1P5TA

Crystal structure of dok1 ptb domain
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
107
structure length
107
Chain Sequence
MGSQFWVTSQKTEASERCGLQGSYILRVEAEKLTLLTLGAQSQILEPLLFWPYTLLRRYGRDKVMFSFEAGRRCPSGPGTFTFQTSQGNDIFQAVEAAIQQQKAQGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Docking protein 1
publication title Structural Basis for the Specific Recognition of RET by the Dok1 Phosphotyrosine Binding Domain
pubmed doi rcsb
source organism Mus musculus
molecule tags Signaling protein
total genus 25
structure length 107
sequence length 107
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-04-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 1p5tA00
1FGZA 5D3YA 3DXCA 1I7AA 2EMSA 1W1HA 2D11A 1XKEA 4HB0B 3QWMA 4WSFA 3A8PA 3ULCA 1K5DB 2VKIA 3U8ZA 2I5FA 2YF0A 1N3HA 3KY9A 2MWNB 5HE0A 4GN1A 1WJMA 3MPXA 3TCAA 4C0AA 1RJ2A 3NSUA 4PNKA 1WI1A 1XD4A 5L81A 1X86A 1B55A 2M38A 4KVGB 2D2QA 1E5WA 1UNPA 4ZRIA 4HAZB 1FAOA 4MT7A 4K17A 4GPTB 2OQBA 2EJ8A 1ZSQA 4PQ0A 2KCJA 5HE2A 1IRSA 3M1IB 1X05A 4BBKA 1U5FA 2L1CA 3KSYA 1X1GA 1XX0A 1U5DA 1Z87A 2GJYA 4KHBB 5JLJB 2YS5A 2P0FA 2P0HA 2W2XD 2D9YA 3T06A 4NY0A 3GYPA 1V5MA 1OY2A 2DLWA 1P5TA 3TVVA 1H4RA 2CY5A 2CRFA 3ZVRA 1SHCA 3P7ZA 3SV1A 1MAIA 2GCLA 2N23A 2Q13A 2D10A 2D9VA 2ROZB 3A8QA 1U5GA 5DI9B 2MKRA 2E2XA 2ELBA 2COAA 3PSCA 2ELAA 4A6HA 4HAYB 3PVLA 3SNHA 3VOQA 1X11A 3U7DA 1K5GB 1ZVRA 2LG1A 4YONA 2N0YA 3V5WA 2NZ8B 1WG7A 2Z0PA 1QQGA 4HDOA 4XWXA 1LW3A 4KHAA 2DTCA 4YL8A 1ZC4B 1Q67A 1MKEA 1WGQA 5J3YA 2CODA 2LOXA 4B6HA 1J19A 3HW2B 3VIAA 5D27A 2VSZA 1GG3A 4H8SA 3SO6A 1J0WA 2H7EA 5LOPB 4ZRKA 3AJ4A 4F7HA 5C5BB 1MIZB 3N7CA 5C16A 4ZRJA 2ROVA 1XCGA 2R0DA 3AU5A 1V61A 1PFJA 1FHOA 3KRXA 3ODXA 4A6FA 3TO1A 5C6RA 3CIKA 5D3XA 2V76A 2XQNM 2YVCA 3PEGA 1U27A 3QBVB 3WYFB 3F0WA 3CXBB 4CHMA 2D9ZA 1AWEA 2Z0QA 4Z2MB 2I5CA 4HAUB 2CAYA 3P6AA 2J0MA 2DN6A 3HK0A 2YS3A 3TFMA 1DDWA 2DYQA 2Z0OA 2BCJA 3TW1A 1FHWA 1UNQA 3SUZA 4TYZA 2NMBA 1X1FA 5EFXA 2P8VA 1KZ7A 5DIFB 3O96A 3LJUX 1PMSA 5FI1A 4D0NB 1U5EA 4F7UP 5DHAB 1UNRA 2HE7A 1BWNA 1MK9B 3F5RA 2UZSA 5LONB 1P3RA 1LB1A 1BAKA 1TJ6A 1DROA 5JHGA 4WJ7A 4EKUA 2COCA 2LKOA 3G9WA 4CYEA 4GMXB 1RRPB 2D9XA 4F7GA 3ODWA 4NSWA 2PZ1A 1EF1A 1SGHA 3ULBA 2RSGA 2IFSA 1MPHA 4IFSA 4KHOA 1PLSA 2YS1A 2MFQA 5HE3A 4CHJA 1QC6A 4P7IA 2K00A 2G35A 1FOEA 2YSZA 2DX5A 1EVHA 1XODA 1XR0B 4MY6A 2RGNB 3KZ1A 4DXAB 4DX90 4IOYX 2W2WA 4K2PA 3BINA 4WVFB 1EGXA 3GYOA 2ZPYA 1MIXA 2VRWB 4HAXB 2P0DA 1KI1B 3FSSA 1NTYA 2DYNA 3DXEA 2Y7BA 5KQ4A 4GMVA 3PVUA 1U2BA 1UPRA 2R09A 1GC7A 2I1KA 1DDVA 2DKQA 4GXBA 2IYBA 4TKNA 5J3QA 4Y94A 2GS0A 2DHKA 2EMTA 2RVBB 2COFA 4HB3B 3X23A 2DKPA 2J0JA 2Y8FA 4HHVA 5JP4A 3PG7A 5C5BA 1NI2A 1EAZA 3FEHA 4EMOA 1WJ1A 4EJNA 2Y8GA 2I1JA 3WA0A 1W1GA 2MDXA 4DX8A 3D8EA 4A5KA 5JHHA 2KGXB 5CLQB 4K2OA 5HE1A 4KAXB 1OQNA 2DA0A 1M7RA 2D9WA 4HAVB 1FHXA 1KZGA 4GZUA 2KUPA 3UZTA 3BJIA 3KRWA 1H10A 4K81A 4L6EA 3PP2A 2K2JA 1BTKA 1DBHA 2UVMA 1DDMA 2JP2A 1NU2A 2RLOA 3PZDA 5D3WA 1W1DA 2FJLA 1WVHA 1V88A 3HQCA 2X18A 2GCJA 1Y5OA 3PVWA 4DBBA 1FGYA 1V5PA 3ZDTA 1I2HA 2OTXA 3QIJA 1FB8A 2YT1A 3SYXA 4HB2B 1DYNA 3MDBC 2LULA 2H7DA 2D4QA 1GC6A 5DH9B 1Y19B 1OMWA 2AL6A 1WGUA 3D8DA 2CY4A 2LOZA 4Z2NA 1BTNA 5J3TA 1AQCA 1TXDA 2DHIA 5FI0A 1MK7B 2DFKA 5CLLB 2QKMA 4HATB 4HAWB 2DHJA 2YRYA 1TQZA 1UEFA 2UZRA 2ADZA 4HDQA 1V89A 1ZM0A 2HTHB 2RUKB 4A6FB 3OANA 1P6SA 2DX1A 5D3VA 1NTVA 3DXDA 5KQ1A 5DHFB 1ZC3B 3FM8C 1V5UA 2J0KA 1U29A 3RCPA 2W2XC 3ML4A 2M14A 3ODOA 5KCVA 2K2UA 3AU4A 1M7EA 2AEHA 2EC1A 3A98B 4IAPA 4HB4B 1ISNA 2QKLA 2LYDA 3IVFA 4A6KA 5C79A 4MK0A 3D8FA 2J59M 5GOWB 2RNRB 2YT0A 2L2IA 1UPQA
chains in the Genus database with same CATH superfamily
1FGZA 5D3YA 3DXCA 2K8EA 1I7AA 2EMSA 1W1HA 2D11A 1XKEA 2KIGA 2Z59A 4HB0B 3QWMA 4HSIA 4WSFA 3A8PA 3ULCA 1K5DB 2VKIA 3U8ZA 2I5FA 2YF0A 1N3HA 3KY9A 2MWNB 5HE0A 4GN1A 1WJMA 3MPXA 3TCAA 4C0AA 1RJ2A 3NSUA 4PNKA 1WI1A 1XD4A 5L81A 1X86A 4GNKB 1B55A 2M38A 4KVGB 2D2QA 1E5WA 1UNPA 3DCXA 4HAZB 4ZRIA 1FAOA 4MT7A 4K17A 4GPTB 2OQBA 2EJ8A 1ZSQA 4PQ0A 2Z4DA 2KCJA 5HE2A 1IRSA 3M1IB 1X05A 4BBKA 1U5FA 2L1CA 3KSYA 1X1GA 1XX0A 1U5DA 1Z87A 2GJYA 4KHBB 5JLJB 2YS5A 2P0FA 2P0HA 2W2XD 2D9YA 3T06A 4NY0A 4QJ4B 3GYPA 1V5MA 1OY2A 2DLWA 1P5TA 3TVVA 1H4RA 2CY5A 2CRFA 3ZVRA 1SHCA 3P7ZA 3SV1A 1MAIA 2GCLA 2N23A 2Q13A 2D10A 2D9VA 2ROZB 3A8QA 1U5GA 5DI9B 2MKRA 2E2XA 2ELBA 2COAA 3PSCA 2ELAA 4A6HA 3B77A 5M4YB 4HAYB 1T77A 3PVLA 3SNHA 3VOQA 1X11A 3U7DA 1K5GB 1ZVRA 5IRSA 2LG1A 4YONA 2N0YA 3V5WA 2NZ8B 1WG7A 2Z0PA 3A58A 1QQGA 4HDOA 4XWXA 1LW3A 4KHAA 2DTCA 4YL8A 1ZC4B 1Q67A 1MKEA 3HIEA 1WGQA 5J3YA 2CODA 2LOXA 4L1RA 4B6HA 5I2MA 1J19A 2KIEA 3HW2B 3VIAA 5D27A 2VSZA 1GG3A 4H8SA 4GOUA 3SO6A 3OHMB 1J0WA 2H7EA 5LOPB 4ZRKA 3AJ4A 4F7HA 5C5BB 3NWFA 1MIZB 3N7CA 5C16A 4ZRJA 2ROVA 1XCGA 2R0DA 3AU5A 1V61A 1PFJA 1FHOA 3KRXA 3ODXA 4A6FA 3TO1A 5C6RA 3CIKA 5D3XA 2V76A 2XQNM 2GUMA 2YVCA 3PEGA 1U27A 3QBVB 3WYFB 3F0WA 3CXBB 4CHMA 4OT1A 2D9ZA 2NBVA 1AWEA 2Z0QA 4Z2MB 2I5CA 4HAUB 2CAYA 3P6AA 2J0MA 2DN6A 3HK0A 2YS3A 3TFMA 4CSQA 1DDWA 2DYQA 2Z0OA 2BCJA 3TW1A 1FHWA 1UNQA 3SUZA 1ZYIA 4TYZA 2NMBA 1X1FA 1UPQA 5EFXA 2P8VA 1KZ7A 5DIFB 3O96A 3LJUX 3FVCA 1PMSA 5FI1A 4D0NB 1U5EA 4F7UP 5DHAB 1UNRA 5LG4B 2HE7A 2RRFA 1BWNA 1MK9B 3F5RA 2UZSA 5LONB 1P3RA 1LB1A 1BAKA 1TJ6A 1DROA 5JHGA 4WJ7A 4EKUA 2COCA 2LKOA 3G9WA 4CYEA 4GMXB 1RRPB 4KHBA 2D9XA 4F7GA 2KUQA 3ODWA 4NSWA 2PZ1A 1EF1A 1SGHA 3ULBA 2RSGA 2IFSA 1MPHA 4IFSA 4KHOA 1PLSA 2YS1A 2MFQA 5HE3A 4CHJA 1QC6A 4P7IA 2K00A 2YT2A 2G35A 1FOEA 2YSZA 2DX5A 1EVHA 1XODA 1XR0B 4MY6A 2RGNB 3KZ1A 4DXAB 4DX90 4IOYX 2W2WA 4K2PA 3BINA 4WVFB 1EGXA 3GYOA 2ZPYA 1MIXA 2FJUB 2VRWB 4HAXB 2P0DA 1KI1B 3FSSA 1NTYA 2DYNA 3DXEA 2Y7BA 5KQ4A 4GMVA 3PVUA 1U2BA 1UPRA 3NWAA 2R09A 1GC7A 3HSAA 2I1KA 1DDVA 2DKQA 4GXBA 2IYBA 4QJ3B 4TKNA 4QJ5B 4Y94A 5J3QA 2GS0A 2DHKA 2EMTA 2RVBB 2COFA 4HB3B 3X23A 2DKPA 2J0JA 2Y8FA 4HHVA 5JP4A 3PG7A 5C5BA 1NI2A 3NWDA 4QXAB 1EAZA 3FEHA 4EMOA 1WJ1A 3U12A 4EJNA 2Y8GA 2I1JA 3WA0A 1W1GA 2MDXA 4DX8A 3D8EA 4A5KA 5JHHA 4D6WA 2KGXB 5CLQB 4K2OA 5HE1A 4KAXB 1OQNA 2DA0A 1M7RA 2D9WA 4HAVB 1FHXA 1KZGA 4DIXA 2ZKMX 4GZUA 2KUPA 3UZTA 3BJIA 3KRWA 1H10A 4K81A 4L6EA 3PP2A 2K2JA 2Z14A 1BTKA 1DBHA 2UVMA 1DDMA 2JP2A 1NU2A 2RLOA 3PZDA 5D3WA 1W1DA 2FJLA 1WVHA 1V88A 3HQCA 2X18A 2GCJA 1Y5OA 3PVWA 4DBBA 1FGYA 1V5PA 3ZDTA 1I2HA 2OTXA 3QIJA 1FB8A 2YT1A 3SYXA 4HB2B 1DYNA 3MDBC 2LULA 2H7DA 2D4QA 1GC6A 5DH9B 1Y19B 1OMWA 2AL6A 1MI1A 1WGUA 3D8DA 2CY4A 2LOZA 4Z2NA 1BTNA 5J3TA 1AQCA 1TXDA 2DHIA 5FI0A 1MK7B 2DFKA 5CLLB 2QKMA 4HATB 4HAWB 2DHJA 2YRYA 1TQZA 1UEFA 5I2SA 2UZRA 2ADZA 4HDQA 4OSNA 1V89A 1ZM0A 2HTHB 2RUKB 3NW8A 4A6FB 3OANA 1P6SA 2DX1A 5D3VA 1NTVA 2R2YA 3DXDA 5KQ1A 5DHFB 1ZC3B 3FM8C 2Z13A 1V5UA 2J0KA 1U29A 3RCPA 2W2XC 3ML4A 2M14A 3ODOA 5KCVA 2K2UA 3AU4A 1M7EA 2AEHA 2EC1A 3A98B 4IAPA 4HB4B 1ISNA 2K49A 2QKLA 2LYDA 3IVFA 4A6KA 5C79A 4MK0A 3D8FA 2J59M 5GOWB 2RNRB 2YT0A 2L2IA 2KR0A
chains in the Genus database with same CATH topology
1FGZA 5D3YA 3DXCA 1I7AA 2EMSA 1W1HA 2D11A 1XKEA 4HB0B 3QWMA 4WSFA 3A8PA 3ULCA 1K5DB 2VKIA 3U8ZA 2I5FA 2YF0A 1N3HA 3KY9A 2MWNB 5HE0A 4GN1A 1WJMA 3MPXA 3TCAA 4C0AA 1RJ2A 3NSUA 4PNKA 1WI1A 1XD4A 5L81A 1X86A 1B55A 2M38A 4KVGB 2D2QA 1E5WA 1UNPA 4ZRIA 4HAZB 1FAOA 4MT7A 4K17A 4GPTB 2OQBA 2EJ8A 1ZSQA 4PQ0A 2KCJA 5HE2A 1IRSA 3M1IB 1X05A 4BBKA 1U5FA 2L1CA 3KSYA 1X1GA 1XX0A 1U5DA 1Z87A 2GJYA 4KHBB 5JLJB 2YS5A 2P0FA 2P0HA 2W2XD 2D9YA 3T06A 4NY0A 3GYPA 1V5MA 1OY2A 2DLWA 1P5TA 3TVVA 1H4RA 2CY5A 2CRFA 3ZVRA 1SHCA 3P7ZA 3SV1A 1MAIA 2GCLA 2N23A 2Q13A 2D10A 2D9VA 2ROZB 3A8QA 1U5GA 5DI9B 2MKRA 2E2XA 2ELBA 2COAA 3PSCA 2ELAA 4A6HA 4HAYB 3PVLA 3SNHA 3VOQA 1X11A 3U7DA 1K5GB 1ZVRA 2LG1A 4YONA 2N0YA 3V5WA 2NZ8B 1WG7A 2Z0PA 1QQGA 4HDOA 4XWXA 1LW3A 4KHAA 2DTCA 4YL8A 1ZC4B 1Q67A 1MKEA 1WGQA 5J3YA 2CODA 2LOXA 4B6HA 1J19A 3HW2B 3VIAA 5D27A 2VSZA 1GG3A 4H8SA 3SO6A 1J0WA 2H7EA 5LOPB 4ZRKA 3AJ4A 4F7HA 5C5BB 1MIZB 3N7CA 5C16A 4ZRJA 2ROVA 1XCGA 2R0DA 3AU5A 1V61A 1PFJA 1FHOA 3KRXA 3ODXA 4A6FA 3TO1A 5C6RA 3CIKA 5D3XA 2V76A 2XQNM 2YVCA 3PEGA 1U27A 3QBVB 3WYFB 3F0WA 3CXBB 4CHMA 2D9ZA 1AWEA 2Z0QA 4Z2MB 2I5CA 4HAUB 2CAYA 3P6AA 2J0MA 2DN6A 3HK0A 2YS3A 3TFMA 1DDWA 2DYQA 2Z0OA 2BCJA 3TW1A 1FHWA 1UNQA 3SUZA 4TYZA 2NMBA 1X1FA 5EFXA 2P8VA 1KZ7A 5DIFB 3O96A 3LJUX 1PMSA 5FI1A 4D0NB 1U5EA 4F7UP 5DHAB 1UNRA 2HE7A 1BWNA 1MK9B 3F5RA 2UZSA 5LONB 1P3RA 1LB1A 1BAKA 1TJ6A 1DROA 5JHGA 4WJ7A 4EKUA 2COCA 2LKOA 3G9WA 4CYEA 4GMXB 1RRPB 2D9XA 4F7GA 3ODWA 4NSWA 2PZ1A 1EF1A 1SGHA 3ULBA 2RSGA 2IFSA 1MPHA 4IFSA 4KHOA 1PLSA 2YS1A 2MFQA 5HE3A 4CHJA 1QC6A 4P7IA 2K00A 2G35A 1FOEA 2YSZA 2DX5A 1EVHA 1XODA 1XR0B 4MY6A 2RGNB 3KZ1A 4DXAB 4DX90 4IOYX 2W2WA 4K2PA 3BINA 4WVFB 1EGXA 3GYOA 2ZPYA 1MIXA 2VRWB 4HAXB 2P0DA 1KI1B 3FSSA 1NTYA 2DYNA 3DXEA 2Y7BA 5KQ4A 4GMVA 3PVUA 1U2BA 1UPRA 2R09A 1GC7A 2I1KA 1DDVA 2DKQA 4GXBA 2IYBA 4TKNA 5J3QA 4Y94A 2GS0A 2DHKA 2EMTA 2RVBB 2COFA 4HB3B 3X23A 2DKPA 2J0JA 2Y8FA 4HHVA 5JP4A 3PG7A 5C5BA 1NI2A 1EAZA 3FEHA 4EMOA 1WJ1A 4EJNA 2Y8GA 2I1JA 3WA0A 1W1GA 2MDXA 4DX8A 3D8EA 4A5KA 5JHHA 2KGXB 5CLQB 4K2OA 5HE1A 4KAXB 1OQNA 2DA0A 1M7RA 2D9WA 4HAVB 1FHXA 1KZGA 4GZUA 2KUPA 3UZTA 3BJIA 3KRWA 1H10A 4K81A 4L6EA 3PP2A 2K2JA 1BTKA 1DBHA 2UVMA 1DDMA 2JP2A 1NU2A 2RLOA 3PZDA 5D3WA 1W1DA 2FJLA 1WVHA 1V88A 3HQCA 2X18A 2GCJA 1Y5OA 3PVWA 4DBBA 1FGYA 1V5PA 3ZDTA 1I2HA 2OTXA 3QIJA 1FB8A 2YT1A 3SYXA 4HB2B 1DYNA 3MDBC 2LULA 2H7DA 2D4QA 1GC6A 5DH9B 1Y19B 1OMWA 2AL6A 1WGUA 3D8DA 2CY4A 2LOZA 4Z2NA 1BTNA 5J3TA 1AQCA 1TXDA 2DHIA 5FI0A 1MK7B 2DFKA 5CLLB 2QKMA 4HATB 4HAWB 2DHJA 2YRYA 1TQZA 1UEFA 2UZRA 2ADZA 4HDQA 1V89A 1ZM0A 2HTHB 2RUKB 4A6FB 3OANA 1P6SA 2DX1A 5D3VA 1NTVA 3DXDA 5KQ1A 5DHFB 1ZC3B 3FM8C 1V5UA 2J0KA 1U29A 3RCPA 2W2XC 3ML4A 2M14A 3ODOA 5KCVA 2K2UA 3AU4A 1M7EA 2AEHA 2EC1A 3A98B 4IAPA 4HB4B 1ISNA 2QKLA 2LYDA 3IVFA 4A6KA 5C79A 4MK0A 3D8FA 2J59M 5GOWB 2RNRB 2YT0A 2L2IA 1UPQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FGZ A;  5D3Y A;  3DXC A;  1I7A A;  2EMS A;  1W1H A;  2D11 A;  1XKE A;  4HB0 B;  3QWM A;  4WSF A;  3A8P A;  3ULC A;  1K5D B;  2VKI A;  3U8Z A;  2I5F A;  2YF0 A;  1N3H A;  3KY9 A;  2MWN B;  5HE0 A;  4GN1 A;  1WJM A;  3MPX A;  3TCA A;  4C0A A;  1RJ2 A;  3NSU A;  4PNK A;  1WI1 A;  1XD4 A;  5L81 A;  1X86 A;  1B55 A;  2M38 A;  4KVG B;  2D2Q A;  1E5W A;  1UNP A;  4ZRI A;  4HAZ B;  1FAO A;  4MT7 A;  4K17 A;  4GPT B;  2OQB A;  2EJ8 A;  1ZSQ A;  4PQ0 A;  2KCJ A;  5HE2 A;  1IRS A;  3M1I B;  1X05 A;  4BBK A;  1U5F A;  2L1C A;  3KSY A;  1X1G A;  1XX0 A;  1U5D A;  1Z87 A;  2GJY A;  4KHB B;  5JLJ B;  2YS5 A;  2P0F A;  2P0H A;  2W2X D;  2D9Y A;  3T06 A;  4NY0 A;  3GYP A;  1V5M A;  1OY2 A;  2DLW A;  1P5T A;  3TVV A;  1H4R A;  2CY5 A;  2CRF A;  3ZVR A;  1SHC A;  3P7Z A;  3SV1 A;  1MAI A;  2GCL A;  2N23 A;  2Q13 A;  2D10 A;  2D9V A;  2ROZ B;  3A8Q A;  1U5G A;  5DI9 B;  2MKR A;  2E2X A;  2ELB A;  2COA A;  3PSC A;  2ELA A;  4A6H A;  4HAY B;  3PVL A;  3SNH A;  3VOQ A;  1X11 A;  3U7D A;  1K5G B;  1ZVR A;  2LG1 A;  4YON A;  2N0Y A;  3V5W A;  2NZ8 B;  1WG7 A;  2Z0P A;  1QQG A;  4HDO A;  4XWX A;  1LW3 A;  4KHA A;  2DTC A;  4YL8 A;  1ZC4 B;  1Q67 A;  1MKE A;  1WGQ A;  5J3Y A;  2COD A;  2LOX A;  4B6H A;  1J19 A;  3HW2 B;  3VIA A;  5D27 A;  2VSZ A;  1GG3 A;  4H8S A;  3SO6 A;  1J0W A;  2H7E A;  5LOP B;  4ZRK A;  3AJ4 A;  4F7H A;  5C5B B;  1MIZ B;  3N7C A;  5C16 A;  4ZRJ A;  2ROV A;  1XCG A;  2R0D A;  3AU5 A;  1V61 A;  1PFJ A;  1FHO A;  3KRX A;  3ODX A;  4A6F A;  3TO1 A;  5C6R A;  3CIK A;  5D3X A;  2V76 A;  2XQN M;  2YVC A;  3PEG A;  1U27 A;  3QBV B;  3WYF B;  3F0W A;  3CXB B;  4CHM A;  2D9Z A;  1AWE A;  2Z0Q A;  4Z2M B;  2I5C A;  4HAU B;  2CAY A;  3P6A A;  2J0M A;  2DN6 A;  3HK0 A;  2YS3 A;  3TFM A;  1DDW A;  2DYQ A;  2Z0O A;  2BCJ A;  3TW1 A;  1FHW A;  1UNQ A;  3SUZ A;  4TYZ A;  2NMB A;  1X1F A;  5EFX A;  2P8V A;  1KZ7 A;  5DIF B;  3O96 A;  3LJU X;  1PMS A;  5FI1 A;  4D0N B;  1U5E A;  4F7U P;  5DHA B;  1UNR A;  2HE7 A;  1BWN A;  1MK9 B;  3F5R A;  2UZS A;  5LON B;  1P3R A;  1LB1 A;  1BAK A;  1TJ6 A;  1DRO A;  5JHG A;  4WJ7 A;  4EKU A;  2COC A;  2LKO A;  3G9W A;  4CYE A;  4GMX B;  1RRP B;  2D9X A;  4F7G A;  3ODW A;  4NSW A;  2PZ1 A;  1EF1 A;  1SGH A;  3ULB A;  2RSG A;  2IFS A;  1MPH A;  4IFS A;  4KHO A;  1PLS A;  2YS1 A;  2MFQ A;  5HE3 A;  4CHJ A;  1QC6 A;  4P7I A;  2K00 A;  2G35 A;  1FOE A;  2YSZ A;  2DX5 A;  1EVH A;  1XOD A;  1XR0 B;  4MY6 A;  2RGN B;  3KZ1 A;  4DXA B;  4DX9 0;  4IOY X;  2W2W A;  4K2P A;  3BIN A;  4WVF B;  1EGX A;  3GYO A;  2ZPY A;  1MIX A;  2VRW B;  4HAX B;  2P0D A;  1KI1 B;  3FSS A;  1NTY A;  2DYN A;  3DXE A;  2Y7B A;  5KQ4 A;  4GMV A;  3PVU A;  1U2B A;  1UPR A;  2R09 A;  1GC7 A;  2I1K A;  1DDV A;  2DKQ A;  4GXB A;  2IYB A;  4TKN A;  5J3Q A;  4Y94 A;  2GS0 A;  2DHK A;  2EMT A;  2RVB B;  2COF A;  4HB3 B;  3X23 A;  2DKP A;  2J0J A;  2Y8F A;  4HHV A;  5JP4 A;  3PG7 A;  5C5B A;  1NI2 A;  1EAZ A;  3FEH A;  4EMO A;  1WJ1 A;  4EJN A;  2Y8G A;  2I1J A;  3WA0 A;  1W1G A;  2MDX A;  4DX8 A;  3D8E A;  4A5K A;  5JHH A;  2KGX B;  5CLQ B;  4K2O A;  5HE1 A;  4KAX B;  1OQN A;  2DA0 A;  1M7R A;  2D9W A;  4HAV B;  1FHX A;  1KZG A;  4GZU A;  2KUP A;  3UZT A;  3BJI A;  3KRW A;  1H10 A;  4K81 A;  4L6E A;  3PP2 A;  2K2J A;  1BTK A;  1DBH A;  2UVM A;  1DDM A;  2JP2 A;  1NU2 A;  2RLO A;  3PZD A;  5D3W A;  1W1D A;  2FJL A;  1WVH A;  1V88 A;  3HQC A;  2X18 A;  2GCJ A;  1Y5O A;  3PVW A;  4DBB A;  1FGY A;  1V5P A;  3ZDT A;  1I2H A;  2OTX A;  3QIJ A;  1FB8 A;  2YT1 A;  3SYX A;  4HB2 B;  1DYN A;  3MDB C;  2LUL A;  2H7D A;  2D4Q A;  1GC6 A;  5DH9 B;  1Y19 B;  1OMW A;  2AL6 A;  1WGU A;  3D8D A;  2CY4 A;  2LOZ A;  4Z2N A;  1BTN A;  5J3T A;  1AQC A;  1TXD A;  2DHI A;  5FI0 A;  1MK7 B;  2DFK A;  5CLL B;  2QKM A;  4HAT B;  4HAW B;  2DHJ A;  2YRY A;  1TQZ A;  1UEF A;  2UZR A;  2ADZ A;  4HDQ A;  1V89 A;  1ZM0 A;  2HTH B;  2RUK B;  4A6F B;  3OAN A;  1P6S A;  2DX1 A;  5D3V A;  1NTV A;  3DXD A;  5KQ1 A;  5DHF B;  1ZC3 B;  3FM8 C;  1V5U A;  2J0K A;  1U29 A;  3RCP A;  2W2X C;  3ML4 A;  2M14 A;  3ODO A;  5KCV A;  2K2U A;  3AU4 A;  1M7E A;  2AEH A;  2EC1 A;  3A98 B;  4IAP A;  4HB4 B;  1ISN A;  2QKL A;  2LYD A;  3IVF A;  4A6K A;  5C79 A;  4MK0 A;  3D8F A;  2J59 M;  5GOW B;  2RNR B;  2YT0 A;  2L2I A;  1UPQ A; 
#chains in the Genus database with same CATH topology
 1FGZ A;  5D3Y A;  3DXC A;  2K8E A;  1I7A A;  2EMS A;  1W1H A;  2D11 A;  1XKE A;  2KIG A;  2Z59 A;  4HB0 B;  3QWM A;  4HSI A;  4WSF A;  3A8P A;  3ULC A;  1K5D B;  2VKI A;  3U8Z A;  2I5F A;  2YF0 A;  1N3H A;  3KY9 A;  2MWN B;  5HE0 A;  4GN1 A;  1WJM A;  3MPX A;  3TCA A;  4C0A A;  1RJ2 A;  3NSU A;  4PNK A;  1WI1 A;  1XD4 A;  5L81 A;  1X86 A;  4GNK B;  1B55 A;  2M38 A;  4KVG B;  2D2Q A;  1E5W A;  1UNP A;  3DCX A;  4HAZ B;  4ZRI A;  1FAO A;  4MT7 A;  4K17 A;  4GPT B;  2OQB A;  2EJ8 A;  1ZSQ A;  4PQ0 A;  2Z4D A;  2KCJ A;  5HE2 A;  1IRS A;  3M1I B;  1X05 A;  4BBK A;  1U5F A;  2L1C A;  3KSY A;  1X1G A;  1XX0 A;  1U5D A;  1Z87 A;  2GJY A;  4KHB B;  5JLJ B;  2YS5 A;  2P0F A;  2P0H A;  2W2X D;  2D9Y A;  3T06 A;  4NY0 A;  4QJ4 B;  3GYP A;  1V5M A;  1OY2 A;  2DLW A;  1P5T A;  3TVV A;  1H4R A;  2CY5 A;  2CRF A;  3ZVR A;  1SHC A;  3P7Z A;  3SV1 A;  1MAI A;  2GCL A;  2N23 A;  2Q13 A;  2D10 A;  2D9V A;  2ROZ B;  3A8Q A;  1U5G A;  5DI9 B;  2MKR A;  2E2X A;  2ELB A;  2COA A;  3PSC A;  2ELA A;  4A6H A;  3B77 A;  5M4Y B;  4HAY B;  1T77 A;  3PVL A;  3SNH A;  3VOQ A;  1X11 A;  3U7D A;  1K5G B;  1ZVR A;  5IRS A;  2LG1 A;  4YON A;  2N0Y A;  3V5W A;  2NZ8 B;  1WG7 A;  2Z0P A;  3A58 A;  1QQG A;  4HDO A;  4XWX A;  1LW3 A;  4KHA A;  2DTC A;  4YL8 A;  1ZC4 B;  1Q67 A;  1MKE A;  3HIE A;  1WGQ A;  5J3Y A;  2COD A;  2LOX A;  4L1R A;  4B6H A;  5I2M A;  1J19 A;  2KIE A;  3HW2 B;  3VIA A;  5D27 A;  2VSZ A;  1GG3 A;  4H8S A;  4GOU A;  3SO6 A;  3OHM B;  1J0W A;  2H7E A;  5LOP B;  4ZRK A;  3AJ4 A;  4F7H A;  5C5B B;  3NWF A;  1MIZ B;  3N7C A;  5C16 A;  4ZRJ A;  2ROV A;  1XCG A;  2R0D A;  3AU5 A;  1V61 A;  1PFJ A;  1FHO A;  3KRX A;  3ODX A;  4A6F A;  3TO1 A;  5C6R A;  3CIK A;  5D3X A;  2V76 A;  2XQN M;  2GUM A;  2YVC A;  3PEG A;  1U27 A;  3QBV B;  3WYF B;  3F0W A;  3CXB B;  4CHM A;  4OT1 A;  2D9Z A;  2NBV A;  1AWE A;  2Z0Q A;  4Z2M B;  2I5C A;  4HAU B;  2CAY A;  3P6A A;  2J0M A;  2DN6 A;  3HK0 A;  2YS3 A;  3TFM A;  4CSQ A;  1DDW A;  2DYQ A;  2Z0O A;  2BCJ A;  3TW1 A;  1FHW A;  1UNQ A;  3SUZ A;  1ZYI A;  4TYZ A;  2NMB A;  1X1F A;  1UPQ A;  5EFX A;  2P8V A;  1KZ7 A;  5DIF B;  3O96 A;  3LJU X;  3FVC A;  1PMS A;  5FI1 A;  4D0N B;  1U5E A;  4F7U P;  5DHA B;  1UNR A;  5LG4 B;  2HE7 A;  2RRF A;  1BWN A;  1MK9 B;  3F5R A;  2UZS A;  5LON B;  1P3R A;  1LB1 A;  1BAK A;  1TJ6 A;  1DRO A;  5JHG A;  4WJ7 A;  4EKU A;  2COC A;  2LKO A;  3G9W A;  4CYE A;  4GMX B;  1RRP B;  4KHB A;  2D9X A;  4F7G A;  2KUQ A;  3ODW A;  4NSW A;  2PZ1 A;  1EF1 A;  1SGH A;  3ULB A;  2RSG A;  2IFS A;  1MPH A;  4IFS A;  4KHO A;  1PLS A;  2YS1 A;  2MFQ A;  5HE3 A;  4CHJ A;  1QC6 A;  4P7I A;  2K00 A;  2YT2 A;  2G35 A;  1FOE A;  2YSZ A;  2DX5 A;  1EVH A;  1XOD A;  1XR0 B;  4MY6 A;  2RGN B;  3KZ1 A;  4DXA B;  4DX9 0;  4IOY X;  2W2W A;  4K2P A;  3BIN A;  4WVF B;  1EGX A;  3GYO A;  2ZPY A;  1MIX A;  2FJU B;  2VRW B;  4HAX B;  2P0D A;  1KI1 B;  3FSS A;  1NTY A;  2DYN A;  3DXE A;  2Y7B A;  5KQ4 A;  4GMV A;  3PVU A;  1U2B A;  1UPR A;  3NWA A;  2R09 A;  1GC7 A;  3HSA A;  2I1K A;  1DDV A;  2DKQ A;  4GXB A;  2IYB A;  4QJ3 B;  4TKN A;  4QJ5 B;  4Y94 A;  5J3Q A;  2GS0 A;  2DHK A;  2EMT A;  2RVB B;  2COF A;  4HB3 B;  3X23 A;  2DKP A;  2J0J A;  2Y8F A;  4HHV A;  5JP4 A;  3PG7 A;  5C5B A;  1NI2 A;  3NWD A;  4QXA B;  1EAZ A;  3FEH A;  4EMO A;  1WJ1 A;  3U12 A;  4EJN A;  2Y8G A;  2I1J A;  3WA0 A;  1W1G A;  2MDX A;  4DX8 A;  3D8E A;  4A5K A;  5JHH A;  4D6W A;  2KGX B;  5CLQ B;  4K2O A;  5HE1 A;  4KAX B;  1OQN A;  2DA0 A;  1M7R A;  2D9W A;  4HAV B;  1FHX A;  1KZG A;  4DIX A;  2ZKM X;  4GZU A;  2KUP A;  3UZT A;  3BJI A;  3KRW A;  1H10 A;  4K81 A;  4L6E A;  3PP2 A;  2K2J A;  2Z14 A;  1BTK A;  1DBH A;  2UVM A;  1DDM A;  2JP2 A;  1NU2 A;  2RLO A;  3PZD A;  5D3W A;  1W1D A;  2FJL A;  1WVH A;  1V88 A;  3HQC A;  2X18 A;  2GCJ A;  1Y5O A;  3PVW A;  4DBB A;  1FGY A;  1V5P A;  3ZDT A;  1I2H A;  2OTX A;  3QIJ A;  1FB8 A;  2YT1 A;  3SYX A;  4HB2 B;  1DYN A;  3MDB C;  2LUL A;  2H7D A;  2D4Q A;  1GC6 A;  5DH9 B;  1Y19 B;  1OMW A;  2AL6 A;  1MI1 A;  1WGU A;  3D8D A;  2CY4 A;  2LOZ A;  4Z2N A;  1BTN A;  5J3T A;  1AQC A;  1TXD A;  2DHI A;  5FI0 A;  1MK7 B;  2DFK A;  5CLL B;  2QKM A;  4HAT B;  4HAW B;  2DHJ A;  2YRY A;  1TQZ A;  1UEF A;  5I2S A;  2UZR A;  2ADZ A;  4HDQ A;  4OSN A;  1V89 A;  1ZM0 A;  2HTH B;  2RUK B;  3NW8 A;  4A6F B;  3OAN A;  1P6S A;  2DX1 A;  5D3V A;  1NTV A;  2R2Y A;  3DXD A;  5KQ1 A;  5DHF B;  1ZC3 B;  3FM8 C;  2Z13 A;  1V5U A;  2J0K A;  1U29 A;  3RCP A;  2W2X C;  3ML4 A;  2M14 A;  3ODO A;  5KCV A;  2K2U A;  3AU4 A;  1M7E A;  2AEH A;  2EC1 A;  3A98 B;  4IAP A;  4HB4 B;  1ISN A;  2K49 A;  2QKL A;  2LYD A;  3IVF A;  4A6K A;  5C79 A;  4MK0 A;  3D8F A;  2J59 M;  5GOW B;  2RNR B;  2YT0 A;  2L2I A;  2KR0 A; 
#chains in the Genus database with same CATH homology
 1FGZ A;  5D3Y A;  3DXC A;  1I7A A;  2EMS A;  1W1H A;  2D11 A;  1XKE A;  4HB0 B;  3QWM A;  4WSF A;  3A8P A;  3ULC A;  1K5D B;  2VKI A;  3U8Z A;  2I5F A;  2YF0 A;  1N3H A;  3KY9 A;  2MWN B;  5HE0 A;  4GN1 A;  1WJM A;  3MPX A;  3TCA A;  4C0A A;  1RJ2 A;  3NSU A;  4PNK A;  1WI1 A;  1XD4 A;  5L81 A;  1X86 A;  1B55 A;  2M38 A;  4KVG B;  2D2Q A;  1E5W A;  1UNP A;  4ZRI A;  4HAZ B;  1FAO A;  4MT7 A;  4K17 A;  4GPT B;  2OQB A;  2EJ8 A;  1ZSQ A;  4PQ0 A;  2KCJ A;  5HE2 A;  1IRS A;  3M1I B;  1X05 A;  4BBK A;  1U5F A;  2L1C A;  3KSY A;  1X1G A;  1XX0 A;  1U5D A;  1Z87 A;  2GJY A;  4KHB B;  5JLJ B;  2YS5 A;  2P0F A;  2P0H A;  2W2X D;  2D9Y A;  3T06 A;  4NY0 A;  3GYP A;  1V5M A;  1OY2 A;  2DLW A;  1P5T A;  3TVV A;  1H4R A;  2CY5 A;  2CRF A;  3ZVR A;  1SHC A;  3P7Z A;  3SV1 A;  1MAI A;  2GCL A;  2N23 A;  2Q13 A;  2D10 A;  2D9V A;  2ROZ B;  3A8Q A;  1U5G A;  5DI9 B;  2MKR A;  2E2X A;  2ELB A;  2COA A;  3PSC A;  2ELA A;  4A6H A;  4HAY B;  3PVL A;  3SNH A;  3VOQ A;  1X11 A;  3U7D A;  1K5G B;  1ZVR A;  2LG1 A;  4YON A;  2N0Y A;  3V5W A;  2NZ8 B;  1WG7 A;  2Z0P A;  1QQG A;  4HDO A;  4XWX A;  1LW3 A;  4KHA A;  2DTC A;  4YL8 A;  1ZC4 B;  1Q67 A;  1MKE A;  1WGQ A;  5J3Y A;  2COD A;  2LOX A;  4B6H A;  1J19 A;  3HW2 B;  3VIA A;  5D27 A;  2VSZ A;  1GG3 A;  4H8S A;  3SO6 A;  1J0W A;  2H7E A;  5LOP B;  4ZRK A;  3AJ4 A;  4F7H A;  5C5B B;  1MIZ B;  3N7C A;  5C16 A;  4ZRJ A;  2ROV A;  1XCG A;  2R0D A;  3AU5 A;  1V61 A;  1PFJ A;  1FHO A;  3KRX A;  3ODX A;  4A6F A;  3TO1 A;  5C6R A;  3CIK A;  5D3X A;  2V76 A;  2XQN M;  2YVC A;  3PEG A;  1U27 A;  3QBV B;  3WYF B;  3F0W A;  3CXB B;  4CHM A;  2D9Z A;  1AWE A;  2Z0Q A;  4Z2M B;  2I5C A;  4HAU B;  2CAY A;  3P6A A;  2J0M A;  2DN6 A;  3HK0 A;  2YS3 A;  3TFM A;  1DDW A;  2DYQ A;  2Z0O A;  2BCJ A;  3TW1 A;  1FHW A;  1UNQ A;  3SUZ A;  4TYZ A;  2NMB A;  1X1F A;  5EFX A;  2P8V A;  1KZ7 A;  5DIF B;  3O96 A;  3LJU X;  1PMS A;  5FI1 A;  4D0N B;  1U5E A;  4F7U P;  5DHA B;  1UNR A;  2HE7 A;  1BWN A;  1MK9 B;  3F5R A;  2UZS A;  5LON B;  1P3R A;  1LB1 A;  1BAK A;  1TJ6 A;  1DRO A;  5JHG A;  4WJ7 A;  4EKU A;  2COC A;  2LKO A;  3G9W A;  4CYE A;  4GMX B;  1RRP B;  2D9X A;  4F7G A;  3ODW A;  4NSW A;  2PZ1 A;  1EF1 A;  1SGH A;  3ULB A;  2RSG A;  2IFS A;  1MPH A;  4IFS A;  4KHO A;  1PLS A;  2YS1 A;  2MFQ A;  5HE3 A;  4CHJ A;  1QC6 A;  4P7I A;  2K00 A;  2G35 A;  1FOE A;  2YSZ A;  2DX5 A;  1EVH A;  1XOD A;  1XR0 B;  4MY6 A;  2RGN B;  3KZ1 A;  4DXA B;  4DX9 0;  4IOY X;  2W2W A;  4K2P A;  3BIN A;  4WVF B;  1EGX A;  3GYO A;  2ZPY A;  1MIX A;  2VRW B;  4HAX B;  2P0D A;  1KI1 B;  3FSS A;  1NTY A;  2DYN A;  3DXE A;  2Y7B A;  5KQ4 A;  4GMV A;  3PVU A;  1U2B A;  1UPR A;  2R09 A;  1GC7 A;  2I1K A;  1DDV A;  2DKQ A;  4GXB A;  2IYB A;  4TKN A;  5J3Q A;  4Y94 A;  2GS0 A;  2DHK A;  2EMT A;  2RVB B;  2COF A;  4HB3 B;  3X23 A;  2DKP A;  2J0J A;  2Y8F A;  4HHV A;  5JP4 A;  3PG7 A;  5C5B A;  1NI2 A;  1EAZ A;  3FEH A;  4EMO A;  1WJ1 A;  4EJN A;  2Y8G A;  2I1J A;  3WA0 A;  1W1G A;  2MDX A;  4DX8 A;  3D8E A;  4A5K A;  5JHH A;  2KGX B;  5CLQ B;  4K2O A;  5HE1 A;  4KAX B;  1OQN A;  2DA0 A;  1M7R A;  2D9W A;  4HAV B;  1FHX A;  1KZG A;  4GZU A;  2KUP A;  3UZT A;  3BJI A;  3KRW A;  1H10 A;  4K81 A;  4L6E A;  3PP2 A;  2K2J A;  1BTK A;  1DBH A;  2UVM A;  1DDM A;  2JP2 A;  1NU2 A;  2RLO A;  3PZD A;  5D3W A;  1W1D A;  2FJL A;  1WVH A;  1V88 A;  3HQC A;  2X18 A;  2GCJ A;  1Y5O A;  3PVW A;  4DBB A;  1FGY A;  1V5P A;  3ZDT A;  1I2H A;  2OTX A;  3QIJ A;  1FB8 A;  2YT1 A;  3SYX A;  4HB2 B;  1DYN A;  3MDB C;  2LUL A;  2H7D A;  2D4Q A;  1GC6 A;  5DH9 B;  1Y19 B;  1OMW A;  2AL6 A;  1WGU A;  3D8D A;  2CY4 A;  2LOZ A;  4Z2N A;  1BTN A;  5J3T A;  1AQC A;  1TXD A;  2DHI A;  5FI0 A;  1MK7 B;  2DFK A;  5CLL B;  2QKM A;  4HAT B;  4HAW B;  2DHJ A;  2YRY A;  1TQZ A;  1UEF A;  2UZR A;  2ADZ A;  4HDQ A;  1V89 A;  1ZM0 A;  2HTH B;  2RUK B;  4A6F B;  3OAN A;  1P6S A;  2DX1 A;  5D3V A;  1NTV A;  3DXD A;  5KQ1 A;  5DHF B;  1ZC3 B;  3FM8 C;  1V5U A;  2J0K A;  1U29 A;  3RCP A;  2W2X C;  3ML4 A;  2M14 A;  3ODO A;  5KCV A;  2K2U A;  3AU4 A;  1M7E A;  2AEH A;  2EC1 A;  3A98 B;  4IAP A;  4HB4 B;  1ISN A;  2QKL A;  2LYD A;  3IVF A;  4A6K A;  5C79 A;  4MK0 A;  3D8F A;  2J59 M;  5GOW B;  2RNR B;  2YT0 A;  2L2I A;  1UPQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...