2ROVA

The split ph domain of rock ii
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
117
structure length
117
Chain Sequence
SRLEGWLSLPVRNNTKKFGWVKKYVIVSSKKILFYDSEQDKEQSNPYMVLDIDKLFHVRPVTQTDVYRADAKEIPRIFQILYANEGISSAKNLLLLANSTEEQQKWVSRLVKKIPKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The split PH domain of ROCK II
rcsb
source organism Rattus norvegicus
molecule tags Transferase
molecule keywords Rho-associated protein kinase 2
total genus 18
structure length 117
sequence length 117
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2008-04-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2rovA00
1KI1B 2QKMA 1BWNA 1PFJA 4HB4B 2P0HA 2KUPA 2ROVA 1MIZB 5D3VA 3TCAA 2RNRB 4XWXA 4HHVA 1LW3A 2W2XD 4HB2B 5D3XA 5J3TA 4GZUA 3A98B 1P5TA 2N23A 3DXEA 1SGHA 2YS1A 1X1FA 2D11A 5C79A 3KZ1A 4TYZA 1X11A 3PG7A 3CIKA 1WG7A 2D9VA 5KQ1A 2D9YA 3V5WA 3PVWA 4A6KA 2CRFA 2DHIA 3PVLA 3NSUA 3M1IB 2VSZA 2EMTA 1V5MA 5CLLB 2DKPA 4KHBB 2DTCA 1V89A 4D0NB 2AL6A 2P0DA 3KRXA 1WVHA 2X18A 3AU5A 5DH9B 5HE0A 1E5WA 3WA0A 5D27A 1FGYA 3F0WA 2CY5A 3A8PA 2J0MA 1W1HA 1DDVA 4DX90 5KCVA 2I1JA 1ZC4B 1MPHA 4HAVB 1UPRA 1UEFA 1OY2A 4K2OA 1X1GA 1KZGA 1P6SA 4KVGB 1U5DA 1M7RA 3A8QA 1TQZA 2IFSA 4MK0A 1UNRA 3BJIA 4GMXB 3PVUA 5JHHA 1ZVRA 2H7EA 2D10A 2CODA 3ULBA 1K5DB 5KQ4A 2I5FA 4DXAB 4C0AA 1BTKA 3GYPA 3TW1A 2BCJA 2H7DA 4DBBA 1J0WA 4P7IA 3X23A 2Y7BA 2DKQA 1M7EA 2J59M 1U29A 1XCGA 1AQCA 2Q13A 2E2XA 3GYOA 1UNPA 2EJ8A 2L1CA 1RRPB 3P6AA 4HDQA 4ZRIA 4F7GA 1ZC3B 2UVMA 1V88A 5GOWB 4IFSA 4HAXB 3PSCA 1I7AA 1NTYA 3WYFB 3VIAA 2J0JA 2QKLA 2DX1A 1EVHA 1NI2A 5JHGA 1WGQA 2YF0A 2P0FA 3DXDA 1DDWA 3UZTA 1ZSQA 2JP2A 1WJ1A 2KCJA 1MK7B 2YT1A 2XQNM 2VKIA 3HW2B 1SHCA 4HB3B 3D8DA 1H4RA 1U27A 2K2JA 2Z0OA 1DYNA 2MDXA 2Z0QA 1OQNA 4K81A 2R09A 1UPQA 1QQGA 2GCJA 2L2IA 1U5GA 3SUZA 1FB8A 2I1KA 1MAIA 3PZDA 1MK9B 1V5UA 3KRWA 4DX8A 3KY9A 2R0DA 4WVFB 4BBKA 3TO1A 1W1DA 4EKUA 1NTVA 1ZM0A 3MDBC 1I2HA 4ZRKA 2HE7A 3ODOA 3O96A 3VOQA 5C5BA 3FSSA 1P3RA 4HAWB 2G35A 1V61A 4B6HA 5D3YA 4MT7A 4KHAA 4CYEA 1Y5OA 1X05A 2K00A 3AU4A 5C16A 4KAXB 2MKRA 1AWEA 3ML4A 2W2XC 2HTHB 2DYNA 1KZ7A 2D4QA 2DFKA 3SYXA 2ELBA 2CY4A 2DA0A 4NSWA 3HK0A 3ODXA 1W1GA 3P7ZA 4HAZB 5DHFB 2J0KA 2Y8FA 4EJNA 1BAKA 2GS0A 2DHJA 1EGXA 1IRSA 4TKNA 3ULCA 4CHJA 1Z87A 2RVBB 3TVVA 4NY0A 5D3WA 1B55A 3HQCA 1V5PA 2ROZB 3PEGA 3QBVB 1U5EA 4A5KA 2D9WA 3U7DA 5J3QA 5LOPB 3IVFA 1FOEA 3TFMA 1X86A 3QWMA 4HDOA 2LYDA 2ADZA 4EMOA 1U2BA 4PNKA 2P8VA 3PP2A 4GPTB 5FI0A 4MY6A 1XODA 2RUKB 4K2PA 2N0YA 2D9ZA 4Y94A 2COFA 3G9WA 2EC1A 1FAOA 1UNQA 1N3HA 2COCA 5LONB 3LJUX 4H8SA 1XD4A 1OMWA 1EAZA 1WI1A 4GXBA 2AEHA 1Q67A 1MIXA 3ZVRA 3RCPA 2D9XA 1TXDA 2KGXB 3SV1A 3FM8C 2IYBA 2DX5A 3QIJA 2I5CA 2CAYA 1QC6A 4WJ7A 5L81A 1K5GB 2PZ1A 2UZRA 3BINA 5EFXA 2FJLA 4Z2NA 1U5FA 3F5RA 3MPXA 3KSYA 1WJMA 1GC6A 4IAPA 4F7HA 5DHAB 2YS5A 3SNHA 1DBHA 1BTNA 1FGZA 1NU2A 4HAUB 4HB0B 2LG1A 2V76A 1DROA 2DYQA 1MKEA 4A6FA 4YL8A 4WSFA 2D2QA 2W2WA 4HATB 2DHKA 4K17A 1PLSA 3OANA 2OTXA 1DDMA 2RGNB 3FEHA 5JP4A 2MFQA 4ZRJA 1XR0B 4GN1A 5DIFB 1WGUA 2YT0A 4HAYB 2LKOA 2RLOA 1TJ6A 1H10A 4PQ0A 2Y8GA 5DI9B 5C5BB 3DXCA 2LOZA 5JLJB 5FI1A 5HE3A 2K2UA 5CLQB 4A6HA 2OQBA 2M38A 3D8FA 2ELAA 2NMBA 2COAA 4L6EA 4YONA 3CXBB 4Z2MB 2UZSA 2DLWA 5C6RA 3ZDTA 1RJ2A 1FHXA 5HE1A 4KHOA 2NZ8B 1PMSA 1LB1A 2VRWB 2LOXA 1EF1A 2MWNB 2M14A 1J19A 2GCLA 4A6FB 3U8ZA 1ISNA 1XKEA 3AJ4A 3N7CA 2RSGA 1XX0A 3ODWA 2ZPYA 2YVCA 4IOYX 3SO6A 1Y19B 2EMSA 2LULA 1GC7A 2GJYA 2Z0PA 1FHOA 2YS3A 4F7UP 3D8EA 1FHWA 4GMVA 2YSZA 2YRYA 5HE2A 4CHMA 3T06A 2DN6A 5J3YA 1GG3A
chains in the Genus database with same CATH superfamily
1KI1B 2QKMA 1BWNA 1PFJA 2YT2A 4HB4B 2P0HA 2KUPA 2ROVA 1MIZB 5D3VA 3NW8A 3TCAA 2RNRB 4XWXA 3B77A 2GUMA 4HHVA 1LW3A 2W2XD 4HB2B 5D3XA 5J3TA 4GZUA 3A98B 1P5TA 3OHMB 2N23A 3DXEA 1SGHA 2YS1A 1X1FA 2D11A 5C79A 3KZ1A 4TYZA 2KR0A 1X11A 3PG7A 3CIKA 1WG7A 2D9VA 5KQ1A 2D9YA 3V5WA 3PVWA 4A6KA 2CRFA 2DHIA 3PVLA 3NSUA 3M1IB 2VSZA 2EMTA 1V5MA 5CLLB 2DKPA 4KHBB 2DTCA 1V89A 4D0NB 2AL6A 2P0DA 3KRXA 2NBVA 1WVHA 2X18A 3AU5A 5DH9B 5HE0A 1E5WA 3WA0A 5D27A 1FGYA 3F0WA 2KIGA 2CY5A 3A8PA 2J0MA 1W1HA 1DDVA 4DX90 5KCVA 3FVCA 2I1JA 1ZC4B 1MPHA 4HAVB 1UPRA 1UEFA 1OY2A 3A58A 4K2OA 4QXAB 1X1GA 1KZGA 1P6SA 4KVGB 4KHBA 1U5DA 1M7RA 3A8QA 1TQZA 2IFSA 4MK0A 1UNRA 3BJIA 4GMXB 3PVUA 5JHHA 1ZVRA 2H7EA 2D10A 5M4YB 2CODA 3ULBA 1K5DB 5KQ4A 2I5FA 4DXAB 2K8EA 4C0AA 1BTKA 3GYPA 3TW1A 2BCJA 2H7DA 4DBBA 1J0WA 4P7IA 3X23A 2Y7BA 2DKQA 1M7EA 2J59M 1U29A 1XCGA 1AQCA 2Q13A 2E2XA 3GYOA 1UNPA 2EJ8A 2L1CA 1RRPB 3P6AA 4HDQA 4ZRIA 4F7GA 1ZC3B 2UVMA 3HIEA 1V88A 5GOWB 4IFSA 4HAXB 3PSCA 1I7AA 1NTYA 3WYFB 3NWDA 3VIAA 2J0JA 2QKLA 2DX1A 1EVHA 1NI2A 2KIEA 5JHGA 1WGQA 2R2YA 2YF0A 2P0FA 3DXDA 1DDWA 3UZTA 1ZSQA 4HSIA 2JP2A 1WJ1A 2KCJA 1MK7B 2YT1A 2XQNM 2VKIA 3HW2B 1SHCA 4HB3B 3D8DA 4QJ4B 1H4RA 1U27A 2K2JA 2Z0OA 1DYNA 2MDXA 2Z0QA 1OQNA 4K81A 2R09A 1UPQA 1QQGA 2GCJA 2L2IA 1U5GA 3SUZA 1FB8A 2I1KA 1MAIA 3PZDA 1MK9B 1V5UA 2Z4DA 3KRWA 4DX8A 3KY9A 2R0DA 4WVFB 4BBKA 3TO1A 1W1DA 4EKUA 5LG4B 1NTVA 1ZM0A 3MDBC 1I2HA 4ZRKA 2HE7A 4QJ3B 3ODOA 3O96A 3VOQA 5C5BA 4GOUA 3FSSA 1P3RA 4HAWB 2G35A 1V61A 4B6HA 5D3YA 4MT7A 4KHAA 4CYEA 1Y5OA 4OT1A 1X05A 2K00A 2Z59A 3AU4A 5C16A 4KAXB 2MKRA 1AWEA 3ML4A 2W2XC 2HTHB 2DYNA 1KZ7A 2D4QA 2DFKA 3SYXA 2ELBA 2CY4A 2DA0A 4NSWA 3HK0A 3ODXA 1W1GA 3P7ZA 4HAZB 5DHFB 2J0KA 2Y8FA 4EJNA 1BAKA 2GS0A 2DHJA 1EGXA 1IRSA 4TKNA 3ULCA 4CHJA 1Z87A 2RVBB 3TVVA 4NY0A 5D3WA 1B55A 3HQCA 1V5PA 2ROZB 3PEGA 3QBVB 1U5EA 4A5KA 2D9WA 3U7DA 5J3QA 5LOPB 3IVFA 1FOEA 3TFMA 4CSQA 1X86A 3QWMA 4HDOA 2LYDA 2ADZA 4EMOA 1U2BA 4PNKA 2P8VA 1MI1A 3PP2A 4GPTB 5FI0A 1T77A 4MY6A 1XODA 2RUKB 4K2PA 2N0YA 2D9ZA 4Y94A 2RRFA 2COFA 3G9WA 2EC1A 1FAOA 1UNQA 1N3HA 2COCA 5LONB 3LJUX 4H8SA 1XD4A 1OMWA 1EAZA 3NWFA 1WI1A 4GXBA 2AEHA 1Q67A 1MIXA 3ZVRA 3RCPA 2D9XA 1TXDA 2KGXB 3SV1A 3FM8C 2IYBA 2DX5A 3QIJA 2I5CA 2CAYA 1QC6A 4WJ7A 5L81A 1K5GB 2PZ1A 2UZRA 3BINA 5EFXA 2FJLA 4Z2NA 1U5FA 3F5RA 3MPXA 3KSYA 1WJMA 1GC6A 4D6WA 4IAPA 4F7HA 5DHAB 2YS5A 3SNHA 1DBHA 1BTNA 1FGZA 1NU2A 4HAUB 4HB0B 2LG1A 2V76A 3NWAA 1DROA 2DYQA 4GNKB 1MKEA 4A6FA 4YL8A 5I2SA 4WSFA 2D2QA 2W2WA 4HATB 2DHKA 2Z13A 1PLSA 3OANA 4K17A 2OTXA 1DDMA 2RGNB 3FEHA 4QJ5B 5JP4A 2MFQA 4ZRJA 1XR0B 4GN1A 5DIFB 3U12A 1WGUA 2YT0A 3HSAA 1ZYIA 4DIXA 4HAYB 2LKOA 2RLOA 1TJ6A 1H10A 4PQ0A 2KUQA 2Y8GA 5DI9B 5C5BB 3DXCA 4OSNA 2LOZA 5JLJB 5IRSA 5FI1A 5HE3A 2K2UA 5CLQB 4A6HA 2OQBA 2M38A 4L1RA 3D8FA 2ELAA 2NMBA 2COAA 4L6EA 4YONA 3CXBB 4Z2MB 2UZSA 2DLWA 5C6RA 3ZDTA 1RJ2A 1FHXA 5HE1A 2ZKMX 4KHOA 2NZ8B 1PMSA 1LB1A 2VRWB 2LOXA 1EF1A 2MWNB 2M14A 1J19A 2GCLA 4A6FB 3U8ZA 2Z14A 1ISNA 1XKEA 3AJ4A 5I2MA 3N7CA 2RSGA 1XX0A 3ODWA 2ZPYA 2YVCA 4IOYX 3SO6A 1Y19B 2EMSA 2LULA 1GC7A 2GJYA 2Z0PA 1FHOA 2YS3A 4F7UP 3D8EA 2FJUB 1FHWA 3DCXA 2K49A 4GMVA 2YSZA 2YRYA 5HE2A 4CHMA 3T06A 2DN6A 5J3YA 1GG3A
chains in the Genus database with same CATH topology
1KI1B 2QKMA 1BWNA 1PFJA 4HB4B 2P0HA 2KUPA 2ROVA 1MIZB 5D3VA 3TCAA 2RNRB 4XWXA 4HHVA 1LW3A 2W2XD 4HB2B 5D3XA 5J3TA 4GZUA 3A98B 1P5TA 2N23A 3DXEA 1SGHA 2YS1A 1X1FA 2D11A 5C79A 3KZ1A 4TYZA 1X11A 3PG7A 3CIKA 1WG7A 2D9VA 5KQ1A 2D9YA 3V5WA 3PVWA 4A6KA 2CRFA 2DHIA 3PVLA 3NSUA 3M1IB 2VSZA 2EMTA 1V5MA 5CLLB 2DKPA 4KHBB 2DTCA 1V89A 4D0NB 2AL6A 2P0DA 3KRXA 1WVHA 2X18A 3AU5A 5DH9B 5HE0A 1E5WA 3WA0A 5D27A 1FGYA 3F0WA 2CY5A 3A8PA 2J0MA 1W1HA 1DDVA 4DX90 5KCVA 2I1JA 1ZC4B 1MPHA 4HAVB 1UPRA 1UEFA 1OY2A 4K2OA 1X1GA 1KZGA 1P6SA 4KVGB 1U5DA 1M7RA 3A8QA 1TQZA 2IFSA 4MK0A 1UNRA 3BJIA 4GMXB 3PVUA 5JHHA 1ZVRA 2H7EA 2D10A 2CODA 3ULBA 1K5DB 5KQ4A 2I5FA 4DXAB 4C0AA 1BTKA 3GYPA 3TW1A 2BCJA 2H7DA 4DBBA 1J0WA 4P7IA 3X23A 2Y7BA 2DKQA 1M7EA 2J59M 1U29A 1XCGA 1AQCA 2Q13A 2E2XA 3GYOA 1UNPA 2EJ8A 2L1CA 1RRPB 3P6AA 4HDQA 4ZRIA 4F7GA 1ZC3B 2UVMA 1V88A 5GOWB 4IFSA 4HAXB 3PSCA 1I7AA 1NTYA 3WYFB 3VIAA 2J0JA 2QKLA 2DX1A 1EVHA 1NI2A 5JHGA 1WGQA 2YF0A 2P0FA 3DXDA 1DDWA 3UZTA 1ZSQA 2JP2A 1WJ1A 2KCJA 1MK7B 2YT1A 2XQNM 2VKIA 3HW2B 1SHCA 4HB3B 3D8DA 1H4RA 1U27A 2K2JA 2Z0OA 1DYNA 2MDXA 2Z0QA 1OQNA 4K81A 2R09A 1UPQA 1QQGA 2GCJA 2L2IA 1U5GA 3SUZA 1FB8A 2I1KA 1MAIA 3PZDA 1MK9B 1V5UA 3KRWA 4DX8A 3KY9A 2R0DA 4WVFB 4BBKA 3TO1A 1W1DA 4EKUA 1NTVA 1ZM0A 3MDBC 1I2HA 4ZRKA 2HE7A 3ODOA 3O96A 3VOQA 5C5BA 3FSSA 1P3RA 4HAWB 2G35A 1V61A 4B6HA 5D3YA 4MT7A 4KHAA 4CYEA 1Y5OA 1X05A 2K00A 3AU4A 5C16A 4KAXB 2MKRA 1AWEA 3ML4A 2W2XC 2HTHB 2DYNA 1KZ7A 2D4QA 2DFKA 3SYXA 2ELBA 2CY4A 2DA0A 4NSWA 3HK0A 3ODXA 1W1GA 3P7ZA 4HAZB 5DHFB 2J0KA 2Y8FA 4EJNA 1BAKA 2GS0A 2DHJA 1EGXA 1IRSA 4TKNA 3ULCA 4CHJA 1Z87A 2RVBB 3TVVA 4NY0A 5D3WA 1B55A 3HQCA 1V5PA 2ROZB 3PEGA 3QBVB 1U5EA 4A5KA 2D9WA 3U7DA 5J3QA 5LOPB 3IVFA 1FOEA 3TFMA 1X86A 3QWMA 4HDOA 2LYDA 2ADZA 4EMOA 1U2BA 4PNKA 2P8VA 3PP2A 4GPTB 5FI0A 4MY6A 1XODA 2RUKB 4K2PA 2N0YA 2D9ZA 4Y94A 2COFA 3G9WA 2EC1A 1FAOA 1UNQA 1N3HA 2COCA 5LONB 3LJUX 4H8SA 1XD4A 1OMWA 1EAZA 1WI1A 4GXBA 2AEHA 1Q67A 1MIXA 3ZVRA 3RCPA 2D9XA 1TXDA 2KGXB 3SV1A 3FM8C 2IYBA 2DX5A 3QIJA 2I5CA 2CAYA 1QC6A 4WJ7A 5L81A 1K5GB 2PZ1A 2UZRA 3BINA 5EFXA 2FJLA 4Z2NA 1U5FA 3F5RA 3MPXA 3KSYA 1WJMA 1GC6A 4IAPA 4F7HA 5DHAB 2YS5A 3SNHA 1DBHA 1BTNA 1FGZA 1NU2A 4HAUB 4HB0B 2LG1A 2V76A 1DROA 2DYQA 1MKEA 4A6FA 4YL8A 4WSFA 2D2QA 2W2WA 4HATB 2DHKA 4K17A 1PLSA 3OANA 2OTXA 1DDMA 2RGNB 3FEHA 5JP4A 2MFQA 4ZRJA 1XR0B 4GN1A 5DIFB 1WGUA 2YT0A 4HAYB 2LKOA 2RLOA 1TJ6A 1H10A 4PQ0A 2Y8GA 5DI9B 5C5BB 3DXCA 2LOZA 5JLJB 5FI1A 5HE3A 2K2UA 5CLQB 4A6HA 2OQBA 2M38A 3D8FA 2ELAA 2NMBA 2COAA 4L6EA 4YONA 3CXBB 4Z2MB 2UZSA 2DLWA 5C6RA 3ZDTA 1RJ2A 1FHXA 5HE1A 4KHOA 2NZ8B 1PMSA 1LB1A 2VRWB 2LOXA 1EF1A 2MWNB 2M14A 1J19A 2GCLA 4A6FB 3U8ZA 1ISNA 1XKEA 3AJ4A 3N7CA 2RSGA 1XX0A 3ODWA 2ZPYA 2YVCA 4IOYX 3SO6A 1Y19B 2EMSA 2LULA 1GC7A 2GJYA 2Z0PA 1FHOA 2YS3A 4F7UP 3D8EA 1FHWA 4GMVA 2YSZA 2YRYA 5HE2A 4CHMA 3T06A 2DN6A 5J3YA 1GG3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KI1 B;  2QKM A;  1BWN A;  1PFJ A;  4HB4 B;  2P0H A;  2KUP A;  2ROV A;  1MIZ B;  5D3V A;  3TCA A;  2RNR B;  4XWX A;  4HHV A;  1LW3 A;  2W2X D;  4HB2 B;  5D3X A;  5J3T A;  4GZU A;  3A98 B;  1P5T A;  2N23 A;  3DXE A;  1SGH A;  2YS1 A;  1X1F A;  2D11 A;  5C79 A;  3KZ1 A;  4TYZ A;  1X11 A;  3PG7 A;  3CIK A;  1WG7 A;  2D9V A;  5KQ1 A;  2D9Y A;  3V5W A;  3PVW A;  4A6K A;  2CRF A;  2DHI A;  3PVL A;  3NSU A;  3M1I B;  2VSZ A;  2EMT A;  1V5M A;  5CLL B;  2DKP A;  4KHB B;  2DTC A;  1V89 A;  4D0N B;  2AL6 A;  2P0D A;  3KRX A;  1WVH A;  2X18 A;  3AU5 A;  5DH9 B;  5HE0 A;  1E5W A;  3WA0 A;  5D27 A;  1FGY A;  3F0W A;  2CY5 A;  3A8P A;  2J0M A;  1W1H A;  1DDV A;  4DX9 0;  5KCV A;  2I1J A;  1ZC4 B;  1MPH A;  4HAV B;  1UPR A;  1UEF A;  1OY2 A;  4K2O A;  1X1G A;  1KZG A;  1P6S A;  4KVG B;  1U5D A;  1M7R A;  3A8Q A;  1TQZ A;  2IFS A;  4MK0 A;  1UNR A;  3BJI A;  4GMX B;  3PVU A;  5JHH A;  1ZVR A;  2H7E A;  2D10 A;  2COD A;  3ULB A;  1K5D B;  5KQ4 A;  2I5F A;  4DXA B;  4C0A A;  1BTK A;  3GYP A;  3TW1 A;  2BCJ A;  2H7D A;  4DBB A;  1J0W A;  4P7I A;  3X23 A;  2Y7B A;  2DKQ A;  1M7E A;  2J59 M;  1U29 A;  1XCG A;  1AQC A;  2Q13 A;  2E2X A;  3GYO A;  1UNP A;  2EJ8 A;  2L1C A;  1RRP B;  3P6A A;  4HDQ A;  4ZRI A;  4F7G A;  1ZC3 B;  2UVM A;  1V88 A;  5GOW B;  4IFS A;  4HAX B;  3PSC A;  1I7A A;  1NTY A;  3WYF B;  3VIA A;  2J0J A;  2QKL A;  2DX1 A;  1EVH A;  1NI2 A;  5JHG A;  1WGQ A;  2YF0 A;  2P0F A;  3DXD A;  1DDW A;  3UZT A;  1ZSQ A;  2JP2 A;  1WJ1 A;  2KCJ A;  1MK7 B;  2YT1 A;  2XQN M;  2VKI A;  3HW2 B;  1SHC A;  4HB3 B;  3D8D A;  1H4R A;  1U27 A;  2K2J A;  2Z0O A;  1DYN A;  2MDX A;  2Z0Q A;  1OQN A;  4K81 A;  2R09 A;  1UPQ A;  1QQG A;  2GCJ A;  2L2I A;  1U5G A;  3SUZ A;  1FB8 A;  2I1K A;  1MAI A;  3PZD A;  1MK9 B;  1V5U A;  3KRW A;  4DX8 A;  3KY9 A;  2R0D A;  4WVF B;  4BBK A;  3TO1 A;  1W1D A;  4EKU A;  1NTV A;  1ZM0 A;  3MDB C;  1I2H A;  4ZRK A;  2HE7 A;  3ODO A;  3O96 A;  3VOQ A;  5C5B A;  3FSS A;  1P3R A;  4HAW B;  2G35 A;  1V61 A;  4B6H A;  5D3Y A;  4MT7 A;  4KHA A;  4CYE A;  1Y5O A;  1X05 A;  2K00 A;  3AU4 A;  5C16 A;  4KAX B;  2MKR A;  1AWE A;  3ML4 A;  2W2X C;  2HTH B;  2DYN A;  1KZ7 A;  2D4Q A;  2DFK A;  3SYX A;  2ELB A;  2CY4 A;  2DA0 A;  4NSW A;  3HK0 A;  3ODX A;  1W1G A;  3P7Z A;  4HAZ B;  5DHF B;  2J0K A;  2Y8F A;  4EJN A;  1BAK A;  2GS0 A;  2DHJ A;  1EGX A;  1IRS A;  4TKN A;  3ULC A;  4CHJ A;  1Z87 A;  2RVB B;  3TVV A;  4NY0 A;  5D3W A;  1B55 A;  3HQC A;  1V5P A;  2ROZ B;  3PEG A;  3QBV B;  1U5E A;  4A5K A;  2D9W A;  3U7D A;  5J3Q A;  5LOP B;  3IVF A;  1FOE A;  3TFM A;  1X86 A;  3QWM A;  4HDO A;  2LYD A;  2ADZ A;  4EMO A;  1U2B A;  4PNK A;  2P8V A;  3PP2 A;  4GPT B;  5FI0 A;  4MY6 A;  1XOD A;  2RUK B;  4K2P A;  2N0Y A;  2D9Z A;  4Y94 A;  2COF A;  3G9W A;  2EC1 A;  1FAO A;  1UNQ A;  1N3H A;  2COC A;  5LON B;  3LJU X;  4H8S A;  1XD4 A;  1OMW A;  1EAZ A;  1WI1 A;  4GXB A;  2AEH A;  1Q67 A;  1MIX A;  3ZVR A;  3RCP A;  2D9X A;  1TXD A;  2KGX B;  3SV1 A;  3FM8 C;  2IYB A;  2DX5 A;  3QIJ A;  2I5C A;  2CAY A;  1QC6 A;  4WJ7 A;  5L81 A;  1K5G B;  2PZ1 A;  2UZR A;  3BIN A;  5EFX A;  2FJL A;  4Z2N A;  1U5F A;  3F5R A;  3MPX A;  3KSY A;  1WJM A;  1GC6 A;  4IAP A;  4F7H A;  5DHA B;  2YS5 A;  3SNH A;  1DBH A;  1BTN A;  1FGZ A;  1NU2 A;  4HAU B;  4HB0 B;  2LG1 A;  2V76 A;  1DRO A;  2DYQ A;  1MKE A;  4A6F A;  4YL8 A;  4WSF A;  2D2Q A;  2W2W A;  4HAT B;  2DHK A;  4K17 A;  1PLS A;  3OAN A;  2OTX A;  1DDM A;  2RGN B;  3FEH A;  5JP4 A;  2MFQ A;  4ZRJ A;  1XR0 B;  4GN1 A;  5DIF B;  1WGU A;  2YT0 A;  4HAY B;  2LKO A;  2RLO A;  1TJ6 A;  1H10 A;  4PQ0 A;  2Y8G A;  5DI9 B;  5C5B B;  3DXC A;  2LOZ A;  5JLJ B;  5FI1 A;  5HE3 A;  2K2U A;  5CLQ B;  4A6H A;  2OQB A;  2M38 A;  3D8F A;  2ELA A;  2NMB A;  2COA A;  4L6E A;  4YON A;  3CXB B;  4Z2M B;  2UZS A;  2DLW A;  5C6R A;  3ZDT A;  1RJ2 A;  1FHX A;  5HE1 A;  4KHO A;  2NZ8 B;  1PMS A;  1LB1 A;  2VRW B;  2LOX A;  1EF1 A;  2MWN B;  2M14 A;  1J19 A;  2GCL A;  4A6F B;  3U8Z A;  1ISN A;  1XKE A;  3AJ4 A;  3N7C A;  2RSG A;  1XX0 A;  3ODW A;  2ZPY A;  2YVC A;  4IOY X;  3SO6 A;  1Y19 B;  2EMS A;  2LUL A;  1GC7 A;  2GJY A;  2Z0P A;  1FHO A;  2YS3 A;  4F7U P;  3D8E A;  1FHW A;  4GMV A;  2YSZ A;  2YRY A;  5HE2 A;  4CHM A;  3T06 A;  2DN6 A;  5J3Y A;  1GG3 A; 
#chains in the Genus database with same CATH topology
 1KI1 B;  2QKM A;  1BWN A;  1PFJ A;  2YT2 A;  4HB4 B;  2P0H A;  2KUP A;  2ROV A;  1MIZ B;  5D3V A;  3NW8 A;  3TCA A;  2RNR B;  4XWX A;  3B77 A;  2GUM A;  4HHV A;  1LW3 A;  2W2X D;  4HB2 B;  5D3X A;  5J3T A;  4GZU A;  3A98 B;  1P5T A;  3OHM B;  2N23 A;  3DXE A;  1SGH A;  2YS1 A;  1X1F A;  2D11 A;  5C79 A;  3KZ1 A;  4TYZ A;  2KR0 A;  1X11 A;  3PG7 A;  3CIK A;  1WG7 A;  2D9V A;  5KQ1 A;  2D9Y A;  3V5W A;  3PVW A;  4A6K A;  2CRF A;  2DHI A;  3PVL A;  3NSU A;  3M1I B;  2VSZ A;  2EMT A;  1V5M A;  5CLL B;  2DKP A;  4KHB B;  2DTC A;  1V89 A;  4D0N B;  2AL6 A;  2P0D A;  3KRX A;  2NBV A;  1WVH A;  2X18 A;  3AU5 A;  5DH9 B;  5HE0 A;  1E5W A;  3WA0 A;  5D27 A;  1FGY A;  3F0W A;  2KIG A;  2CY5 A;  3A8P A;  2J0M A;  1W1H A;  1DDV A;  4DX9 0;  5KCV A;  3FVC A;  2I1J A;  1ZC4 B;  1MPH A;  4HAV B;  1UPR A;  1UEF A;  1OY2 A;  3A58 A;  4K2O A;  4QXA B;  1X1G A;  1KZG A;  1P6S A;  4KVG B;  4KHB A;  1U5D A;  1M7R A;  3A8Q A;  1TQZ A;  2IFS A;  4MK0 A;  1UNR A;  3BJI A;  4GMX B;  3PVU A;  5JHH A;  1ZVR A;  2H7E A;  2D10 A;  5M4Y B;  2COD A;  3ULB A;  1K5D B;  5KQ4 A;  2I5F A;  4DXA B;  2K8E A;  4C0A A;  1BTK A;  3GYP A;  3TW1 A;  2BCJ A;  2H7D A;  4DBB A;  1J0W A;  4P7I A;  3X23 A;  2Y7B A;  2DKQ A;  1M7E A;  2J59 M;  1U29 A;  1XCG A;  1AQC A;  2Q13 A;  2E2X A;  3GYO A;  1UNP A;  2EJ8 A;  2L1C A;  1RRP B;  3P6A A;  4HDQ A;  4ZRI A;  4F7G A;  1ZC3 B;  2UVM A;  3HIE A;  1V88 A;  5GOW B;  4IFS A;  4HAX B;  3PSC A;  1I7A A;  1NTY A;  3WYF B;  3NWD A;  3VIA A;  2J0J A;  2QKL A;  2DX1 A;  1EVH A;  1NI2 A;  2KIE A;  5JHG A;  1WGQ A;  2R2Y A;  2YF0 A;  2P0F A;  3DXD A;  1DDW A;  3UZT A;  1ZSQ A;  4HSI A;  2JP2 A;  1WJ1 A;  2KCJ A;  1MK7 B;  2YT1 A;  2XQN M;  2VKI A;  3HW2 B;  1SHC A;  4HB3 B;  3D8D A;  4QJ4 B;  1H4R A;  1U27 A;  2K2J A;  2Z0O A;  1DYN A;  2MDX A;  2Z0Q A;  1OQN A;  4K81 A;  2R09 A;  1UPQ A;  1QQG A;  2GCJ A;  2L2I A;  1U5G A;  3SUZ A;  1FB8 A;  2I1K A;  1MAI A;  3PZD A;  1MK9 B;  1V5U A;  2Z4D A;  3KRW A;  4DX8 A;  3KY9 A;  2R0D A;  4WVF B;  4BBK A;  3TO1 A;  1W1D A;  4EKU A;  5LG4 B;  1NTV A;  1ZM0 A;  3MDB C;  1I2H A;  4ZRK A;  2HE7 A;  4QJ3 B;  3ODO A;  3O96 A;  3VOQ A;  5C5B A;  4GOU A;  3FSS A;  1P3R A;  4HAW B;  2G35 A;  1V61 A;  4B6H A;  5D3Y A;  4MT7 A;  4KHA A;  4CYE A;  1Y5O A;  4OT1 A;  1X05 A;  2K00 A;  2Z59 A;  3AU4 A;  5C16 A;  4KAX B;  2MKR A;  1AWE A;  3ML4 A;  2W2X C;  2HTH B;  2DYN A;  1KZ7 A;  2D4Q A;  2DFK A;  3SYX A;  2ELB A;  2CY4 A;  2DA0 A;  4NSW A;  3HK0 A;  3ODX A;  1W1G A;  3P7Z A;  4HAZ B;  5DHF B;  2J0K A;  2Y8F A;  4EJN A;  1BAK A;  2GS0 A;  2DHJ A;  1EGX A;  1IRS A;  4TKN A;  3ULC A;  4CHJ A;  1Z87 A;  2RVB B;  3TVV A;  4NY0 A;  5D3W A;  1B55 A;  3HQC A;  1V5P A;  2ROZ B;  3PEG A;  3QBV B;  1U5E A;  4A5K A;  2D9W A;  3U7D A;  5J3Q A;  5LOP B;  3IVF A;  1FOE A;  3TFM A;  4CSQ A;  1X86 A;  3QWM A;  4HDO A;  2LYD A;  2ADZ A;  4EMO A;  1U2B A;  4PNK A;  2P8V A;  1MI1 A;  3PP2 A;  4GPT B;  5FI0 A;  1T77 A;  4MY6 A;  1XOD A;  2RUK B;  4K2P A;  2N0Y A;  2D9Z A;  4Y94 A;  2RRF A;  2COF A;  3G9W A;  2EC1 A;  1FAO A;  1UNQ A;  1N3H A;  2COC A;  5LON B;  3LJU X;  4H8S A;  1XD4 A;  1OMW A;  1EAZ A;  3NWF A;  1WI1 A;  4GXB A;  2AEH A;  1Q67 A;  1MIX A;  3ZVR A;  3RCP A;  2D9X A;  1TXD A;  2KGX B;  3SV1 A;  3FM8 C;  2IYB A;  2DX5 A;  3QIJ A;  2I5C A;  2CAY A;  1QC6 A;  4WJ7 A;  5L81 A;  1K5G B;  2PZ1 A;  2UZR A;  3BIN A;  5EFX A;  2FJL A;  4Z2N A;  1U5F A;  3F5R A;  3MPX A;  3KSY A;  1WJM A;  1GC6 A;  4D6W A;  4IAP A;  4F7H A;  5DHA B;  2YS5 A;  3SNH A;  1DBH A;  1BTN A;  1FGZ A;  1NU2 A;  4HAU B;  4HB0 B;  2LG1 A;  2V76 A;  3NWA A;  1DRO A;  2DYQ A;  4GNK B;  1MKE A;  4A6F A;  4YL8 A;  5I2S A;  4WSF A;  2D2Q A;  2W2W A;  4HAT B;  2DHK A;  2Z13 A;  1PLS A;  3OAN A;  4K17 A;  2OTX A;  1DDM A;  2RGN B;  3FEH A;  4QJ5 B;  5JP4 A;  2MFQ A;  4ZRJ A;  1XR0 B;  4GN1 A;  5DIF B;  3U12 A;  1WGU A;  2YT0 A;  3HSA A;  1ZYI A;  4DIX A;  4HAY B;  2LKO A;  2RLO A;  1TJ6 A;  1H10 A;  4PQ0 A;  2KUQ A;  2Y8G A;  5DI9 B;  5C5B B;  3DXC A;  4OSN A;  2LOZ A;  5JLJ B;  5IRS A;  5FI1 A;  5HE3 A;  2K2U A;  5CLQ B;  4A6H A;  2OQB A;  2M38 A;  4L1R A;  3D8F A;  2ELA A;  2NMB A;  2COA A;  4L6E A;  4YON A;  3CXB B;  4Z2M B;  2UZS A;  2DLW A;  5C6R A;  3ZDT A;  1RJ2 A;  1FHX A;  5HE1 A;  2ZKM X;  4KHO A;  2NZ8 B;  1PMS A;  1LB1 A;  2VRW B;  2LOX A;  1EF1 A;  2MWN B;  2M14 A;  1J19 A;  2GCL A;  4A6F B;  3U8Z A;  2Z14 A;  1ISN A;  1XKE A;  3AJ4 A;  5I2M A;  3N7C A;  2RSG A;  1XX0 A;  3ODW A;  2ZPY A;  2YVC A;  4IOY X;  3SO6 A;  1Y19 B;  2EMS A;  2LUL A;  1GC7 A;  2GJY A;  2Z0P A;  1FHO A;  2YS3 A;  4F7U P;  3D8E A;  2FJU B;  1FHW A;  3DCX A;  2K49 A;  4GMV A;  2YSZ A;  2YRY A;  5HE2 A;  4CHM A;  3T06 A;  2DN6 A;  5J3Y A;  1GG3 A; 
#chains in the Genus database with same CATH homology
 1KI1 B;  2QKM A;  1BWN A;  1PFJ A;  4HB4 B;  2P0H A;  2KUP A;  2ROV A;  1MIZ B;  5D3V A;  3TCA A;  2RNR B;  4XWX A;  4HHV A;  1LW3 A;  2W2X D;  4HB2 B;  5D3X A;  5J3T A;  4GZU A;  3A98 B;  1P5T A;  2N23 A;  3DXE A;  1SGH A;  2YS1 A;  1X1F A;  2D11 A;  5C79 A;  3KZ1 A;  4TYZ A;  1X11 A;  3PG7 A;  3CIK A;  1WG7 A;  2D9V A;  5KQ1 A;  2D9Y A;  3V5W A;  3PVW A;  4A6K A;  2CRF A;  2DHI A;  3PVL A;  3NSU A;  3M1I B;  2VSZ A;  2EMT A;  1V5M A;  5CLL B;  2DKP A;  4KHB B;  2DTC A;  1V89 A;  4D0N B;  2AL6 A;  2P0D A;  3KRX A;  1WVH A;  2X18 A;  3AU5 A;  5DH9 B;  5HE0 A;  1E5W A;  3WA0 A;  5D27 A;  1FGY A;  3F0W A;  2CY5 A;  3A8P A;  2J0M A;  1W1H A;  1DDV A;  4DX9 0;  5KCV A;  2I1J A;  1ZC4 B;  1MPH A;  4HAV B;  1UPR A;  1UEF A;  1OY2 A;  4K2O A;  1X1G A;  1KZG A;  1P6S A;  4KVG B;  1U5D A;  1M7R A;  3A8Q A;  1TQZ A;  2IFS A;  4MK0 A;  1UNR A;  3BJI A;  4GMX B;  3PVU A;  5JHH A;  1ZVR A;  2H7E A;  2D10 A;  2COD A;  3ULB A;  1K5D B;  5KQ4 A;  2I5F A;  4DXA B;  4C0A A;  1BTK A;  3GYP A;  3TW1 A;  2BCJ A;  2H7D A;  4DBB A;  1J0W A;  4P7I A;  3X23 A;  2Y7B A;  2DKQ A;  1M7E A;  2J59 M;  1U29 A;  1XCG A;  1AQC A;  2Q13 A;  2E2X A;  3GYO A;  1UNP A;  2EJ8 A;  2L1C A;  1RRP B;  3P6A A;  4HDQ A;  4ZRI A;  4F7G A;  1ZC3 B;  2UVM A;  1V88 A;  5GOW B;  4IFS A;  4HAX B;  3PSC A;  1I7A A;  1NTY A;  3WYF B;  3VIA A;  2J0J A;  2QKL A;  2DX1 A;  1EVH A;  1NI2 A;  5JHG A;  1WGQ A;  2YF0 A;  2P0F A;  3DXD A;  1DDW A;  3UZT A;  1ZSQ A;  2JP2 A;  1WJ1 A;  2KCJ A;  1MK7 B;  2YT1 A;  2XQN M;  2VKI A;  3HW2 B;  1SHC A;  4HB3 B;  3D8D A;  1H4R A;  1U27 A;  2K2J A;  2Z0O A;  1DYN A;  2MDX A;  2Z0Q A;  1OQN A;  4K81 A;  2R09 A;  1UPQ A;  1QQG A;  2GCJ A;  2L2I A;  1U5G A;  3SUZ A;  1FB8 A;  2I1K A;  1MAI A;  3PZD A;  1MK9 B;  1V5U A;  3KRW A;  4DX8 A;  3KY9 A;  2R0D A;  4WVF B;  4BBK A;  3TO1 A;  1W1D A;  4EKU A;  1NTV A;  1ZM0 A;  3MDB C;  1I2H A;  4ZRK A;  2HE7 A;  3ODO A;  3O96 A;  3VOQ A;  5C5B A;  3FSS A;  1P3R A;  4HAW B;  2G35 A;  1V61 A;  4B6H A;  5D3Y A;  4MT7 A;  4KHA A;  4CYE A;  1Y5O A;  1X05 A;  2K00 A;  3AU4 A;  5C16 A;  4KAX B;  2MKR A;  1AWE A;  3ML4 A;  2W2X C;  2HTH B;  2DYN A;  1KZ7 A;  2D4Q A;  2DFK A;  3SYX A;  2ELB A;  2CY4 A;  2DA0 A;  4NSW A;  3HK0 A;  3ODX A;  1W1G A;  3P7Z A;  4HAZ B;  5DHF B;  2J0K A;  2Y8F A;  4EJN A;  1BAK A;  2GS0 A;  2DHJ A;  1EGX A;  1IRS A;  4TKN A;  3ULC A;  4CHJ A;  1Z87 A;  2RVB B;  3TVV A;  4NY0 A;  5D3W A;  1B55 A;  3HQC A;  1V5P A;  2ROZ B;  3PEG A;  3QBV B;  1U5E A;  4A5K A;  2D9W A;  3U7D A;  5J3Q A;  5LOP B;  3IVF A;  1FOE A;  3TFM A;  1X86 A;  3QWM A;  4HDO A;  2LYD A;  2ADZ A;  4EMO A;  1U2B A;  4PNK A;  2P8V A;  3PP2 A;  4GPT B;  5FI0 A;  4MY6 A;  1XOD A;  2RUK B;  4K2P A;  2N0Y A;  2D9Z A;  4Y94 A;  2COF A;  3G9W A;  2EC1 A;  1FAO A;  1UNQ A;  1N3H A;  2COC A;  5LON B;  3LJU X;  4H8S A;  1XD4 A;  1OMW A;  1EAZ A;  1WI1 A;  4GXB A;  2AEH A;  1Q67 A;  1MIX A;  3ZVR A;  3RCP A;  2D9X A;  1TXD A;  2KGX B;  3SV1 A;  3FM8 C;  2IYB A;  2DX5 A;  3QIJ A;  2I5C A;  2CAY A;  1QC6 A;  4WJ7 A;  5L81 A;  1K5G B;  2PZ1 A;  2UZR A;  3BIN A;  5EFX A;  2FJL A;  4Z2N A;  1U5F A;  3F5R A;  3MPX A;  3KSY A;  1WJM A;  1GC6 A;  4IAP A;  4F7H A;  5DHA B;  2YS5 A;  3SNH A;  1DBH A;  1BTN A;  1FGZ A;  1NU2 A;  4HAU B;  4HB0 B;  2LG1 A;  2V76 A;  1DRO A;  2DYQ A;  1MKE A;  4A6F A;  4YL8 A;  4WSF A;  2D2Q A;  2W2W A;  4HAT B;  2DHK A;  4K17 A;  1PLS A;  3OAN A;  2OTX A;  1DDM A;  2RGN B;  3FEH A;  5JP4 A;  2MFQ A;  4ZRJ A;  1XR0 B;  4GN1 A;  5DIF B;  1WGU A;  2YT0 A;  4HAY B;  2LKO A;  2RLO A;  1TJ6 A;  1H10 A;  4PQ0 A;  2Y8G A;  5DI9 B;  5C5B B;  3DXC A;  2LOZ A;  5JLJ B;  5FI1 A;  5HE3 A;  2K2U A;  5CLQ B;  4A6H A;  2OQB A;  2M38 A;  3D8F A;  2ELA A;  2NMB A;  2COA A;  4L6E A;  4YON A;  3CXB B;  4Z2M B;  2UZS A;  2DLW A;  5C6R A;  3ZDT A;  1RJ2 A;  1FHX A;  5HE1 A;  4KHO A;  2NZ8 B;  1PMS A;  1LB1 A;  2VRW B;  2LOX A;  1EF1 A;  2MWN B;  2M14 A;  1J19 A;  2GCL A;  4A6F B;  3U8Z A;  1ISN A;  1XKE A;  3AJ4 A;  3N7C A;  2RSG A;  1XX0 A;  3ODW A;  2ZPY A;  2YVC A;  4IOY X;  3SO6 A;  1Y19 B;  2EMS A;  2LUL A;  1GC7 A;  2GJY A;  2Z0P A;  1FHO A;  2YS3 A;  4F7U P;  3D8E A;  1FHW A;  4GMV A;  2YSZ A;  2YRY A;  5HE2 A;  4CHM A;  3T06 A;  2DN6 A;  5J3Y A;  1GG3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...