1P5TA

Crystal structure of dok1 ptb domain
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
107
structure length
107
Chain Sequence
b'MGSQFWVTSQKTEASERCGLQGSYILRVEAEKLTLLTLGAQSQILEPLLFWPYTLLRRYGRDKVMFSFEAGRRCPSGPGTFTFQTSQGNDIFQAVEAAIQQQKAQGK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Docking protein 1
publication title Structural Basis for the Specific Recognition of RET by the Dok1 Phosphotyrosine Binding Domain
pubmed doi rcsb
source organism Mus musculus
molecule tags Signaling protein
total genus 25
structure length 107
sequence length 107
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-04-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 1p5tA00
5GOWB 2IYBA 2FJLA 2D10A 5HE0A 3D8FA 1I2HA 4YONA 1RRPB 3ULBA 1X05A 3WA0A 4A5KA 4WVFB 2MWNB 3SV1A 5FI1A 2P0DA 2OTXA 3HQCA 2YF0A 1EAZA 5C5BA 4NSWA 1DYNA 1FAOA 3CIKA 3ML4A 1RJ2A 3KY9A 4CYEA 3LJUX 2ROZB 2K2JA 1K5DB 2EJ8A 2J0JA 1DBHA 2N0YA 2D9XA 2RSGA 2KUPA 3RCPA 3P6AA 4P7IA 1E5WA 3PVUA 3O96A 3TVVA 5L81A 2D4QA 4GZUA 1X11A 1DROA 1X1FA 3QIJA 3KZ1A 1BAKA 1FGZA 4H8SA 4DXAB 1P3RA 2HE7A 1ZSQA 2YS3A 3SNHA 1MK9B 5LONB 2KCJA 1UEFA 2D11A 3U7DA 1NTYA 4TKNA 1FGYA 2XQNM 1Y5OA 4GPTB 2DN6A 2M38A 2G35A 3AU4A 2KGXB 5HE1A 3V5WA 2LYDA 4MT7A 4K2PA 2E2XA 3M1IB 1I7AA 1Z87A 2ROVA 3VOQA 4MY6A 1AWEA 2UZSA 2YVCA 2GCLA 2VKIA 2H7EA 3FM8C 5HE3A 3DXDA 2Y7BA 2RNRB 3TFMA 2DHIA 1UNRA 2YS1A 4HB3B 1FHXA 1FB8A 2Q13A 1ZVRA 1U5GA 2LKOA 5DHFB 4PNKA 4IFSA 3CXBB 4Z2NA 1U5EA 2QKMA 1TJ6A 4GXBA 4EKUA 1IRSA 3MDBC 4HAWB 4CHMA 2DX5A 1W1DA 1XR0B 1BWNA 5JLJB 1OQNA 4A6HA 3PEGA 3G9WA 1OMWA 4A6FA 4HHVA 1DDVA 2K2UA 2J0MA 1WG7A 1XCGA 1PLSA 3KRXA 4MK0A 3ODWA 2RGNB 4K17A 5HE2A 5CLQB 1MIZB 3D8DA 3UZTA 2Z0PA 2N23A 2P0FA 4PQ0A 1FOEA 2DLWA 3P7ZA 3KRWA 2MDXA 5D3VA 1WGQA 1QQGA 1UNPA 3U8ZA 1H10A 2I1JA 1WJMA 1X1GA 1U2BA 3PP2A 5D3YA 2EMTA 2Y8GA 2CODA 1ZC3B 2HTHB 4GN1A 2D9VA 2DHKA 3QBVB 1UPRA 5DH9B 1BTNA 2V76A 2Z0OA 1DDWA 1PMSA 3PVLA 5C16A 1SHCA 2VRWB 1ZM0A 2COFA 5LOPB 2DA0A 4HB4B 1NU2A 4XWXA 1U29A 1WJ1A 2LULA 5D27A 1LW3A 2YSZA 4DX90 2DHJA 3DXCA 1WI1A 3TCAA 3FEHA 4KVGB 3FSSA 1W1HA 4NY0A 1XODA 3PG7A 2EC1A 4Y94A 3ZVRA 3QWMA 3SO6A 1M7EA 4HAYB 2QKLA 4HAUB 2DFKA 4F7GA 5JHGA 2D9WA 4BBKA 1PFJA 4HATB 1V5MA 2K00A 4HB2B 2I5CA 3WYFB 1J0WA 2P8VA 3OANA 5J3TA 5CLLB 3KSYA 1FHOA 1QC6A 1V5PA 2YT0A 4DBBA 4TYZA 1M7RA 1U5FA 1U5DA 4A6FB 1Y19B 3GYPA 5C6RA 5KCVA 2YRYA 4L6EA 2COCA 3T06A 2L2IA 2RLOA 2AEHA 2W2XD 3HW2B 4K81A 5C5BB 2W2XC 5JP4A 3A8QA 5FI0A 4B6HA 1WVHA 4CHJA 2GS0A 1EVHA 2H7DA 2DTCA 5DI9B 3SYXA 3SUZA 1MKEA 1MAIA 2LOZA 2NMBA 2ELBA 5D3XA 2D9ZA 1UPQA 2UVMA 3X23A 2J59M 3AU5A 1LB1A 1BTKA 2IFSA 4F7HA 3ZDTA 3TW1A 2GCJA 3A98B 2P0HA 1Q67A 1N3HA 5J3QA 2YT1A 1GC7A 1NI2A 3D8EA 3AJ4A 1XKEA 1P6SA 5JHHA 1SGHA 2Y8FA 3IVFA 5EFXA 4HDOA 2RUKB 2COAA 4HB0B 2R09A 3BJIA 4YL8A 2DYQA 1V89A 3PVWA 1UNQA 2ADZA 2OQBA 1EF1A 4KHOA 2M14A 4KHAA 3A8PA 2CAYA 3BINA 4F7UP 2Z0QA 1XD4A 4KAXB 1MPHA 3F0WA 1U27A 2I1KA 2RVBB 1NTVA 4KHBB 4HAZB 5J3YA 3N7CA 2DX1A 2I5FA 3TO1A 1KZ7A 4EMOA 5DHAB 1KZGA 2ELAA 1TQZA 2AL6A 2UZRA 1WGUA 1XX0A 1MK7B 3ODOA 1W1GA 2YS5A 1AQCA 1OY2A 1V61A 2R0DA 2VSZA 1X86A 4IOYX 2BCJA 1K5GB 5DIFB 1ZC4B 2DYNA 2LG1A 3DXEA 2PZ1A 2EMSA 4C0AA 4K2OA 1DDMA 3HK0A 5KQ4A 2D9YA 4EJNA 2X18A 2CY5A 2L1CA 4HAVB 3VIAA 1GC6A 2NZ8B 2J0KA 1TXDA 3NSUA 1KI1B 3ULCA 4WSFA 1V88A 4DX8A 4HDQA 3MPXA 4A6KA 1EGXA 1P5TA 4Z2MB 1MIXA 5D3WA 2DKPA 3PZDA 5C79A 3GYOA 3PSCA 4GMXB 2CRFA 2DKQA 2W2WA 4D0NB 2LOXA 4ZRKA 2D2QA 4GMVA 4ZRIA 2ZPYA 1ISNA 1GG3A 5KQ1A 4WJ7A 1B55A 1V5UA 3ODXA 1H4RA 2MKRA 1FHWA 2GJYA 2JP2A 4IAPA 2MFQA 3F5RA 1J19A 4HAXB 4ZRJA 2CY4A
chains in the Genus database with same CATH superfamily
5GOWB 2IYBA 2FJLA 2D10A 5HE0A 3D8FA 1I2HA 4YONA 1RRPB 3ULBA 1X05A 3WA0A 4A5KA 4WVFB 5IRSA 2MWNB 2KIEA 3SV1A 5FI1A 2P0DA 2OTXA 3NWDA 3HQCA 2YF0A 1EAZA 5C5BA 4NSWA 1DYNA 1FAOA 3CIKA 3ML4A 1RJ2A 3KY9A 4CYEA 3LJUX 2ROZB 2K2JA 1K5DB 2EJ8A 2J0JA 1DBHA 2KR0A 2D9XA 2N0YA 2RSGA 2KUPA 3RCPA 3P6AA 4P7IA 1E5WA 3PVUA 3O96A 3TVVA 5L81A 2D4QA 4GZUA 1X11A 2GUMA 1DROA 1X1FA 3QIJA 3KZ1A 1BAKA 2Z13A 1FGZA 5I2MA 4H8SA 4DXAB 1P3RA 2HE7A 1ZSQA 2YS3A 3SNHA 1MK9B 5LONB 2KCJA 1UEFA 2D11A 3U7DA 1NTYA 4TKNA 1FGYA 2XQNM 1Y5OA 4GPTB 2DN6A 2M38A 2G35A 3AU4A 2KGXB 5HE1A 3V5WA 2LYDA 4MT7A 4K2PA 2E2XA 3M1IB 1I7AA 1Z87A 2ROVA 3VOQA 4MY6A 2Z4DA 1AWEA 2UZSA 2YVCA 2GCLA 2VKIA 2H7EA 3FM8C 5HE3A 4KHBA 3DXDA 2Y7BA 2RNRB 3TFMA 2DHIA 4GNKB 1UNRA 2YS1A 4HB3B 1FHXA 1FB8A 2Q13A 1ZVRA 1U5GA 2LKOA 5DHFB 2Z59A 4IFSA 4PNKA 3CXBB 4Z2NA 1U5EA 2QKMA 1TJ6A 4GXBA 4EKUA 1IRSA 3MDBC 4HAWB 4CHMA 2DX5A 1W1DA 1XR0B 1BWNA 5JLJB 1OQNA 4A6HA 3PEGA 3G9WA 3NW8A 1OMWA 4A6FA 4HHVA 1DDVA 2K2UA 2J0MA 4OT1A 1WG7A 1XCGA 1PLSA 3KRXA 3HSAA 3ODWA 2RGNB 4MK0A 4K17A 5HE2A 5CLQB 1MIZB 2FJUB 3D8DA 3UZTA 2Z0PA 2N23A 2P0FA 4PQ0A 1FOEA 2DLWA 3P7ZA 3KRWA 2MDXA 5D3VA 1WGQA 1QQGA 1UNPA 3U8ZA 1H10A 2I1JA 1WJMA 1X1GA 1U2BA 3PP2A 5D3YA 5M4YB 2EMTA 2Y8GA 2CODA 2ZKMX 1ZC3B 3OHMB 2HTHB 4GN1A 2D9VA 2DHKA 3QBVB 1UPRA 5DH9B 1BTNA 2V76A 2Z0OA 3FVCA 1DDWA 1PMSA 3PVLA 4HSIA 1SHCA 5C16A 2VRWB 1ZM0A 2COFA 5LOPB 2DA0A 4HB4B 1NU2A 4XWXA 1U29A 1WJ1A 2LULA 5D27A 2NBVA 1LW3A 2YSZA 4DX90 2DHJA 3DXCA 1WI1A 3TCAA 3FEHA 4KVGB 3FSSA 1W1HA 2R2YA 4NY0A 1XODA 3PG7A 2EC1A 4L1RA 4Y94A 3ZVRA 3QWMA 3SO6A 1M7EA 4HAYB 2QKLA 4HAUB 2DFKA 4F7GA 5JHGA 2D9WA 4BBKA 1PFJA 4HATB 1V5MA 2K00A 4HB2B 2I5CA 3WYFB 1J0WA 2P8VA 3OANA 1T77A 5J3TA 4CSQA 3NWFA 5CLLB 3KSYA 1FHOA 1QC6A 1V5PA 2YT0A 4DBBA 4TYZA 1M7RA 3NWAA 1U5FA 1U5DA 4A6FB 1Y19B 3GYPA 4QJ4B 5C6RA 2YT2A 5KCVA 2YRYA 4L6EA 2COCA 3T06A 2L2IA 2RLOA 2AEHA 2W2XD 2KUQA 4GOUA 3HW2B 4K81A 5C5BB 2W2XC 5JP4A 3A8QA 5FI0A 4B6HA 1WVHA 4CHJA 2GS0A 1EVHA 2H7DA 2DTCA 5DI9B 3SYXA 3SUZA 1MKEA 1MAIA 2LOZA 2NMBA 2ELBA 5D3XA 2D9ZA 1UPQA 5I2SA 2UVMA 3X23A 2J59M 3AU5A 1ZYIA 1LB1A 1BTKA 2IFSA 4F7HA 3U12A 3ZDTA 3TW1A 2GCJA 3A98B 2P0HA 1Q67A 1N3HA 5J3QA 2K8EA 2YT1A 1GC7A 1NI2A 3D8EA 3A58A 3AJ4A 1MI1A 1XKEA 1P6SA 5JHHA 1SGHA 2Y8FA 3IVFA 5EFXA 4HDOA 2RUKB 2COAA 4HB0B 2R09A 3BJIA 2K49A 4QJ3B 4YL8A 5LG4B 2DYQA 1V89A 3PVWA 1UNQA 2ADZA 2OQBA 4QJ5B 1EF1A 4KHOA 2M14A 4KHAA 3A8PA 2CAYA 3BINA 4F7UP 2Z0QA 1XD4A 4KAXB 1MPHA 3F0WA 1U27A 2I1KA 2RVBB 1NTVA 4KHBB 4HAZB 5J3YA 3N7CA 2DX1A 2I5FA 3TO1A 4QXAB 1KZ7A 4EMOA 5DHAB 1KZGA 2ELAA 1TQZA 3DCXA 2AL6A 2UZRA 1WGUA 4OSNA 1XX0A 1MK7B 3ODOA 1W1GA 2YS5A 1AQCA 1OY2A 4D6WA 1V61A 2R0DA 2VSZA 1X86A 2KIGA 2BCJA 4IOYX 2Z14A 1K5GB 5DIFB 1ZC4B 2DYNA 2LG1A 3DXEA 2PZ1A 2EMSA 4C0AA 2RRFA 4K2OA 1DDMA 3HK0A 5KQ4A 2D9YA 4EJNA 2X18A 2CY5A 2L1CA 4HAVB 3VIAA 3HIEA 1GC6A 2NZ8B 2J0KA 1TXDA 3NSUA 1KI1B 3ULCA 4WSFA 1V88A 4DX8A 4HDQA 3MPXA 4A6KA 1EGXA 1P5TA 4Z2MB 1MIXA 5D3WA 2DKPA 3PZDA 5C79A 3GYOA 3PSCA 4GMXB 2CRFA 2DKQA 2W2WA 4D0NB 2LOXA 4ZRKA 4DIXA 2D2QA 4GMVA 4ZRIA 2ZPYA 1ISNA 1GG3A 5KQ1A 4WJ7A 3B77A 1B55A 1V5UA 3ODXA 1H4RA 2MKRA 1FHWA 2GJYA 2JP2A 4IAPA 2MFQA 3F5RA 1J19A 4HAXB 4ZRJA 2CY4A
chains in the Genus database with same CATH topology
5GOWB 2IYBA 2FJLA 2D10A 5HE0A 3D8FA 1I2HA 4YONA 1RRPB 3ULBA 1X05A 3WA0A 4A5KA 4WVFB 2MWNB 3SV1A 5FI1A 2P0DA 2OTXA 3HQCA 2YF0A 1EAZA 5C5BA 4NSWA 1DYNA 1FAOA 3CIKA 3ML4A 1RJ2A 3KY9A 4CYEA 3LJUX 2ROZB 2K2JA 1K5DB 2EJ8A 2J0JA 1DBHA 2N0YA 2D9XA 2RSGA 2KUPA 3RCPA 3P6AA 4P7IA 1E5WA 3PVUA 3O96A 3TVVA 5L81A 2D4QA 4GZUA 1X11A 1DROA 1X1FA 3QIJA 3KZ1A 1BAKA 1FGZA 4H8SA 4DXAB 1P3RA 2HE7A 1ZSQA 2YS3A 3SNHA 1MK9B 5LONB 2KCJA 1UEFA 2D11A 3U7DA 1NTYA 4TKNA 1FGYA 2XQNM 1Y5OA 4GPTB 2DN6A 2M38A 2G35A 3AU4A 2KGXB 5HE1A 3V5WA 2LYDA 4MT7A 4K2PA 2E2XA 3M1IB 1I7AA 1Z87A 2ROVA 3VOQA 4MY6A 1AWEA 2UZSA 2YVCA 2GCLA 2VKIA 2H7EA 3FM8C 5HE3A 3DXDA 2Y7BA 2RNRB 3TFMA 2DHIA 1UNRA 2YS1A 4HB3B 1FHXA 1FB8A 2Q13A 1ZVRA 1U5GA 2LKOA 5DHFB 4PNKA 4IFSA 3CXBB 4Z2NA 1U5EA 2QKMA 1TJ6A 4GXBA 4EKUA 1IRSA 3MDBC 4HAWB 4CHMA 2DX5A 1W1DA 1XR0B 1BWNA 5JLJB 1OQNA 4A6HA 3PEGA 3G9WA 1OMWA 4A6FA 4HHVA 1DDVA 2K2UA 2J0MA 1WG7A 1XCGA 1PLSA 3KRXA 4MK0A 3ODWA 2RGNB 4K17A 5HE2A 5CLQB 1MIZB 3D8DA 3UZTA 2Z0PA 2N23A 2P0FA 4PQ0A 1FOEA 2DLWA 3P7ZA 3KRWA 2MDXA 5D3VA 1WGQA 1QQGA 1UNPA 3U8ZA 1H10A 2I1JA 1WJMA 1X1GA 1U2BA 3PP2A 5D3YA 2EMTA 2Y8GA 2CODA 1ZC3B 2HTHB 4GN1A 2D9VA 2DHKA 3QBVB 1UPRA 5DH9B 1BTNA 2V76A 2Z0OA 1DDWA 1PMSA 3PVLA 5C16A 1SHCA 2VRWB 1ZM0A 2COFA 5LOPB 2DA0A 4HB4B 1NU2A 4XWXA 1U29A 1WJ1A 2LULA 5D27A 1LW3A 2YSZA 4DX90 2DHJA 3DXCA 1WI1A 3TCAA 3FEHA 4KVGB 3FSSA 1W1HA 4NY0A 1XODA 3PG7A 2EC1A 4Y94A 3ZVRA 3QWMA 3SO6A 1M7EA 4HAYB 2QKLA 4HAUB 2DFKA 4F7GA 5JHGA 2D9WA 4BBKA 1PFJA 4HATB 1V5MA 2K00A 4HB2B 2I5CA 3WYFB 1J0WA 2P8VA 3OANA 5J3TA 5CLLB 3KSYA 1FHOA 1QC6A 1V5PA 2YT0A 4DBBA 4TYZA 1M7RA 1U5FA 1U5DA 4A6FB 1Y19B 3GYPA 5C6RA 5KCVA 2YRYA 4L6EA 2COCA 3T06A 2L2IA 2RLOA 2AEHA 2W2XD 3HW2B 4K81A 5C5BB 2W2XC 5JP4A 3A8QA 5FI0A 4B6HA 1WVHA 4CHJA 2GS0A 1EVHA 2H7DA 2DTCA 5DI9B 3SYXA 3SUZA 1MKEA 1MAIA 2LOZA 2NMBA 2ELBA 5D3XA 2D9ZA 1UPQA 2UVMA 3X23A 2J59M 3AU5A 1LB1A 1BTKA 2IFSA 4F7HA 3ZDTA 3TW1A 2GCJA 3A98B 2P0HA 1Q67A 1N3HA 5J3QA 2YT1A 1GC7A 1NI2A 3D8EA 3AJ4A 1XKEA 1P6SA 5JHHA 1SGHA 2Y8FA 3IVFA 5EFXA 4HDOA 2RUKB 2COAA 4HB0B 2R09A 3BJIA 4YL8A 2DYQA 1V89A 3PVWA 1UNQA 2ADZA 2OQBA 1EF1A 4KHOA 2M14A 4KHAA 3A8PA 2CAYA 3BINA 4F7UP 2Z0QA 1XD4A 4KAXB 1MPHA 3F0WA 1U27A 2I1KA 2RVBB 1NTVA 4KHBB 4HAZB 5J3YA 3N7CA 2DX1A 2I5FA 3TO1A 1KZ7A 4EMOA 5DHAB 1KZGA 2ELAA 1TQZA 2AL6A 2UZRA 1WGUA 1XX0A 1MK7B 3ODOA 1W1GA 2YS5A 1AQCA 1OY2A 1V61A 2R0DA 2VSZA 1X86A 4IOYX 2BCJA 1K5GB 5DIFB 1ZC4B 2DYNA 2LG1A 3DXEA 2PZ1A 2EMSA 4C0AA 4K2OA 1DDMA 3HK0A 5KQ4A 2D9YA 4EJNA 2X18A 2CY5A 2L1CA 4HAVB 3VIAA 1GC6A 2NZ8B 2J0KA 1TXDA 3NSUA 1KI1B 3ULCA 4WSFA 1V88A 4DX8A 4HDQA 3MPXA 4A6KA 1EGXA 1P5TA 4Z2MB 1MIXA 5D3WA 2DKPA 3PZDA 5C79A 3GYOA 3PSCA 4GMXB 2CRFA 2DKQA 2W2WA 4D0NB 2LOXA 4ZRKA 2D2QA 4GMVA 4ZRIA 2ZPYA 1ISNA 1GG3A 5KQ1A 4WJ7A 1B55A 1V5UA 3ODXA 1H4RA 2MKRA 1FHWA 2GJYA 2JP2A 4IAPA 2MFQA 3F5RA 1J19A 4HAXB 4ZRJA 2CY4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5GOW B;  2IYB A;  2FJL A;  2D10 A;  5HE0 A;  3D8F A;  1I2H A;  4YON A;  1RRP B;  3ULB A;  1X05 A;  3WA0 A;  4A5K A;  4WVF B;  2MWN B;  3SV1 A;  5FI1 A;  2P0D A;  2OTX A;  3HQC A;  2YF0 A;  1EAZ A;  5C5B A;  4NSW A;  1DYN A;  1FAO A;  3CIK A;  3ML4 A;  1RJ2 A;  3KY9 A;  4CYE A;  3LJU X;  2ROZ B;  2K2J A;  1K5D B;  2EJ8 A;  2J0J A;  1DBH A;  2N0Y A;  2D9X A;  2RSG A;  2KUP A;  3RCP A;  3P6A A;  4P7I A;  1E5W A;  3PVU A;  3O96 A;  3TVV A;  5L81 A;  2D4Q A;  4GZU A;  1X11 A;  1DRO A;  1X1F A;  3QIJ A;  3KZ1 A;  1BAK A;  1FGZ A;  4H8S A;  4DXA B;  1P3R A;  2HE7 A;  1ZSQ A;  2YS3 A;  3SNH A;  1MK9 B;  5LON B;  2KCJ A;  1UEF A;  2D11 A;  3U7D A;  1NTY A;  4TKN A;  1FGY A;  2XQN M;  1Y5O A;  4GPT B;  2DN6 A;  2M38 A;  2G35 A;  3AU4 A;  2KGX B;  5HE1 A;  3V5W A;  2LYD A;  4MT7 A;  4K2P A;  2E2X A;  3M1I B;  1I7A A;  1Z87 A;  2ROV A;  3VOQ A;  4MY6 A;  1AWE A;  2UZS A;  2YVC A;  2GCL A;  2VKI A;  2H7E A;  3FM8 C;  5HE3 A;  3DXD A;  2Y7B A;  2RNR B;  3TFM A;  2DHI A;  1UNR A;  2YS1 A;  4HB3 B;  1FHX A;  1FB8 A;  2Q13 A;  1ZVR A;  1U5G A;  2LKO A;  5DHF B;  4PNK A;  4IFS A;  3CXB B;  4Z2N A;  1U5E A;  2QKM A;  1TJ6 A;  4GXB A;  4EKU A;  1IRS A;  3MDB C;  4HAW B;  4CHM A;  2DX5 A;  1W1D A;  1XR0 B;  1BWN A;  5JLJ B;  1OQN A;  4A6H A;  3PEG A;  3G9W A;  1OMW A;  4A6F A;  4HHV A;  1DDV A;  2K2U A;  2J0M A;  1WG7 A;  1XCG A;  1PLS A;  3KRX A;  4MK0 A;  3ODW A;  2RGN B;  4K17 A;  5HE2 A;  5CLQ B;  1MIZ B;  3D8D A;  3UZT A;  2Z0P A;  2N23 A;  2P0F A;  4PQ0 A;  1FOE A;  2DLW A;  3P7Z A;  3KRW A;  2MDX A;  5D3V A;  1WGQ A;  1QQG A;  1UNP A;  3U8Z A;  1H10 A;  2I1J A;  1WJM A;  1X1G A;  1U2B A;  3PP2 A;  5D3Y A;  2EMT A;  2Y8G A;  2COD A;  1ZC3 B;  2HTH B;  4GN1 A;  2D9V A;  2DHK A;  3QBV B;  1UPR A;  5DH9 B;  1BTN A;  2V76 A;  2Z0O A;  1DDW A;  1PMS A;  3PVL A;  5C16 A;  1SHC A;  2VRW B;  1ZM0 A;  2COF A;  5LOP B;  2DA0 A;  4HB4 B;  1NU2 A;  4XWX A;  1U29 A;  1WJ1 A;  2LUL A;  5D27 A;  1LW3 A;  2YSZ A;  4DX9 0;  2DHJ A;  3DXC A;  1WI1 A;  3TCA A;  3FEH A;  4KVG B;  3FSS A;  1W1H A;  4NY0 A;  1XOD A;  3PG7 A;  2EC1 A;  4Y94 A;  3ZVR A;  3QWM A;  3SO6 A;  1M7E A;  4HAY B;  2QKL A;  4HAU B;  2DFK A;  4F7G A;  5JHG A;  2D9W A;  4BBK A;  1PFJ A;  4HAT B;  1V5M A;  2K00 A;  4HB2 B;  2I5C A;  3WYF B;  1J0W A;  2P8V A;  3OAN A;  5J3T A;  5CLL B;  3KSY A;  1FHO A;  1QC6 A;  1V5P A;  2YT0 A;  4DBB A;  4TYZ A;  1M7R A;  1U5F A;  1U5D A;  4A6F B;  1Y19 B;  3GYP A;  5C6R A;  5KCV A;  2YRY A;  4L6E A;  2COC A;  3T06 A;  2L2I A;  2RLO A;  2AEH A;  2W2X D;  3HW2 B;  4K81 A;  5C5B B;  2W2X C;  5JP4 A;  3A8Q A;  5FI0 A;  4B6H A;  1WVH A;  4CHJ A;  2GS0 A;  1EVH A;  2H7D A;  2DTC A;  5DI9 B;  3SYX A;  3SUZ A;  1MKE A;  1MAI A;  2LOZ A;  2NMB A;  2ELB A;  5D3X A;  2D9Z A;  1UPQ A;  2UVM A;  3X23 A;  2J59 M;  3AU5 A;  1LB1 A;  1BTK A;  2IFS A;  4F7H A;  3ZDT A;  3TW1 A;  2GCJ A;  3A98 B;  2P0H A;  1Q67 A;  1N3H A;  5J3Q A;  2YT1 A;  1GC7 A;  1NI2 A;  3D8E A;  3AJ4 A;  1XKE A;  1P6S A;  5JHH A;  1SGH A;  2Y8F A;  3IVF A;  5EFX A;  4HDO A;  2RUK B;  2COA A;  4HB0 B;  2R09 A;  3BJI A;  4YL8 A;  2DYQ A;  1V89 A;  3PVW A;  1UNQ A;  2ADZ A;  2OQB A;  1EF1 A;  4KHO A;  2M14 A;  4KHA A;  3A8P A;  2CAY A;  3BIN A;  4F7U P;  2Z0Q A;  1XD4 A;  4KAX B;  1MPH A;  3F0W A;  1U27 A;  2I1K A;  2RVB B;  1NTV A;  4KHB B;  4HAZ B;  5J3Y A;  3N7C A;  2DX1 A;  2I5F A;  3TO1 A;  1KZ7 A;  4EMO A;  5DHA B;  1KZG A;  2ELA A;  1TQZ A;  2AL6 A;  2UZR A;  1WGU A;  1XX0 A;  1MK7 B;  3ODO A;  1W1G A;  2YS5 A;  1AQC A;  1OY2 A;  1V61 A;  2R0D A;  2VSZ A;  1X86 A;  4IOY X;  2BCJ A;  1K5G B;  5DIF B;  1ZC4 B;  2DYN A;  2LG1 A;  3DXE A;  2PZ1 A;  2EMS A;  4C0A A;  4K2O A;  1DDM A;  3HK0 A;  5KQ4 A;  2D9Y A;  4EJN A;  2X18 A;  2CY5 A;  2L1C A;  4HAV B;  3VIA A;  1GC6 A;  2NZ8 B;  2J0K A;  1TXD A;  3NSU A;  1KI1 B;  3ULC A;  4WSF A;  1V88 A;  4DX8 A;  4HDQ A;  3MPX A;  4A6K A;  1EGX A;  1P5T A;  4Z2M B;  1MIX A;  5D3W A;  2DKP A;  3PZD A;  5C79 A;  3GYO A;  3PSC A;  4GMX B;  2CRF A;  2DKQ A;  2W2W A;  4D0N B;  2LOX A;  4ZRK A;  2D2Q A;  4GMV A;  4ZRI A;  2ZPY A;  1ISN A;  1GG3 A;  5KQ1 A;  4WJ7 A;  1B55 A;  1V5U A;  3ODX A;  1H4R A;  2MKR A;  1FHW A;  2GJY A;  2JP2 A;  4IAP A;  2MFQ A;  3F5R A;  1J19 A;  4HAX B;  4ZRJ A;  2CY4 A; 
#chains in the Genus database with same CATH topology
 5GOW B;  2IYB A;  2FJL A;  2D10 A;  5HE0 A;  3D8F A;  1I2H A;  4YON A;  1RRP B;  3ULB A;  1X05 A;  3WA0 A;  4A5K A;  4WVF B;  5IRS A;  2MWN B;  2KIE A;  3SV1 A;  5FI1 A;  2P0D A;  2OTX A;  3NWD A;  3HQC A;  2YF0 A;  1EAZ A;  5C5B A;  4NSW A;  1DYN A;  1FAO A;  3CIK A;  3ML4 A;  1RJ2 A;  3KY9 A;  4CYE A;  3LJU X;  2ROZ B;  2K2J A;  1K5D B;  2EJ8 A;  2J0J A;  1DBH A;  2KR0 A;  2D9X A;  2N0Y A;  2RSG A;  2KUP A;  3RCP A;  3P6A A;  4P7I A;  1E5W A;  3PVU A;  3O96 A;  3TVV A;  5L81 A;  2D4Q A;  4GZU A;  1X11 A;  2GUM A;  1DRO A;  1X1F A;  3QIJ A;  3KZ1 A;  1BAK A;  2Z13 A;  1FGZ A;  5I2M A;  4H8S A;  4DXA B;  1P3R A;  2HE7 A;  1ZSQ A;  2YS3 A;  3SNH A;  1MK9 B;  5LON B;  2KCJ A;  1UEF A;  2D11 A;  3U7D A;  1NTY A;  4TKN A;  1FGY A;  2XQN M;  1Y5O A;  4GPT B;  2DN6 A;  2M38 A;  2G35 A;  3AU4 A;  2KGX B;  5HE1 A;  3V5W A;  2LYD A;  4MT7 A;  4K2P A;  2E2X A;  3M1I B;  1I7A A;  1Z87 A;  2ROV A;  3VOQ A;  4MY6 A;  2Z4D A;  1AWE A;  2UZS A;  2YVC A;  2GCL A;  2VKI A;  2H7E A;  3FM8 C;  5HE3 A;  4KHB A;  3DXD A;  2Y7B A;  2RNR B;  3TFM A;  2DHI A;  4GNK B;  1UNR A;  2YS1 A;  4HB3 B;  1FHX A;  1FB8 A;  2Q13 A;  1ZVR A;  1U5G A;  2LKO A;  5DHF B;  2Z59 A;  4IFS A;  4PNK A;  3CXB B;  4Z2N A;  1U5E A;  2QKM A;  1TJ6 A;  4GXB A;  4EKU A;  1IRS A;  3MDB C;  4HAW B;  4CHM A;  2DX5 A;  1W1D A;  1XR0 B;  1BWN A;  5JLJ B;  1OQN A;  4A6H A;  3PEG A;  3G9W A;  3NW8 A;  1OMW A;  4A6F A;  4HHV A;  1DDV A;  2K2U A;  2J0M A;  4OT1 A;  1WG7 A;  1XCG A;  1PLS A;  3KRX A;  3HSA A;  3ODW A;  2RGN B;  4MK0 A;  4K17 A;  5HE2 A;  5CLQ B;  1MIZ B;  2FJU B;  3D8D A;  3UZT A;  2Z0P A;  2N23 A;  2P0F A;  4PQ0 A;  1FOE A;  2DLW A;  3P7Z A;  3KRW A;  2MDX A;  5D3V A;  1WGQ A;  1QQG A;  1UNP A;  3U8Z A;  1H10 A;  2I1J A;  1WJM A;  1X1G A;  1U2B A;  3PP2 A;  5D3Y A;  5M4Y B;  2EMT A;  2Y8G A;  2COD A;  2ZKM X;  1ZC3 B;  3OHM B;  2HTH B;  4GN1 A;  2D9V A;  2DHK A;  3QBV B;  1UPR A;  5DH9 B;  1BTN A;  2V76 A;  2Z0O A;  3FVC A;  1DDW A;  1PMS A;  3PVL A;  4HSI A;  1SHC A;  5C16 A;  2VRW B;  1ZM0 A;  2COF A;  5LOP B;  2DA0 A;  4HB4 B;  1NU2 A;  4XWX A;  1U29 A;  1WJ1 A;  2LUL A;  5D27 A;  2NBV A;  1LW3 A;  2YSZ A;  4DX9 0;  2DHJ A;  3DXC A;  1WI1 A;  3TCA A;  3FEH A;  4KVG B;  3FSS A;  1W1H A;  2R2Y A;  4NY0 A;  1XOD A;  3PG7 A;  2EC1 A;  4L1R A;  4Y94 A;  3ZVR A;  3QWM A;  3SO6 A;  1M7E A;  4HAY B;  2QKL A;  4HAU B;  2DFK A;  4F7G A;  5JHG A;  2D9W A;  4BBK A;  1PFJ A;  4HAT B;  1V5M A;  2K00 A;  4HB2 B;  2I5C A;  3WYF B;  1J0W A;  2P8V A;  3OAN A;  1T77 A;  5J3T A;  4CSQ A;  3NWF A;  5CLL B;  3KSY A;  1FHO A;  1QC6 A;  1V5P A;  2YT0 A;  4DBB A;  4TYZ A;  1M7R A;  3NWA A;  1U5F A;  1U5D A;  4A6F B;  1Y19 B;  3GYP A;  4QJ4 B;  5C6R A;  2YT2 A;  5KCV A;  2YRY A;  4L6E A;  2COC A;  3T06 A;  2L2I A;  2RLO A;  2AEH A;  2W2X D;  2KUQ A;  4GOU A;  3HW2 B;  4K81 A;  5C5B B;  2W2X C;  5JP4 A;  3A8Q A;  5FI0 A;  4B6H A;  1WVH A;  4CHJ A;  2GS0 A;  1EVH A;  2H7D A;  2DTC A;  5DI9 B;  3SYX A;  3SUZ A;  1MKE A;  1MAI A;  2LOZ A;  2NMB A;  2ELB A;  5D3X A;  2D9Z A;  1UPQ A;  5I2S A;  2UVM A;  3X23 A;  2J59 M;  3AU5 A;  1ZYI A;  1LB1 A;  1BTK A;  2IFS A;  4F7H A;  3U12 A;  3ZDT A;  3TW1 A;  2GCJ A;  3A98 B;  2P0H A;  1Q67 A;  1N3H A;  5J3Q A;  2K8E A;  2YT1 A;  1GC7 A;  1NI2 A;  3D8E A;  3A58 A;  3AJ4 A;  1MI1 A;  1XKE A;  1P6S A;  5JHH A;  1SGH A;  2Y8F A;  3IVF A;  5EFX A;  4HDO A;  2RUK B;  2COA A;  4HB0 B;  2R09 A;  3BJI A;  2K49 A;  4QJ3 B;  4YL8 A;  5LG4 B;  2DYQ A;  1V89 A;  3PVW A;  1UNQ A;  2ADZ A;  2OQB A;  4QJ5 B;  1EF1 A;  4KHO A;  2M14 A;  4KHA A;  3A8P A;  2CAY A;  3BIN A;  4F7U P;  2Z0Q A;  1XD4 A;  4KAX B;  1MPH A;  3F0W A;  1U27 A;  2I1K A;  2RVB B;  1NTV A;  4KHB B;  4HAZ B;  5J3Y A;  3N7C A;  2DX1 A;  2I5F A;  3TO1 A;  4QXA B;  1KZ7 A;  4EMO A;  5DHA B;  1KZG A;  2ELA A;  1TQZ A;  3DCX A;  2AL6 A;  2UZR A;  1WGU A;  4OSN A;  1XX0 A;  1MK7 B;  3ODO A;  1W1G A;  2YS5 A;  1AQC A;  1OY2 A;  4D6W A;  1V61 A;  2R0D A;  2VSZ A;  1X86 A;  2KIG A;  2BCJ A;  4IOY X;  2Z14 A;  1K5G B;  5DIF B;  1ZC4 B;  2DYN A;  2LG1 A;  3DXE A;  2PZ1 A;  2EMS A;  4C0A A;  2RRF A;  4K2O A;  1DDM A;  3HK0 A;  5KQ4 A;  2D9Y A;  4EJN A;  2X18 A;  2CY5 A;  2L1C A;  4HAV B;  3VIA A;  3HIE A;  1GC6 A;  2NZ8 B;  2J0K A;  1TXD A;  3NSU A;  1KI1 B;  3ULC A;  4WSF A;  1V88 A;  4DX8 A;  4HDQ A;  3MPX A;  4A6K A;  1EGX A;  1P5T A;  4Z2M B;  1MIX A;  5D3W A;  2DKP A;  3PZD A;  5C79 A;  3GYO A;  3PSC A;  4GMX B;  2CRF A;  2DKQ A;  2W2W A;  4D0N B;  2LOX A;  4ZRK A;  4DIX A;  2D2Q A;  4GMV A;  4ZRI A;  2ZPY A;  1ISN A;  1GG3 A;  5KQ1 A;  4WJ7 A;  3B77 A;  1B55 A;  1V5U A;  3ODX A;  1H4R A;  2MKR A;  1FHW A;  2GJY A;  2JP2 A;  4IAP A;  2MFQ A;  3F5R A;  1J19 A;  4HAX B;  4ZRJ A;  2CY4 A; 
#chains in the Genus database with same CATH homology
 5GOW B;  2IYB A;  2FJL A;  2D10 A;  5HE0 A;  3D8F A;  1I2H A;  4YON A;  1RRP B;  3ULB A;  1X05 A;  3WA0 A;  4A5K A;  4WVF B;  2MWN B;  3SV1 A;  5FI1 A;  2P0D A;  2OTX A;  3HQC A;  2YF0 A;  1EAZ A;  5C5B A;  4NSW A;  1DYN A;  1FAO A;  3CIK A;  3ML4 A;  1RJ2 A;  3KY9 A;  4CYE A;  3LJU X;  2ROZ B;  2K2J A;  1K5D B;  2EJ8 A;  2J0J A;  1DBH A;  2N0Y A;  2D9X A;  2RSG A;  2KUP A;  3RCP A;  3P6A A;  4P7I A;  1E5W A;  3PVU A;  3O96 A;  3TVV A;  5L81 A;  2D4Q A;  4GZU A;  1X11 A;  1DRO A;  1X1F A;  3QIJ A;  3KZ1 A;  1BAK A;  1FGZ A;  4H8S A;  4DXA B;  1P3R A;  2HE7 A;  1ZSQ A;  2YS3 A;  3SNH A;  1MK9 B;  5LON B;  2KCJ A;  1UEF A;  2D11 A;  3U7D A;  1NTY A;  4TKN A;  1FGY A;  2XQN M;  1Y5O A;  4GPT B;  2DN6 A;  2M38 A;  2G35 A;  3AU4 A;  2KGX B;  5HE1 A;  3V5W A;  2LYD A;  4MT7 A;  4K2P A;  2E2X A;  3M1I B;  1I7A A;  1Z87 A;  2ROV A;  3VOQ A;  4MY6 A;  1AWE A;  2UZS A;  2YVC A;  2GCL A;  2VKI A;  2H7E A;  3FM8 C;  5HE3 A;  3DXD A;  2Y7B A;  2RNR B;  3TFM A;  2DHI A;  1UNR A;  2YS1 A;  4HB3 B;  1FHX A;  1FB8 A;  2Q13 A;  1ZVR A;  1U5G A;  2LKO A;  5DHF B;  4PNK A;  4IFS A;  3CXB B;  4Z2N A;  1U5E A;  2QKM A;  1TJ6 A;  4GXB A;  4EKU A;  1IRS A;  3MDB C;  4HAW B;  4CHM A;  2DX5 A;  1W1D A;  1XR0 B;  1BWN A;  5JLJ B;  1OQN A;  4A6H A;  3PEG A;  3G9W A;  1OMW A;  4A6F A;  4HHV A;  1DDV A;  2K2U A;  2J0M A;  1WG7 A;  1XCG A;  1PLS A;  3KRX A;  4MK0 A;  3ODW A;  2RGN B;  4K17 A;  5HE2 A;  5CLQ B;  1MIZ B;  3D8D A;  3UZT A;  2Z0P A;  2N23 A;  2P0F A;  4PQ0 A;  1FOE A;  2DLW A;  3P7Z A;  3KRW A;  2MDX A;  5D3V A;  1WGQ A;  1QQG A;  1UNP A;  3U8Z A;  1H10 A;  2I1J A;  1WJM A;  1X1G A;  1U2B A;  3PP2 A;  5D3Y A;  2EMT A;  2Y8G A;  2COD A;  1ZC3 B;  2HTH B;  4GN1 A;  2D9V A;  2DHK A;  3QBV B;  1UPR A;  5DH9 B;  1BTN A;  2V76 A;  2Z0O A;  1DDW A;  1PMS A;  3PVL A;  5C16 A;  1SHC A;  2VRW B;  1ZM0 A;  2COF A;  5LOP B;  2DA0 A;  4HB4 B;  1NU2 A;  4XWX A;  1U29 A;  1WJ1 A;  2LUL A;  5D27 A;  1LW3 A;  2YSZ A;  4DX9 0;  2DHJ A;  3DXC A;  1WI1 A;  3TCA A;  3FEH A;  4KVG B;  3FSS A;  1W1H A;  4NY0 A;  1XOD A;  3PG7 A;  2EC1 A;  4Y94 A;  3ZVR A;  3QWM A;  3SO6 A;  1M7E A;  4HAY B;  2QKL A;  4HAU B;  2DFK A;  4F7G A;  5JHG A;  2D9W A;  4BBK A;  1PFJ A;  4HAT B;  1V5M A;  2K00 A;  4HB2 B;  2I5C A;  3WYF B;  1J0W A;  2P8V A;  3OAN A;  5J3T A;  5CLL B;  3KSY A;  1FHO A;  1QC6 A;  1V5P A;  2YT0 A;  4DBB A;  4TYZ A;  1M7R A;  1U5F A;  1U5D A;  4A6F B;  1Y19 B;  3GYP A;  5C6R A;  5KCV A;  2YRY A;  4L6E A;  2COC A;  3T06 A;  2L2I A;  2RLO A;  2AEH A;  2W2X D;  3HW2 B;  4K81 A;  5C5B B;  2W2X C;  5JP4 A;  3A8Q A;  5FI0 A;  4B6H A;  1WVH A;  4CHJ A;  2GS0 A;  1EVH A;  2H7D A;  2DTC A;  5DI9 B;  3SYX A;  3SUZ A;  1MKE A;  1MAI A;  2LOZ A;  2NMB A;  2ELB A;  5D3X A;  2D9Z A;  1UPQ A;  2UVM A;  3X23 A;  2J59 M;  3AU5 A;  1LB1 A;  1BTK A;  2IFS A;  4F7H A;  3ZDT A;  3TW1 A;  2GCJ A;  3A98 B;  2P0H A;  1Q67 A;  1N3H A;  5J3Q A;  2YT1 A;  1GC7 A;  1NI2 A;  3D8E A;  3AJ4 A;  1XKE A;  1P6S A;  5JHH A;  1SGH A;  2Y8F A;  3IVF A;  5EFX A;  4HDO A;  2RUK B;  2COA A;  4HB0 B;  2R09 A;  3BJI A;  4YL8 A;  2DYQ A;  1V89 A;  3PVW A;  1UNQ A;  2ADZ A;  2OQB A;  1EF1 A;  4KHO A;  2M14 A;  4KHA A;  3A8P A;  2CAY A;  3BIN A;  4F7U P;  2Z0Q A;  1XD4 A;  4KAX B;  1MPH A;  3F0W A;  1U27 A;  2I1K A;  2RVB B;  1NTV A;  4KHB B;  4HAZ B;  5J3Y A;  3N7C A;  2DX1 A;  2I5F A;  3TO1 A;  1KZ7 A;  4EMO A;  5DHA B;  1KZG A;  2ELA A;  1TQZ A;  2AL6 A;  2UZR A;  1WGU A;  1XX0 A;  1MK7 B;  3ODO A;  1W1G A;  2YS5 A;  1AQC A;  1OY2 A;  1V61 A;  2R0D A;  2VSZ A;  1X86 A;  4IOY X;  2BCJ A;  1K5G B;  5DIF B;  1ZC4 B;  2DYN A;  2LG1 A;  3DXE A;  2PZ1 A;  2EMS A;  4C0A A;  4K2O A;  1DDM A;  3HK0 A;  5KQ4 A;  2D9Y A;  4EJN A;  2X18 A;  2CY5 A;  2L1C A;  4HAV B;  3VIA A;  1GC6 A;  2NZ8 B;  2J0K A;  1TXD A;  3NSU A;  1KI1 B;  3ULC A;  4WSF A;  1V88 A;  4DX8 A;  4HDQ A;  3MPX A;  4A6K A;  1EGX A;  1P5T A;  4Z2M B;  1MIX A;  5D3W A;  2DKP A;  3PZD A;  5C79 A;  3GYO A;  3PSC A;  4GMX B;  2CRF A;  2DKQ A;  2W2W A;  4D0N B;  2LOX A;  4ZRK A;  2D2Q A;  4GMV A;  4ZRI A;  2ZPY A;  1ISN A;  1GG3 A;  5KQ1 A;  4WJ7 A;  1B55 A;  1V5U A;  3ODX A;  1H4R A;  2MKR A;  1FHW A;  2GJY A;  2JP2 A;  4IAP A;  2MFQ A;  3F5R A;  1J19 A;  4HAX B;  4ZRJ A;  2CY4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...