2ROVA

The split ph domain of rock ii
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
117
structure length
117
Chain Sequence
b'SRLEGWLSLPVRNNTKKFGWVKKYVIVSSKKILFYDSEQDKEQSNPYMVLDIDKLFHVRPVTQTDVYRADAKEIPRIFQILYANEGISSAKNLLLLANSTEEQQKWVSRLVKKIPKK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Rho-associated protein kinase 2
publication title The split PH domain of ROCK II
rcsb
source organism Rattus norvegicus
molecule tags Transferase
total genus 18
structure length 117
sequence length 117
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2008-04-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2rovA00
1N3HA 3OANA 4TKNA 1EAZA 3HK0A 1MKEA 1E5WA 4IAPA 2M14A 2N0YA 2I1KA 2XQNM 4DX8A 1MIXA 2DKPA 3F0WA 1KZGA 2VRWB 2LKOA 4HDQA 3D8FA 4GMVA 3U7DA 3TFMA 5LONB 4GZUA 3P6AA 1BWNA 3PP2A 2DLWA 4K17A 4A6KA 1UPQA 1WGUA 5J3QA 2J0JA 4EKUA 5DIFB 1V61A 3LJUX 4HAYB 2M38A 1WJMA 2VSZA 2DHKA 2D9YA 1P5TA 5C5BB 2DN6A 4TYZA 2UZRA 1OY2A 1P3RA 1Q67A 3MPXA 4IFSA 3SYXA 3SNHA 2W2XC 1K5GB 2GCJA 4KHBB 3QIJA 3TCAA 1WVHA 1U2BA 1RJ2A 2L1CA 1DROA 1GC6A 2RSGA 1NTYA 1X05A 3X23A 2I1JA 2YRYA 4DX90 1KZ7A 2GCLA 2ROZB 4NY0A 1TJ6A 4WSFA 4HAUB 1DDMA 2DHIA 5FI1A 3SV1A 4Z2MB 4NSWA 2LOXA 2KCJA 1LB1A 1FHXA 1BAKA 2E2XA 4DBBA 1BTKA 2DKQA 2EMTA 2HE7A 4CYEA 1W1GA 1GC7A 4MT7A 2RVBB 1IRSA 1U29A 2EJ8A 1SGHA 1U27A 3FM8C 4D0NB 5HE0A 3HQCA 1FB8A 5DHAB 3KZ1A 3G9WA 1I2HA 4MK0A 1TQZA 2JP2A 5HE1A 2LG1A 3IVFA 5KQ4A 3D8EA 1WGQA 1EF1A 2DX5A 4HB4B 2IYBA 1QQGA 2L2IA 2CAYA 1V89A 4Z2NA 2VKIA 2AEHA 2YT1A 4IOYX 2EC1A 2Y8GA 1AQCA 2P0HA 1H10A 5L81A 3BINA 4F7HA 3F5RA 4HB3B 2DFKA 1P6SA 2P0FA 4ZRJA 1I7AA 4DXAB 2J0KA 1XCGA 5JLJB 2CODA 2D11A 2K2UA 1U5EA 3V5WA 1NTVA 4GXBA 2D2QA 2OQBA 5DH9B 4HDOA 3KSYA 1TXDA 3D8DA 2J59M 2YS5A 1Z87A 3KRWA 4CHMA 4A6FA 1MIZB 2HTHB 4BBKA 1NU2A 2D9XA 4F7GA 1B55A 2GJYA 2CY5A 4K2PA 2DTCA 3P7ZA 2RLOA 5D3VA 5D3YA 4F7UP 2W2XD 4WVFB 1EVHA 2DYQA 5DHFB 1PLSA 3PZDA 4HATB 1V5UA 1X1FA 2COAA 4YL8A 2N23A 1ISNA 5D3XA 2RUKB 1ZSQA 2K00A 1ZC4B 2ADZA 2YS3A 2QKMA 3PG7A 5D27A 2D9ZA 1GG3A 4PQ0A 2H7EA 3N7CA 4B6HA 2H7DA 2LYDA 2R09A 2DA0A 5J3YA 1W1HA 5HE2A 5EFXA 3RCPA 1ZC3B 4PNKA 2MWNB 2G35A 3FEHA 3ZVRA 5CLLB 1V5PA 3AU5A 2LOZA 2BCJA 2D9WA 1FHWA 4YONA 3ZDTA 2YT0A 2Z0PA 4WJ7A 3ODXA 4XWXA 4KHOA 3SO6A 2YF0A 2R0DA 1U5DA 1U5FA 4A6HA 1UNQA 1XD4A 2OTXA 3KRXA 4H8SA 1DYNA 2MKRA 3O96A 1MPHA 1X1GA 1MK9B 1UNPA 1V88A 4MY6A 4P7IA 1K5DB 4HAWB 3NSUA 4GN1A 2YS1A 2PZ1A 2V76A 3SUZA 4L6EA 2IFSA 2I5CA 5DI9B 3DXEA 2KGXB 1OMWA 3VIAA 2DYNA 1AWEA 1SHCA 1DBHA 1DDWA 1X86A 1M7RA 4HAXB 2Y8FA 1X11A 4K81A 3WA0A 5C16A 5LOPB 2MFQA 2NZ8B 3ML4A 4EJNA 1FHOA 4HAZB 2COFA 2W2WA 3UZTA 1QC6A 1UPRA 2QKLA 2D10A 3VOQA 4GPTB 1NI2A 3TW1A 3DXCA 1FOEA 1WJ1A 4A5KA 1XKEA 4HAVB 5C6RA 2I5FA 2Q13A 1PFJA 1WI1A 1J0WA 5C5BA 2K2JA 3WYFB 1EGXA 2CRFA 5GOWB 2P0DA 3PVLA 2YVCA 3PVWA 2UZSA 5J3TA 3PVUA 3QBVB 5HE3A 1W1DA 3ULCA 2UVMA 4A6FB 3AU4A 1MK7B 2CY4A 1XX0A 4HB0B 3ODWA 2EMSA 3CIKA 2MDXA 2Z0OA 3A98B 2X18A 2Z0QA 1LW3A 1H4RA 3TVVA 2DX1A 2ELAA 2ZPYA 3TO1A 2NMBA 3AJ4A 2D4QA 3GYOA 4EMOA 2AL6A 2ELBA 5KQ1A 4Y94A 4ZRIA 2ROVA 4HB2B 5CLQB 2FJLA 4ZRKA 3T06A 4CHJA 1ZM0A 3BJIA 2LULA 1FGYA 1XR0B 2GS0A 3PEGA 3MDBC 3M1IB 4KAXB 1FGZA 5JP4A 3CXBB 5KCVA 1UEFA 3ODOA 5C79A 2P8VA 3FSSA 2RNRB 1WG7A 3DXDA 2KUPA 1UNRA 5D3WA 1FAOA 4K2OA 1V5MA 1XODA 1Y5OA 1ZVRA 1MAIA 4KHAA 1OQNA 2DHJA 5JHHA 1M7EA 3A8QA 1PMSA 4GMXB 2Y7BA 5JHGA 2RGNB 2YSZA 3U8ZA 4C0AA 1Y19B 3KY9A 1KI1B 3PSCA 1BTNA 4KVGB 5FI0A 3HW2B 2J0MA 1RRPB 3ULBA 1J19A 3GYPA 3QWMA 2COCA 2D9VA 4HHVA 3A8PA 1U5GA 1DDVA
chains in the Genus database with same CATH superfamily
1N3HA 3OANA 4TKNA 1EAZA 2Z4DA 3HK0A 1MKEA 1E5WA 4IAPA 2M14A 2N0YA 2I1KA 2XQNM 2NBVA 4DX8A 1MIXA 2DKPA 3F0WA 1KZGA 2Z14A 2VRWB 2LKOA 4HDQA 3D8FA 4GMVA 3U7DA 3TFMA 5LONB 4GZUA 3P6AA 1BWNA 3PP2A 4HSIA 2DLWA 4K17A 4A6KA 1UPQA 1WGUA 5J3QA 2J0JA 4EKUA 5DIFB 1V61A 3LJUX 4HAYB 2M38A 1WJMA 2VSZA 2DHKA 2D9YA 1P5TA 5C5BB 2DN6A 4TYZA 2UZRA 1OY2A 1P3RA 1Q67A 2RRFA 3MPXA 4IFSA 3SYXA 3SNHA 2W2XC 1K5GB 2GCJA 4KHBB 3QIJA 3TCAA 1WVHA 1U2BA 1RJ2A 2L1CA 1DROA 1GC6A 2RSGA 1NTYA 1X05A 3X23A 2I1JA 2YRYA 4DX90 1KZ7A 4D6WA 3U12A 2GCLA 2ROZB 4NY0A 1TJ6A 1MI1A 2Z59A 4HAUB 4WSFA 1DDMA 2DHIA 5FI1A 3SV1A 4Z2MB 4NSWA 2LOXA 2KCJA 4DIXA 1LB1A 1FHXA 1BAKA 2E2XA 4DBBA 1BTKA 2DKQA 2EMTA 3NWDA 2HE7A 4CYEA 1W1GA 1GC7A 4MT7A 2RVBB 1IRSA 1U29A 2EJ8A 1SGHA 1U27A 3FM8C 4D0NB 5HE0A 3HQCA 1FB8A 4QXAB 5DHAB 3KZ1A 3G9WA 1I2HA 4MK0A 1TQZA 4QJ3B 2JP2A 5HE1A 2LG1A 3IVFA 5KQ4A 3D8EA 1WGQA 1EF1A 2DX5A 4HB4B 2IYBA 1QQGA 3HSAA 2L2IA 2CAYA 1V89A 4Z2NA 2VKIA 2AEHA 2YT1A 4IOYX 2EC1A 2Y8GA 1AQCA 2P0HA 1H10A 5L81A 2KIEA 4QJ5B 3BINA 4F7HA 3F5RA 4HB3B 2DFKA 1P6SA 2P0FA 4ZRJA 1I7AA 4DXAB 2J0KA 1XCGA 5JLJB 2CODA 2D11A 2K2UA 1U5EA 3V5WA 1NTVA 4GXBA 2D2QA 2OQBA 5DH9B 4HDOA 3KSYA 2YT2A 1TXDA 3D8DA 2J59M 2K8EA 2YS5A 1Z87A 3KRWA 4CHMA 4A6FA 2ZKMX 1MIZB 2HTHB 4BBKA 1NU2A 2D9XA 4F7GA 1B55A 2GJYA 2CY5A 4K2PA 2DTCA 3P7ZA 4GNKB 2RLOA 5D3VA 5D3YA 4F7UP 2W2XD 4OSNA 3B77A 4WVFB 1EVHA 2DYQA 5DHFB 1PLSA 3PZDA 4HATB 1V5UA 1X1FA 2COAA 4YL8A 2N23A 1ISNA 3HIEA 5D3XA 2RUKB 2Z13A 1ZSQA 2K00A 1ZC4B 2ADZA 2YS3A 2QKMA 3PG7A 5D27A 2D9ZA 1GG3A 4PQ0A 5I2SA 2H7EA 3N7CA 4B6HA 2H7DA 2KIGA 2LYDA 2R09A 3OHMB 2DA0A 5J3YA 1W1HA 5HE2A 5EFXA 3RCPA 1ZC3B 3NW8A 4PNKA 2MWNB 2G35A 3FEHA 1T77A 3ZVRA 5CLLB 2KR0A 1V5PA 3AU5A 2LOZA 2BCJA 2D9WA 1FHWA 4YONA 3ZDTA 2YT0A 2Z0PA 4WJ7A 3ODXA 4XWXA 4KHOA 3SO6A 2YF0A 4QJ4B 2R0DA 5M4YB 1U5DA 1U5FA 4A6HA 1UNQA 1XD4A 2OTXA 3KRXA 4H8SA 1DYNA 2MKRA 3O96A 1MPHA 1X1GA 1MK9B 1UNPA 1V88A 4MY6A 5IRSA 4P7IA 1K5DB 4HAWB 3NSUA 4GN1A 2YS1A 2PZ1A 2V76A 3SUZA 4L6EA 2GUMA 2IFSA 2I5CA 5DI9B 3DXEA 2KGXB 4GOUA 1OMWA 3VIAA 2DYNA 1AWEA 1SHCA 1DBHA 1DDWA 1X86A 1M7RA 4HAXB 2Y8FA 1X11A 4K81A 3WA0A 5C16A 5LOPB 2MFQA 2NZ8B 3ML4A 4EJNA 1FHOA 4HAZB 2FJUB 2COFA 2W2WA 3UZTA 1QC6A 5I2MA 1UPRA 2QKLA 2D10A 3VOQA 4GPTB 1NI2A 3TW1A 3DXCA 1FOEA 2KUQA 1WJ1A 4A5KA 1XKEA 4HAVB 1ZYIA 5C6RA 2I5FA 3NWAA 2Q13A 1PFJA 1WI1A 1J0WA 5C5BA 2K2JA 3WYFB 1EGXA 2CRFA 5GOWB 5LG4B 2P0DA 3PVLA 2YVCA 3PVWA 2UZSA 5J3TA 4KHBA 3FVCA 3PVUA 3QBVB 5HE3A 1W1DA 4L1RA 3ULCA 2UVMA 4A6FB 3AU4A 1MK7B 2CY4A 4CSQA 4OT1A 1XX0A 4HB0B 3NWFA 3ODWA 2EMSA 3CIKA 2MDXA 2Z0OA 3A98B 2X18A 2Z0QA 1LW3A 1H4RA 3TVVA 2DX1A 2ELAA 2ZPYA 3TO1A 2NMBA 3AJ4A 2D4QA 3GYOA 4EMOA 2AL6A 2ELBA 5KQ1A 4Y94A 4ZRIA 2ROVA 4HB2B 5CLQB 2FJLA 4ZRKA 3T06A 4CHJA 1ZM0A 3BJIA 2LULA 1FGYA 1XR0B 2GS0A 3PEGA 3MDBC 3M1IB 4KAXB 1FGZA 5JP4A 3CXBB 5KCVA 1UEFA 3ODOA 5C79A 2P8VA 3FSSA 2RNRB 1WG7A 3DXDA 2KUPA 1UNRA 5D3WA 1FAOA 2R2YA 4K2OA 1V5MA 1XODA 1Y5OA 2K49A 1ZVRA 1MAIA 4KHAA 1OQNA 2DHJA 5JHHA 1M7EA 3A8QA 1PMSA 4GMXB 2Y7BA 5JHGA 2RGNB 2YSZA 3DCXA 3U8ZA 4C0AA 1Y19B 3KY9A 1KI1B 3A58A 3PSCA 1BTNA 4KVGB 5FI0A 3HW2B 2J0MA 1RRPB 3ULBA 1J19A 3GYPA 3QWMA 2COCA 2D9VA 4HHVA 3A8PA 1U5GA 1DDVA
chains in the Genus database with same CATH topology
1N3HA 3OANA 4TKNA 1EAZA 3HK0A 1MKEA 1E5WA 4IAPA 2M14A 2N0YA 2I1KA 2XQNM 4DX8A 1MIXA 2DKPA 3F0WA 1KZGA 2VRWB 2LKOA 4HDQA 3D8FA 4GMVA 3U7DA 3TFMA 5LONB 4GZUA 3P6AA 1BWNA 3PP2A 2DLWA 4K17A 4A6KA 1UPQA 1WGUA 5J3QA 2J0JA 4EKUA 5DIFB 1V61A 3LJUX 4HAYB 2M38A 1WJMA 2VSZA 2DHKA 2D9YA 1P5TA 5C5BB 2DN6A 4TYZA 2UZRA 1OY2A 1P3RA 1Q67A 3MPXA 4IFSA 3SYXA 3SNHA 2W2XC 1K5GB 2GCJA 4KHBB 3QIJA 3TCAA 1WVHA 1U2BA 1RJ2A 2L1CA 1DROA 1GC6A 2RSGA 1NTYA 1X05A 3X23A 2I1JA 2YRYA 4DX90 1KZ7A 2GCLA 2ROZB 4NY0A 1TJ6A 4WSFA 4HAUB 1DDMA 2DHIA 5FI1A 3SV1A 4Z2MB 4NSWA 2LOXA 2KCJA 1LB1A 1FHXA 1BAKA 2E2XA 4DBBA 1BTKA 2DKQA 2EMTA 2HE7A 4CYEA 1W1GA 1GC7A 4MT7A 2RVBB 1IRSA 1U29A 2EJ8A 1SGHA 1U27A 3FM8C 4D0NB 5HE0A 3HQCA 1FB8A 5DHAB 3KZ1A 3G9WA 1I2HA 4MK0A 1TQZA 2JP2A 5HE1A 2LG1A 3IVFA 5KQ4A 3D8EA 1WGQA 1EF1A 2DX5A 4HB4B 2IYBA 1QQGA 2L2IA 2CAYA 1V89A 4Z2NA 2VKIA 2AEHA 2YT1A 4IOYX 2EC1A 2Y8GA 1AQCA 2P0HA 1H10A 5L81A 3BINA 4F7HA 3F5RA 4HB3B 2DFKA 1P6SA 2P0FA 4ZRJA 1I7AA 4DXAB 2J0KA 1XCGA 5JLJB 2CODA 2D11A 2K2UA 1U5EA 3V5WA 1NTVA 4GXBA 2D2QA 2OQBA 5DH9B 4HDOA 3KSYA 1TXDA 3D8DA 2J59M 2YS5A 1Z87A 3KRWA 4CHMA 4A6FA 1MIZB 2HTHB 4BBKA 1NU2A 2D9XA 4F7GA 1B55A 2GJYA 2CY5A 4K2PA 2DTCA 3P7ZA 2RLOA 5D3VA 5D3YA 4F7UP 2W2XD 4WVFB 1EVHA 2DYQA 5DHFB 1PLSA 3PZDA 4HATB 1V5UA 1X1FA 2COAA 4YL8A 2N23A 1ISNA 5D3XA 2RUKB 1ZSQA 2K00A 1ZC4B 2ADZA 2YS3A 2QKMA 3PG7A 5D27A 2D9ZA 1GG3A 4PQ0A 2H7EA 3N7CA 4B6HA 2H7DA 2LYDA 2R09A 2DA0A 5J3YA 1W1HA 5HE2A 5EFXA 3RCPA 1ZC3B 4PNKA 2MWNB 2G35A 3FEHA 3ZVRA 5CLLB 1V5PA 3AU5A 2LOZA 2BCJA 2D9WA 1FHWA 4YONA 3ZDTA 2YT0A 2Z0PA 4WJ7A 3ODXA 4XWXA 4KHOA 3SO6A 2YF0A 2R0DA 1U5DA 1U5FA 4A6HA 1UNQA 1XD4A 2OTXA 3KRXA 4H8SA 1DYNA 2MKRA 3O96A 1MPHA 1X1GA 1MK9B 1UNPA 1V88A 4MY6A 4P7IA 1K5DB 4HAWB 3NSUA 4GN1A 2YS1A 2PZ1A 2V76A 3SUZA 4L6EA 2IFSA 2I5CA 5DI9B 3DXEA 2KGXB 1OMWA 3VIAA 2DYNA 1AWEA 1SHCA 1DBHA 1DDWA 1X86A 1M7RA 4HAXB 2Y8FA 1X11A 4K81A 3WA0A 5C16A 5LOPB 2MFQA 2NZ8B 3ML4A 4EJNA 1FHOA 4HAZB 2COFA 2W2WA 3UZTA 1QC6A 1UPRA 2QKLA 2D10A 3VOQA 4GPTB 1NI2A 3TW1A 3DXCA 1FOEA 1WJ1A 4A5KA 1XKEA 4HAVB 5C6RA 2I5FA 2Q13A 1PFJA 1WI1A 1J0WA 5C5BA 2K2JA 3WYFB 1EGXA 2CRFA 5GOWB 2P0DA 3PVLA 2YVCA 3PVWA 2UZSA 5J3TA 3PVUA 3QBVB 5HE3A 1W1DA 3ULCA 2UVMA 4A6FB 3AU4A 1MK7B 2CY4A 1XX0A 4HB0B 3ODWA 2EMSA 3CIKA 2MDXA 2Z0OA 3A98B 2X18A 2Z0QA 1LW3A 1H4RA 3TVVA 2DX1A 2ELAA 2ZPYA 3TO1A 2NMBA 3AJ4A 2D4QA 3GYOA 4EMOA 2AL6A 2ELBA 5KQ1A 4Y94A 4ZRIA 2ROVA 4HB2B 5CLQB 2FJLA 4ZRKA 3T06A 4CHJA 1ZM0A 3BJIA 2LULA 1FGYA 1XR0B 2GS0A 3PEGA 3MDBC 3M1IB 4KAXB 1FGZA 5JP4A 3CXBB 5KCVA 1UEFA 3ODOA 5C79A 2P8VA 3FSSA 2RNRB 1WG7A 3DXDA 2KUPA 1UNRA 5D3WA 1FAOA 4K2OA 1V5MA 1XODA 1Y5OA 1ZVRA 1MAIA 4KHAA 1OQNA 2DHJA 5JHHA 1M7EA 3A8QA 1PMSA 4GMXB 2Y7BA 5JHGA 2RGNB 2YSZA 3U8ZA 4C0AA 1Y19B 3KY9A 1KI1B 3PSCA 1BTNA 4KVGB 5FI0A 3HW2B 2J0MA 1RRPB 3ULBA 1J19A 3GYPA 3QWMA 2COCA 2D9VA 4HHVA 3A8PA 1U5GA 1DDVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N3H A;  3OAN A;  4TKN A;  1EAZ A;  3HK0 A;  1MKE A;  1E5W A;  4IAP A;  2M14 A;  2N0Y A;  2I1K A;  2XQN M;  4DX8 A;  1MIX A;  2DKP A;  3F0W A;  1KZG A;  2VRW B;  2LKO A;  4HDQ A;  3D8F A;  4GMV A;  3U7D A;  3TFM A;  5LON B;  4GZU A;  3P6A A;  1BWN A;  3PP2 A;  2DLW A;  4K17 A;  4A6K A;  1UPQ A;  1WGU A;  5J3Q A;  2J0J A;  4EKU A;  5DIF B;  1V61 A;  3LJU X;  4HAY B;  2M38 A;  1WJM A;  2VSZ A;  2DHK A;  2D9Y A;  1P5T A;  5C5B B;  2DN6 A;  4TYZ A;  2UZR A;  1OY2 A;  1P3R A;  1Q67 A;  3MPX A;  4IFS A;  3SYX A;  3SNH A;  2W2X C;  1K5G B;  2GCJ A;  4KHB B;  3QIJ A;  3TCA A;  1WVH A;  1U2B A;  1RJ2 A;  2L1C A;  1DRO A;  1GC6 A;  2RSG A;  1NTY A;  1X05 A;  3X23 A;  2I1J A;  2YRY A;  4DX9 0;  1KZ7 A;  2GCL A;  2ROZ B;  4NY0 A;  1TJ6 A;  4WSF A;  4HAU B;  1DDM A;  2DHI A;  5FI1 A;  3SV1 A;  4Z2M B;  4NSW A;  2LOX A;  2KCJ A;  1LB1 A;  1FHX A;  1BAK A;  2E2X A;  4DBB A;  1BTK A;  2DKQ A;  2EMT A;  2HE7 A;  4CYE A;  1W1G A;  1GC7 A;  4MT7 A;  2RVB B;  1IRS A;  1U29 A;  2EJ8 A;  1SGH A;  1U27 A;  3FM8 C;  4D0N B;  5HE0 A;  3HQC A;  1FB8 A;  5DHA B;  3KZ1 A;  3G9W A;  1I2H A;  4MK0 A;  1TQZ A;  2JP2 A;  5HE1 A;  2LG1 A;  3IVF A;  5KQ4 A;  3D8E A;  1WGQ A;  1EF1 A;  2DX5 A;  4HB4 B;  2IYB A;  1QQG A;  2L2I A;  2CAY A;  1V89 A;  4Z2N A;  2VKI A;  2AEH A;  2YT1 A;  4IOY X;  2EC1 A;  2Y8G A;  1AQC A;  2P0H A;  1H10 A;  5L81 A;  3BIN A;  4F7H A;  3F5R A;  4HB3 B;  2DFK A;  1P6S A;  2P0F A;  4ZRJ A;  1I7A A;  4DXA B;  2J0K A;  1XCG A;  5JLJ B;  2COD A;  2D11 A;  2K2U A;  1U5E A;  3V5W A;  1NTV A;  4GXB A;  2D2Q A;  2OQB A;  5DH9 B;  4HDO A;  3KSY A;  1TXD A;  3D8D A;  2J59 M;  2YS5 A;  1Z87 A;  3KRW A;  4CHM A;  4A6F A;  1MIZ B;  2HTH B;  4BBK A;  1NU2 A;  2D9X A;  4F7G A;  1B55 A;  2GJY A;  2CY5 A;  4K2P A;  2DTC A;  3P7Z A;  2RLO A;  5D3V A;  5D3Y A;  4F7U P;  2W2X D;  4WVF B;  1EVH A;  2DYQ A;  5DHF B;  1PLS A;  3PZD A;  4HAT B;  1V5U A;  1X1F A;  2COA A;  4YL8 A;  2N23 A;  1ISN A;  5D3X A;  2RUK B;  1ZSQ A;  2K00 A;  1ZC4 B;  2ADZ A;  2YS3 A;  2QKM A;  3PG7 A;  5D27 A;  2D9Z A;  1GG3 A;  4PQ0 A;  2H7E A;  3N7C A;  4B6H A;  2H7D A;  2LYD A;  2R09 A;  2DA0 A;  5J3Y A;  1W1H A;  5HE2 A;  5EFX A;  3RCP A;  1ZC3 B;  4PNK A;  2MWN B;  2G35 A;  3FEH A;  3ZVR A;  5CLL B;  1V5P A;  3AU5 A;  2LOZ A;  2BCJ A;  2D9W A;  1FHW A;  4YON A;  3ZDT A;  2YT0 A;  2Z0P A;  4WJ7 A;  3ODX A;  4XWX A;  4KHO A;  3SO6 A;  2YF0 A;  2R0D A;  1U5D A;  1U5F A;  4A6H A;  1UNQ A;  1XD4 A;  2OTX A;  3KRX A;  4H8S A;  1DYN A;  2MKR A;  3O96 A;  1MPH A;  1X1G A;  1MK9 B;  1UNP A;  1V88 A;  4MY6 A;  4P7I A;  1K5D B;  4HAW B;  3NSU A;  4GN1 A;  2YS1 A;  2PZ1 A;  2V76 A;  3SUZ A;  4L6E A;  2IFS A;  2I5C A;  5DI9 B;  3DXE A;  2KGX B;  1OMW A;  3VIA A;  2DYN A;  1AWE A;  1SHC A;  1DBH A;  1DDW A;  1X86 A;  1M7R A;  4HAX B;  2Y8F A;  1X11 A;  4K81 A;  3WA0 A;  5C16 A;  5LOP B;  2MFQ A;  2NZ8 B;  3ML4 A;  4EJN A;  1FHO A;  4HAZ B;  2COF A;  2W2W A;  3UZT A;  1QC6 A;  1UPR A;  2QKL A;  2D10 A;  3VOQ A;  4GPT B;  1NI2 A;  3TW1 A;  3DXC A;  1FOE A;  1WJ1 A;  4A5K A;  1XKE A;  4HAV B;  5C6R A;  2I5F A;  2Q13 A;  1PFJ A;  1WI1 A;  1J0W A;  5C5B A;  2K2J A;  3WYF B;  1EGX A;  2CRF A;  5GOW B;  2P0D A;  3PVL A;  2YVC A;  3PVW A;  2UZS A;  5J3T A;  3PVU A;  3QBV B;  5HE3 A;  1W1D A;  3ULC A;  2UVM A;  4A6F B;  3AU4 A;  1MK7 B;  2CY4 A;  1XX0 A;  4HB0 B;  3ODW A;  2EMS A;  3CIK A;  2MDX A;  2Z0O A;  3A98 B;  2X18 A;  2Z0Q A;  1LW3 A;  1H4R A;  3TVV A;  2DX1 A;  2ELA A;  2ZPY A;  3TO1 A;  2NMB A;  3AJ4 A;  2D4Q A;  3GYO A;  4EMO A;  2AL6 A;  2ELB A;  5KQ1 A;  4Y94 A;  4ZRI A;  2ROV A;  4HB2 B;  5CLQ B;  2FJL A;  4ZRK A;  3T06 A;  4CHJ A;  1ZM0 A;  3BJI A;  2LUL A;  1FGY A;  1XR0 B;  2GS0 A;  3PEG A;  3MDB C;  3M1I B;  4KAX B;  1FGZ A;  5JP4 A;  3CXB B;  5KCV A;  1UEF A;  3ODO A;  5C79 A;  2P8V A;  3FSS A;  2RNR B;  1WG7 A;  3DXD A;  2KUP A;  1UNR A;  5D3W A;  1FAO A;  4K2O A;  1V5M A;  1XOD A;  1Y5O A;  1ZVR A;  1MAI A;  4KHA A;  1OQN A;  2DHJ A;  5JHH A;  1M7E A;  3A8Q A;  1PMS A;  4GMX B;  2Y7B A;  5JHG A;  2RGN B;  2YSZ A;  3U8Z A;  4C0A A;  1Y19 B;  3KY9 A;  1KI1 B;  3PSC A;  1BTN A;  4KVG B;  5FI0 A;  3HW2 B;  2J0M A;  1RRP B;  3ULB A;  1J19 A;  3GYP A;  3QWM A;  2COC A;  2D9V A;  4HHV A;  3A8P A;  1U5G A;  1DDV A; 
#chains in the Genus database with same CATH topology
 1N3H A;  3OAN A;  4TKN A;  1EAZ A;  2Z4D A;  3HK0 A;  1MKE A;  1E5W A;  4IAP A;  2M14 A;  2N0Y A;  2I1K A;  2XQN M;  2NBV A;  4DX8 A;  1MIX A;  2DKP A;  3F0W A;  1KZG A;  2Z14 A;  2VRW B;  2LKO A;  4HDQ A;  3D8F A;  4GMV A;  3U7D A;  3TFM A;  5LON B;  4GZU A;  3P6A A;  1BWN A;  3PP2 A;  4HSI A;  2DLW A;  4K17 A;  4A6K A;  1UPQ A;  1WGU A;  5J3Q A;  2J0J A;  4EKU A;  5DIF B;  1V61 A;  3LJU X;  4HAY B;  2M38 A;  1WJM A;  2VSZ A;  2DHK A;  2D9Y A;  1P5T A;  5C5B B;  2DN6 A;  4TYZ A;  2UZR A;  1OY2 A;  1P3R A;  1Q67 A;  2RRF A;  3MPX A;  4IFS A;  3SYX A;  3SNH A;  2W2X C;  1K5G B;  2GCJ A;  4KHB B;  3QIJ A;  3TCA A;  1WVH A;  1U2B A;  1RJ2 A;  2L1C A;  1DRO A;  1GC6 A;  2RSG A;  1NTY A;  1X05 A;  3X23 A;  2I1J A;  2YRY A;  4DX9 0;  1KZ7 A;  4D6W A;  3U12 A;  2GCL A;  2ROZ B;  4NY0 A;  1TJ6 A;  1MI1 A;  2Z59 A;  4HAU B;  4WSF A;  1DDM A;  2DHI A;  5FI1 A;  3SV1 A;  4Z2M B;  4NSW A;  2LOX A;  2KCJ A;  4DIX A;  1LB1 A;  1FHX A;  1BAK A;  2E2X A;  4DBB A;  1BTK A;  2DKQ A;  2EMT A;  3NWD A;  2HE7 A;  4CYE A;  1W1G A;  1GC7 A;  4MT7 A;  2RVB B;  1IRS A;  1U29 A;  2EJ8 A;  1SGH A;  1U27 A;  3FM8 C;  4D0N B;  5HE0 A;  3HQC A;  1FB8 A;  4QXA B;  5DHA B;  3KZ1 A;  3G9W A;  1I2H A;  4MK0 A;  1TQZ A;  4QJ3 B;  2JP2 A;  5HE1 A;  2LG1 A;  3IVF A;  5KQ4 A;  3D8E A;  1WGQ A;  1EF1 A;  2DX5 A;  4HB4 B;  2IYB A;  1QQG A;  3HSA A;  2L2I A;  2CAY A;  1V89 A;  4Z2N A;  2VKI A;  2AEH A;  2YT1 A;  4IOY X;  2EC1 A;  2Y8G A;  1AQC A;  2P0H A;  1H10 A;  5L81 A;  2KIE A;  4QJ5 B;  3BIN A;  4F7H A;  3F5R A;  4HB3 B;  2DFK A;  1P6S A;  2P0F A;  4ZRJ A;  1I7A A;  4DXA B;  2J0K A;  1XCG A;  5JLJ B;  2COD A;  2D11 A;  2K2U A;  1U5E A;  3V5W A;  1NTV A;  4GXB A;  2D2Q A;  2OQB A;  5DH9 B;  4HDO A;  3KSY A;  2YT2 A;  1TXD A;  3D8D A;  2J59 M;  2K8E A;  2YS5 A;  1Z87 A;  3KRW A;  4CHM A;  4A6F A;  2ZKM X;  1MIZ B;  2HTH B;  4BBK A;  1NU2 A;  2D9X A;  4F7G A;  1B55 A;  2GJY A;  2CY5 A;  4K2P A;  2DTC A;  3P7Z A;  4GNK B;  2RLO A;  5D3V A;  5D3Y A;  4F7U P;  2W2X D;  4OSN A;  3B77 A;  4WVF B;  1EVH A;  2DYQ A;  5DHF B;  1PLS A;  3PZD A;  4HAT B;  1V5U A;  1X1F A;  2COA A;  4YL8 A;  2N23 A;  1ISN A;  3HIE A;  5D3X A;  2RUK B;  2Z13 A;  1ZSQ A;  2K00 A;  1ZC4 B;  2ADZ A;  2YS3 A;  2QKM A;  3PG7 A;  5D27 A;  2D9Z A;  1GG3 A;  4PQ0 A;  5I2S A;  2H7E A;  3N7C A;  4B6H A;  2H7D A;  2KIG A;  2LYD A;  2R09 A;  3OHM B;  2DA0 A;  5J3Y A;  1W1H A;  5HE2 A;  5EFX A;  3RCP A;  1ZC3 B;  3NW8 A;  4PNK A;  2MWN B;  2G35 A;  3FEH A;  1T77 A;  3ZVR A;  5CLL B;  2KR0 A;  1V5P A;  3AU5 A;  2LOZ A;  2BCJ A;  2D9W A;  1FHW A;  4YON A;  3ZDT A;  2YT0 A;  2Z0P A;  4WJ7 A;  3ODX A;  4XWX A;  4KHO A;  3SO6 A;  2YF0 A;  4QJ4 B;  2R0D A;  5M4Y B;  1U5D A;  1U5F A;  4A6H A;  1UNQ A;  1XD4 A;  2OTX A;  3KRX A;  4H8S A;  1DYN A;  2MKR A;  3O96 A;  1MPH A;  1X1G A;  1MK9 B;  1UNP A;  1V88 A;  4MY6 A;  5IRS A;  4P7I A;  1K5D B;  4HAW B;  3NSU A;  4GN1 A;  2YS1 A;  2PZ1 A;  2V76 A;  3SUZ A;  4L6E A;  2GUM A;  2IFS A;  2I5C A;  5DI9 B;  3DXE A;  2KGX B;  4GOU A;  1OMW A;  3VIA A;  2DYN A;  1AWE A;  1SHC A;  1DBH A;  1DDW A;  1X86 A;  1M7R A;  4HAX B;  2Y8F A;  1X11 A;  4K81 A;  3WA0 A;  5C16 A;  5LOP B;  2MFQ A;  2NZ8 B;  3ML4 A;  4EJN A;  1FHO A;  4HAZ B;  2FJU B;  2COF A;  2W2W A;  3UZT A;  1QC6 A;  5I2M A;  1UPR A;  2QKL A;  2D10 A;  3VOQ A;  4GPT B;  1NI2 A;  3TW1 A;  3DXC A;  1FOE A;  2KUQ A;  1WJ1 A;  4A5K A;  1XKE A;  4HAV B;  1ZYI A;  5C6R A;  2I5F A;  3NWA A;  2Q13 A;  1PFJ A;  1WI1 A;  1J0W A;  5C5B A;  2K2J A;  3WYF B;  1EGX A;  2CRF A;  5GOW B;  5LG4 B;  2P0D A;  3PVL A;  2YVC A;  3PVW A;  2UZS A;  5J3T A;  4KHB A;  3FVC A;  3PVU A;  3QBV B;  5HE3 A;  1W1D A;  4L1R A;  3ULC A;  2UVM A;  4A6F B;  3AU4 A;  1MK7 B;  2CY4 A;  4CSQ A;  4OT1 A;  1XX0 A;  4HB0 B;  3NWF A;  3ODW A;  2EMS A;  3CIK A;  2MDX A;  2Z0O A;  3A98 B;  2X18 A;  2Z0Q A;  1LW3 A;  1H4R A;  3TVV A;  2DX1 A;  2ELA A;  2ZPY A;  3TO1 A;  2NMB A;  3AJ4 A;  2D4Q A;  3GYO A;  4EMO A;  2AL6 A;  2ELB A;  5KQ1 A;  4Y94 A;  4ZRI A;  2ROV A;  4HB2 B;  5CLQ B;  2FJL A;  4ZRK A;  3T06 A;  4CHJ A;  1ZM0 A;  3BJI A;  2LUL A;  1FGY A;  1XR0 B;  2GS0 A;  3PEG A;  3MDB C;  3M1I B;  4KAX B;  1FGZ A;  5JP4 A;  3CXB B;  5KCV A;  1UEF A;  3ODO A;  5C79 A;  2P8V A;  3FSS A;  2RNR B;  1WG7 A;  3DXD A;  2KUP A;  1UNR A;  5D3W A;  1FAO A;  2R2Y A;  4K2O A;  1V5M A;  1XOD A;  1Y5O A;  2K49 A;  1ZVR A;  1MAI A;  4KHA A;  1OQN A;  2DHJ A;  5JHH A;  1M7E A;  3A8Q A;  1PMS A;  4GMX B;  2Y7B A;  5JHG A;  2RGN B;  2YSZ A;  3DCX A;  3U8Z A;  4C0A A;  1Y19 B;  3KY9 A;  1KI1 B;  3A58 A;  3PSC A;  1BTN A;  4KVG B;  5FI0 A;  3HW2 B;  2J0M A;  1RRP B;  3ULB A;  1J19 A;  3GYP A;  3QWM A;  2COC A;  2D9V A;  4HHV A;  3A8P A;  1U5G A;  1DDV A; 
#chains in the Genus database with same CATH homology
 1N3H A;  3OAN A;  4TKN A;  1EAZ A;  3HK0 A;  1MKE A;  1E5W A;  4IAP A;  2M14 A;  2N0Y A;  2I1K A;  2XQN M;  4DX8 A;  1MIX A;  2DKP A;  3F0W A;  1KZG A;  2VRW B;  2LKO A;  4HDQ A;  3D8F A;  4GMV A;  3U7D A;  3TFM A;  5LON B;  4GZU A;  3P6A A;  1BWN A;  3PP2 A;  2DLW A;  4K17 A;  4A6K A;  1UPQ A;  1WGU A;  5J3Q A;  2J0J A;  4EKU A;  5DIF B;  1V61 A;  3LJU X;  4HAY B;  2M38 A;  1WJM A;  2VSZ A;  2DHK A;  2D9Y A;  1P5T A;  5C5B B;  2DN6 A;  4TYZ A;  2UZR A;  1OY2 A;  1P3R A;  1Q67 A;  3MPX A;  4IFS A;  3SYX A;  3SNH A;  2W2X C;  1K5G B;  2GCJ A;  4KHB B;  3QIJ A;  3TCA A;  1WVH A;  1U2B A;  1RJ2 A;  2L1C A;  1DRO A;  1GC6 A;  2RSG A;  1NTY A;  1X05 A;  3X23 A;  2I1J A;  2YRY A;  4DX9 0;  1KZ7 A;  2GCL A;  2ROZ B;  4NY0 A;  1TJ6 A;  4WSF A;  4HAU B;  1DDM A;  2DHI A;  5FI1 A;  3SV1 A;  4Z2M B;  4NSW A;  2LOX A;  2KCJ A;  1LB1 A;  1FHX A;  1BAK A;  2E2X A;  4DBB A;  1BTK A;  2DKQ A;  2EMT A;  2HE7 A;  4CYE A;  1W1G A;  1GC7 A;  4MT7 A;  2RVB B;  1IRS A;  1U29 A;  2EJ8 A;  1SGH A;  1U27 A;  3FM8 C;  4D0N B;  5HE0 A;  3HQC A;  1FB8 A;  5DHA B;  3KZ1 A;  3G9W A;  1I2H A;  4MK0 A;  1TQZ A;  2JP2 A;  5HE1 A;  2LG1 A;  3IVF A;  5KQ4 A;  3D8E A;  1WGQ A;  1EF1 A;  2DX5 A;  4HB4 B;  2IYB A;  1QQG A;  2L2I A;  2CAY A;  1V89 A;  4Z2N A;  2VKI A;  2AEH A;  2YT1 A;  4IOY X;  2EC1 A;  2Y8G A;  1AQC A;  2P0H A;  1H10 A;  5L81 A;  3BIN A;  4F7H A;  3F5R A;  4HB3 B;  2DFK A;  1P6S A;  2P0F A;  4ZRJ A;  1I7A A;  4DXA B;  2J0K A;  1XCG A;  5JLJ B;  2COD A;  2D11 A;  2K2U A;  1U5E A;  3V5W A;  1NTV A;  4GXB A;  2D2Q A;  2OQB A;  5DH9 B;  4HDO A;  3KSY A;  1TXD A;  3D8D A;  2J59 M;  2YS5 A;  1Z87 A;  3KRW A;  4CHM A;  4A6F A;  1MIZ B;  2HTH B;  4BBK A;  1NU2 A;  2D9X A;  4F7G A;  1B55 A;  2GJY A;  2CY5 A;  4K2P A;  2DTC A;  3P7Z A;  2RLO A;  5D3V A;  5D3Y A;  4F7U P;  2W2X D;  4WVF B;  1EVH A;  2DYQ A;  5DHF B;  1PLS A;  3PZD A;  4HAT B;  1V5U A;  1X1F A;  2COA A;  4YL8 A;  2N23 A;  1ISN A;  5D3X A;  2RUK B;  1ZSQ A;  2K00 A;  1ZC4 B;  2ADZ A;  2YS3 A;  2QKM A;  3PG7 A;  5D27 A;  2D9Z A;  1GG3 A;  4PQ0 A;  2H7E A;  3N7C A;  4B6H A;  2H7D A;  2LYD A;  2R09 A;  2DA0 A;  5J3Y A;  1W1H A;  5HE2 A;  5EFX A;  3RCP A;  1ZC3 B;  4PNK A;  2MWN B;  2G35 A;  3FEH A;  3ZVR A;  5CLL B;  1V5P A;  3AU5 A;  2LOZ A;  2BCJ A;  2D9W A;  1FHW A;  4YON A;  3ZDT A;  2YT0 A;  2Z0P A;  4WJ7 A;  3ODX A;  4XWX A;  4KHO A;  3SO6 A;  2YF0 A;  2R0D A;  1U5D A;  1U5F A;  4A6H A;  1UNQ A;  1XD4 A;  2OTX A;  3KRX A;  4H8S A;  1DYN A;  2MKR A;  3O96 A;  1MPH A;  1X1G A;  1MK9 B;  1UNP A;  1V88 A;  4MY6 A;  4P7I A;  1K5D B;  4HAW B;  3NSU A;  4GN1 A;  2YS1 A;  2PZ1 A;  2V76 A;  3SUZ A;  4L6E A;  2IFS A;  2I5C A;  5DI9 B;  3DXE A;  2KGX B;  1OMW A;  3VIA A;  2DYN A;  1AWE A;  1SHC A;  1DBH A;  1DDW A;  1X86 A;  1M7R A;  4HAX B;  2Y8F A;  1X11 A;  4K81 A;  3WA0 A;  5C16 A;  5LOP B;  2MFQ A;  2NZ8 B;  3ML4 A;  4EJN A;  1FHO A;  4HAZ B;  2COF A;  2W2W A;  3UZT A;  1QC6 A;  1UPR A;  2QKL A;  2D10 A;  3VOQ A;  4GPT B;  1NI2 A;  3TW1 A;  3DXC A;  1FOE A;  1WJ1 A;  4A5K A;  1XKE A;  4HAV B;  5C6R A;  2I5F A;  2Q13 A;  1PFJ A;  1WI1 A;  1J0W A;  5C5B A;  2K2J A;  3WYF B;  1EGX A;  2CRF A;  5GOW B;  2P0D A;  3PVL A;  2YVC A;  3PVW A;  2UZS A;  5J3T A;  3PVU A;  3QBV B;  5HE3 A;  1W1D A;  3ULC A;  2UVM A;  4A6F B;  3AU4 A;  1MK7 B;  2CY4 A;  1XX0 A;  4HB0 B;  3ODW A;  2EMS A;  3CIK A;  2MDX A;  2Z0O A;  3A98 B;  2X18 A;  2Z0Q A;  1LW3 A;  1H4R A;  3TVV A;  2DX1 A;  2ELA A;  2ZPY A;  3TO1 A;  2NMB A;  3AJ4 A;  2D4Q A;  3GYO A;  4EMO A;  2AL6 A;  2ELB A;  5KQ1 A;  4Y94 A;  4ZRI A;  2ROV A;  4HB2 B;  5CLQ B;  2FJL A;  4ZRK A;  3T06 A;  4CHJ A;  1ZM0 A;  3BJI A;  2LUL A;  1FGY A;  1XR0 B;  2GS0 A;  3PEG A;  3MDB C;  3M1I B;  4KAX B;  1FGZ A;  5JP4 A;  3CXB B;  5KCV A;  1UEF A;  3ODO A;  5C79 A;  2P8V A;  3FSS A;  2RNR B;  1WG7 A;  3DXD A;  2KUP A;  1UNR A;  5D3W A;  1FAO A;  4K2O A;  1V5M A;  1XOD A;  1Y5O A;  1ZVR A;  1MAI A;  4KHA A;  1OQN A;  2DHJ A;  5JHH A;  1M7E A;  3A8Q A;  1PMS A;  4GMX B;  2Y7B A;  5JHG A;  2RGN B;  2YSZ A;  3U8Z A;  4C0A A;  1Y19 B;  3KY9 A;  1KI1 B;  3PSC A;  1BTN A;  4KVG B;  5FI0 A;  3HW2 B;  2J0M A;  1RRP B;  3ULB A;  1J19 A;  3GYP A;  3QWM A;  2COC A;  2D9V A;  4HHV A;  3A8P A;  1U5G A;  1DDV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...