1P5TA

Crystal structure of dok1 ptb domain
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
107
structure length
107
Chain Sequence
MGSQFWVTSQKTEASERCGLQGSYILRVEAEKLTLLTLGAQSQILEPLLFWPYTLLRRYGRDKVMFSFEAGRRCPSGPGTFTFQTSQGNDIFQAVEAAIQQQKAQGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis for the Specific Recognition of RET by the Dok1 Phosphotyrosine Binding Domain
pubmed doi rcsb
source organism Mus musculus
molecule tags Signaling protein
molecule keywords Docking protein 1
total genus 25
structure length 107
sequence length 107
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-04-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 1p5tA00
2KCJA 3FM8C 1U5FA 2ROVA 4HB0B 2MFQA 1U5GA 2DLWA 2YVCA 2Y8FA 3SUZA 1Q67A 3AJ4A 1FGYA 4MK0A 2YF0A 3KRWA 2KGXB 4EMOA 2DYNA 2COFA 3SO6A 3HW2B 4Z2NA 4KHBB 5LOPB 4F7HA 2QKMA 3DXCA 3WA0A 4B6HA 4IOYX 2MWNB 2AEHA 3P7ZA 2LYDA 5FI0A 1TJ6A 2YT1A 3QIJA 2CY5A 2YT0A 5D3WA 3FEHA 3ULCA 1LW3A 5C5BA 1V5MA 1DYNA 4IAPA 2ELBA 4GN1A 2D9WA 1OY2A 4HDOA 2D2QA 1FAOA 1GC6A 1EF1A 1I2HA 4ZRIA 1BTKA 4PQ0A 3VIAA 1BWNA 4BBKA 2I1JA 2MDXA 2DN6A 2D10A 2JP2A 4TKNA 1WJMA 4DXAB 4DBBA 1UPQA 2ADZA 3TVVA 3SYXA 4PNKA 2V76A 4HHVA 1GG3A 4K17A 1QQGA 4DX8A 1TQZA 5LONB 1BAKA 4KVGB 1UNPA 2UZRA 2P0DA 3KY9A 4YONA 5D3VA 4HATB 4K2OA 3AU5A 2M38A 2R09A 1X86A 2EC1A 1FB8A 3IVFA 1IRSA 5GOWB 4HAZB 2VSZA 5DIFB 2E2XA 2GS0A 4HAUB 1UEFA 2DFKA 1NTVA 1U2BA 4WJ7A 3ODWA 4A6FA 3MDBC 4L6EA 4HAXB 1OMWA 3U7DA 3VOQA 5JHHA 3AU4A 3KRXA 4CHJA 2OQBA 4H8SA 2IYBA 2CAYA 2DHKA 4EJNA 2LKOA 2DHIA 1ZSQA 2YS1A 3FSSA 1EVHA 3TCAA 1W1HA 1WJ1A 2J59M 5D3YA 2AL6A 2KUPA 2J0MA 1X1FA 2YRYA 1FOEA 1V5UA 2YSZA 3ODXA 2DKPA 1XX0A 1V5PA 2D9VA 2K2JA 4KHOA 1LB1A 3TFMA 3O96A 2D9YA 3ULBA 1X1GA 3P6AA 2DA0A 1V88A 1ZC4B 4P7IA 4D0NB 3PP2A 4HDQA 5HE1A 1AQCA 2IFSA 2W2WA 3ZDTA 2NMBA 3DXDA 2DX1A 4GPTB 4A6KA 4KHAA 2H7DA 1RJ2A 2UZSA 4HB4B 3HQCA 1AWEA 2X18A 4IFSA 1KI1B 5JHGA 4F7GA 1M7RA 1OQNA 4K2PA 3ODOA 1WGUA 1J19A 4GMVA 2RLOA 1K5DB 5D3XA 3WYFB 2I1KA 2DX5A 2K2UA 1E5WA 1EGXA 1FGZA 1ZM0A 2XQNM 1H10A 2Q13A 5DI9B 4CYEA 4EKUA 2RSGA 2GCJA 3BJIA 5HE3A 2BCJA 3QBVB 1U5DA 1UPRA 2PZ1A 3D8FA 4Y94A 4GXBA 1WVHA 4A6FB 2I5CA 1ZC3B 1DDVA 1FHWA 2OTXA 3U8ZA 2D4QA 5HE0A 1ZVRA 2COAA 1MK9B 3TW1A 3N7CA 4F7UP 3DXEA 1Y5OA 4KAXB 1UNRA 2LG1A 1U5EA 1Y19B 5CLQB 4WSFA 3V5WA 1W1GA 2W2XD 1DDWA 1M7EA 5FI1A 5DHFB 2G35A 2LOXA 3A8PA 3CIKA 1TXDA 1K5GB 2LOZA 4ZRJA 3KZ1A 1W1DA 4NY0A 5C16A 1XD4A 2RNRB 4DX90 2HE7A 2ZPYA 1H4RA 1XR0B 2P8VA 5C5BB 1B55A 1SGHA 3OANA 3PZDA 3PVWA 2Y8GA 2D9XA 1BTNA 2Z0OA 4A5KA 1MIZB 2DKQA 2GJYA 1U29A 1RRPB 2EJ8A 3NSUA 2R0DA 3M1IB 3PG7A 2ELAA 2Y7BA 4NSWA 3D8DA 1QC6A 4C0AA 2DHJA 3MPXA 5D27A 4YL8A 5KQ1A 2N0YA 3GYPA 3LJUX 4WVFB 1P3RA 4TYZA 2K00A 3PSCA 1NI2A 3SNHA 3A8QA 3PVUA 2L1CA 5DHAB 2J0KA 2ROZB 4Z2MB 2RVBB 1V89A 2DTCA 2W2XC 5CLLB 2D9ZA 2J0JA 3ZVRA 1WG7A 4MY6A 5JLJB 5J3YA 4HB2B 2N23A 4HB3B 5JP4A 1Z87A 5J3QA 5J3TA 1I7AA 3D8EA 5C79A 1XODA 2MKRA 1FHXA 3BINA 1U27A 2NZ8B 2LULA 1FHOA 5C6RA 3G9WA 1SHCA 2VRWB 1WGQA 2Z0QA 3SV1A 1PFJA 1UNQA 4XWXA 2EMSA 2P0FA 2HTHB 1MAIA 3HK0A 4A6HA 1EAZA 1XCGA 5L81A 2CRFA 3F5RA 1X11A 5KQ4A 1KZ7A 1P5TA 3RCPA 2UVMA 1N3HA 2CODA 3PEGA 1P6SA 2D11A 1DBHA 2GCLA 2YS5A 2H7EA 5EFXA 1GC7A 3ML4A 2DYQA 1DDMA 4ZRKA 1WI1A 3F0WA 1MPHA 2I5FA 1V61A 3T06A 4HAYB 3A98B 3GYOA 4HAWB 2L2IA 3PVLA 2VKIA 2P0HA 1MKEA 4K81A 2RGNB 4HAVB 5HE2A 3TO1A 1KZGA 1XKEA 2M14A 2RUKB 1MIXA 3X23A 3QWMA 2EMTA 3UZTA 3KSYA 1NTYA 1NU2A 1PMSA 1X05A 1ISNA 1MK7B 2QKLA 4GZUA 2FJLA 2YS3A 4GMXB 1J0WA 5KCVA 4MT7A 1PLSA 5DH9B 3CXBB 2COCA 2Z0PA 1DROA 4CHMA 2CY4A
chains in the Genus database with same CATH superfamily
2RRFA 2KCJA 3FM8C 1U5FA 2ROVA 4HB0B 2MFQA 1U5GA 2DLWA 2YVCA 2Y8FA 3SUZA 1Q67A 3AJ4A 1FGYA 4MK0A 2YF0A 3KRWA 2KGXB 4EMOA 2DYNA 2COFA 3SO6A 3HW2B 4L1RA 4KHBB 4Z2NA 5LOPB 4F7HA 2QKMA 3DXCA 3WA0A 4B6HA 4IOYX 2MWNB 2AEHA 3P7ZA 2LYDA 5FI0A 1TJ6A 2YT1A 3QIJA 2CY5A 2YT0A 5D3WA 3FEHA 3ULCA 1LW3A 3NW8A 2FJUB 2NBVA 5C5BA 1V5MA 1DYNA 4IAPA 3NWFA 2ELBA 4GN1A 2D9WA 1OY2A 4HDOA 2D2QA 1FAOA 1GC6A 4QXAB 1EF1A 1I2HA 4ZRIA 1BTKA 4PQ0A 3VIAA 1BWNA 4BBKA 2I1JA 2MDXA 2DN6A 3B77A 5I2SA 2D10A 2JP2A 4TKNA 1WJMA 4DXAB 4DBBA 1UPQA 2ADZA 3NWAA 3TVVA 3SYXA 4PNKA 2V76A 2Z4DA 4HHVA 1GG3A 2Z13A 4K17A 1QQGA 4DX8A 1TQZA 5LONB 1BAKA 4KVGB 1UNPA 2UZRA 2P0DA 3KY9A 4YONA 5D3VA 4HATB 4K2OA 3AU5A 2M38A 2R09A 1X86A 2EC1A 5I2MA 1FB8A 3IVFA 1IRSA 5GOWB 4HAZB 2VSZA 5DIFB 2E2XA 2GS0A 4HAUB 1UEFA 2DFKA 1NTVA 1U2BA 4WJ7A 3ODWA 4A6FA 3MDBC 4L6EA 4HAXB 1OMWA 3U7DA 3VOQA 5JHHA 3AU4A 3KRXA 4CHJA 2OQBA 4H8SA 2IYBA 2CAYA 2DHKA 4DIXA 4EJNA 2LKOA 2DHIA 1ZSQA 2YS1A 3FSSA 1EVHA 3TCAA 1W1HA 1WJ1A 2J59M 5D3YA 2AL6A 2KUPA 2J0MA 1X1FA 2YRYA 1FOEA 1V5UA 2YSZA 3ODXA 2DKPA 1XX0A 3OHMB 1V5PA 2D9VA 2K2JA 4KHOA 1LB1A 4KHBA 3TFMA 3O96A 2D9YA 3ULBA 1X1GA 3P6AA 2DA0A 1V88A 1ZC4B 4P7IA 4D0NB 3PP2A 4HDQA 5HE1A 1AQCA 2IFSA 2W2WA 3ZDTA 4GNKB 2NMBA 3DXDA 2DX1A 4GPTB 4A6KA 4KHAA 2H7DA 1RJ2A 2UZSA 4HB4B 3HQCA 1AWEA 2X18A 4IFSA 1KI1B 5JHGA 4F7GA 1M7RA 4QJ5B 1OQNA 4K2PA 3ODOA 1WGUA 1J19A 4GMVA 2RLOA 1K5DB 5D3XA 2KIEA 3WYFB 2I1KA 2KR0A 2DX5A 2K2UA 1E5WA 1EGXA 1FGZA 1ZM0A 2XQNM 1H10A 2Q13A 1T77A 5DI9B 4CYEA 4EKUA 2RSGA 2K49A 2GCJA 3BJIA 5HE3A 2BCJA 3QBVB 1U5DA 1UPRA 2PZ1A 3NWDA 3D8FA 4Y94A 4GXBA 5IRSA 1WVHA 4A6FB 2I5CA 1ZC3B 1DDVA 1FHWA 3HSAA 2OTXA 3U8ZA 2D4QA 5HE0A 1ZVRA 2COAA 1MK9B 3TW1A 3N7CA 4F7UP 3DXEA 2Z59A 1Y5OA 4KAXB 1UNRA 2LG1A 4GOUA 1U5EA 1Y19B 5CLQB 4WSFA 3V5WA 1W1GA 4OT1A 2W2XD 4D6WA 1DDWA 1M7EA 5FI1A 5DHFB 2G35A 2LOXA 3A8PA 3CIKA 1TXDA 1K5GB 3FVCA 2LOZA 4ZRJA 3KZ1A 1W1DA 4NY0A 5C16A 1XD4A 2ZKMX 2RNRB 2KUQA 4DX90 2HE7A 2YT2A 2ZPYA 1H4RA 1XR0B 2P8VA 5C5BB 1B55A 1SGHA 3OANA 3PZDA 3PVWA 2Y8GA 2D9XA 1BTNA 2Z0OA 4A5KA 1MIZB 2DKQA 2GJYA 1U29A 1MI1A 3A58A 1RRPB 2EJ8A 3NSUA 2R0DA 3M1IB 3PG7A 3HIEA 2ELAA 2GUMA 2Y7BA 4NSWA 3D8DA 1QC6A 4C0AA 2K8EA 2DHJA 3MPXA 5D27A 4YL8A 5KQ1A 2N0YA 3GYPA 3LJUX 4WVFB 1P3RA 4TYZA 3U12A 2K00A 3PSCA 1NI2A 3SNHA 3A8QA 3PVUA 2L1CA 5DHAB 2J0KA 2ROZB 4Z2MB 2RVBB 1V89A 2DTCA 2W2XC 5CLLB 4QJ4B 2D9ZA 2J0JA 3ZVRA 1WG7A 4MY6A 5JLJB 5J3YA 4HB2B 2N23A 5LG4B 4HB3B 5JP4A 1Z87A 5J3QA 5J3TA 1I7AA 3D8EA 5C79A 1XODA 2MKRA 1FHXA 3BINA 1U27A 2R2YA 2NZ8B 2LULA 1FHOA 5C6RA 3G9WA 1SHCA 2VRWB 1WGQA 2Z0QA 3SV1A 1PFJA 1UNQA 2Z14A 4XWXA 2EMSA 2P0FA 2HTHB 1MAIA 3HK0A 4A6HA 4OSNA 1EAZA 1XCGA 4CSQA 5L81A 2CRFA 3F5RA 1X11A 5KQ4A 1KZ7A 1P5TA 3RCPA 2UVMA 1N3HA 2CODA 3PEGA 1P6SA 2D11A 1DBHA 2GCLA 2YS5A 2H7EA 5M4YB 5EFXA 4QJ3B 1GC7A 3ML4A 2DYQA 1DDMA 4ZRKA 1WI1A 3F0WA 1MPHA 2I5FA 1V61A 3T06A 4HAYB 3A98B 3GYOA 4HAWB 2L2IA 3PVLA 2VKIA 2P0HA 3DCXA 1MKEA 4K81A 2RGNB 4HAVB 5HE2A 3TO1A 1KZGA 1XKEA 2M14A 2RUKB 1MIXA 3X23A 3QWMA 2EMTA 3UZTA 3KSYA 1NTYA 1NU2A 1PMSA 1X05A 1ISNA 1MK7B 2QKLA 4GZUA 2KIGA 2FJLA 2YS3A 1ZYIA 4GMXB 1J0WA 5KCVA 4MT7A 1PLSA 5DH9B 3CXBB 2COCA 2Z0PA 4HSIA 1DROA 4CHMA 2CY4A
chains in the Genus database with same CATH topology
2KCJA 3FM8C 1U5FA 2ROVA 4HB0B 2MFQA 1U5GA 2DLWA 2YVCA 2Y8FA 3SUZA 1Q67A 3AJ4A 1FGYA 4MK0A 2YF0A 3KRWA 2KGXB 4EMOA 2DYNA 2COFA 3SO6A 3HW2B 4Z2NA 4KHBB 5LOPB 4F7HA 2QKMA 3DXCA 3WA0A 4B6HA 4IOYX 2MWNB 2AEHA 3P7ZA 2LYDA 5FI0A 1TJ6A 2YT1A 3QIJA 2CY5A 2YT0A 5D3WA 3FEHA 3ULCA 1LW3A 5C5BA 1V5MA 1DYNA 4IAPA 2ELBA 4GN1A 2D9WA 1OY2A 4HDOA 2D2QA 1FAOA 1GC6A 1EF1A 1I2HA 4ZRIA 1BTKA 4PQ0A 3VIAA 1BWNA 4BBKA 2I1JA 2MDXA 2DN6A 2D10A 2JP2A 4TKNA 1WJMA 4DXAB 4DBBA 1UPQA 2ADZA 3TVVA 3SYXA 4PNKA 2V76A 4HHVA 1GG3A 4K17A 1QQGA 4DX8A 1TQZA 5LONB 1BAKA 4KVGB 1UNPA 2UZRA 2P0DA 3KY9A 4YONA 5D3VA 4HATB 4K2OA 3AU5A 2M38A 2R09A 1X86A 2EC1A 1FB8A 3IVFA 1IRSA 5GOWB 4HAZB 2VSZA 5DIFB 2E2XA 2GS0A 4HAUB 1UEFA 2DFKA 1NTVA 1U2BA 4WJ7A 3ODWA 4A6FA 3MDBC 4L6EA 4HAXB 1OMWA 3U7DA 3VOQA 5JHHA 3AU4A 3KRXA 4CHJA 2OQBA 4H8SA 2IYBA 2CAYA 2DHKA 4EJNA 2LKOA 2DHIA 1ZSQA 2YS1A 3FSSA 1EVHA 3TCAA 1W1HA 1WJ1A 2J59M 5D3YA 2AL6A 2KUPA 2J0MA 1X1FA 2YRYA 1FOEA 1V5UA 2YSZA 3ODXA 2DKPA 1XX0A 1V5PA 2D9VA 2K2JA 4KHOA 1LB1A 3TFMA 3O96A 2D9YA 3ULBA 1X1GA 3P6AA 2DA0A 1V88A 1ZC4B 4P7IA 4D0NB 3PP2A 4HDQA 5HE1A 1AQCA 2IFSA 2W2WA 3ZDTA 2NMBA 3DXDA 2DX1A 4GPTB 4A6KA 4KHAA 2H7DA 1RJ2A 2UZSA 4HB4B 3HQCA 1AWEA 2X18A 4IFSA 1KI1B 5JHGA 4F7GA 1M7RA 1OQNA 4K2PA 3ODOA 1WGUA 1J19A 4GMVA 2RLOA 1K5DB 5D3XA 3WYFB 2I1KA 2DX5A 2K2UA 1E5WA 1EGXA 1FGZA 1ZM0A 2XQNM 1H10A 2Q13A 5DI9B 4CYEA 4EKUA 2RSGA 2GCJA 3BJIA 5HE3A 2BCJA 3QBVB 1U5DA 1UPRA 2PZ1A 3D8FA 4Y94A 4GXBA 1WVHA 4A6FB 2I5CA 1ZC3B 1DDVA 1FHWA 2OTXA 3U8ZA 2D4QA 5HE0A 1ZVRA 2COAA 1MK9B 3TW1A 3N7CA 4F7UP 3DXEA 1Y5OA 4KAXB 1UNRA 2LG1A 1U5EA 1Y19B 5CLQB 4WSFA 3V5WA 1W1GA 2W2XD 1DDWA 1M7EA 5FI1A 5DHFB 2G35A 2LOXA 3A8PA 3CIKA 1TXDA 1K5GB 2LOZA 4ZRJA 3KZ1A 1W1DA 4NY0A 5C16A 1XD4A 2RNRB 4DX90 2HE7A 2ZPYA 1H4RA 1XR0B 2P8VA 5C5BB 1B55A 1SGHA 3OANA 3PZDA 3PVWA 2Y8GA 2D9XA 1BTNA 2Z0OA 4A5KA 1MIZB 2DKQA 2GJYA 1U29A 1RRPB 2EJ8A 3NSUA 2R0DA 3M1IB 3PG7A 2ELAA 2Y7BA 4NSWA 3D8DA 1QC6A 4C0AA 2DHJA 3MPXA 5D27A 4YL8A 5KQ1A 2N0YA 3GYPA 3LJUX 4WVFB 1P3RA 4TYZA 2K00A 3PSCA 1NI2A 3SNHA 3A8QA 3PVUA 2L1CA 5DHAB 2J0KA 2ROZB 4Z2MB 2RVBB 1V89A 2DTCA 2W2XC 5CLLB 2D9ZA 2J0JA 3ZVRA 1WG7A 4MY6A 5JLJB 5J3YA 4HB2B 2N23A 4HB3B 5JP4A 1Z87A 5J3QA 5J3TA 1I7AA 3D8EA 5C79A 1XODA 2MKRA 1FHXA 3BINA 1U27A 2NZ8B 2LULA 1FHOA 5C6RA 3G9WA 1SHCA 2VRWB 1WGQA 2Z0QA 3SV1A 1PFJA 1UNQA 4XWXA 2EMSA 2P0FA 2HTHB 1MAIA 3HK0A 4A6HA 1EAZA 1XCGA 5L81A 2CRFA 3F5RA 1X11A 5KQ4A 1KZ7A 1P5TA 3RCPA 2UVMA 1N3HA 2CODA 3PEGA 1P6SA 2D11A 1DBHA 2GCLA 2YS5A 2H7EA 5EFXA 1GC7A 3ML4A 2DYQA 1DDMA 4ZRKA 1WI1A 3F0WA 1MPHA 2I5FA 1V61A 3T06A 4HAYB 3A98B 3GYOA 4HAWB 2L2IA 3PVLA 2VKIA 2P0HA 1MKEA 4K81A 2RGNB 4HAVB 5HE2A 3TO1A 1KZGA 1XKEA 2M14A 2RUKB 1MIXA 3X23A 3QWMA 2EMTA 3UZTA 3KSYA 1NTYA 1NU2A 1PMSA 1X05A 1ISNA 1MK7B 2QKLA 4GZUA 2FJLA 2YS3A 4GMXB 1J0WA 5KCVA 4MT7A 1PLSA 5DH9B 3CXBB 2COCA 2Z0PA 1DROA 4CHMA 2CY4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KCJ A;  3FM8 C;  1U5F A;  2ROV A;  4HB0 B;  2MFQ A;  1U5G A;  2DLW A;  2YVC A;  2Y8F A;  3SUZ A;  1Q67 A;  3AJ4 A;  1FGY A;  4MK0 A;  2YF0 A;  3KRW A;  2KGX B;  4EMO A;  2DYN A;  2COF A;  3SO6 A;  3HW2 B;  4Z2N A;  4KHB B;  5LOP B;  4F7H A;  2QKM A;  3DXC A;  3WA0 A;  4B6H A;  4IOY X;  2MWN B;  2AEH A;  3P7Z A;  2LYD A;  5FI0 A;  1TJ6 A;  2YT1 A;  3QIJ A;  2CY5 A;  2YT0 A;  5D3W A;  3FEH A;  3ULC A;  1LW3 A;  5C5B A;  1V5M A;  1DYN A;  4IAP A;  2ELB A;  4GN1 A;  2D9W A;  1OY2 A;  4HDO A;  2D2Q A;  1FAO A;  1GC6 A;  1EF1 A;  1I2H A;  4ZRI A;  1BTK A;  4PQ0 A;  3VIA A;  1BWN A;  4BBK A;  2I1J A;  2MDX A;  2DN6 A;  2D10 A;  2JP2 A;  4TKN A;  1WJM A;  4DXA B;  4DBB A;  1UPQ A;  2ADZ A;  3TVV A;  3SYX A;  4PNK A;  2V76 A;  4HHV A;  1GG3 A;  4K17 A;  1QQG A;  4DX8 A;  1TQZ A;  5LON B;  1BAK A;  4KVG B;  1UNP A;  2UZR A;  2P0D A;  3KY9 A;  4YON A;  5D3V A;  4HAT B;  4K2O A;  3AU5 A;  2M38 A;  2R09 A;  1X86 A;  2EC1 A;  1FB8 A;  3IVF A;  1IRS A;  5GOW B;  4HAZ B;  2VSZ A;  5DIF B;  2E2X A;  2GS0 A;  4HAU B;  1UEF A;  2DFK A;  1NTV A;  1U2B A;  4WJ7 A;  3ODW A;  4A6F A;  3MDB C;  4L6E A;  4HAX B;  1OMW A;  3U7D A;  3VOQ A;  5JHH A;  3AU4 A;  3KRX A;  4CHJ A;  2OQB A;  4H8S A;  2IYB A;  2CAY A;  2DHK A;  4EJN A;  2LKO A;  2DHI A;  1ZSQ A;  2YS1 A;  3FSS A;  1EVH A;  3TCA A;  1W1H A;  1WJ1 A;  2J59 M;  5D3Y A;  2AL6 A;  2KUP A;  2J0M A;  1X1F A;  2YRY A;  1FOE A;  1V5U A;  2YSZ A;  3ODX A;  2DKP A;  1XX0 A;  1V5P A;  2D9V A;  2K2J A;  4KHO A;  1LB1 A;  3TFM A;  3O96 A;  2D9Y A;  3ULB A;  1X1G A;  3P6A A;  2DA0 A;  1V88 A;  1ZC4 B;  4P7I A;  4D0N B;  3PP2 A;  4HDQ A;  5HE1 A;  1AQC A;  2IFS A;  2W2W A;  3ZDT A;  2NMB A;  3DXD A;  2DX1 A;  4GPT B;  4A6K A;  4KHA A;  2H7D A;  1RJ2 A;  2UZS A;  4HB4 B;  3HQC A;  1AWE A;  2X18 A;  4IFS A;  1KI1 B;  5JHG A;  4F7G A;  1M7R A;  1OQN A;  4K2P A;  3ODO A;  1WGU A;  1J19 A;  4GMV A;  2RLO A;  1K5D B;  5D3X A;  3WYF B;  2I1K A;  2DX5 A;  2K2U A;  1E5W A;  1EGX A;  1FGZ A;  1ZM0 A;  2XQN M;  1H10 A;  2Q13 A;  5DI9 B;  4CYE A;  4EKU A;  2RSG A;  2GCJ A;  3BJI A;  5HE3 A;  2BCJ A;  3QBV B;  1U5D A;  1UPR A;  2PZ1 A;  3D8F A;  4Y94 A;  4GXB A;  1WVH A;  4A6F B;  2I5C A;  1ZC3 B;  1DDV A;  1FHW A;  2OTX A;  3U8Z A;  2D4Q A;  5HE0 A;  1ZVR A;  2COA A;  1MK9 B;  3TW1 A;  3N7C A;  4F7U P;  3DXE A;  1Y5O A;  4KAX B;  1UNR A;  2LG1 A;  1U5E A;  1Y19 B;  5CLQ B;  4WSF A;  3V5W A;  1W1G A;  2W2X D;  1DDW A;  1M7E A;  5FI1 A;  5DHF B;  2G35 A;  2LOX A;  3A8P A;  3CIK A;  1TXD A;  1K5G B;  2LOZ A;  4ZRJ A;  3KZ1 A;  1W1D A;  4NY0 A;  5C16 A;  1XD4 A;  2RNR B;  4DX9 0;  2HE7 A;  2ZPY A;  1H4R A;  1XR0 B;  2P8V A;  5C5B B;  1B55 A;  1SGH A;  3OAN A;  3PZD A;  3PVW A;  2Y8G A;  2D9X A;  1BTN A;  2Z0O A;  4A5K A;  1MIZ B;  2DKQ A;  2GJY A;  1U29 A;  1RRP B;  2EJ8 A;  3NSU A;  2R0D A;  3M1I B;  3PG7 A;  2ELA A;  2Y7B A;  4NSW A;  3D8D A;  1QC6 A;  4C0A A;  2DHJ A;  3MPX A;  5D27 A;  4YL8 A;  5KQ1 A;  2N0Y A;  3GYP A;  3LJU X;  4WVF B;  1P3R A;  4TYZ A;  2K00 A;  3PSC A;  1NI2 A;  3SNH A;  3A8Q A;  3PVU A;  2L1C A;  5DHA B;  2J0K A;  2ROZ B;  4Z2M B;  2RVB B;  1V89 A;  2DTC A;  2W2X C;  5CLL B;  2D9Z A;  2J0J A;  3ZVR A;  1WG7 A;  4MY6 A;  5JLJ B;  5J3Y A;  4HB2 B;  2N23 A;  4HB3 B;  5JP4 A;  1Z87 A;  5J3Q A;  5J3T A;  1I7A A;  3D8E A;  5C79 A;  1XOD A;  2MKR A;  1FHX A;  3BIN A;  1U27 A;  2NZ8 B;  2LUL A;  1FHO A;  5C6R A;  3G9W A;  1SHC A;  2VRW B;  1WGQ A;  2Z0Q A;  3SV1 A;  1PFJ A;  1UNQ A;  4XWX A;  2EMS A;  2P0F A;  2HTH B;  1MAI A;  3HK0 A;  4A6H A;  1EAZ A;  1XCG A;  5L81 A;  2CRF A;  3F5R A;  1X11 A;  5KQ4 A;  1KZ7 A;  1P5T A;  3RCP A;  2UVM A;  1N3H A;  2COD A;  3PEG A;  1P6S A;  2D11 A;  1DBH A;  2GCL A;  2YS5 A;  2H7E A;  5EFX A;  1GC7 A;  3ML4 A;  2DYQ A;  1DDM A;  4ZRK A;  1WI1 A;  3F0W A;  1MPH A;  2I5F A;  1V61 A;  3T06 A;  4HAY B;  3A98 B;  3GYO A;  4HAW B;  2L2I A;  3PVL A;  2VKI A;  2P0H A;  1MKE A;  4K81 A;  2RGN B;  4HAV B;  5HE2 A;  3TO1 A;  1KZG A;  1XKE A;  2M14 A;  2RUK B;  1MIX A;  3X23 A;  3QWM A;  2EMT A;  3UZT A;  3KSY A;  1NTY A;  1NU2 A;  1PMS A;  1X05 A;  1ISN A;  1MK7 B;  2QKL A;  4GZU A;  2FJL A;  2YS3 A;  4GMX B;  1J0W A;  5KCV A;  4MT7 A;  1PLS A;  5DH9 B;  3CXB B;  2COC A;  2Z0P A;  1DRO A;  4CHM A;  2CY4 A; 
#chains in the Genus database with same CATH topology
 2RRF A;  2KCJ A;  3FM8 C;  1U5F A;  2ROV A;  4HB0 B;  2MFQ A;  1U5G A;  2DLW A;  2YVC A;  2Y8F A;  3SUZ A;  1Q67 A;  3AJ4 A;  1FGY A;  4MK0 A;  2YF0 A;  3KRW A;  2KGX B;  4EMO A;  2DYN A;  2COF A;  3SO6 A;  3HW2 B;  4L1R A;  4KHB B;  4Z2N A;  5LOP B;  4F7H A;  2QKM A;  3DXC A;  3WA0 A;  4B6H A;  4IOY X;  2MWN B;  2AEH A;  3P7Z A;  2LYD A;  5FI0 A;  1TJ6 A;  2YT1 A;  3QIJ A;  2CY5 A;  2YT0 A;  5D3W A;  3FEH A;  3ULC A;  1LW3 A;  3NW8 A;  2FJU B;  2NBV A;  5C5B A;  1V5M A;  1DYN A;  4IAP A;  3NWF A;  2ELB A;  4GN1 A;  2D9W A;  1OY2 A;  4HDO A;  2D2Q A;  1FAO A;  1GC6 A;  4QXA B;  1EF1 A;  1I2H A;  4ZRI A;  1BTK A;  4PQ0 A;  3VIA A;  1BWN A;  4BBK A;  2I1J A;  2MDX A;  2DN6 A;  3B77 A;  5I2S A;  2D10 A;  2JP2 A;  4TKN A;  1WJM A;  4DXA B;  4DBB A;  1UPQ A;  2ADZ A;  3NWA A;  3TVV A;  3SYX A;  4PNK A;  2V76 A;  2Z4D A;  4HHV A;  1GG3 A;  2Z13 A;  4K17 A;  1QQG A;  4DX8 A;  1TQZ A;  5LON B;  1BAK A;  4KVG B;  1UNP A;  2UZR A;  2P0D A;  3KY9 A;  4YON A;  5D3V A;  4HAT B;  4K2O A;  3AU5 A;  2M38 A;  2R09 A;  1X86 A;  2EC1 A;  5I2M A;  1FB8 A;  3IVF A;  1IRS A;  5GOW B;  4HAZ B;  2VSZ A;  5DIF B;  2E2X A;  2GS0 A;  4HAU B;  1UEF A;  2DFK A;  1NTV A;  1U2B A;  4WJ7 A;  3ODW A;  4A6F A;  3MDB C;  4L6E A;  4HAX B;  1OMW A;  3U7D A;  3VOQ A;  5JHH A;  3AU4 A;  3KRX A;  4CHJ A;  2OQB A;  4H8S A;  2IYB A;  2CAY A;  2DHK A;  4DIX A;  4EJN A;  2LKO A;  2DHI A;  1ZSQ A;  2YS1 A;  3FSS A;  1EVH A;  3TCA A;  1W1H A;  1WJ1 A;  2J59 M;  5D3Y A;  2AL6 A;  2KUP A;  2J0M A;  1X1F A;  2YRY A;  1FOE A;  1V5U A;  2YSZ A;  3ODX A;  2DKP A;  1XX0 A;  3OHM B;  1V5P A;  2D9V A;  2K2J A;  4KHO A;  1LB1 A;  4KHB A;  3TFM A;  3O96 A;  2D9Y A;  3ULB A;  1X1G A;  3P6A A;  2DA0 A;  1V88 A;  1ZC4 B;  4P7I A;  4D0N B;  3PP2 A;  4HDQ A;  5HE1 A;  1AQC A;  2IFS A;  2W2W A;  3ZDT A;  4GNK B;  2NMB A;  3DXD A;  2DX1 A;  4GPT B;  4A6K A;  4KHA A;  2H7D A;  1RJ2 A;  2UZS A;  4HB4 B;  3HQC A;  1AWE A;  2X18 A;  4IFS A;  1KI1 B;  5JHG A;  4F7G A;  1M7R A;  4QJ5 B;  1OQN A;  4K2P A;  3ODO A;  1WGU A;  1J19 A;  4GMV A;  2RLO A;  1K5D B;  5D3X A;  2KIE A;  3WYF B;  2I1K A;  2KR0 A;  2DX5 A;  2K2U A;  1E5W A;  1EGX A;  1FGZ A;  1ZM0 A;  2XQN M;  1H10 A;  2Q13 A;  1T77 A;  5DI9 B;  4CYE A;  4EKU A;  2RSG A;  2K49 A;  2GCJ A;  3BJI A;  5HE3 A;  2BCJ A;  3QBV B;  1U5D A;  1UPR A;  2PZ1 A;  3NWD A;  3D8F A;  4Y94 A;  4GXB A;  5IRS A;  1WVH A;  4A6F B;  2I5C A;  1ZC3 B;  1DDV A;  1FHW A;  3HSA A;  2OTX A;  3U8Z A;  2D4Q A;  5HE0 A;  1ZVR A;  2COA A;  1MK9 B;  3TW1 A;  3N7C A;  4F7U P;  3DXE A;  2Z59 A;  1Y5O A;  4KAX B;  1UNR A;  2LG1 A;  4GOU A;  1U5E A;  1Y19 B;  5CLQ B;  4WSF A;  3V5W A;  1W1G A;  4OT1 A;  2W2X D;  4D6W A;  1DDW A;  1M7E A;  5FI1 A;  5DHF B;  2G35 A;  2LOX A;  3A8P A;  3CIK A;  1TXD A;  1K5G B;  3FVC A;  2LOZ A;  4ZRJ A;  3KZ1 A;  1W1D A;  4NY0 A;  5C16 A;  1XD4 A;  2ZKM X;  2RNR B;  2KUQ A;  4DX9 0;  2HE7 A;  2YT2 A;  2ZPY A;  1H4R A;  1XR0 B;  2P8V A;  5C5B B;  1B55 A;  1SGH A;  3OAN A;  3PZD A;  3PVW A;  2Y8G A;  2D9X A;  1BTN A;  2Z0O A;  4A5K A;  1MIZ B;  2DKQ A;  2GJY A;  1U29 A;  1MI1 A;  3A58 A;  1RRP B;  2EJ8 A;  3NSU A;  2R0D A;  3M1I B;  3PG7 A;  3HIE A;  2ELA A;  2GUM A;  2Y7B A;  4NSW A;  3D8D A;  1QC6 A;  4C0A A;  2K8E A;  2DHJ A;  3MPX A;  5D27 A;  4YL8 A;  5KQ1 A;  2N0Y A;  3GYP A;  3LJU X;  4WVF B;  1P3R A;  4TYZ A;  3U12 A;  2K00 A;  3PSC A;  1NI2 A;  3SNH A;  3A8Q A;  3PVU A;  2L1C A;  5DHA B;  2J0K A;  2ROZ B;  4Z2M B;  2RVB B;  1V89 A;  2DTC A;  2W2X C;  5CLL B;  4QJ4 B;  2D9Z A;  2J0J A;  3ZVR A;  1WG7 A;  4MY6 A;  5JLJ B;  5J3Y A;  4HB2 B;  2N23 A;  5LG4 B;  4HB3 B;  5JP4 A;  1Z87 A;  5J3Q A;  5J3T A;  1I7A A;  3D8E A;  5C79 A;  1XOD A;  2MKR A;  1FHX A;  3BIN A;  1U27 A;  2R2Y A;  2NZ8 B;  2LUL A;  1FHO A;  5C6R A;  3G9W A;  1SHC A;  2VRW B;  1WGQ A;  2Z0Q A;  3SV1 A;  1PFJ A;  1UNQ A;  2Z14 A;  4XWX A;  2EMS A;  2P0F A;  2HTH B;  1MAI A;  3HK0 A;  4A6H A;  4OSN A;  1EAZ A;  1XCG A;  4CSQ A;  5L81 A;  2CRF A;  3F5R A;  1X11 A;  5KQ4 A;  1KZ7 A;  1P5T A;  3RCP A;  2UVM A;  1N3H A;  2COD A;  3PEG A;  1P6S A;  2D11 A;  1DBH A;  2GCL A;  2YS5 A;  2H7E A;  5M4Y B;  5EFX A;  4QJ3 B;  1GC7 A;  3ML4 A;  2DYQ A;  1DDM A;  4ZRK A;  1WI1 A;  3F0W A;  1MPH A;  2I5F A;  1V61 A;  3T06 A;  4HAY B;  3A98 B;  3GYO A;  4HAW B;  2L2I A;  3PVL A;  2VKI A;  2P0H A;  3DCX A;  1MKE A;  4K81 A;  2RGN B;  4HAV B;  5HE2 A;  3TO1 A;  1KZG A;  1XKE A;  2M14 A;  2RUK B;  1MIX A;  3X23 A;  3QWM A;  2EMT A;  3UZT A;  3KSY A;  1NTY A;  1NU2 A;  1PMS A;  1X05 A;  1ISN A;  1MK7 B;  2QKL A;  4GZU A;  2KIG A;  2FJL A;  2YS3 A;  1ZYI A;  4GMX B;  1J0W A;  5KCV A;  4MT7 A;  1PLS A;  5DH9 B;  3CXB B;  2COC A;  2Z0P A;  4HSI A;  1DRO A;  4CHM A;  2CY4 A; 
#chains in the Genus database with same CATH homology
 2KCJ A;  3FM8 C;  1U5F A;  2ROV A;  4HB0 B;  2MFQ A;  1U5G A;  2DLW A;  2YVC A;  2Y8F A;  3SUZ A;  1Q67 A;  3AJ4 A;  1FGY A;  4MK0 A;  2YF0 A;  3KRW A;  2KGX B;  4EMO A;  2DYN A;  2COF A;  3SO6 A;  3HW2 B;  4Z2N A;  4KHB B;  5LOP B;  4F7H A;  2QKM A;  3DXC A;  3WA0 A;  4B6H A;  4IOY X;  2MWN B;  2AEH A;  3P7Z A;  2LYD A;  5FI0 A;  1TJ6 A;  2YT1 A;  3QIJ A;  2CY5 A;  2YT0 A;  5D3W A;  3FEH A;  3ULC A;  1LW3 A;  5C5B A;  1V5M A;  1DYN A;  4IAP A;  2ELB A;  4GN1 A;  2D9W A;  1OY2 A;  4HDO A;  2D2Q A;  1FAO A;  1GC6 A;  1EF1 A;  1I2H A;  4ZRI A;  1BTK A;  4PQ0 A;  3VIA A;  1BWN A;  4BBK A;  2I1J A;  2MDX A;  2DN6 A;  2D10 A;  2JP2 A;  4TKN A;  1WJM A;  4DXA B;  4DBB A;  1UPQ A;  2ADZ A;  3TVV A;  3SYX A;  4PNK A;  2V76 A;  4HHV A;  1GG3 A;  4K17 A;  1QQG A;  4DX8 A;  1TQZ A;  5LON B;  1BAK A;  4KVG B;  1UNP A;  2UZR A;  2P0D A;  3KY9 A;  4YON A;  5D3V A;  4HAT B;  4K2O A;  3AU5 A;  2M38 A;  2R09 A;  1X86 A;  2EC1 A;  1FB8 A;  3IVF A;  1IRS A;  5GOW B;  4HAZ B;  2VSZ A;  5DIF B;  2E2X A;  2GS0 A;  4HAU B;  1UEF A;  2DFK A;  1NTV A;  1U2B A;  4WJ7 A;  3ODW A;  4A6F A;  3MDB C;  4L6E A;  4HAX B;  1OMW A;  3U7D A;  3VOQ A;  5JHH A;  3AU4 A;  3KRX A;  4CHJ A;  2OQB A;  4H8S A;  2IYB A;  2CAY A;  2DHK A;  4EJN A;  2LKO A;  2DHI A;  1ZSQ A;  2YS1 A;  3FSS A;  1EVH A;  3TCA A;  1W1H A;  1WJ1 A;  2J59 M;  5D3Y A;  2AL6 A;  2KUP A;  2J0M A;  1X1F A;  2YRY A;  1FOE A;  1V5U A;  2YSZ A;  3ODX A;  2DKP A;  1XX0 A;  1V5P A;  2D9V A;  2K2J A;  4KHO A;  1LB1 A;  3TFM A;  3O96 A;  2D9Y A;  3ULB A;  1X1G A;  3P6A A;  2DA0 A;  1V88 A;  1ZC4 B;  4P7I A;  4D0N B;  3PP2 A;  4HDQ A;  5HE1 A;  1AQC A;  2IFS A;  2W2W A;  3ZDT A;  2NMB A;  3DXD A;  2DX1 A;  4GPT B;  4A6K A;  4KHA A;  2H7D A;  1RJ2 A;  2UZS A;  4HB4 B;  3HQC A;  1AWE A;  2X18 A;  4IFS A;  1KI1 B;  5JHG A;  4F7G A;  1M7R A;  1OQN A;  4K2P A;  3ODO A;  1WGU A;  1J19 A;  4GMV A;  2RLO A;  1K5D B;  5D3X A;  3WYF B;  2I1K A;  2DX5 A;  2K2U A;  1E5W A;  1EGX A;  1FGZ A;  1ZM0 A;  2XQN M;  1H10 A;  2Q13 A;  5DI9 B;  4CYE A;  4EKU A;  2RSG A;  2GCJ A;  3BJI A;  5HE3 A;  2BCJ A;  3QBV B;  1U5D A;  1UPR A;  2PZ1 A;  3D8F A;  4Y94 A;  4GXB A;  1WVH A;  4A6F B;  2I5C A;  1ZC3 B;  1DDV A;  1FHW A;  2OTX A;  3U8Z A;  2D4Q A;  5HE0 A;  1ZVR A;  2COA A;  1MK9 B;  3TW1 A;  3N7C A;  4F7U P;  3DXE A;  1Y5O A;  4KAX B;  1UNR A;  2LG1 A;  1U5E A;  1Y19 B;  5CLQ B;  4WSF A;  3V5W A;  1W1G A;  2W2X D;  1DDW A;  1M7E A;  5FI1 A;  5DHF B;  2G35 A;  2LOX A;  3A8P A;  3CIK A;  1TXD A;  1K5G B;  2LOZ A;  4ZRJ A;  3KZ1 A;  1W1D A;  4NY0 A;  5C16 A;  1XD4 A;  2RNR B;  4DX9 0;  2HE7 A;  2ZPY A;  1H4R A;  1XR0 B;  2P8V A;  5C5B B;  1B55 A;  1SGH A;  3OAN A;  3PZD A;  3PVW A;  2Y8G A;  2D9X A;  1BTN A;  2Z0O A;  4A5K A;  1MIZ B;  2DKQ A;  2GJY A;  1U29 A;  1RRP B;  2EJ8 A;  3NSU A;  2R0D A;  3M1I B;  3PG7 A;  2ELA A;  2Y7B A;  4NSW A;  3D8D A;  1QC6 A;  4C0A A;  2DHJ A;  3MPX A;  5D27 A;  4YL8 A;  5KQ1 A;  2N0Y A;  3GYP A;  3LJU X;  4WVF B;  1P3R A;  4TYZ A;  2K00 A;  3PSC A;  1NI2 A;  3SNH A;  3A8Q A;  3PVU A;  2L1C A;  5DHA B;  2J0K A;  2ROZ B;  4Z2M B;  2RVB B;  1V89 A;  2DTC A;  2W2X C;  5CLL B;  2D9Z A;  2J0J A;  3ZVR A;  1WG7 A;  4MY6 A;  5JLJ B;  5J3Y A;  4HB2 B;  2N23 A;  4HB3 B;  5JP4 A;  1Z87 A;  5J3Q A;  5J3T A;  1I7A A;  3D8E A;  5C79 A;  1XOD A;  2MKR A;  1FHX A;  3BIN A;  1U27 A;  2NZ8 B;  2LUL A;  1FHO A;  5C6R A;  3G9W A;  1SHC A;  2VRW B;  1WGQ A;  2Z0Q A;  3SV1 A;  1PFJ A;  1UNQ A;  4XWX A;  2EMS A;  2P0F A;  2HTH B;  1MAI A;  3HK0 A;  4A6H A;  1EAZ A;  1XCG A;  5L81 A;  2CRF A;  3F5R A;  1X11 A;  5KQ4 A;  1KZ7 A;  1P5T A;  3RCP A;  2UVM A;  1N3H A;  2COD A;  3PEG A;  1P6S A;  2D11 A;  1DBH A;  2GCL A;  2YS5 A;  2H7E A;  5EFX A;  1GC7 A;  3ML4 A;  2DYQ A;  1DDM A;  4ZRK A;  1WI1 A;  3F0W A;  1MPH A;  2I5F A;  1V61 A;  3T06 A;  4HAY B;  3A98 B;  3GYO A;  4HAW B;  2L2I A;  3PVL A;  2VKI A;  2P0H A;  1MKE A;  4K81 A;  2RGN B;  4HAV B;  5HE2 A;  3TO1 A;  1KZG A;  1XKE A;  2M14 A;  2RUK B;  1MIX A;  3X23 A;  3QWM A;  2EMT A;  3UZT A;  3KSY A;  1NTY A;  1NU2 A;  1PMS A;  1X05 A;  1ISN A;  1MK7 B;  2QKL A;  4GZU A;  2FJL A;  2YS3 A;  4GMX B;  1J0W A;  5KCV A;  4MT7 A;  1PLS A;  5DH9 B;  3CXB B;  2COC A;  2Z0P A;  1DRO A;  4CHM A;  2CY4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...