2DN6A

Solution structure of the ph domain of kiaa0640 protein from human
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
115
structure length
115
Chain Sequence
GSSGSSGVLKQGYMMKKGHRRKNWTERWFVLKPNIISYYVSEDLKDKKGDILLDENCCVESLPDKDGKKCLFLVKCFDKTFEISASDKKKKQEWIQAIHSTIHLLKLGSSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords KIAA0640 protein
publication title Solution structure of the PH domain of KIAA0640 protein from human
rcsb
source organism Homo sapiens
total genus 16
structure length 115
sequence length 115
ec nomenclature
pdb deposition date 2006-04-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00169 PH PH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2dn6A00
4PNKA 5HE3A 1MKEA 3DXEA 3V5WA 4EKUA 2EC1A 1MPHA 4GPTB 5LOPB 1P5TA 2K2JA 3A8PA 1UNQA 4Y94A 1DDMA 2GJYA 2YT0A 2Y8FA 5EFXA 2RNRB 4GMVA 2D9XA 1ZC3B 1H10A 2Y8GA 1QC6A 3QIJA 2R0DA 4K81A 2Q13A 1UPQA 2D4QA 3GYOA 3QWMA 4A6KA 1Q67A 3AU5A 1V88A 3DXDA 2AEHA 3ODOA 4YONA 2D9YA 4HDOA 5D3XA 2QKMA 1FGYA 1MK7B 4K17A 1OQNA 5D27A 1PFJA 1BTKA 2K00A 4GZUA 5DHAB 2J59M 4DXAB 2DYQA 1NTYA 2D2QA 1V89A 5J3TA 4GN1A 4DBBA 3FSSA 2W2XC 3P6AA 2CAYA 2COFA 5C5BB 2W2WA 4WJ7A 2DKPA 5DHFB 2XQNM 3O96A 1DDWA 1MK9B 2M38A 1KI1B 3PEGA 2V76A 1EF1A 1BWNA 3PG7A 1K5GB 4EMOA 2DHIA 3X23A 4NSWA 4WSFA 2EMSA 3CXBB 3PP2A 2ADZA 4K2PA 1OY2A 4ZRIA 2COCA 3SUZA 2IYBA 2DHJA 2MFQA 5FI0A 4WVFB 2I1KA 4A6FA 1U29A 1XODA 5HE0A 2EJ8A 2GCJA 4F7HA 2KCJA 3DXCA 1UEFA 2YS3A 1W1GA 5JP4A 1PLSA 2YF0A 1MIZB 1XCGA 2D11A 5D3VA 3ZVRA 1EVHA 1Y5OA 1V61A 4ZRKA 2N23A 2P0HA 4GXBA 3HQCA 4CHMA 5HE2A 2DX5A 2JP2A 3SO6A 2LULA 5KCVA 1TXDA 1XKEA 2DN6A 2LG1A 4L6EA 2RLOA 5J3QA 1MIXA 2YT1A 1XD4A 2CODA 3FM8C 3KRWA 2DLWA 2DTCA 4MY6A 4IOYX 1W1HA 4GMXB 1WJ1A 4Z2NA 5JHGA 4HAZB 1U27A 1FHOA 4DX90 1QQGA 2FJLA 2D9WA 1B55A 4HB3B 4KAXB 1KZGA 3ULCA 1P6SA 3D8DA 1V5UA 1SGHA 5GOWB 3F0WA 1ZVRA 1X05A 1GC6A 2UZSA 4PQ0A 2YVCA 2DA0A 2P8VA 1ZC4B 1E5WA 1ISNA 1WVHA 2RUKB 1SHCA 2OQBA 2J0KA 5FI1A 1EAZA 2E2XA 3M1IB 3A98B 2J0JA 2KGXB 3ULBA 1U2BA 4KHBB 2VRWB 2LYDA 3D8EA 3PSCA 3A8QA 3ML4A 4F7GA 2VSZA 2UVMA 4TYZA 2I5FA 1TQZA 2MWNB 5CLLB 4BBKA 1FHXA 2ELAA 2KUPA 4KHOA 3BINA 3TO1A 2MKRA 3PZDA 1J19A 5KQ4A 4A6HA 3N7CA 1P3RA 2ZPYA 4KVGB 4B6HA 4YL8A 3ODWA 2Z0OA 2RSGA 2CY4A 2CRFA 2DHKA 3UZTA 1FAOA 1TJ6A 3KRXA 2DFKA 1U5GA 4MT7A 4A5KA 4HHVA 1AWEA 2LOXA 1I7AA 2DYNA 2I5CA 1Y19B 4CHJA 2H7DA 3T06A 1V5PA 3OANA 1FGZA 3U7DA 2EMTA 1LW3A 1WI1A 2YS1A 3U8ZA 1H4RA 5LONB 2R09A 1Z87A 3TCAA 2PZ1A 3KZ1A 2J0MA 2L1CA 5C5BA 5CLQB 1M7RA 3LJUX 1DYNA 1FHWA 1BAKA 5D3YA 2ROZB 2LOZA 3BJIA 3KY9A 2X18A 1AQCA 1K5DB 5C16A 1BTNA 3TW1A 1WG7A 3VIAA 2N0YA 3P7ZA 1V5MA 1U5FA 1I2HA 4IAPA 5J3YA 1EGXA 2YS5A 4P7IA 1DBHA 5C6RA 3ODXA 4HAUB 2NMBA 3RCPA 2BCJA 2ROVA 1UNRA 3TFMA 3MDBC 1WJMA 2GS0A 3GYPA 1ZM0A 2Z0PA 3SNHA 2M14A 2OTXA 3NSUA 4TKNA 2ELBA 2YRYA 1XR0B 4HAWB 5HE1A 1GC7A 3G9WA 4A6FB 2P0FA 1ZSQA 4HATB 5L81A 1DDVA 2H7EA 1N3HA 2NZ8B 2HTHB 1UPRA 2W2XD 2AL6A 4ZRJA 2UZRA 3AU4A 4HB4B 4Z2MB 1WGUA 1FB8A 3FEHA 2IFSA 4CYEA 1IRSA 2D9ZA 3SV1A 3PVLA 1M7EA 2D9VA 2RVBB 1PMSA 4HAXB 4EJNA 2HE7A 4KHAA 3IVFA 1DROA 1MAIA 3ZDTA 3D8FA 2G35A 2D10A 2L2IA 4MK0A 2QKLA 2Z0QA 5KQ1A 1X11A 1U5DA 2COAA 2YSZA 3QBVB 3PVWA 1NU2A 2RGNB 2MDXA 3HW2B 1NTVA 1UNPA 3TVVA 2K2UA 3SYXA 4IFSA 3WA0A 1XX0A 2CY5A 1KZ7A 1U5EA 4HB0B 5D3WA 1OMWA 5JLJB 5JHHA 3CIKA 5DH9B 4F7UP 2P0DA 3VOQA 1X1FA 1NI2A 2Y7BA 4DX8A 2VKIA 3WYFB 1RJ2A 2I1JA 4NY0A 1WGQA 2LKOA 1LB1A 3F5RA 4D0NB 4K2OA 3PVUA 4HAVB 3HK0A 1FOEA 1W1DA 3AJ4A 4H8SA 5DI9B 3KSYA 5C79A 1X1GA 4XWXA 2DKQA 1J0WA 4HB2B 4HDQA 1RRPB 4HAYB 5DIFB 4C0AA 1GG3A 1X86A 2DX1A 2GCLA 3MPXA
chains in the Genus database with same CATH superfamily
1ZYIA 4PNKA 5HE3A 1MKEA 3DXEA 2KUQA 4QJ3B 3V5WA 4EKUA 2EC1A 1MPHA 4GPTB 5LOPB 2FJUB 1P5TA 2K2JA 3A8PA 1UNQA 2ZKMX 4Y94A 1DDMA 2GJYA 2RRFA 2YT0A 2Y8FA 5EFXA 2RNRB 4GMVA 2D9XA 1ZC3B 1H10A 2Y8GA 1QC6A 3QIJA 2R0DA 4K81A 2Q13A 1UPQA 2D4QA 3GYOA 3QWMA 4A6KA 1Q67A 3AU5A 1V88A 3DXDA 2AEHA 3ODOA 4YONA 2D9YA 4HDOA 5D3XA 2QKMA 1FGYA 1MK7B 4K17A 1OQNA 5D27A 1PFJA 1BTKA 2K00A 4GZUA 5DHAB 4QJ5B 2J59M 4DXAB 2DYQA 1NTYA 2D2QA 3A58A 1V89A 5J3TA 4GN1A 4DBBA 3FSSA 2W2XC 3P6AA 2CAYA 3DCXA 2COFA 5C5BB 2W2WA 4WJ7A 2DKPA 5DHFB 2XQNM 3O96A 1DDWA 1MK9B 2M38A 1KI1B 3PEGA 5IRSA 2V76A 1EF1A 1BWNA 3PG7A 1K5GB 4EMOA 2DHIA 3X23A 4NSWA 4WSFA 2EMSA 3CXBB 3PP2A 2ADZA 4K2PA 1OY2A 4ZRIA 2COCA 3SUZA 2IYBA 3OHMB 2DHJA 2MFQA 5FI0A 4WVFB 2I1KA 4A6FA 1U29A 1XODA 3U12A 3HIEA 5HE0A 2EJ8A 2GCJA 5I2MA 4F7HA 3FVCA 2KCJA 4OT1A 3DXCA 1UEFA 2R2YA 2YS3A 3NW8A 1W1GA 5JP4A 1PLSA 2YF0A 1MIZB 1XCGA 2D11A 5D3VA 3ZVRA 1EVHA 1Y5OA 1V61A 4ZRKA 2N23A 2P0HA 4GXBA 3HQCA 4CHMA 5HE2A 2DX5A 2JP2A 3SO6A 2LULA 5KCVA 1TXDA 1XKEA 2DN6A 2LG1A 3NWFA 4L6EA 2RLOA 5J3QA 1MIXA 2YT1A 1XD4A 2CODA 3FM8C 3KRWA 2DLWA 2DTCA 4MY6A 4IOYX 4GNKB 1W1HA 4GMXB 1WJ1A 4Z2NA 5JHGA 4HAZB 1U27A 1FHOA 4DX90 1QQGA 2FJLA 2D9WA 1B55A 4HB3B 4KAXB 1KZGA 3ULCA 1P6SA 3D8DA 1V5UA 1SGHA 5GOWB 3F0WA 1ZVRA 1X05A 1GC6A 4QXAB 2UZSA 4PQ0A 2YVCA 2DA0A 2P8VA 1ZC4B 1E5WA 1ISNA 1WVHA 2RUKB 1SHCA 2KR0A 2OQBA 2J0KA 5FI1A 1EAZA 2E2XA 3M1IB 3A98B 2J0JA 2KGXB 3ULBA 1U2BA 4KHBB 4L1RA 2VRWB 2LYDA 3D8EA 3PSCA 1MI1A 3A8QA 5LG4B 3ML4A 4F7GA 5I2SA 2VSZA 2UVMA 4TYZA 2I5FA 1TQZA 2MWNB 5CLLB 4BBKA 1FHXA 2ELAA 2KUPA 4KHOA 3BINA 3TO1A 2MKRA 3PZDA 1J19A 5KQ4A 4A6HA 3N7CA 1P3RA 2ZPYA 4KVGB 4B6HA 4HSIA 4YL8A 3ODWA 3B77A 2Z0OA 2RSGA 2CY4A 2CRFA 2DHKA 3UZTA 1FAOA 1TJ6A 3KRXA 2DFKA 1U5GA 2K49A 4MT7A 4A5KA 4HHVA 1AWEA 2LOXA 1I7AA 2DYNA 2I5CA 5M4YB 1Y19B 4CHJA 2H7DA 3T06A 1V5PA 3OANA 1FGZA 3U7DA 2EMTA 1LW3A 1WI1A 2YS1A 3U8ZA 1H4RA 5LONB 2R09A 1Z87A 3TCAA 2PZ1A 3KZ1A 2J0MA 2L1CA 5C5BA 5CLQB 1M7RA 3LJUX 1DYNA 1FHWA 1BAKA 5D3YA 2Z14A 2ROZB 2LOZA 3BJIA 3KY9A 2X18A 1AQCA 1K5DB 5C16A 1BTNA 2YT2A 1WG7A 3TW1A 3VIAA 2N0YA 3P7ZA 1V5MA 1U5FA 1I2HA 4IAPA 4OSNA 5J3YA 1EGXA 2YS5A 4P7IA 1DBHA 5C6RA 3ODXA 4HAUB 2NMBA 3RCPA 2BCJA 2ROVA 4GOUA 1UNRA 3TFMA 3MDBC 1WJMA 2GS0A 3GYPA 1ZM0A 2Z0PA 3SNHA 4CSQA 2M14A 2OTXA 3NSUA 4TKNA 2ELBA 2YRYA 1XR0B 4HAWB 5HE1A 1GC7A 3G9WA 4A6FB 2P0FA 1ZSQA 4HATB 5L81A 2Z4DA 1DDVA 2H7EA 1N3HA 2NZ8B 2Z13A 2HTHB 1UPRA 2W2XD 4D6WA 2AL6A 4ZRJA 2UZRA 3AU4A 4HB4B 4Z2MB 1T77A 1WGUA 1FB8A 3FEHA 2IFSA 4CYEA 1IRSA 2D9ZA 2GUMA 3SV1A 3PVLA 1M7EA 2D9VA 2RVBB 1PMSA 4HAXB 4EJNA 2HE7A 4KHAA 3IVFA 1DROA 1MAIA 3ZDTA 3D8FA 2G35A 2D10A 3HSAA 2L2IA 4MK0A 2QKLA 2Z0QA 5KQ1A 3NWDA 1X11A 1U5DA 2COAA 2YSZA 3QBVB 2KIEA 3PVWA 1NU2A 2RGNB 2MDXA 2K8EA 3HW2B 1NTVA 1UNPA 3TVVA 2K2UA 3SYXA 4IFSA 3WA0A 1XX0A 2CY5A 1KZ7A 1U5EA 4HB0B 5D3WA 1OMWA 5JLJB 5JHHA 3CIKA 5DH9B 3NWAA 4F7UP 2P0DA 3VOQA 1X1FA 1NI2A 2Y7BA 4DX8A 2VKIA 2Z59A 4KHBA 3WYFB 1RJ2A 2I1JA 4NY0A 2KIGA 1WGQA 2LKOA 1LB1A 3F5RA 4D0NB 4K2OA 3PVUA 4HAVB 3HK0A 1FOEA 1W1DA 3AJ4A 4H8SA 5DI9B 3KSYA 5C79A 1X1GA 4XWXA 2DKQA 1J0WA 2NBVA 4HB2B 4HDQA 1RRPB 4HAYB 4DIXA 5DIFB 4C0AA 1GG3A 4QJ4B 1X86A 2DX1A 2GCLA 3MPXA
chains in the Genus database with same CATH topology
4PNKA 5HE3A 1MKEA 3DXEA 3V5WA 4EKUA 2EC1A 1MPHA 4GPTB 5LOPB 1P5TA 2K2JA 3A8PA 1UNQA 4Y94A 1DDMA 2GJYA 2YT0A 2Y8FA 5EFXA 2RNRB 4GMVA 2D9XA 1ZC3B 1H10A 2Y8GA 1QC6A 3QIJA 2R0DA 4K81A 2Q13A 1UPQA 2D4QA 3GYOA 3QWMA 4A6KA 1Q67A 3AU5A 1V88A 3DXDA 2AEHA 3ODOA 4YONA 2D9YA 4HDOA 5D3XA 2QKMA 1FGYA 1MK7B 4K17A 1OQNA 5D27A 1PFJA 1BTKA 2K00A 4GZUA 5DHAB 2J59M 4DXAB 2DYQA 1NTYA 2D2QA 1V89A 5J3TA 4GN1A 4DBBA 3FSSA 2W2XC 3P6AA 2CAYA 2COFA 5C5BB 2W2WA 4WJ7A 2DKPA 5DHFB 2XQNM 3O96A 1DDWA 1MK9B 2M38A 1KI1B 3PEGA 2V76A 1EF1A 1BWNA 3PG7A 1K5GB 4EMOA 2DHIA 3X23A 4NSWA 4WSFA 2EMSA 3CXBB 3PP2A 2ADZA 4K2PA 1OY2A 4ZRIA 2COCA 3SUZA 2IYBA 2DHJA 2MFQA 5FI0A 4WVFB 2I1KA 4A6FA 1U29A 1XODA 5HE0A 2EJ8A 2GCJA 4F7HA 2KCJA 3DXCA 1UEFA 2YS3A 1W1GA 5JP4A 1PLSA 2YF0A 1MIZB 1XCGA 2D11A 5D3VA 3ZVRA 1EVHA 1Y5OA 1V61A 4ZRKA 2N23A 2P0HA 4GXBA 3HQCA 4CHMA 5HE2A 2DX5A 2JP2A 3SO6A 2LULA 5KCVA 1TXDA 1XKEA 2DN6A 2LG1A 4L6EA 2RLOA 5J3QA 1MIXA 2YT1A 1XD4A 2CODA 3FM8C 3KRWA 2DLWA 2DTCA 4MY6A 4IOYX 1W1HA 4GMXB 1WJ1A 4Z2NA 5JHGA 4HAZB 1U27A 1FHOA 4DX90 1QQGA 2FJLA 2D9WA 1B55A 4HB3B 4KAXB 1KZGA 3ULCA 1P6SA 3D8DA 1V5UA 1SGHA 5GOWB 3F0WA 1ZVRA 1X05A 1GC6A 2UZSA 4PQ0A 2YVCA 2DA0A 2P8VA 1ZC4B 1E5WA 1ISNA 1WVHA 2RUKB 1SHCA 2OQBA 2J0KA 5FI1A 1EAZA 2E2XA 3M1IB 3A98B 2J0JA 2KGXB 3ULBA 1U2BA 4KHBB 2VRWB 2LYDA 3D8EA 3PSCA 3A8QA 3ML4A 4F7GA 2VSZA 2UVMA 4TYZA 2I5FA 1TQZA 2MWNB 5CLLB 4BBKA 1FHXA 2ELAA 2KUPA 4KHOA 3BINA 3TO1A 2MKRA 3PZDA 1J19A 5KQ4A 4A6HA 3N7CA 1P3RA 2ZPYA 4KVGB 4B6HA 4YL8A 3ODWA 2Z0OA 2RSGA 2CY4A 2CRFA 2DHKA 3UZTA 1FAOA 1TJ6A 3KRXA 2DFKA 1U5GA 4MT7A 4A5KA 4HHVA 1AWEA 2LOXA 1I7AA 2DYNA 2I5CA 1Y19B 4CHJA 2H7DA 3T06A 1V5PA 3OANA 1FGZA 3U7DA 2EMTA 1LW3A 1WI1A 2YS1A 3U8ZA 1H4RA 5LONB 2R09A 1Z87A 3TCAA 2PZ1A 3KZ1A 2J0MA 2L1CA 5C5BA 5CLQB 1M7RA 3LJUX 1DYNA 1FHWA 1BAKA 5D3YA 2ROZB 2LOZA 3BJIA 3KY9A 2X18A 1AQCA 1K5DB 5C16A 1BTNA 3TW1A 1WG7A 3VIAA 2N0YA 3P7ZA 1V5MA 1U5FA 1I2HA 4IAPA 5J3YA 1EGXA 2YS5A 4P7IA 1DBHA 5C6RA 3ODXA 4HAUB 2NMBA 3RCPA 2BCJA 2ROVA 1UNRA 3TFMA 3MDBC 1WJMA 2GS0A 3GYPA 1ZM0A 2Z0PA 3SNHA 2M14A 2OTXA 3NSUA 4TKNA 2ELBA 2YRYA 1XR0B 4HAWB 5HE1A 1GC7A 3G9WA 4A6FB 2P0FA 1ZSQA 4HATB 5L81A 1DDVA 2H7EA 1N3HA 2NZ8B 2HTHB 1UPRA 2W2XD 2AL6A 4ZRJA 2UZRA 3AU4A 4HB4B 4Z2MB 1WGUA 1FB8A 3FEHA 2IFSA 4CYEA 1IRSA 2D9ZA 3SV1A 3PVLA 1M7EA 2D9VA 2RVBB 1PMSA 4HAXB 4EJNA 2HE7A 4KHAA 3IVFA 1DROA 1MAIA 3ZDTA 3D8FA 2G35A 2D10A 2L2IA 4MK0A 2QKLA 2Z0QA 5KQ1A 1X11A 1U5DA 2COAA 2YSZA 3QBVB 3PVWA 1NU2A 2RGNB 2MDXA 3HW2B 1NTVA 1UNPA 3TVVA 2K2UA 3SYXA 4IFSA 3WA0A 1XX0A 2CY5A 1KZ7A 1U5EA 4HB0B 5D3WA 1OMWA 5JLJB 5JHHA 3CIKA 5DH9B 4F7UP 2P0DA 3VOQA 1X1FA 1NI2A 2Y7BA 4DX8A 2VKIA 3WYFB 1RJ2A 2I1JA 4NY0A 1WGQA 2LKOA 1LB1A 3F5RA 4D0NB 4K2OA 3PVUA 4HAVB 3HK0A 1FOEA 1W1DA 3AJ4A 4H8SA 5DI9B 3KSYA 5C79A 1X1GA 4XWXA 2DKQA 1J0WA 4HB2B 4HDQA 1RRPB 4HAYB 5DIFB 4C0AA 1GG3A 1X86A 2DX1A 2GCLA 3MPXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PNK A;  5HE3 A;  1MKE A;  3DXE A;  3V5W A;  4EKU A;  2EC1 A;  1MPH A;  4GPT B;  5LOP B;  1P5T A;  2K2J A;  3A8P A;  1UNQ A;  4Y94 A;  1DDM A;  2GJY A;  2YT0 A;  2Y8F A;  5EFX A;  2RNR B;  4GMV A;  2D9X A;  1ZC3 B;  1H10 A;  2Y8G A;  1QC6 A;  3QIJ A;  2R0D A;  4K81 A;  2Q13 A;  1UPQ A;  2D4Q A;  3GYO A;  3QWM A;  4A6K A;  1Q67 A;  3AU5 A;  1V88 A;  3DXD A;  2AEH A;  3ODO A;  4YON A;  2D9Y A;  4HDO A;  5D3X A;  2QKM A;  1FGY A;  1MK7 B;  4K17 A;  1OQN A;  5D27 A;  1PFJ A;  1BTK A;  2K00 A;  4GZU A;  5DHA B;  2J59 M;  4DXA B;  2DYQ A;  1NTY A;  2D2Q A;  1V89 A;  5J3T A;  4GN1 A;  4DBB A;  3FSS A;  2W2X C;  3P6A A;  2CAY A;  2COF A;  5C5B B;  2W2W A;  4WJ7 A;  2DKP A;  5DHF B;  2XQN M;  3O96 A;  1DDW A;  1MK9 B;  2M38 A;  1KI1 B;  3PEG A;  2V76 A;  1EF1 A;  1BWN A;  3PG7 A;  1K5G B;  4EMO A;  2DHI A;  3X23 A;  4NSW A;  4WSF A;  2EMS A;  3CXB B;  3PP2 A;  2ADZ A;  4K2P A;  1OY2 A;  4ZRI A;  2COC A;  3SUZ A;  2IYB A;  2DHJ A;  2MFQ A;  5FI0 A;  4WVF B;  2I1K A;  4A6F A;  1U29 A;  1XOD A;  5HE0 A;  2EJ8 A;  2GCJ A;  4F7H A;  2KCJ A;  3DXC A;  1UEF A;  2YS3 A;  1W1G A;  5JP4 A;  1PLS A;  2YF0 A;  1MIZ B;  1XCG A;  2D11 A;  5D3V A;  3ZVR A;  1EVH A;  1Y5O A;  1V61 A;  4ZRK A;  2N23 A;  2P0H A;  4GXB A;  3HQC A;  4CHM A;  5HE2 A;  2DX5 A;  2JP2 A;  3SO6 A;  2LUL A;  5KCV A;  1TXD A;  1XKE A;  2DN6 A;  2LG1 A;  4L6E A;  2RLO A;  5J3Q A;  1MIX A;  2YT1 A;  1XD4 A;  2COD A;  3FM8 C;  3KRW A;  2DLW A;  2DTC A;  4MY6 A;  4IOY X;  1W1H A;  4GMX B;  1WJ1 A;  4Z2N A;  5JHG A;  4HAZ B;  1U27 A;  1FHO A;  4DX9 0;  1QQG A;  2FJL A;  2D9W A;  1B55 A;  4HB3 B;  4KAX B;  1KZG A;  3ULC A;  1P6S A;  3D8D A;  1V5U A;  1SGH A;  5GOW B;  3F0W A;  1ZVR A;  1X05 A;  1GC6 A;  2UZS A;  4PQ0 A;  2YVC A;  2DA0 A;  2P8V A;  1ZC4 B;  1E5W A;  1ISN A;  1WVH A;  2RUK B;  1SHC A;  2OQB A;  2J0K A;  5FI1 A;  1EAZ A;  2E2X A;  3M1I B;  3A98 B;  2J0J A;  2KGX B;  3ULB A;  1U2B A;  4KHB B;  2VRW B;  2LYD A;  3D8E A;  3PSC A;  3A8Q A;  3ML4 A;  4F7G A;  2VSZ A;  2UVM A;  4TYZ A;  2I5F A;  1TQZ A;  2MWN B;  5CLL B;  4BBK A;  1FHX A;  2ELA A;  2KUP A;  4KHO A;  3BIN A;  3TO1 A;  2MKR A;  3PZD A;  1J19 A;  5KQ4 A;  4A6H A;  3N7C A;  1P3R A;  2ZPY A;  4KVG B;  4B6H A;  4YL8 A;  3ODW A;  2Z0O A;  2RSG A;  2CY4 A;  2CRF A;  2DHK A;  3UZT A;  1FAO A;  1TJ6 A;  3KRX A;  2DFK A;  1U5G A;  4MT7 A;  4A5K A;  4HHV A;  1AWE A;  2LOX A;  1I7A A;  2DYN A;  2I5C A;  1Y19 B;  4CHJ A;  2H7D A;  3T06 A;  1V5P A;  3OAN A;  1FGZ A;  3U7D A;  2EMT A;  1LW3 A;  1WI1 A;  2YS1 A;  3U8Z A;  1H4R A;  5LON B;  2R09 A;  1Z87 A;  3TCA A;  2PZ1 A;  3KZ1 A;  2J0M A;  2L1C A;  5C5B A;  5CLQ B;  1M7R A;  3LJU X;  1DYN A;  1FHW A;  1BAK A;  5D3Y A;  2ROZ B;  2LOZ A;  3BJI A;  3KY9 A;  2X18 A;  1AQC A;  1K5D B;  5C16 A;  1BTN A;  3TW1 A;  1WG7 A;  3VIA A;  2N0Y A;  3P7Z A;  1V5M A;  1U5F A;  1I2H A;  4IAP A;  5J3Y A;  1EGX A;  2YS5 A;  4P7I A;  1DBH A;  5C6R A;  3ODX A;  4HAU B;  2NMB A;  3RCP A;  2BCJ A;  2ROV A;  1UNR A;  3TFM A;  3MDB C;  1WJM A;  2GS0 A;  3GYP A;  1ZM0 A;  2Z0P A;  3SNH A;  2M14 A;  2OTX A;  3NSU A;  4TKN A;  2ELB A;  2YRY A;  1XR0 B;  4HAW B;  5HE1 A;  1GC7 A;  3G9W A;  4A6F B;  2P0F A;  1ZSQ A;  4HAT B;  5L81 A;  1DDV A;  2H7E A;  1N3H A;  2NZ8 B;  2HTH B;  1UPR A;  2W2X D;  2AL6 A;  4ZRJ A;  2UZR A;  3AU4 A;  4HB4 B;  4Z2M B;  1WGU A;  1FB8 A;  3FEH A;  2IFS A;  4CYE A;  1IRS A;  2D9Z A;  3SV1 A;  3PVL A;  1M7E A;  2D9V A;  2RVB B;  1PMS A;  4HAX B;  4EJN A;  2HE7 A;  4KHA A;  3IVF A;  1DRO A;  1MAI A;  3ZDT A;  3D8F A;  2G35 A;  2D10 A;  2L2I A;  4MK0 A;  2QKL A;  2Z0Q A;  5KQ1 A;  1X11 A;  1U5D A;  2COA A;  2YSZ A;  3QBV B;  3PVW A;  1NU2 A;  2RGN B;  2MDX A;  3HW2 B;  1NTV A;  1UNP A;  3TVV A;  2K2U A;  3SYX A;  4IFS A;  3WA0 A;  1XX0 A;  2CY5 A;  1KZ7 A;  1U5E A;  4HB0 B;  5D3W A;  1OMW A;  5JLJ B;  5JHH A;  3CIK A;  5DH9 B;  4F7U P;  2P0D A;  3VOQ A;  1X1F A;  1NI2 A;  2Y7B A;  4DX8 A;  2VKI A;  3WYF B;  1RJ2 A;  2I1J A;  4NY0 A;  1WGQ A;  2LKO A;  1LB1 A;  3F5R A;  4D0N B;  4K2O A;  3PVU A;  4HAV B;  3HK0 A;  1FOE A;  1W1D A;  3AJ4 A;  4H8S A;  5DI9 B;  3KSY A;  5C79 A;  1X1G A;  4XWX A;  2DKQ A;  1J0W A;  4HB2 B;  4HDQ A;  1RRP B;  4HAY B;  5DIF B;  4C0A A;  1GG3 A;  1X86 A;  2DX1 A;  2GCL A;  3MPX A; 
#chains in the Genus database with same CATH topology
 1ZYI A;  4PNK A;  5HE3 A;  1MKE A;  3DXE A;  2KUQ A;  4QJ3 B;  3V5W A;  4EKU A;  2EC1 A;  1MPH A;  4GPT B;  5LOP B;  2FJU B;  1P5T A;  2K2J A;  3A8P A;  1UNQ A;  2ZKM X;  4Y94 A;  1DDM A;  2GJY A;  2RRF A;  2YT0 A;  2Y8F A;  5EFX A;  2RNR B;  4GMV A;  2D9X A;  1ZC3 B;  1H10 A;  2Y8G A;  1QC6 A;  3QIJ A;  2R0D A;  4K81 A;  2Q13 A;  1UPQ A;  2D4Q A;  3GYO A;  3QWM A;  4A6K A;  1Q67 A;  3AU5 A;  1V88 A;  3DXD A;  2AEH A;  3ODO A;  4YON A;  2D9Y A;  4HDO A;  5D3X A;  2QKM A;  1FGY A;  1MK7 B;  4K17 A;  1OQN A;  5D27 A;  1PFJ A;  1BTK A;  2K00 A;  4GZU A;  5DHA B;  4QJ5 B;  2J59 M;  4DXA B;  2DYQ A;  1NTY A;  2D2Q A;  3A58 A;  1V89 A;  5J3T A;  4GN1 A;  4DBB A;  3FSS A;  2W2X C;  3P6A A;  2CAY A;  3DCX A;  2COF A;  5C5B B;  2W2W A;  4WJ7 A;  2DKP A;  5DHF B;  2XQN M;  3O96 A;  1DDW A;  1MK9 B;  2M38 A;  1KI1 B;  3PEG A;  5IRS A;  2V76 A;  1EF1 A;  1BWN A;  3PG7 A;  1K5G B;  4EMO A;  2DHI A;  3X23 A;  4NSW A;  4WSF A;  2EMS A;  3CXB B;  3PP2 A;  2ADZ A;  4K2P A;  1OY2 A;  4ZRI A;  2COC A;  3SUZ A;  2IYB A;  3OHM B;  2DHJ A;  2MFQ A;  5FI0 A;  4WVF B;  2I1K A;  4A6F A;  1U29 A;  1XOD A;  3U12 A;  3HIE A;  5HE0 A;  2EJ8 A;  2GCJ A;  5I2M A;  4F7H A;  3FVC A;  2KCJ A;  4OT1 A;  3DXC A;  1UEF A;  2R2Y A;  2YS3 A;  3NW8 A;  1W1G A;  5JP4 A;  1PLS A;  2YF0 A;  1MIZ B;  1XCG A;  2D11 A;  5D3V A;  3ZVR A;  1EVH A;  1Y5O A;  1V61 A;  4ZRK A;  2N23 A;  2P0H A;  4GXB A;  3HQC A;  4CHM A;  5HE2 A;  2DX5 A;  2JP2 A;  3SO6 A;  2LUL A;  5KCV A;  1TXD A;  1XKE A;  2DN6 A;  2LG1 A;  3NWF A;  4L6E A;  2RLO A;  5J3Q A;  1MIX A;  2YT1 A;  1XD4 A;  2COD A;  3FM8 C;  3KRW A;  2DLW A;  2DTC A;  4MY6 A;  4IOY X;  4GNK B;  1W1H A;  4GMX B;  1WJ1 A;  4Z2N A;  5JHG A;  4HAZ B;  1U27 A;  1FHO A;  4DX9 0;  1QQG A;  2FJL A;  2D9W A;  1B55 A;  4HB3 B;  4KAX B;  1KZG A;  3ULC A;  1P6S A;  3D8D A;  1V5U A;  1SGH A;  5GOW B;  3F0W A;  1ZVR A;  1X05 A;  1GC6 A;  4QXA B;  2UZS A;  4PQ0 A;  2YVC A;  2DA0 A;  2P8V A;  1ZC4 B;  1E5W A;  1ISN A;  1WVH A;  2RUK B;  1SHC A;  2KR0 A;  2OQB A;  2J0K A;  5FI1 A;  1EAZ A;  2E2X A;  3M1I B;  3A98 B;  2J0J A;  2KGX B;  3ULB A;  1U2B A;  4KHB B;  4L1R A;  2VRW B;  2LYD A;  3D8E A;  3PSC A;  1MI1 A;  3A8Q A;  5LG4 B;  3ML4 A;  4F7G A;  5I2S A;  2VSZ A;  2UVM A;  4TYZ A;  2I5F A;  1TQZ A;  2MWN B;  5CLL B;  4BBK A;  1FHX A;  2ELA A;  2KUP A;  4KHO A;  3BIN A;  3TO1 A;  2MKR A;  3PZD A;  1J19 A;  5KQ4 A;  4A6H A;  3N7C A;  1P3R A;  2ZPY A;  4KVG B;  4B6H A;  4HSI A;  4YL8 A;  3ODW A;  3B77 A;  2Z0O A;  2RSG A;  2CY4 A;  2CRF A;  2DHK A;  3UZT A;  1FAO A;  1TJ6 A;  3KRX A;  2DFK A;  1U5G A;  2K49 A;  4MT7 A;  4A5K A;  4HHV A;  1AWE A;  2LOX A;  1I7A A;  2DYN A;  2I5C A;  5M4Y B;  1Y19 B;  4CHJ A;  2H7D A;  3T06 A;  1V5P A;  3OAN A;  1FGZ A;  3U7D A;  2EMT A;  1LW3 A;  1WI1 A;  2YS1 A;  3U8Z A;  1H4R A;  5LON B;  2R09 A;  1Z87 A;  3TCA A;  2PZ1 A;  3KZ1 A;  2J0M A;  2L1C A;  5C5B A;  5CLQ B;  1M7R A;  3LJU X;  1DYN A;  1FHW A;  1BAK A;  5D3Y A;  2Z14 A;  2ROZ B;  2LOZ A;  3BJI A;  3KY9 A;  2X18 A;  1AQC A;  1K5D B;  5C16 A;  1BTN A;  2YT2 A;  1WG7 A;  3TW1 A;  3VIA A;  2N0Y A;  3P7Z A;  1V5M A;  1U5F A;  1I2H A;  4IAP A;  4OSN A;  5J3Y A;  1EGX A;  2YS5 A;  4P7I A;  1DBH A;  5C6R A;  3ODX A;  4HAU B;  2NMB A;  3RCP A;  2BCJ A;  2ROV A;  4GOU A;  1UNR A;  3TFM A;  3MDB C;  1WJM A;  2GS0 A;  3GYP A;  1ZM0 A;  2Z0P A;  3SNH A;  4CSQ A;  2M14 A;  2OTX A;  3NSU A;  4TKN A;  2ELB A;  2YRY A;  1XR0 B;  4HAW B;  5HE1 A;  1GC7 A;  3G9W A;  4A6F B;  2P0F A;  1ZSQ A;  4HAT B;  5L81 A;  2Z4D A;  1DDV A;  2H7E A;  1N3H A;  2NZ8 B;  2Z13 A;  2HTH B;  1UPR A;  2W2X D;  4D6W A;  2AL6 A;  4ZRJ A;  2UZR A;  3AU4 A;  4HB4 B;  4Z2M B;  1T77 A;  1WGU A;  1FB8 A;  3FEH A;  2IFS A;  4CYE A;  1IRS A;  2D9Z A;  2GUM A;  3SV1 A;  3PVL A;  1M7E A;  2D9V A;  2RVB B;  1PMS A;  4HAX B;  4EJN A;  2HE7 A;  4KHA A;  3IVF A;  1DRO A;  1MAI A;  3ZDT A;  3D8F A;  2G35 A;  2D10 A;  3HSA A;  2L2I A;  4MK0 A;  2QKL A;  2Z0Q A;  5KQ1 A;  3NWD A;  1X11 A;  1U5D A;  2COA A;  2YSZ A;  3QBV B;  2KIE A;  3PVW A;  1NU2 A;  2RGN B;  2MDX A;  2K8E A;  3HW2 B;  1NTV A;  1UNP A;  3TVV A;  2K2U A;  3SYX A;  4IFS A;  3WA0 A;  1XX0 A;  2CY5 A;  1KZ7 A;  1U5E A;  4HB0 B;  5D3W A;  1OMW A;  5JLJ B;  5JHH A;  3CIK A;  5DH9 B;  3NWA A;  4F7U P;  2P0D A;  3VOQ A;  1X1F A;  1NI2 A;  2Y7B A;  4DX8 A;  2VKI A;  2Z59 A;  4KHB A;  3WYF B;  1RJ2 A;  2I1J A;  4NY0 A;  2KIG A;  1WGQ A;  2LKO A;  1LB1 A;  3F5R A;  4D0N B;  4K2O A;  3PVU A;  4HAV B;  3HK0 A;  1FOE A;  1W1D A;  3AJ4 A;  4H8S A;  5DI9 B;  3KSY A;  5C79 A;  1X1G A;  4XWX A;  2DKQ A;  1J0W A;  2NBV A;  4HB2 B;  4HDQ A;  1RRP B;  4HAY B;  4DIX A;  5DIF B;  4C0A A;  1GG3 A;  4QJ4 B;  1X86 A;  2DX1 A;  2GCL A;  3MPX A; 
#chains in the Genus database with same CATH homology
 4PNK A;  5HE3 A;  1MKE A;  3DXE A;  3V5W A;  4EKU A;  2EC1 A;  1MPH A;  4GPT B;  5LOP B;  1P5T A;  2K2J A;  3A8P A;  1UNQ A;  4Y94 A;  1DDM A;  2GJY A;  2YT0 A;  2Y8F A;  5EFX A;  2RNR B;  4GMV A;  2D9X A;  1ZC3 B;  1H10 A;  2Y8G A;  1QC6 A;  3QIJ A;  2R0D A;  4K81 A;  2Q13 A;  1UPQ A;  2D4Q A;  3GYO A;  3QWM A;  4A6K A;  1Q67 A;  3AU5 A;  1V88 A;  3DXD A;  2AEH A;  3ODO A;  4YON A;  2D9Y A;  4HDO A;  5D3X A;  2QKM A;  1FGY A;  1MK7 B;  4K17 A;  1OQN A;  5D27 A;  1PFJ A;  1BTK A;  2K00 A;  4GZU A;  5DHA B;  2J59 M;  4DXA B;  2DYQ A;  1NTY A;  2D2Q A;  1V89 A;  5J3T A;  4GN1 A;  4DBB A;  3FSS A;  2W2X C;  3P6A A;  2CAY A;  2COF A;  5C5B B;  2W2W A;  4WJ7 A;  2DKP A;  5DHF B;  2XQN M;  3O96 A;  1DDW A;  1MK9 B;  2M38 A;  1KI1 B;  3PEG A;  2V76 A;  1EF1 A;  1BWN A;  3PG7 A;  1K5G B;  4EMO A;  2DHI A;  3X23 A;  4NSW A;  4WSF A;  2EMS A;  3CXB B;  3PP2 A;  2ADZ A;  4K2P A;  1OY2 A;  4ZRI A;  2COC A;  3SUZ A;  2IYB A;  2DHJ A;  2MFQ A;  5FI0 A;  4WVF B;  2I1K A;  4A6F A;  1U29 A;  1XOD A;  5HE0 A;  2EJ8 A;  2GCJ A;  4F7H A;  2KCJ A;  3DXC A;  1UEF A;  2YS3 A;  1W1G A;  5JP4 A;  1PLS A;  2YF0 A;  1MIZ B;  1XCG A;  2D11 A;  5D3V A;  3ZVR A;  1EVH A;  1Y5O A;  1V61 A;  4ZRK A;  2N23 A;  2P0H A;  4GXB A;  3HQC A;  4CHM A;  5HE2 A;  2DX5 A;  2JP2 A;  3SO6 A;  2LUL A;  5KCV A;  1TXD A;  1XKE A;  2DN6 A;  2LG1 A;  4L6E A;  2RLO A;  5J3Q A;  1MIX A;  2YT1 A;  1XD4 A;  2COD A;  3FM8 C;  3KRW A;  2DLW A;  2DTC A;  4MY6 A;  4IOY X;  1W1H A;  4GMX B;  1WJ1 A;  4Z2N A;  5JHG A;  4HAZ B;  1U27 A;  1FHO A;  4DX9 0;  1QQG A;  2FJL A;  2D9W A;  1B55 A;  4HB3 B;  4KAX B;  1KZG A;  3ULC A;  1P6S A;  3D8D A;  1V5U A;  1SGH A;  5GOW B;  3F0W A;  1ZVR A;  1X05 A;  1GC6 A;  2UZS A;  4PQ0 A;  2YVC A;  2DA0 A;  2P8V A;  1ZC4 B;  1E5W A;  1ISN A;  1WVH A;  2RUK B;  1SHC A;  2OQB A;  2J0K A;  5FI1 A;  1EAZ A;  2E2X A;  3M1I B;  3A98 B;  2J0J A;  2KGX B;  3ULB A;  1U2B A;  4KHB B;  2VRW B;  2LYD A;  3D8E A;  3PSC A;  3A8Q A;  3ML4 A;  4F7G A;  2VSZ A;  2UVM A;  4TYZ A;  2I5F A;  1TQZ A;  2MWN B;  5CLL B;  4BBK A;  1FHX A;  2ELA A;  2KUP A;  4KHO A;  3BIN A;  3TO1 A;  2MKR A;  3PZD A;  1J19 A;  5KQ4 A;  4A6H A;  3N7C A;  1P3R A;  2ZPY A;  4KVG B;  4B6H A;  4YL8 A;  3ODW A;  2Z0O A;  2RSG A;  2CY4 A;  2CRF A;  2DHK A;  3UZT A;  1FAO A;  1TJ6 A;  3KRX A;  2DFK A;  1U5G A;  4MT7 A;  4A5K A;  4HHV A;  1AWE A;  2LOX A;  1I7A A;  2DYN A;  2I5C A;  1Y19 B;  4CHJ A;  2H7D A;  3T06 A;  1V5P A;  3OAN A;  1FGZ A;  3U7D A;  2EMT A;  1LW3 A;  1WI1 A;  2YS1 A;  3U8Z A;  1H4R A;  5LON B;  2R09 A;  1Z87 A;  3TCA A;  2PZ1 A;  3KZ1 A;  2J0M A;  2L1C A;  5C5B A;  5CLQ B;  1M7R A;  3LJU X;  1DYN A;  1FHW A;  1BAK A;  5D3Y A;  2ROZ B;  2LOZ A;  3BJI A;  3KY9 A;  2X18 A;  1AQC A;  1K5D B;  5C16 A;  1BTN A;  3TW1 A;  1WG7 A;  3VIA A;  2N0Y A;  3P7Z A;  1V5M A;  1U5F A;  1I2H A;  4IAP A;  5J3Y A;  1EGX A;  2YS5 A;  4P7I A;  1DBH A;  5C6R A;  3ODX A;  4HAU B;  2NMB A;  3RCP A;  2BCJ A;  2ROV A;  1UNR A;  3TFM A;  3MDB C;  1WJM A;  2GS0 A;  3GYP A;  1ZM0 A;  2Z0P A;  3SNH A;  2M14 A;  2OTX A;  3NSU A;  4TKN A;  2ELB A;  2YRY A;  1XR0 B;  4HAW B;  5HE1 A;  1GC7 A;  3G9W A;  4A6F B;  2P0F A;  1ZSQ A;  4HAT B;  5L81 A;  1DDV A;  2H7E A;  1N3H A;  2NZ8 B;  2HTH B;  1UPR A;  2W2X D;  2AL6 A;  4ZRJ A;  2UZR A;  3AU4 A;  4HB4 B;  4Z2M B;  1WGU A;  1FB8 A;  3FEH A;  2IFS A;  4CYE A;  1IRS A;  2D9Z A;  3SV1 A;  3PVL A;  1M7E A;  2D9V A;  2RVB B;  1PMS A;  4HAX B;  4EJN A;  2HE7 A;  4KHA A;  3IVF A;  1DRO A;  1MAI A;  3ZDT A;  3D8F A;  2G35 A;  2D10 A;  2L2I A;  4MK0 A;  2QKL A;  2Z0Q A;  5KQ1 A;  1X11 A;  1U5D A;  2COA A;  2YSZ A;  3QBV B;  3PVW A;  1NU2 A;  2RGN B;  2MDX A;  3HW2 B;  1NTV A;  1UNP A;  3TVV A;  2K2U A;  3SYX A;  4IFS A;  3WA0 A;  1XX0 A;  2CY5 A;  1KZ7 A;  1U5E A;  4HB0 B;  5D3W A;  1OMW A;  5JLJ B;  5JHH A;  3CIK A;  5DH9 B;  4F7U P;  2P0D A;  3VOQ A;  1X1F A;  1NI2 A;  2Y7B A;  4DX8 A;  2VKI A;  3WYF B;  1RJ2 A;  2I1J A;  4NY0 A;  1WGQ A;  2LKO A;  1LB1 A;  3F5R A;  4D0N B;  4K2O A;  3PVU A;  4HAV B;  3HK0 A;  1FOE A;  1W1D A;  3AJ4 A;  4H8S A;  5DI9 B;  3KSY A;  5C79 A;  1X1G A;  4XWX A;  2DKQ A;  1J0W A;  4HB2 B;  4HDQ A;  1RRP B;  4HAY B;  5DIF B;  4C0A A;  1GG3 A;  1X86 A;  2DX1 A;  2GCL A;  3MPX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...