7 A;  2GJY A;  1ZM0 A;  2UZS A;  5HE2 A;  4EMO A;  2K00 A;  2QKM A;  1X86 A;  2YS5 A;  1H4R A;  5DI9 B;  3TVV A;  4B6H A;  2Q13 A;  1V5M A;  3M1I B;  2GS0 A;  3A98 B;  4C0A A;  2EJ8 A;  3X23 A;  2Z0P A;  2UZR A;  2GCJ A;  2D10 A;  4GXB A;  3BIN A;  3B77 A;  5C5B B;  1WJM A;  1NU2 A;  2DLW A;  4HAV B;  3RCP A;  2H7D A;  2MFQ A;  1UPR A;  2DYN A;  2KIE A;  4NY0 A;  1FHW A;  5DIF B;  2V76 A;  4QXA B;  2DYQ A;  2DA0 A;  2KR0 A;  3HK0 A;  1EVH A;  4OT1 A;  2COF A;  5DHF B;  3A8Q A;  4TKN A;  1AQC A;  5HE0 A;  2EC1 A;  1LW3 A;  2DKP A;  3MPX A;  3TFM A;  2EMT A;  2NBV A;  2KUP A;  1FOE A;  1WI1 A;  2Z0Q A;  1AWE A;  3GYP A;  1Y5O A;  1PMS A;  2D4Q A;  2J0J A;  3G9W A; 
#chains in the Genus database with same CATH homology
 5J3Q A;  5JHH A;  1W1G A;  3PVW A;  4DBB A;  2PZ1 A;  2J0M A;  2P0H A;  4CHM A;  5DHA B;  2JP2 A;  2W2X C;  1W1H A;  1GC7 A;  2LOX A;  5D27 A;  2D9X A;  1B55 A;  2M14 A;  1MIX A;  4K2P A;  4KHB B;  3ODO A;  3QWM A;  1DDW A;  2I5F A;  1KZG A;  2I1J A;  3VOQ A;  2I5C A;  4A6F B;  2UVM A;  1MAI A;  5FI0 A;  1U27 A;  4ZRI A;  5KCV A;  1UNP A;  2RNR B;  4WVF B;  3P6A A;  1PFJ A;  1M7R A;  3TCA A;  4HDO A;  3WYF B;  1DDM A;  3V5W A;  5LOP B;  3D8D A;  5CLQ B;  5J3Y A;  1FHO A;  2DN6 A;  2COC A;  2AEH A;  2H7E A;  5C6R A;  1N3H A;  1FAO A;  3HW2 B;  1V61 A;  2YS1 A;  1OY2 A;  3DXD A;  4GN1 A;  2E2X A;  2FJL A;  4WSF A;  1BTK A;  4HAY B;  3T06 A;  2N0Y A;  2R0D A;  1I7A A;  2Y8F A;  1ISN A;  4XWX A;  2J59 M;  1X1G A;  2LYD A;  1MK7 B;  3N7C A;  4K17 A;  4MT7 A;  1X1F A;  5L81 A;  1XR0 B;  3BJI A;  2Y8G A;  2RGN B;  2ROZ B;  2ADZ A;  5KQ1 A;  1FGY A;  2HE7 A;  1IRS A;  5CLL B;  4P7I A;  1P6S A;  2DX5 A;  1PLS A;  5JP4 A;  2P8V A;  1J0W A;  4Y94 A;  5C5B A;  4EKU A;  5FI1 A;  3TW1 A;  3U8Z A;  2LUL A;  4HAZ B;  1U5E A;  3HQC A;  1SGH A;  1WVH A;  1WGU A;  3ZDT A;  1NTV A;  3P7Z A;  2K2U A;  4F7G A;  2Z0O A;  2W2W A;  3FSS A;  2YT0 A;  1K5D B;  2D9W A;  3KSY A;  2MKR A;  2HTH B;  4BBK A;  1P3R A;  1UNR A;  4KAX B;  4HAW B;  1EAZ A;  3ML4 A;  2DHJ A;  1EGX A;  3KRX A;  3VIA A;  3FEH A;  3KZ1 A;  2J0K A;  1TJ6 A;  2ROV A;  4IAP A;  1V5P A;  2OQB A;  2Y7B A;  4HHV A;  5LON B;  4MK0 A;  4Z2N A;  1WG7 A;  4ZRJ A;  4K2O A;  2D11 A;  2ELA A;  2P0D A;  4DX8 A;  1ZC4 B;  4HAU B;  1SHC A;  3DXC A;  3OAN A;  1UPQ A;  3SO6 A;  1MKE A;  5GOW B;  3PZD A;  1GG3 A;  4A6K A;  2VKI A;  1RRP B;  2N23 A;  1P5T A;  4GMV A;  2D9V A;  3ULC A;  1U5D A;  1MPH A;  2DHK A;  1ZSQ A;  4DXA B;  3PP2 A;  2AL6 A;  3AU5 A;  3PEG A;  5D3W A;  4A6F A;  2L1C A;  1V88 A;  4WJ7 A;  5C79 A;  4YON A;  1UNQ A;  1OQN A;  1Q67 A;  2NMB A;  1MK9 B;  3SV1 A;  2YVC A;  3LJU X;  4PQ0 A;  4Z2M B;  1DBH A;  1DDV A;  3DXE A;  4IFS A;  5JHG A;  2CAY A;  3AJ4 A;  3FM8 C;  5HE1 A;  2LG1 A;  3PSC A;  2YS3 A;  1DYN A;  4HB4 B;  1K5G B;  2OTX A;  1WGQ A;  2LKO A;  3SNH A;  2COA A;  1E5W A;  3TO1 A;  1XCG A;  3SUZ A;  1UEF A;  3NSU A;  1KI1 B;  5JLJ B;  2GCL A;  1BWN A;  1ZC3 B;  3ULB A;  1KZ7 A;  2D9Y A;  3ODX A;  4A5K A;  3D8E A;  2DHI A;  4GZU A;  1WJ1 A;  1W1D A;  3AU4 A;  5C16 A;  1TQZ A;  1U2B A;  3QBV B;  3UZT A;  2RVB B;  3O96 A;  4F7H A;  2LOZ A;  5KQ4 A;  2VSZ A;  2RSG A;  3CIK A;  1H10 A;  4EJN A;  2EMS A;  1OMW A;  1FGZ A;  1XX0 A;  3IVF A;  1MIZ B;  4HDQ A;  5HE3 A;  1BAK A;  4KVG B;  5J3T A;  4GMX B;  2BCJ A;  2YF0 A;  1U5G A;  3MDB C;  1V89 A;  2L2I A;  2MDX A;  4K81 A;  5DH9 B;  1EF1 A;  2VRW B;  4F7U P;  4HAT B;  3KY9 A;  3QIJ A;  3PVU A;  2K2J A;  3CXB B;  1XD4 A;  4ZRK A;  1Z87 A;  2ELB A;  4MY6 A;  4GPT B;  2DFK A;  4HAX B;  3F0W A;  4IOY X;  4CHJ A;  2KCJ A;  4A6H A;  2YRY A;  1X11 A;  2DKQ A;  2D9Z A;  4D0N B;  4HB0 B;  4YL8 A;  4PNK A;  4HB2 B;  1Y19 B;  1ZVR A;  2I1K A;  4H8S A;  2QKL A;  2IYB A;  2RLO A;  3D8F A;  2DX1 A;  3F5R A;  3PVL A;  2R09 A;  1NTY A;  4CYE A;  1LB1 A;  2YSZ A;  4L6E A;  2COD A;  2CRF A;  5D3X A;  1TXD A;  3ZVR A;  3U7D A;  2CY4 A;  1J19 A;  4TYZ A;  2M38 A;  3A8P A;  4KHA A;  3GYO A;  2MWN B;  4NSW A;  2IFS A;  2RUK B;  4DX9 0;  1XKE A;  2P0F A;  3SYX A;  2X18 A;  1QC6 A;  1M7E A;  5D3V A;  1U29 A;  1DRO A;  1FHX A;  1QQG A;  2XQN M;  1U5F A;  2G35 A;  2D2Q A;  4HB3 B;  1NI2 A;  2ZPY A;  1RJ2 A;  2YT1 A;  2NZ8 B;  5D3Y A;  3WA0 A;  4KHO A;  1XOD A;  2CY5 A;  2DTC A;  2KGX B;  1X05 A;  1I2H A;  5EFX A;  2W2X D;  3KRW A;  1BTN A;  1V5U A;  1GC6 A;  1FB8 A;  3ODW A;  3PG7 A;  2GJY A;  1ZM0 A;  2UZS A;  5HE2 A;  4EMO A;  2K00 A;  2QKM A;  1X86 A;  2YS5 A;  1H4R A;  5DI9 B;  3TVV A;  4B6H A;  2Q13 A;  1V5M A;  3M1I B;  2GS0 A;  3A98 B;  4C0A A;  2EJ8 A;  3X23 A;  2Z0P A;  2UZR A;  2GCJ A;  2D10 A;  4GXB A;  3BIN A;  5C5B B;  1WJM A;  1NU2 A;  2DLW A;  4HAV B;  3RCP A;  2H7D A;  2MFQ A;  1UPR A;  2DYN A;  4NY0 A;  1FHW A;  5DIF B;  2V76 A;  2DYQ A;  2DA0 A;  3HK0 A;  1EVH A;  2COF A;  5DHF B;  3A8Q A;  4TKN A;  1AQC A;  5HE0 A;  2EC1 A;  1LW3 A;  2DKP A;  3MPX A;  3TFM A;  2EMT A;  2KUP A;  1FOE A;  1WI1 A;  2Z0Q A;  1AWE A;  3GYP A;  1Y5O A;  1PMS A;  2D4Q A;  2J0J A;  3G9W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...