2ROVA

The split ph domain of rock ii
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
117
structure length
117
Chain Sequence
SRLEGWLSLPVRNNTKKFGWVKKYVIVSSKKILFYDSEQDKEQSNPYMVLDIDKLFHVRPVTQTDVYRADAKEIPRIFQILYANEGISSAKNLLLLANSTEEQQKWVSRLVKKIPKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Rho-associated protein kinase 2
publication title The split PH domain of ROCK II
rcsb
source organism Rattus norvegicus
molecule tags Transferase
total genus 18
structure length 117
sequence length 117
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2008-04-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2rovA00
2Y8GA 1QC6A 2P0DA 3MDBC 4H8SA 2I1KA 2CAYA 2Y8FA 4DX8A 2OQBA 4A5KA 2D9WA 2DYQA 1XR0B 5L81A 2RLOA 1WI1A 2MKRA 2COCA 2DLWA 1PLSA 4IFSA 1ZM0A 4KHBB 1MPHA 2N0YA 2E2XA 1K5DB 1Y19B 1BTNA 2XQNM 3TVVA 4HAUB 2J0JA 5J3TA 4F7HA 1DDMA 1U27A 2RVBB 2DHKA 4MK0A 2QKLA 1WJ1A 2K00A 1Y5OA 3GYOA 4DXAB 2W2XD 1M7EA 4EJNA 1FHWA 2X18A 2I1JA 1BTKA 4NY0A 1TJ6A 3UZTA 3PVUA 2W2WA 2YS1A 1KZGA 2DYNA 2V76A 1X05A 1MK9B 4HHVA 2K2JA 1FHXA 1OY2A 1FB8A 3ODOA 1XD4A 4TYZA 3QIJA 1K5GB 3KRWA 1KZ7A 2N23A 4K17A 1NU2A 3PG7A 2OTXA 1V5PA 1ZSQA 4IOYX 4K2OA 3FSSA 3TCAA 2YSZA 5D3VA 3U7DA 5DH9B 2J0MA 1N3HA 2EJ8A 3X23A 2D2QA 5CLLB 3TW1A 2LYDA 2HTHB 4BBKA 2Q13A 1W1HA 2MWNB 3F5RA 5CLQB 3PZDA 5C5BB 1RRPB 3AU5A 1ZC4B 1V88A 1GC6A 4YL8A 2CRFA 2PZ1A 4EKUA 1WGQA 1MK7B 1UEFA 2YVCA 2Z0PA 1ZVRA 2LOXA 4HAZB 3ML4A 2ZPYA 3PVLA 3LJUX 4HDQA 3KSYA 2H7DA 5DHFB 2KGXB 3M1IB 2W2XC 1KI1B 3SV1A 1GG3A 1DDWA 2LKOA 4GZUA 2CY5A 3ODWA 2KUPA 3GYPA 3ZDTA 3PEGA 2DFKA 1SGHA 1U5EA 1DYNA 3OANA 2DHIA 2I5CA 4GMXB 4K2PA 4KAXB 4WVFB 2D11A 2UVMA 2AL6A 4ZRIA 2ELBA 3U8ZA 3A98B 1SHCA 2H7EA 2ADZA 3AU4A 5HE2A 5J3QA 4IAPA 2I5FA 2EC1A 5JLJB 2GCLA 3DXCA 2YF0A 1DDVA 4PQ0A 3VOQA 1E5WA 5FI1A 2P0HA 4Z2MB 4C0AA 4WSFA 3PSCA 5HE3A 2RSGA 5DI9B 2J59M 1FOEA 2DN6A 5LONB 1MAIA 2KCJA 4Y94A 1AQCA 1X86A 1MIXA 4MT7A 4XWXA 4DX90 4HAVB 2VRWB 3KRXA 1W1DA 1W1GA 2DHJA 3BJIA 5JP4A 1TXDA 2Y7BA 1ISNA 2EMTA 1FHOA 1U5FA 3IVFA 1V89A 2DA0A 3D8FA 4TKNA 3ULBA 1PMSA 2ELAA 1B55A 2DKPA 3DXDA 2R0DA 3CXBB 3TFMA 1H4RA 2DX1A 4KHAA 4ZRKA 1X11A 2D9VA 4YONA 5JHHA 3KZ1A 4D0NB 3VIAA 2K2UA 1NI2A 2Z0OA 1LW3A 4GXBA 1GC7A 2GJYA 1QQGA 1V5UA 3ZVRA 4K81A 3BINA 2Z0QA 1P5TA 3TO1A 3HW2B 4Z2NA 2QKMA 2D4QA 1EF1A 4GN1A 2JP2A 2DX5A 3ODXA 3HK0A 3RCPA 3WYFB 1U5DA 2ROVA 4B6HA 4HB2B 4A6HA 4HB4B 4HDOA 2D9YA 2CODA 1WJMA 5GOWB 3O96A 1OQNA 3FEHA 2D9XA 1X1FA 4A6KA 4F7GA 2ROZB 1UPRA 2M38A 4P7IA 2R09A 3T06A 2P8VA 3V5WA 4HB0B 4CYEA 2L2IA 2HE7A 3CIKA 1XKEA 5D27A 2RUKB 1FGYA 2G35A 4A6FB 1I2HA 2UZRA 3HQCA 1LB1A 1J19A 2VKIA 3WA0A 2DTCA 5D3WA 1V61A 3DXEA 1U2BA 2YT0A 1OMWA 3PVWA 5KQ1A 2FJLA 5HE1A 5C5BA 2J0KA 3P7ZA 1WVHA 1P3RA 3QWMA 1X1GA 5LOPB 4HB3B 4KHOA 2YS3A 1FGZA 2P0FA 5HE0A 1ZC3B 1BAKA 1P6SA 2D9ZA 5C79A 1XX0A 4PNKA 3FM8C 2D10A 3A8QA 2IFSA 3KY9A 3AJ4A 1AWEA 1J0WA 3PP2A 5C16A 2VSZA 4GPTB 3A8PA 5J3YA 5FI0A 1UPQA 1Q67A 1EAZA 2M14A 3D8DA 3G9WA 1WGUA 4NSWA 1UNPA 1DBHA 1EVHA 2IYBA 5D3XA 4HAXB 1U29A 1MIZB 3P6AA 1FAOA 1Z87A 1NTYA 3NSUA 3SO6A 2COAA 2NZ8B 2MDXA 4DBBA 3SYXA 5JHGA 1PFJA 3SNHA 2YT1A 4L6EA 2NMBA 1UNRA 2DKQA 1UNQA 4EMOA 2YS5A 4WJ7A 2MFQA 1WG7A 4A6FA 1RJ2A 1IRSA 2GCJA 2UZSA 3N7CA 1BWNA 3QBVB 5KCVA 4KVGB 3ULCA 4HATB 5EFXA 2AEHA 4ZRJA 4GMVA 1NTVA 4HAWB 3D8EA 1I7AA 2RNRB 4F7UP 1V5MA 2LG1A 2GS0A 2LOZA 1MKEA 5DIFB 4CHJA 1U5GA 5D3YA 2RGNB 1XODA 1EGXA 4MY6A 1XCGA 1H10A 2YRYA 1TQZA 2CY4A 5C6RA 2EMSA 3MPXA 3F0WA 4HAYB 1M7RA 5DHAB 3SUZA 2LULA 4CHMA 2COFA 5KQ4A 2BCJA 2L1CA 1DROA
chains in the Genus database with same CATH superfamily
2Y8GA 1QC6A 2P0DA 3MDBC 4H8SA 2I1KA 2CAYA 2Y8FA 4DX8A 2OQBA 4A5KA 2D9WA 2DYQA 1XR0B 5L81A 2RLOA 1WI1A 2MKRA 2COCA 2GUMA 2DLWA 1PLSA 4IFSA 1ZM0A 4KHBB 2Z59A 1MPHA 2N0YA 2E2XA 1K5DB 1Y19B 1BTNA 2XQNM 3TVVA 4HAUB 2J0JA 5J3TA 4CSQA 4F7HA 1DDMA 1U27A 2RVBB 2DHKA 4MK0A 2QKLA 1WJ1A 2K00A 1Y5OA 3GYOA 4DXAB 2W2XD 1M7EA 4EJNA 1FHWA 2X18A 2I1JA 5IRSA 1BTKA 4NY0A 1TJ6A 3UZTA 3PVUA 2W2WA 2YS1A 1KZGA 2DYNA 2V76A 1X05A 1MK9B 2K49A 4HHVA 2K2JA 1FHXA 1OY2A 1FB8A 3ODOA 4QJ4B 1XD4A 4TYZA 3QIJA 1K5GB 3KRWA 1KZ7A 2N23A 4K17A 1NU2A 3PG7A 2OTXA 1V5PA 1ZSQA 4HSIA 4IOYX 4K2OA 3FSSA 3TCAA 2YSZA 5D3VA 3DCXA 5DH9B 3U7DA 2J0MA 1N3HA 2EJ8A 3FVCA 3X23A 2D2QA 5CLLB 3TW1A 2LYDA 2HTHB 4BBKA 2Q13A 1W1HA 2MWNB 3F5RA 5CLQB 3PZDA 5C5BB 1MI1A 1RRPB 3AU5A 1ZC4B 1V88A 2K8EA 1GC6A 4GOUA 4YL8A 2CRFA 2PZ1A 4EKUA 1WGQA 1MK7B 4GNKB 3OHMB 1UEFA 2YVCA 2Z0PA 1ZVRA 2LOXA 4HAZB 3ML4A 2ZPYA 3PVLA 3LJUX 4HDQA 3KSYA 2H7DA 5DHFB 2KGXB 3M1IB 2W2XC 1KI1B 3SV1A 1GG3A 1DDWA 2LKOA 3U12A 4GZUA 2CY5A 3ODWA 2KUPA 3GYPA 3ZDTA 3PEGA 2DFKA 1SGHA 1U5EA 1DYNA 3OANA 2DHIA 2I5CA 4GMXB 2KIGA 4K2PA 4KAXB 4WVFB 2D11A 2UVMA 4DIXA 2AL6A 4ZRIA 2ELBA 4QXAB 3A98B 3U8ZA 1SHCA 2H7EA 2ADZA 3AU4A 5HE2A 5J3QA 4IAPA 2I5FA 2EC1A 5JLJB 2GCLA 3DXCA 2YF0A 1DDVA 4PQ0A 2ZKMX 3VOQA 3HIEA 1E5WA 5FI1A 2P0HA 4Z2MB 4C0AA 4WSFA 2Z14A 3PSCA 3NW8A 5HE3A 2RSGA 5DI9B 2J59M 1FOEA 2DN6A 5LONB 2KR0A 1MAIA 2KCJA 4Y94A 3HSAA 1AQCA 1X86A 1MIXA 4MT7A 4XWXA 4DX90 4HAVB 2VRWB 3KRXA 1W1DA 1W1GA 2DHJA 3BJIA 5JP4A 1TXDA 2Y7BA 1ISNA 2EMTA 1FHOA 1U5FA 3IVFA 1V89A 2DA0A 3D8FA 4TKNA 3ULBA 5M4YB 3NWFA 5I2MA 1PMSA 2ELAA 1B55A 2DKPA 3DXDA 2R0DA 3CXBB 3TFMA 4QJ5B 1H4RA 2DX1A 4KHAA 4ZRKA 2NBVA 4KHBA 1X11A 2D9VA 4YONA 5JHHA 3KZ1A 4D0NB 3VIAA 2K2UA 1NI2A 2Z0OA 1LW3A 4GXBA 1GC7A 2GJYA 1QQGA 1V5UA 3ZVRA 4K81A 3BINA 2Z4DA 2Z0QA 1P5TA 3TO1A 3HW2B 4Z2NA 2QKMA 2D4QA 1EF1A 4GN1A 2JP2A 3NWAA 2DX5A 3ODXA 3HK0A 3RCPA 3WYFB 1U5DA 2ROVA 4B6HA 2Z13A 4HB2B 4A6HA 4HB4B 3B77A 4HDOA 2D9YA 2CODA 2RRFA 1WJMA 2YT2A 5GOWB 5I2SA 1ZYIA 3O96A 1OQNA 3FEHA 2D9XA 1X1FA 4L1RA 4A6KA 4F7GA 2ROZB 1UPRA 2M38A 4P7IA 2R09A 3T06A 2P8VA 3V5WA 4HB0B 4CYEA 2L2IA 2HE7A 3CIKA 1XKEA 5D27A 2RUKB 1FGYA 2G35A 4A6FB 1I2HA 2R2YA 2UZRA 3HQCA 1LB1A 1J19A 2VKIA 3WA0A 4OT1A 2DTCA 5D3WA 1V61A 3DXEA 1U2BA 2YT0A 1OMWA 3PVWA 5KQ1A 2FJLA 5HE1A 5C5BA 2J0KA 3P7ZA 1WVHA 1P3RA 3QWMA 1X1GA 5LOPB 4HB3B 4KHOA 2YS3A 1FGZA 2P0FA 5HE0A 1ZC3B 1BAKA 1P6SA 2D9ZA 5C79A 1XX0A 4PNKA 3FM8C 2D10A 3A8QA 2IFSA 3KY9A 3AJ4A 1AWEA 2KIEA 1J0WA 3PP2A 5C16A 2VSZA 4GPTB 3A8PA 5J3YA 5FI0A 1UPQA 1Q67A 1EAZA 4QJ3B 2M14A 3D8DA 3G9WA 1WGUA 4NSWA 1UNPA 3A58A 4D6WA 1DBHA 1EVHA 2IYBA 5D3XA 4HAXB 1U29A 1MIZB 3P6AA 1FAOA 1Z87A 1NTYA 3NSUA 1T77A 2COAA 2NZ8B 2MDXA 3NWDA 3SO6A 3SYXA 1PFJA 4DBBA 5JHGA 3SNHA 2YT1A 4L6EA 2NMBA 1UNRA 2DKQA 1UNQA 4EMOA 2YS5A 4WJ7A 2MFQA 1WG7A 4A6FA 1RJ2A 4OSNA 1IRSA 2GCJA 2UZSA 3N7CA 1BWNA 3QBVB 5KCVA 4KVGB 3ULCA 4HATB 5EFXA 2AEHA 4ZRJA 4GMVA 1NTVA 4HAWB 3D8EA 1I7AA 2RNRB 4F7UP 1V5MA 2LG1A 2GS0A 2LOZA 1MKEA 5DIFB 2KUQA 4CHJA 1U5GA 5D3YA 2RGNB 1XODA 2FJUB 1EGXA 4MY6A 1XCGA 1H10A 2YRYA 1TQZA 2CY4A 5C6RA 2EMSA 3MPXA 3F0WA 4HAYB 5LG4B 1M7RA 5DHAB 3SUZA 2LULA 4CHMA 2COFA 5KQ4A 2BCJA 2L1CA 1DROA
chains in the Genus database with same CATH topology
2Y8GA 1QC6A 2P0DA 3MDBC 4H8SA 2I1KA 2CAYA 2Y8FA 4DX8A 2OQBA 4A5KA 2D9WA 2DYQA 1XR0B 5L81A 2RLOA 1WI1A 2MKRA 2COCA 2DLWA 1PLSA 4IFSA 1ZM0A 4KHBB 1MPHA 2N0YA 2E2XA 1K5DB 1Y19B 1BTNA 2XQNM 3TVVA 4HAUB 2J0JA 5J3TA 4F7HA 1DDMA 1U27A 2RVBB 2DHKA 4MK0A 2QKLA 1WJ1A 2K00A 1Y5OA 3GYOA 4DXAB 2W2XD 1M7EA 4EJNA 1FHWA 2X18A 2I1JA 1BTKA 4NY0A 1TJ6A 3UZTA 3PVUA 2W2WA 2YS1A 1KZGA 2DYNA 2V76A 1X05A 1MK9B 4HHVA 2K2JA 1FHXA 1OY2A 1FB8A 3ODOA 1XD4A 4TYZA 3QIJA 1K5GB 3KRWA 1KZ7A 2N23A 4K17A 1NU2A 3PG7A 2OTXA 1V5PA 1ZSQA 4IOYX 4K2OA 3FSSA 3TCAA 2YSZA 5D3VA 3U7DA 5DH9B 2J0MA 1N3HA 2EJ8A 3X23A 2D2QA 5CLLB 3TW1A 2LYDA 2HTHB 4BBKA 2Q13A 1W1HA 2MWNB 3F5RA 5CLQB 3PZDA 5C5BB 1RRPB 3AU5A 1ZC4B 1V88A 1GC6A 4YL8A 2CRFA 2PZ1A 4EKUA 1WGQA 1MK7B 1UEFA 2YVCA 2Z0PA 1ZVRA 2LOXA 4HAZB 3ML4A 2ZPYA 3PVLA 3LJUX 4HDQA 3KSYA 2H7DA 5DHFB 2KGXB 3M1IB 2W2XC 1KI1B 3SV1A 1GG3A 1DDWA 2LKOA 4GZUA 2CY5A 3ODWA 2KUPA 3GYPA 3ZDTA 3PEGA 2DFKA 1SGHA 1U5EA 1DYNA 3OANA 2DHIA 2I5CA 4GMXB 4K2PA 4KAXB 4WVFB 2D11A 2UVMA 2AL6A 4ZRIA 2ELBA 3U8ZA 3A98B 1SHCA 2H7EA 2ADZA 3AU4A 5HE2A 5J3QA 4IAPA 2I5FA 2EC1A 5JLJB 2GCLA 3DXCA 2YF0A 1DDVA 4PQ0A 3VOQA 1E5WA 5FI1A 2P0HA 4Z2MB 4C0AA 4WSFA 3PSCA 5HE3A 2RSGA 5DI9B 2J59M 1FOEA 2DN6A 5LONB 1MAIA 2KCJA 4Y94A 1AQCA 1X86A 1MIXA 4MT7A 4XWXA 4DX90 4HAVB 2VRWB 3KRXA 1W1DA 1W1GA 2DHJA 3BJIA 5JP4A 1TXDA 2Y7BA 1ISNA 2EMTA 1FHOA 1U5FA 3IVFA 1V89A 2DA0A 3D8FA 4TKNA 3ULBA 1PMSA 2ELAA 1B55A 2DKPA 3DXDA 2R0DA 3CXBB 3TFMA 1H4RA 2DX1A 4KHAA 4ZRKA 1X11A 2D9VA 4YONA 5JHHA 3KZ1A 4D0NB 3VIAA 2K2UA 1NI2A 2Z0OA 1LW3A 4GXBA 1GC7A 2GJYA 1QQGA 1V5UA 3ZVRA 4K81A 3BINA 2Z0QA 1P5TA 3TO1A 3HW2B 4Z2NA 2QKMA 2D4QA 1EF1A 4GN1A 2JP2A 2DX5A 3ODXA 3HK0A 3RCPA 3WYFB 1U5DA 2ROVA 4B6HA 4HB2B 4A6HA 4HB4B 4HDOA 2D9YA 2CODA 1WJMA 5GOWB 3O96A 1OQNA 3FEHA 2D9XA 1X1FA 4A6KA 4F7GA 2ROZB 1UPRA 2M38A 4P7IA 2R09A 3T06A 2P8VA 3V5WA 4HB0B 4CYEA 2L2IA 2HE7A 3CIKA 1XKEA 5D27A 2RUKB 1FGYA 2G35A 4A6FB 1I2HA 2UZRA 3HQCA 1LB1A 1J19A 2VKIA 3WA0A 2DTCA 5D3WA 1V61A 3DXEA 1U2BA 2YT0A 1OMWA 3PVWA 5KQ1A 2FJLA 5HE1A 5C5BA 2J0KA 3P7ZA 1WVHA 1P3RA 3QWMA 1X1GA 5LOPB 4HB3B 4KHOA 2YS3A 1FGZA 2P0FA 5HE0A 1ZC3B 1BAKA 1P6SA 2D9ZA 5C79A 1XX0A 4PNKA 3FM8C 2D10A 3A8QA 2IFSA 3KY9A 3AJ4A 1AWEA 1J0WA 3PP2A 5C16A 2VSZA 4GPTB 3A8PA 5J3YA 5FI0A 1UPQA 1Q67A 1EAZA 2M14A 3D8DA 3G9WA 1WGUA 4NSWA 1UNPA 1DBHA 1EVHA 2IYBA 5D3XA 4HAXB 1U29A 1MIZB 3P6AA 1FAOA 1Z87A 1NTYA 3NSUA 3SO6A 2COAA 2NZ8B 2MDXA 4DBBA 3SYXA 5JHGA 1PFJA 3SNHA 2YT1A 4L6EA 2NMBA 1UNRA 2DKQA 1UNQA 4EMOA 2YS5A 4WJ7A 2MFQA 1WG7A 4A6FA 1RJ2A 1IRSA 2GCJA 2UZSA 3N7CA 1BWNA 3QBVB 5KCVA 4KVGB 3ULCA 4HATB 5EFXA 2AEHA 4ZRJA 4GMVA 1NTVA 4HAWB 3D8EA 1I7AA 2RNRB 4F7UP 1V5MA 2LG1A 2GS0A 2LOZA 1MKEA 5DIFB 4CHJA 1U5GA 5D3YA 2RGNB 1XODA 1EGXA 4MY6A 1XCGA 1H10A 2YRYA 1TQZA 2CY4A 5C6RA 2EMSA 3MPXA 3F0WA 4HAYB 1M7RA 5DHAB 3SUZA 2LULA 4CHMA 2COFA 5KQ4A 2BCJA 2L1CA 1DROA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Y8G A;  1QC6 A;  2P0D A;  3MDB C;  4H8S A;  2I1K A;  2CAY A;  2Y8F A;  4DX8 A;  2OQB A;  4A5K A;  2D9W A;  2DYQ A;  1XR0 B;  5L81 A;  2RLO A;  1WI1 A;  2MKR A;  2COC A;  2DLW A;  1PLS A;  4IFS A;  1ZM0 A;  4KHB B;  1MPH A;  2N0Y A;  2E2X A;  1K5D B;  1Y19 B;  1BTN A;  2XQN M;  3TVV A;  4HAU B;  2J0J A;  5J3T A;  4F7H A;  1DDM A;  1U27 A;  2RVB B;  2DHK A;  4MK0 A;  2QKL A;  1WJ1 A;  2K00 A;  1Y5O A;  3GYO A;  4DXA B;  2W2X D;  1M7E A;  4EJN A;  1FHW A;  2X18 A;  2I1J A;  1BTK A;  4NY0 A;  1TJ6 A;  3UZT A;  3PVU A;  2W2W A;  2YS1 A;  1KZG A;  2DYN A;  2V76 A;  1X05 A;  1MK9 B;  4HHV A;  2K2J A;  1FHX A;  1OY2 A;  1FB8 A;  3ODO A;  1XD4 A;  4TYZ A;  3QIJ A;  1K5G B;  3KRW A;  1KZ7 A;  2N23 A;  4K17 A;  1NU2 A;  3PG7 A;  2OTX A;  1V5P A;  1ZSQ A;  4IOY X;  4K2O A;  3FSS A;  3TCA A;  2YSZ A;  5D3V A;  3U7D A;  5DH9 B;  2J0M A;  1N3H A;  2EJ8 A;  3X23 A;  2D2Q A;  5CLL B;  3TW1 A;  2LYD A;  2HTH B;  4BBK A;  2Q13 A;  1W1H A;  2MWN B;  3F5R A;  5CLQ B;  3PZD A;  5C5B B;  1RRP B;  3AU5 A;  1ZC4 B;  1V88 A;  1GC6 A;  4YL8 A;  2CRF A;  2PZ1 A;  4EKU A;  1WGQ A;  1MK7 B;  1UEF A;  2YVC A;  2Z0P A;  1ZVR A;  2LOX A;  4HAZ B;  3ML4 A;  2ZPY A;  3PVL A;  3LJU X;  4HDQ A;  3KSY A;  2H7D A;  5DHF B;  2KGX B;  3M1I B;  2W2X C;  1KI1 B;  3SV1 A;  1GG3 A;  1DDW A;  2LKO A;  4GZU A;  2CY5 A;  3ODW A;  2KUP A;  3GYP A;  3ZDT A;  3PEG A;  2DFK A;  1SGH A;  1U5E A;  1DYN A;  3OAN A;  2DHI A;  2I5C A;  4GMX B;  4K2P A;  4KAX B;  4WVF B;  2D11 A;  2UVM A;  2AL6 A;  4ZRI A;  2ELB A;  3U8Z A;  3A98 B;  1SHC A;  2H7E A;  2ADZ A;  3AU4 A;  5HE2 A;  5J3Q A;  4IAP A;  2I5F A;  2EC1 A;  5JLJ B;  2GCL A;  3DXC A;  2YF0 A;  1DDV A;  4PQ0 A;  3VOQ A;  1E5W A;  5FI1 A;  2P0H A;  4Z2M B;  4C0A A;  4WSF A;  3PSC A;  5HE3 A;  2RSG A;  5DI9 B;  2J59 M;  1FOE A;  2DN6 A;  5LON B;  1MAI A;  2KCJ A;  4Y94 A;  1AQC A;  1X86 A;  1MIX A;  4MT7 A;  4XWX A;  4DX9 0;  4HAV B;  2VRW B;  3KRX A;  1W1D A;  1W1G A;  2DHJ A;  3BJI A;  5JP4 A;  1TXD A;  2Y7B A;  1ISN A;  2EMT A;  1FHO A;  1U5F A;  3IVF A;  1V89 A;  2DA0 A;  3D8F A;  4TKN A;  3ULB A;  1PMS A;  2ELA A;  1B55 A;  2DKP A;  3DXD A;  2R0D A;  3CXB B;  3TFM A;  1H4R A;  2DX1 A;  4KHA A;  4ZRK A;  1X11 A;  2D9V A;  4YON A;  5JHH A;  3KZ1 A;  4D0N B;  3VIA A;  2K2U A;  1NI2 A;  2Z0O A;  1LW3 A;  4GXB A;  1GC7 A;  2GJY A;  1QQG A;  1V5U A;  3ZVR A;  4K81 A;  3BIN A;  2Z0Q A;  1P5T A;  3TO1 A;  3HW2 B;  4Z2N A;  2QKM A;  2D4Q A;  1EF1 A;  4GN1 A;  2JP2 A;  2DX5 A;  3ODX A;  3HK0 A;  3RCP A;  3WYF B;  1U5D A;  2ROV A;  4B6H A;  4HB2 B;  4A6H A;  4HB4 B;  4HDO A;  2D9Y A;  2COD A;  1WJM A;  5GOW B;  3O96 A;  1OQN A;  3FEH A;  2D9X A;  1X1F A;  4A6K A;  4F7G A;  2ROZ B;  1UPR A;  2M38 A;  4P7I A;  2R09 A;  3T06 A;  2P8V A;  3V5W A;  4HB0 B;  4CYE A;  2L2I A;  2HE7 A;  3CIK A;  1XKE A;  5D27 A;  2RUK B;  1FGY A;  2G35 A;  4A6F B;  1I2H A;  2UZR A;  3HQC A;  1LB1 A;  1J19 A;  2VKI A;  3WA0 A;  2DTC A;  5D3W A;  1V61 A;  3DXE A;  1U2B A;  2YT0 A;  1OMW A;  3PVW A;  5KQ1 A;  2FJL A;  5HE1 A;  5C5B A;  2J0K A;  3P7Z A;  1WVH A;  1P3R A;  3QWM A;  1X1G A;  5LOP B;  4HB3 B;  4KHO A;  2YS3 A;  1FGZ A;  2P0F A;  5HE0 A;  1ZC3 B;  1BAK A;  1P6S A;  2D9Z A;  5C79 A;  1XX0 A;  4PNK A;  3FM8 C;  2D10 A;  3A8Q A;  2IFS A;  3KY9 A;  3AJ4 A;  1AWE A;  1J0W A;  3PP2 A;  5C16 A;  2VSZ A;  4GPT B;  3A8P A;  5J3Y A;  5FI0 A;  1UPQ A;  1Q67 A;  1EAZ A;  2M14 A;  3D8D A;  3G9W A;  1WGU A;  4NSW A;  1UNP A;  1DBH A;  1EVH A;  2IYB A;  5D3X A;  4HAX B;  1U29 A;  1MIZ B;  3P6A A;  1FAO A;  1Z87 A;  1NTY A;  3NSU A;  3SO6 A;  2COA A;  2NZ8 B;  2MDX A;  4DBB A;  3SYX A;  5JHG A;  1PFJ A;  3SNH A;  2YT1 A;  4L6E A;  2NMB A;  1UNR A;  2DKQ A;  1UNQ A;  4EMO A;  2YS5 A;  4WJ7 A;  2MFQ A;  1WG7 A;  4A6F A;  1RJ2 A;  1IRS A;  2GCJ A;  2UZS A;  3N7C A;  1BWN A;  3QBV B;  5KCV A;  4KVG B;  3ULC A;  4HAT B;  5EFX A;  2AEH A;  4ZRJ A;  4GMV A;  1NTV A;  4HAW B;  3D8E A;  1I7A A;  2RNR B;  4F7U P;  1V5M A;  2LG1 A;  2GS0 A;  2LOZ A;  1MKE A;  5DIF B;  4CHJ A;  1U5G A;  5D3Y A;  2RGN B;  1XOD A;  1EGX A;  4MY6 A;  1XCG A;  1H10 A;  2YRY A;  1TQZ A;  2CY4 A;  5C6R A;  2EMS A;  3MPX A;  3F0W A;  4HAY B;  1M7R A;  5DHA B;  3SUZ A;  2LUL A;  4CHM A;  2COF A;  5KQ4 A;  2BCJ A;  2L1C A;  1DRO A; 
#chains in the Genus database with same CATH topology
 2Y8G A;  1QC6 A;  2P0D A;  3MDB C;  4H8S A;  2I1K A;  2CAY A;  2Y8F A;  4DX8 A;  2OQB A;  4A5K A;  2D9W A;  2DYQ A;  1XR0 B;  5L81 A;  2RLO A;  1WI1 A;  2MKR A;  2COC A;  2GUM A;  2DLW A;  1PLS A;  4IFS A;  1ZM0 A;  4KHB B;  2Z59 A;  1MPH A;  2N0Y A;  2E2X A;  1K5D B;  1Y19 B;  1BTN A;  2XQN M;  3TVV A;  4HAU B;  2J0J A;  5J3T A;  4CSQ A;  4F7H A;  1DDM A;  1U27 A;  2RVB B;  2DHK A;  4MK0 A;  2QKL A;  1WJ1 A;  2K00 A;  1Y5O A;  3GYO A;  4DXA B;  2W2X D;  1M7E A;  4EJN A;  1FHW A;  2X18 A;  2I1J A;  5IRS A;  1BTK A;  4NY0 A;  1TJ6 A;  3UZT A;  3PVU A;  2W2W A;  2YS1 A;  1KZG A;  2DYN A;  2V76 A;  1X05 A;  1MK9 B;  2K49 A;  4HHV A;  2K2J A;  1FHX A;  1OY2 A;  1FB8 A;  3ODO A;  4QJ4 B;  1XD4 A;  4TYZ A;  3QIJ A;  1K5G B;  3KRW A;  1KZ7 A;  2N23 A;  4K17 A;  1NU2 A;  3PG7 A;  2OTX A;  1V5P A;  1ZSQ A;  4HSI A;  4IOY X;  4K2O A;  3FSS A;  3TCA A;  2YSZ A;  5D3V A;  3DCX A;  5DH9 B;  3U7D A;  2J0M A;  1N3H A;  2EJ8 A;  3FVC A;  3X23 A;  2D2Q A;  5CLL B;  3TW1 A;  2LYD A;  2HTH B;  4BBK A;  2Q13 A;  1W1H A;  2MWN B;  3F5R A;  5CLQ B;  3PZD A;  5C5B B;  1MI1 A;  1RRP B;  3AU5 A;  1ZC4 B;  1V88 A;  2K8E A;  1GC6 A;  4GOU A;  4YL8 A;  2CRF A;  2PZ1 A;  4EKU A;  1WGQ A;  1MK7 B;  4GNK B;  3OHM B;  1UEF A;  2YVC A;  2Z0P A;  1ZVR A;  2LOX A;  4HAZ B;  3ML4 A;  2ZPY A;  3PVL A;  3LJU X;  4HDQ A;  3KSY A;  2H7D A;  5DHF B;  2KGX B;  3M1I B;  2W2X C;  1KI1 B;  3SV1 A;  1GG3 A;  1DDW A;  2LKO A;  3U12 A;  4GZU A;  2CY5 A;  3ODW A;  2KUP A;  3GYP A;  3ZDT A;  3PEG A;  2DFK A;  1SGH A;  1U5E A;  1DYN A;  3OAN A;  2DHI A;  2I5C A;  4GMX B;  2KIG A;  4K2P A;  4KAX B;  4WVF B;  2D11 A;  2UVM A;  4DIX A;  2AL6 A;  4ZRI A;  2ELB A;  4QXA B;  3A98 B;  3U8Z A;  1SHC A;  2H7E A;  2ADZ A;  3AU4 A;  5HE2 A;  5J3Q A;  4IAP A;  2I5F A;  2EC1 A;  5JLJ B;  2GCL A;  3DXC A;  2YF0 A;  1DDV A;  4PQ0 A;  2ZKM X;  3VOQ A;  3HIE A;  1E5W A;  5FI1 A;  2P0H A;  4Z2M B;  4C0A A;  4WSF A;  2Z14 A;  3PSC A;  3NW8 A;  5HE3 A;  2RSG A;  5DI9 B;  2J59 M;  1FOE A;  2DN6 A;  5LON B;  2KR0 A;  1MAI A;  2KCJ A;  4Y94 A;  3HSA A;  1AQC A;  1X86 A;  1MIX A;  4MT7 A;  4XWX A;  4DX9 0;  4HAV B;  2VRW B;  3KRX A;  1W1D A;  1W1G A;  2DHJ A;  3BJI A;  5JP4 A;  1TXD A;  2Y7B A;  1ISN A;  2EMT A;  1FHO A;  1U5F A;  3IVF A;  1V89 A;  2DA0 A;  3D8F A;  4TKN A;  3ULB A;  5M4Y B;  3NWF A;  5I2M A;  1PMS A;  2ELA A;  1B55 A;  2DKP A;  3DXD A;  2R0D A;  3CXB B;  3TFM A;  4QJ5 B;  1H4R A;  2DX1 A;  4KHA A;  4ZRK A;  2NBV A;  4KHB A;  1X11 A;  2D9V A;  4YON A;  5JHH A;  3KZ1 A;  4D0N B;  3VIA A;  2K2U A;  1NI2 A;  2Z0O A;  1LW3 A;  4GXB A;  1GC7 A;  2GJY A;  1QQG A;  1V5U A;  3ZVR A;  4K81 A;  3BIN A;  2Z4D A;  2Z0Q A;  1P5T A;  3TO1 A;  3HW2 B;  4Z2N A;  2QKM A;  2D4Q A;  1EF1 A;  4GN1 A;  2JP2 A;  3NWA A;  2DX5 A;  3ODX A;  3HK0 A;  3RCP A;  3WYF B;  1U5D A;  2ROV A;  4B6H A;  2Z13 A;  4HB2 B;  4A6H A;  4HB4 B;  3B77 A;  4HDO A;  2D9Y A;  2COD A;  2RRF A;  1WJM A;  2YT2 A;  5GOW B;  5I2S A;  1ZYI A;  3O96 A;  1OQN A;  3FEH A;  2D9X A;  1X1F A;  4L1R A;  4A6K A;  4F7G A;  2ROZ B;  1UPR A;  2M38 A;  4P7I A;  2R09 A;  3T06 A;  2P8V A;  3V5W A;  4HB0 B;  4CYE A;  2L2I A;  2HE7 A;  3CIK A;  1XKE A;  5D27 A;  2RUK B;  1FGY A;  2G35 A;  4A6F B;  1I2H A;  2R2Y A;  2UZR A;  3HQC A;  1LB1 A;  1J19 A;  2VKI A;  3WA0 A;  4OT1 A;  2DTC A;  5D3W A;  1V61 A;  3DXE A;  1U2B A;  2YT0 A;  1OMW A;  3PVW A;  5KQ1 A;  2FJL A;  5HE1 A;  5C5B A;  2J0K A;  3P7Z A;  1WVH A;  1P3R A;  3QWM A;  1X1G A;  5LOP B;  4HB3 B;  4KHO A;  2YS3 A;  1FGZ A;  2P0F A;  5HE0 A;  1ZC3 B;  1BAK A;  1P6S A;  2D9Z A;  5C79 A;  1XX0 A;  4PNK A;  3FM8 C;  2D10 A;  3A8Q A;  2IFS A;  3KY9 A;  3AJ4 A;  1AWE A;  2KIE A;  1J0W A;  3PP2 A;  5C16 A;  2VSZ A;  4GPT B;  3A8P A;  5J3Y A;  5FI0 A;  1UPQ A;  1Q67 A;  1EAZ A;  4QJ3 B;  2M14 A;  3D8D A;  3G9W A;  1WGU A;  4NSW A;  1UNP A;  3A58 A;  4D6W A;  1DBH A;  1EVH A;  2IYB A;  5D3X A;  4HAX B;  1U29 A;  1MIZ B;  3P6A A;  1FAO A;  1Z87 A;  1NTY A;  3NSU A;  1T77 A;  2COA A;  2NZ8 B;  2MDX A;  3NWD A;  3SO6 A;  3SYX A;  1PFJ A;  4DBB A;  5JHG A;  3SNH A;  2YT1 A;  4L6E A;  2NMB A;  1UNR A;  2DKQ A;  1UNQ A;  4EMO A;  2YS5 A;  4WJ7 A;  2MFQ A;  1WG7 A;  4A6F A;  1RJ2 A;  4OSN A;  1IRS A;  2GCJ A;  2UZS A;  3N7C A;  1BWN A;  3QBV B;  5KCV A;  4KVG B;  3ULC A;  4HAT B;  5EFX A;  2AEH A;  4ZRJ A;  4GMV A;  1NTV A;  4HAW B;  3D8E A;  1I7A A;  2RNR B;  4F7U P;  1V5M A;  2LG1 A;  2GS0 A;  2LOZ A;  1MKE A;  5DIF B;  2KUQ A;  4CHJ A;  1U5G A;  5D3Y A;  2RGN B;  1XOD A;  2FJU B;  1EGX A;  4MY6 A;  1XCG A;  1H10 A;  2YRY A;  1TQZ A;  2CY4 A;  5C6R A;  2EMS A;  3MPX A;  3F0W A;  4HAY B;  5LG4 B;  1M7R A;  5DHA B;  3SUZ A;  2LUL A;  4CHM A;  2COF A;  5KQ4 A;  2BCJ A;  2L1C A;  1DRO A; 
#chains in the Genus database with same CATH homology
 2Y8G A;  1QC6 A;  2P0D A;  3MDB C;  4H8S A;  2I1K A;  2CAY A;  2Y8F A;  4DX8 A;  2OQB A;  4A5K A;  2D9W A;  2DYQ A;  1XR0 B;  5L81 A;  2RLO A;  1WI1 A;  2MKR A;  2COC A;  2DLW A;  1PLS A;  4IFS A;  1ZM0 A;  4KHB B;  1MPH A;  2N0Y A;  2E2X A;  1K5D B;  1Y19 B;  1BTN A;  2XQN M;  3TVV A;  4HAU B;  2J0J A;  5J3T A;  4F7H A;  1DDM A;  1U27 A;  2RVB B;  2DHK A;  4MK0 A;  2QKL A;  1WJ1 A;  2K00 A;  1Y5O A;  3GYO A;  4DXA B;  2W2X D;  1M7E A;  4EJN A;  1FHW A;  2X18 A;  2I1J A;  1BTK A;  4NY0 A;  1TJ6 A;  3UZT A;  3PVU A;  2W2W A;  2YS1 A;  1KZG A;  2DYN A;  2V76 A;  1X05 A;  1MK9 B;  4HHV A;  2K2J A;  1FHX A;  1OY2 A;  1FB8 A;  3ODO A;  1XD4 A;  4TYZ A;  3QIJ A;  1K5G B;  3KRW A;  1KZ7 A;  2N23 A;  4K17 A;  1NU2 A;  3PG7 A;  2OTX A;  1V5P A;  1ZSQ A;  4IOY X;  4K2O A;  3FSS A;  3TCA A;  2YSZ A;  5D3V A;  3U7D A;  5DH9 B;  2J0M A;  1N3H A;  2EJ8 A;  3X23 A;  2D2Q A;  5CLL B;  3TW1 A;  2LYD A;  2HTH B;  4BBK A;  2Q13 A;  1W1H A;  2MWN B;  3F5R A;  5CLQ B;  3PZD A;  5C5B B;  1RRP B;  3AU5 A;  1ZC4 B;  1V88 A;  1GC6 A;  4YL8 A;  2CRF A;  2PZ1 A;  4EKU A;  1WGQ A;  1MK7 B;  1UEF A;  2YVC A;  2Z0P A;  1ZVR A;  2LOX A;  4HAZ B;  3ML4 A;  2ZPY A;  3PVL A;  3LJU X;  4HDQ A;  3KSY A;  2H7D A;  5DHF B;  2KGX B;  3M1I B;  2W2X C;  1KI1 B;  3SV1 A;  1GG3 A;  1DDW A;  2LKO A;  4GZU A;  2CY5 A;  3ODW A;  2KUP A;  3GYP A;  3ZDT A;  3PEG A;  2DFK A;  1SGH A;  1U5E A;  1DYN A;  3OAN A;  2DHI A;  2I5C A;  4GMX B;  4K2P A;  4KAX B;  4WVF B;  2D11 A;  2UVM A;  2AL6 A;  4ZRI A;  2ELB A;  3U8Z A;  3A98 B;  1SHC A;  2H7E A;  2ADZ A;  3AU4 A;  5HE2 A;  5J3Q A;  4IAP A;  2I5F A;  2EC1 A;  5JLJ B;  2GCL A;  3DXC A;  2YF0 A;  1DDV A;  4PQ0 A;  3VOQ A;  1E5W A;  5FI1 A;  2P0H A;  4Z2M B;  4C0A A;  4WSF A;  3PSC A;  5HE3 A;  2RSG A;  5DI9 B;  2J59 M;  1FOE A;  2DN6 A;  5LON B;  1MAI A;  2KCJ A;  4Y94 A;  1AQC A;  1X86 A;  1MIX A;  4MT7 A;  4XWX A;  4DX9 0;  4HAV B;  2VRW B;  3KRX A;  1W1D A;  1W1G A;  2DHJ A;  3BJI A;  5JP4 A;  1TXD A;  2Y7B A;  1ISN A;  2EMT A;  1FHO A;  1U5F A;  3IVF A;  1V89 A;  2DA0 A;  3D8F A;  4TKN A;  3ULB A;  1PMS A;  2ELA A;  1B55 A;  2DKP A;  3DXD A;  2R0D A;  3CXB B;  3TFM A;  1H4R A;  2DX1 A;  4KHA A;  4ZRK A;  1X11 A;  2D9V A;  4YON A;  5JHH A;  3KZ1 A;  4D0N B;  3VIA A;  2K2U A;  1NI2 A;  2Z0O A;  1LW3 A;  4GXB A;  1GC7 A;  2GJY A;  1QQG A;  1V5U A;  3ZVR A;  4K81 A;  3BIN A;  2Z0Q A;  1P5T A;  3TO1 A;  3HW2 B;  4Z2N A;  2QKM A;  2D4Q A;  1EF1 A;  4GN1 A;  2JP2 A;  2DX5 A;  3ODX A;  3HK0 A;  3RCP A;  3WYF B;  1U5D A;  2ROV A;  4B6H A;  4HB2 B;  4A6H A;  4HB4 B;  4HDO A;  2D9Y A;  2COD A;  1WJM A;  5GOW B;  3O96 A;  1OQN A;  3FEH A;  2D9X A;  1X1F A;  4A6K A;  4F7G A;  2ROZ B;  1UPR A;  2M38 A;  4P7I A;  2R09 A;  3T06 A;  2P8V A;  3V5W A;  4HB0 B;  4CYE A;  2L2I A;  2HE7 A;  3CIK A;  1XKE A;  5D27 A;  2RUK B;  1FGY A;  2G35 A;  4A6F B;  1I2H A;  2UZR A;  3HQC A;  1LB1 A;  1J19 A;  2VKI A;  3WA0 A;  2DTC A;  5D3W A;  1V61 A;  3DXE A;  1U2B A;  2YT0 A;  1OMW A;  3PVW A;  5KQ1 A;  2FJL A;  5HE1 A;  5C5B A;  2J0K A;  3P7Z A;  1WVH A;  1P3R A;  3QWM A;  1X1G A;  5LOP B;  4HB3 B;  4KHO A;  2YS3 A;  1FGZ A;  2P0F A;  5HE0 A;  1ZC3 B;  1BAK A;  1P6S A;  2D9Z A;  5C79 A;  1XX0 A;  4PNK A;  3FM8 C;  2D10 A;  3A8Q A;  2IFS A;  3KY9 A;  3AJ4 A;  1AWE A;  1J0W A;  3PP2 A;  5C16 A;  2VSZ A;  4GPT B;  3A8P A;  5J3Y A;  5FI0 A;  1UPQ A;  1Q67 A;  1EAZ A;  2M14 A;  3D8D A;  3G9W A;  1WGU A;  4NSW A;  1UNP A;  1DBH A;  1EVH A;  2IYB A;  5D3X A;  4HAX B;  1U29 A;  1MIZ B;  3P6A A;  1FAO A;  1Z87 A;  1NTY A;  3NSU A;  3SO6 A;  2COA A;  2NZ8 B;  2MDX A;  4DBB A;  3SYX A;  5JHG A;  1PFJ A;  3SNH A;  2YT1 A;  4L6E A;  2NMB A;  1UNR A;  2DKQ A;  1UNQ A;  4EMO A;  2YS5 A;  4WJ7 A;  2MFQ A;  1WG7 A;  4A6F A;  1RJ2 A;  1IRS A;  2GCJ A;  2UZS A;  3N7C A;  1BWN A;  3QBV B;  5KCV A;  4KVG B;  3ULC A;  4HAT B;  5EFX A;  2AEH A;  4ZRJ A;  4GMV A;  1NTV A;  4HAW B;  3D8E A;  1I7A A;  2RNR B;  4F7U P;  1V5M A;  2LG1 A;  2GS0 A;  2LOZ A;  1MKE A;  5DIF B;  4CHJ A;  1U5G A;  5D3Y A;  2RGN B;  1XOD A;  1EGX A;  4MY6 A;  1XCG A;  1H10 A;  2YRY A;  1TQZ A;  2CY4 A;  5C6R A;  2EMS A;  3MPX A;  3F0W A;  4HAY B;  1M7R A;  5DHA B;  3SUZ A;  2LUL A;  4CHM A;  2COF A;  5KQ4 A;  2BCJ A;  2L1C A;  1DRO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...