2ROVA

The split ph domain of rock ii
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
117
structure length
117
Chain Sequence
SRLEGWLSLPVRNNTKKFGWVKKYVIVSSKKILFYDSEQDKEQSNPYMVLDIDKLFHVRPVTQTDVYRADAKEIPRIFQILYANEGISSAKNLLLLANSTEEQQKWVSRLVKKIPKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The split PH domain of ROCK II
rcsb
source organism Rattus norvegicus
molecule tags Transferase
molecule keywords Rho-associated protein kinase 2
total genus 18
structure length 117
sequence length 117
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2008-04-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2rovA00
3QWMA 5HE3A 2NMBA 3DXEA 4F7GA 1K5DB 2D9ZA 5DI9B 1WJ1A 1BTKA 1EVHA 1ZC4B 1P3RA 1P5TA 3ZVRA 3M1IB 4Y94A 2P0FA 4GPTB 5DH9B 2YS5A 1E5WA 4KAXB 1EGXA 4KHOA 2D4QA 2MWNB 5FI0A 1PMSA 3D8EA 3QBVB 2D9XA 4TKNA 4HATB 2D9YA 3VIAA 5LOPB 4MY6A 2N23A 3T06A 1X1GA 1BAKA 2COAA 4K81A 1MPHA 4A6KA 2P8VA 1ZVRA 4DX90 3SO6A 3KRWA 2K00A 2MFQA 2Z0QA 4K17A 4GXBA 1I2HA 4EKUA 2KUPA 3MDBC 2JP2A 3PVWA 2UZRA 3PEGA 5JHGA 3GYPA 4HAZB 4IAPA 3X23A 2LOXA 3D8FA 5FI1A 1V61A 3SNHA 1GC7A 1XODA 1UNPA 3D8DA 1U2BA 5JHHA 2J59M 2YF0A 3KZ1A 2VSZA 1SGHA 2YSZA 2DYNA 4YL8A 1X11A 4PNKA 2W2XD 2G35A 4WVFB 3CXBB 2VKIA 5GOWB 4HDQA 1TJ6A 1NI2A 2YS1A 1XR0B 3AU5A 1V5MA 2J0JA 2IFSA 2LKOA 1FB8A 2GCJA 1Y5OA 1FGYA 1J0WA 1Q67A 2YT1A 2W2WA 1FHOA 5EFXA 2H7EA 1MIXA 3ULBA 4WJ7A 4PQ0A 1DYNA 4GMVA 1TQZA 2EMTA 3WYFB 3ULCA 1OY2A 5HE0A 1X86A 2DN6A 1U5GA 2DX1A 3TVVA 1W1HA 3A98B 3GYOA 1DDWA 4MT7A 3RCPA 3ODWA 3U7DA 3ODOA 2EC1A 4HHVA 1WGUA 1W1GA 2OQBA 2LYDA 4CYEA 2Y7BA 2QKLA 2MKRA 4A5KA 4GN1A 1WG7A 4ZRIA 1I7AA 2DYQA 2MDXA 3PP2A 4HAUB 1FHXA 1NTVA 1WJMA 2BCJA 4MK0A 5CLLB 3DXDA 4KVGB 2DHIA 2M14A 4ZRKA 2X18A 3KY9A 3AU4A 2D2QA 4IFSA 4CHMA 1RJ2A 4A6FA 1V88A 2YRYA 1MIZB 2CODA 2L1CA 5L81A 3P7ZA 2D9VA 1J19A 3F5RA 1PFJA 4K2PA 4F7UP 2D11A 5KQ1A 1PLSA 1DBHA 2DX5A 5HE2A 5D3VA 4P7IA 1U29A 3KSYA 1DROA 2V76A 1U5FA 3ZDTA 4GZUA 3HW2B 1FGZA 1MK7B 5C5BB 1P6SA 5D3YA 1FOEA 4HB2B 3G9WA 2K2JA 1ZSQA 2GCLA 3OANA 1NU2A 2OTXA 2I1KA 2ZPYA 3BJIA 3KRXA 3TO1A 1ISNA 4HB0B 1QQGA 2RNRB 2W2XC 1U5DA 2ELAA 1GG3A 4YONA 2Q13A 4TYZA 2R0DA 5J3QA 1M7RA 2RUKB 3LJUX 5J3YA 2L2IA 1EAZA 1AWEA 4EJNA 2RLOA 1BTNA 3HK0A 2Y8FA 5C16A 1WVHA 3QIJA 4HDOA 1X1FA 1UEFA 4NY0A 3ML4A 1M7EA 1FAOA 2DHJA 1BWNA 2CY4A 2IYBA 2J0KA 2RSGA 4IOYX 2HTHB 1UNQA 4A6FB 4D0NB 3TFMA 2LULA 4CHJA 1DDMA 2Y8GA 3PZDA 2DKQA 2XQNM 2D10A 1V89A 4WSFA 1ZM0A 2ROVA 3O96A 1LW3A 4DX8A 3A8PA 2ELBA 4Z2MB 1UPQA 1DDVA 3TW1A 2KCJA 3PG7A 1XD4A 1MAIA 2COFA 2P0HA 2YS3A 2P0DA 2COCA 2Z0PA 4HAXB 2QKMA 2DA0A 2NZ8B 1Y19B 2J0MA 4F7HA 1Z87A 1WGQA 3MPXA 1KI1B 4HB3B 3FSSA 2I1JA 2Z0OA 3N7CA 3WA0A 1IRSA 5LONB 5CLQB 4H8SA 2DTCA 4XWXA 2UVMA 2N0YA 3HQCA 5DHFB 2R09A 1H4RA 5C79A 1TXDA 4KHAA 2DFKA 5D3XA 5JP4A 1XX0A 1N3HA 4K2OA 1UPRA 2PZ1A 5J3TA 3PVLA 4A6HA 4ZRJA 2AL6A 1KZ7A 3FM8C 1WI1A 4HAWB 1FHWA 4C0AA 5C6RA 2RVBB 2AEHA 2ROZB 4KHBB 4NSWA 2I5CA 3A8QA 2D9WA 4BBKA 5KQ4A 1H10A 3F0WA 1K5GB 3SV1A 1V5UA 2GS0A 5D27A 3UZTA 1U27A 3NSUA 4Z2NA 2CY5A 1EF1A 2KGXB 3ODXA 5DHAB 3P6AA 1QC6A 1GC6A 4L6EA 3SUZA 5KCVA 2EJ8A 4DXAB 5HE1A 3BINA 1XCGA 1MKEA 4HAVB 1KZGA 1UNRA 5DIFB 3PVUA 4B6HA 1B55A 2DKPA 2I5FA 1OQNA 2E2XA 3V5WA 2LOZA 2FJLA 1SHCA 2VRWB 5C5BA 1XKEA 2YT0A 2CRFA 1MK9B 3IVFA 3FEHA 5D3WA 4HB4B 3CIKA 2CAYA 2YVCA 2K2UA 1X05A 4GMXB 2M38A 3DXCA 3VOQA 2GJYA 2HE7A 3AJ4A 3TCAA 1LB1A 1NTYA 2UZSA 1AQCA 1W1DA 1ZC3B 2ADZA 2LG1A 3PSCA 4EMOA 2RGNB 4HAYB 1V5PA 2DHKA 3SYXA 2EMSA 1RRPB 1OMWA 4DBBA 1U5EA 5JLJB 2DLWA 2H7DA 3U8ZA
chains in the Genus database with same CATH superfamily
3QWMA 5HE3A 2NMBA 3DXEA 4F7GA 1K5DB 2D9ZA 5DI9B 1WJ1A 1BTKA 1EVHA 1ZC4B 1P3RA 1P5TA 3ZVRA 3M1IB 4Y94A 2P0FA 4GPTB 5DH9B 2YS5A 1E5WA 4KAXB 1EGXA 4KHOA 2D4QA 2MWNB 5FI0A 1PMSA 3D8EA 3QBVB 4KHBA 2D9XA 4TKNA 4HATB 2D9YA 3VIAA 5LOPB 4MY6A 2N23A 3T06A 1X1GA 1BAKA 2COAA 4K81A 1MPHA 4A6KA 2P8VA 1ZVRA 4DX90 3SO6A 3KRWA 2K00A 2MFQA 2Z0QA 4K17A 4GXBA 1I2HA 4EKUA 2KUPA 3MDBC 2JP2A 3PVWA 2UZRA 3PEGA 5JHGA 3GYPA 4HAZB 4IAPA 3X23A 2LOXA 3D8FA 5FI1A 1V61A 3SNHA 1GC7A 1XODA 1UNPA 3D8DA 1U2BA 5JHHA 2J59M 2YF0A 3KZ1A 2VSZA 1SGHA 2YSZA 2DYNA 4YL8A 1X11A 4PNKA 2W2XD 2G35A 4WVFB 4CSQA 3CXBB 2VKIA 5GOWB 4HDQA 1TJ6A 1NI2A 3HSAA 2GUMA 2YS1A 1XR0B 3AU5A 1V5MA 2J0JA 2IFSA 2LKOA 1FB8A 2GCJA 1Y5OA 1FGYA 1J0WA 1Q67A 1T77A 2YT1A 2W2WA 2Z59A 1FHOA 5EFXA 2H7EA 1MIXA 4QJ5B 3ULBA 4WJ7A 5M4YB 4PQ0A 1DYNA 2Z4DA 4GMVA 1TQZA 2EMTA 3DCXA 3WYFB 2KR0A 3ULCA 1OY2A 5HE0A 1X86A 2DN6A 1U5GA 2DX1A 3TVVA 1W1HA 3A98B 3GYOA 1DDWA 3NWFA 4MT7A 3RCPA 3ODWA 3U7DA 5I2MA 3ODOA 2EC1A 4HHVA 1WGUA 1W1GA 4QJ3B 2OQBA 2LYDA 4CYEA 5LG4B 2Y7BA 2QKLA 2MKRA 4A5KA 4GN1A 4GOUA 1WG7A 4ZRIA 3A58A 1I7AA 2DYQA 2MDXA 3PP2A 4HAUB 1FHXA 1NTVA 1WJMA 2BCJA 4MK0A 5CLLB 3DXDA 1MI1A 4KVGB 2DHIA 2M14A 4ZRKA 2X18A 3KY9A 3AU4A 2D2QA 2KIGA 4IFSA 4CHMA 1RJ2A 2YT2A 4A6FA 1V88A 2YRYA 1MIZB 2CODA 2L1CA 5L81A 4OSNA 3P7ZA 2D9VA 1J19A 3F5RA 1PFJA 4K2PA 4F7UP 2D11A 5KQ1A 1PLSA 1DBHA 2DX5A 3OHMB 5D3VA 5HE2A 4P7IA 2R2YA 1U29A 3KSYA 1DROA 2V76A 1U5FA 3ZDTA 4GZUA 3HW2B 1FGZA 1MK7B 5C5BB 1P6SA 5D3YA 1FOEA 4HB2B 3G9WA 2K2JA 1ZSQA 2GCLA 3OANA 4QJ4B 1NU2A 2OTXA 2I1KA 2ZPYA 3BJIA 3KRXA 3TO1A 1ISNA 4HB0B 1QQGA 2RNRB 2W2XC 1U5DA 2ELAA 1GG3A 4YONA 2Q13A 4TYZA 2R0DA 5J3QA 1M7RA 2RUKB 3LJUX 5J3YA 2L2IA 1EAZA 1AWEA 4EJNA 2RLOA 3NWDA 2NBVA 1BTNA 3HK0A 2Y8FA 5C16A 1WVHA 3QIJA 4HDOA 1X1FA 1UEFA 4NY0A 3FVCA 2K49A 3ML4A 1M7EA 1FAOA 2DHJA 1BWNA 2CY4A 2IYBA 2J0KA 3U12A 2RSGA 4IOYX 2HTHB 1UNQA 4A6FB 4D0NB 3TFMA 2LULA 4CHJA 4L1RA 1DDMA 2Y8GA 3PZDA 2DKQA 2XQNM 2D10A 1V89A 4QXAB 4WSFA 1ZM0A 2ROVA 3O96A 1LW3A 4DX8A 3A8PA 2ELBA 4Z2MB 1UPQA 1DDVA 3TW1A 2KCJA 3PG7A 1XD4A 1MAIA 2COFA 1ZYIA 2P0HA 2YS3A 2P0DA 2COCA 2Z0PA 4HAXB 2QKMA 2DA0A 2RRFA 2NZ8B 1Y19B 2J0MA 4F7HA 4D6WA 1Z87A 1WGQA 3HIEA 3MPXA 1KI1B 4HB3B 3FSSA 2I1JA 2KIEA 2Z0OA 3N7CA 3WA0A 1IRSA 2FJUB 5LONB 5CLQB 4H8SA 2DTCA 4XWXA 3B77A 2UVMA 2N0YA 3HQCA 5DHFB 3NW8A 2R09A 1H4RA 5C79A 1TXDA 4KHAA 2DFKA 5D3XA 5JP4A 1XX0A 1N3HA 4K2OA 1UPRA 2PZ1A 5J3TA 3PVLA 4A6HA 4ZRJA 2AL6A 1KZ7A 3FM8C 1WI1A 2Z14A 4HAWB 1FHWA 4C0AA 5C6RA 2RVBB 2AEHA 2ROZB 4KHBB 4NSWA 2I5CA 3A8QA 2D9WA 4BBKA 5KQ4A 2Z13A 5IRSA 1H10A 3F0WA 1K5GB 2ZKMX 3SV1A 1V5UA 2GS0A 4GNKB 4HSIA 5D27A 3UZTA 1U27A 3NSUA 4Z2NA 3NWAA 2CY5A 1EF1A 2KGXB 3ODXA 5DHAB 3P6AA 1QC6A 1GC6A 4L6EA 2KUQA 3SUZA 5KCVA 2EJ8A 4DXAB 5HE1A 3BINA 5I2SA 1XCGA 1MKEA 4HAVB 1KZGA 1UNRA 5DIFB 3PVUA 4B6HA 1B55A 2DKPA 2I5FA 1OQNA 2E2XA 4DIXA 3V5WA 2LOZA 2FJLA 1SHCA 2VRWB 5C5BA 1XKEA 2YT0A 2CRFA 1MK9B 3IVFA 3FEHA 5D3WA 4HB4B 3CIKA 2CAYA 2YVCA 2K2UA 1X05A 4GMXB 2M38A 3DXCA 3VOQA 2GJYA 2HE7A 3AJ4A 3TCAA 1LB1A 1NTYA 2UZSA 1AQCA 1W1DA 2K8EA 1ZC3B 2ADZA 2LG1A 3PSCA 4EMOA 2RGNB 4OT1A 4HAYB 1V5PA 2DHKA 3SYXA 2EMSA 1RRPB 1OMWA 4DBBA 1U5EA 5JLJB 2DLWA 2H7DA 3U8ZA
chains in the Genus database with same CATH topology
3QWMA 5HE3A 2NMBA 3DXEA 4F7GA 1K5DB 2D9ZA 5DI9B 1WJ1A 1BTKA 1EVHA 1ZC4B 1P3RA 1P5TA 3ZVRA 3M1IB 4Y94A 2P0FA 4GPTB 5DH9B 2YS5A 1E5WA 4KAXB 1EGXA 4KHOA 2D4QA 2MWNB 5FI0A 1PMSA 3D8EA 3QBVB 2D9XA 4TKNA 4HATB 2D9YA 3VIAA 5LOPB 4MY6A 2N23A 3T06A 1X1GA 1BAKA 2COAA 4K81A 1MPHA 4A6KA 2P8VA 1ZVRA 4DX90 3SO6A 3KRWA 2K00A 2MFQA 2Z0QA 4K17A 4GXBA 1I2HA 4EKUA 2KUPA 3MDBC 2JP2A 3PVWA 2UZRA 3PEGA 5JHGA 3GYPA 4HAZB 4IAPA 3X23A 2LOXA 3D8FA 5FI1A 1V61A 3SNHA 1GC7A 1XODA 1UNPA 3D8DA 1U2BA 5JHHA 2J59M 2YF0A 3KZ1A 2VSZA 1SGHA 2YSZA 2DYNA 4YL8A 1X11A 4PNKA 2W2XD 2G35A 4WVFB 3CXBB 2VKIA 5GOWB 4HDQA 1TJ6A 1NI2A 2YS1A 1XR0B 3AU5A 1V5MA 2J0JA 2IFSA 2LKOA 1FB8A 2GCJA 1Y5OA 1FGYA 1J0WA 1Q67A 2YT1A 2W2WA 1FHOA 5EFXA 2H7EA 1MIXA 3ULBA 4WJ7A 4PQ0A 1DYNA 4GMVA 1TQZA 2EMTA 3WYFB 3ULCA 1OY2A 5HE0A 1X86A 2DN6A 1U5GA 2DX1A 3TVVA 1W1HA 3A98B 3GYOA 1DDWA 4MT7A 3RCPA 3ODWA 3U7DA 3ODOA 2EC1A 4HHVA 1WGUA 1W1GA 2OQBA 2LYDA 4CYEA 2Y7BA 2QKLA 2MKRA 4A5KA 4GN1A 1WG7A 4ZRIA 1I7AA 2DYQA 2MDXA 3PP2A 4HAUB 1FHXA 1NTVA 1WJMA 2BCJA 4MK0A 5CLLB 3DXDA 4KVGB 2DHIA 2M14A 4ZRKA 2X18A 3KY9A 3AU4A 2D2QA 4IFSA 4CHMA 1RJ2A 4A6FA 1V88A 2YRYA 1MIZB 2CODA 2L1CA 5L81A 3P7ZA 2D9VA 1J19A 3F5RA 1PFJA 4K2PA 4F7UP 2D11A 5KQ1A 1PLSA 1DBHA 2DX5A 5HE2A 5D3VA 4P7IA 1U29A 3KSYA 1DROA 2V76A 1U5FA 3ZDTA 4GZUA 3HW2B 1FGZA 1MK7B 5C5BB 1P6SA 5D3YA 1FOEA 4HB2B 3G9WA 2K2JA 1ZSQA 2GCLA 3OANA 1NU2A 2OTXA 2I1KA 2ZPYA 3BJIA 3KRXA 3TO1A 1ISNA 4HB0B 1QQGA 2RNRB 2W2XC 1U5DA 2ELAA 1GG3A 4YONA 2Q13A 4TYZA 2R0DA 5J3QA 1M7RA 2RUKB 3LJUX 5J3YA 2L2IA 1EAZA 1AWEA 4EJNA 2RLOA 1BTNA 3HK0A 2Y8FA 5C16A 1WVHA 3QIJA 4HDOA 1X1FA 1UEFA 4NY0A 3ML4A 1M7EA 1FAOA 2DHJA 1BWNA 2CY4A 2IYBA 2J0KA 2RSGA 4IOYX 2HTHB 1UNQA 4A6FB 4D0NB 3TFMA 2LULA 4CHJA 1DDMA 2Y8GA 3PZDA 2DKQA 2XQNM 2D10A 1V89A 4WSFA 1ZM0A 2ROVA 3O96A 1LW3A 4DX8A 3A8PA 2ELBA 4Z2MB 1UPQA 1DDVA 3TW1A 2KCJA 3PG7A 1XD4A 1MAIA 2COFA 2P0HA 2YS3A 2P0DA 2COCA 2Z0PA 4HAXB 2QKMA 2DA0A 2NZ8B 1Y19B 2J0MA 4F7HA 1Z87A 1WGQA 3MPXA 1KI1B 4HB3B 3FSSA 2I1JA 2Z0OA 3N7CA 3WA0A 1IRSA 5LONB 5CLQB 4H8SA 2DTCA 4XWXA 2UVMA 2N0YA 3HQCA 5DHFB 2R09A 1H4RA 5C79A 1TXDA 4KHAA 2DFKA 5D3XA 5JP4A 1XX0A 1N3HA 4K2OA 1UPRA 2PZ1A 5J3TA 3PVLA 4A6HA 4ZRJA 2AL6A 1KZ7A 3FM8C 1WI1A 4HAWB 1FHWA 4C0AA 5C6RA 2RVBB 2AEHA 2ROZB 4KHBB 4NSWA 2I5CA 3A8QA 2D9WA 4BBKA 5KQ4A 1H10A 3F0WA 1K5GB 3SV1A 1V5UA 2GS0A 5D27A 3UZTA 1U27A 3NSUA 4Z2NA 2CY5A 1EF1A 2KGXB 3ODXA 5DHAB 3P6AA 1QC6A 1GC6A 4L6EA 3SUZA 5KCVA 2EJ8A 4DXAB 5HE1A 3BINA 1XCGA 1MKEA 4HAVB 1KZGA 1UNRA 5DIFB 3PVUA 4B6HA 1B55A 2DKPA 2I5FA 1OQNA 2E2XA 3V5WA 2LOZA 2FJLA 1SHCA 2VRWB 5C5BA 1XKEA 2YT0A 2CRFA 1MK9B 3IVFA 3FEHA 5D3WA 4HB4B 3CIKA 2CAYA 2YVCA 2K2UA 1X05A 4GMXB 2M38A 3DXCA 3VOQA 2GJYA 2HE7A 3AJ4A 3TCAA 1LB1A 1NTYA 2UZSA 1AQCA 1W1DA 1ZC3B 2ADZA 2LG1A 3PSCA 4EMOA 2RGNB 4HAYB 1V5PA 2DHKA 3SYXA 2EMSA 1RRPB 1OMWA 4DBBA 1U5EA 5JLJB 2DLWA 2H7DA 3U8ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QWM A;  5HE3 A;  2NMB A;  3DXE A;  4F7G A;  1K5D B;  2D9Z A;  5DI9 B;  1WJ1 A;  1BTK A;  1EVH A;  1ZC4 B;  1P3R A;  1P5T A;  3ZVR A;  3M1I B;  4Y94 A;  2P0F A;  4GPT B;  5DH9 B;  2YS5 A;  1E5W A;  4KAX B;  1EGX A;  4KHO A;  2D4Q A;  2MWN B;  5FI0 A;  1PMS A;  3D8E A;  3QBV B;  2D9X A;  4TKN A;  4HAT B;  2D9Y A;  3VIA A;  5LOP B;  4MY6 A;  2N23 A;  3T06 A;  1X1G A;  1BAK A;  2COA A;  4K81 A;  1MPH A;  4A6K A;  2P8V A;  1ZVR A;  4DX9 0;  3SO6 A;  3KRW A;  2K00 A;  2MFQ A;  2Z0Q A;  4K17 A;  4GXB A;  1I2H A;  4EKU A;  2KUP A;  3MDB C;  2JP2 A;  3PVW A;  2UZR A;  3PEG A;  5JHG A;  3GYP A;  4HAZ B;  4IAP A;  3X23 A;  2LOX A;  3D8F A;  5FI1 A;  1V61 A;  3SNH A;  1GC7 A;  1XOD A;  1UNP A;  3D8D A;  1U2B A;  5JHH A;  2J59 M;  2YF0 A;  3KZ1 A;  2VSZ A;  1SGH A;  2YSZ A;  2DYN A;  4YL8 A;  1X11 A;  4PNK A;  2W2X D;  2G35 A;  4WVF B;  3CXB B;  2VKI A;  5GOW B;  4HDQ A;  1TJ6 A;  1NI2 A;  2YS1 A;  1XR0 B;  3AU5 A;  1V5M A;  2J0J A;  2IFS A;  2LKO A;  1FB8 A;  2GCJ A;  1Y5O A;  1FGY A;  1J0W A;  1Q67 A;  2YT1 A;  2W2W A;  1FHO A;  5EFX A;  2H7E A;  1MIX A;  3ULB A;  4WJ7 A;  4PQ0 A;  1DYN A;  4GMV A;  1TQZ A;  2EMT A;  3WYF B;  3ULC A;  1OY2 A;  5HE0 A;  1X86 A;  2DN6 A;  1U5G A;  2DX1 A;  3TVV A;  1W1H A;  3A98 B;  3GYO A;  1DDW A;  4MT7 A;  3RCP A;  3ODW A;  3U7D A;  3ODO A;  2EC1 A;  4HHV A;  1WGU A;  1W1G A;  2OQB A;  2LYD A;  4CYE A;  2Y7B A;  2QKL A;  2MKR A;  4A5K A;  4GN1 A;  1WG7 A;  4ZRI A;  1I7A A;  2DYQ A;  2MDX A;  3PP2 A;  4HAU B;  1FHX A;  1NTV A;  1WJM A;  2BCJ A;  4MK0 A;  5CLL B;  3DXD A;  4KVG B;  2DHI A;  2M14 A;  4ZRK A;  2X18 A;  3KY9 A;  3AU4 A;  2D2Q A;  4IFS A;  4CHM A;  1RJ2 A;  4A6F A;  1V88 A;  2YRY A;  1MIZ B;  2COD A;  2L1C A;  5L81 A;  3P7Z A;  2D9V A;  1J19 A;  3F5R A;  1PFJ A;  4K2P A;  4F7U P;  2D11 A;  5KQ1 A;  1PLS A;  1DBH A;  2DX5 A;  5HE2 A;  5D3V A;  4P7I A;  1U29 A;  3KSY A;  1DRO A;  2V76 A;  1U5F A;  3ZDT A;  4GZU A;  3HW2 B;  1FGZ A;  1MK7 B;  5C5B B;  1P6S A;  5D3Y A;  1FOE A;  4HB2 B;  3G9W A;  2K2J A;  1ZSQ A;  2GCL A;  3OAN A;  1NU2 A;  2OTX A;  2I1K A;  2ZPY A;  3BJI A;  3KRX A;  3TO1 A;  1ISN A;  4HB0 B;  1QQG A;  2RNR B;  2W2X C;  1U5D A;  2ELA A;  1GG3 A;  4YON A;  2Q13 A;  4TYZ A;  2R0D A;  5J3Q A;  1M7R A;  2RUK B;  3LJU X;  5J3Y A;  2L2I A;  1EAZ A;  1AWE A;  4EJN A;  2RLO A;  1BTN A;  3HK0 A;  2Y8F A;  5C16 A;  1WVH A;  3QIJ A;  4HDO A;  1X1F A;  1UEF A;  4NY0 A;  3ML4 A;  1M7E A;  1FAO A;  2DHJ A;  1BWN A;  2CY4 A;  2IYB A;  2J0K A;  2RSG A;  4IOY X;  2HTH B;  1UNQ A;  4A6F B;  4D0N B;  3TFM A;  2LUL A;  4CHJ A;  1DDM A;  2Y8G A;  3PZD A;  2DKQ A;  2XQN M;  2D10 A;  1V89 A;  4WSF A;  1ZM0 A;  2ROV A;  3O96 A;  1LW3 A;  4DX8 A;  3A8P A;  2ELB A;  4Z2M B;  1UPQ A;  1DDV A;  3TW1 A;  2KCJ A;  3PG7 A;  1XD4 A;  1MAI A;  2COF A;  2P0H A;  2YS3 A;  2P0D A;  2COC A;  2Z0P A;  4HAX B;  2QKM A;  2DA0 A;  2NZ8 B;  1Y19 B;  2J0M A;  4F7H A;  1Z87 A;  1WGQ A;  3MPX A;  1KI1 B;  4HB3 B;  3FSS A;  2I1J A;  2Z0O A;  3N7C A;  3WA0 A;  1IRS A;  5LON B;  5CLQ B;  4H8S A;  2DTC A;  4XWX A;  2UVM A;  2N0Y A;  3HQC A;  5DHF B;  2R09 A;  1H4R A;  5C79 A;  1TXD A;  4KHA A;  2DFK A;  5D3X A;  5JP4 A;  1XX0 A;  1N3H A;  4K2O A;  1UPR A;  2PZ1 A;  5J3T A;  3PVL A;  4A6H A;  4ZRJ A;  2AL6 A;  1KZ7 A;  3FM8 C;  1WI1 A;  4HAW B;  1FHW A;  4C0A A;  5C6R A;  2RVB B;  2AEH A;  2ROZ B;  4KHB B;  4NSW A;  2I5C A;  3A8Q A;  2D9W A;  4BBK A;  5KQ4 A;  1H10 A;  3F0W A;  1K5G B;  3SV1 A;  1V5U A;  2GS0 A;  5D27 A;  3UZT A;  1U27 A;  3NSU A;  4Z2N A;  2CY5 A;  1EF1 A;  2KGX B;  3ODX A;  5DHA B;  3P6A A;  1QC6 A;  1GC6 A;  4L6E A;  3SUZ A;  5KCV A;  2EJ8 A;  4DXA B;  5HE1 A;  3BIN A;  1XCG A;  1MKE A;  4HAV B;  1KZG A;  1UNR A;  5DIF B;  3PVU A;  4B6H A;  1B55 A;  2DKP A;  2I5F A;  1OQN A;  2E2X A;  3V5W A;  2LOZ A;  2FJL A;  1SHC A;  2VRW B;  5C5B A;  1XKE A;  2YT0 A;  2CRF A;  1MK9 B;  3IVF A;  3FEH A;  5D3W A;  4HB4 B;  3CIK A;  2CAY A;  2YVC A;  2K2U A;  1X05 A;  4GMX B;  2M38 A;  3DXC A;  3VOQ A;  2GJY A;  2HE7 A;  3AJ4 A;  3TCA A;  1LB1 A;  1NTY A;  2UZS A;  1AQC A;  1W1D A;  1ZC3 B;  2ADZ A;  2LG1 A;  3PSC A;  4EMO A;  2RGN B;  4HAY B;  1V5P A;  2DHK A;  3SYX A;  2EMS A;  1RRP B;  1OMW A;  4DBB A;  1U5E A;  5JLJ B;  2DLW A;  2H7D A;  3U8Z A; 
#chains in the Genus database with same CATH topology
 3QWM A;  5HE3 A;  2NMB A;  3DXE A;  4F7G A;  1K5D B;  2D9Z A;  5DI9 B;  1WJ1 A;  1BTK A;  1EVH A;  1ZC4 B;  1P3R A;  1P5T A;  3ZVR A;  3M1I B;  4Y94 A;  2P0F A;  4GPT B;  5DH9 B;  2YS5 A;  1E5W A;  4KAX B;  1EGX A;  4KHO A;  2D4Q A;  2MWN B;  5FI0 A;  1PMS A;  3D8E A;  3QBV B;  4KHB A;  2D9X A;  4TKN A;  4HAT B;  2D9Y A;  3VIA A;  5LOP B;  4MY6 A;  2N23 A;  3T06 A;  1X1G A;  1BAK A;  2COA A;  4K81 A;  1MPH A;  4A6K A;  2P8V A;  1ZVR A;  4DX9 0;  3SO6 A;  3KRW A;  2K00 A;  2MFQ A;  2Z0Q A;  4K17 A;  4GXB A;  1I2H A;  4EKU A;  2KUP A;  3MDB C;  2JP2 A;  3PVW A;  2UZR A;  3PEG A;  5JHG A;  3GYP A;  4HAZ B;  4IAP A;  3X23 A;  2LOX A;  3D8F A;  5FI1 A;  1V61 A;  3SNH A;  1GC7 A;  1XOD A;  1UNP A;  3D8D A;  1U2B A;  5JHH A;  2J59 M;  2YF0 A;  3KZ1 A;  2VSZ A;  1SGH A;  2YSZ A;  2DYN A;  4YL8 A;  1X11 A;  4PNK A;  2W2X D;  2G35 A;  4WVF B;  4CSQ A;  3CXB B;  2VKI A;  5GOW B;  4HDQ A;  1TJ6 A;  1NI2 A;  3HSA A;  2GUM A;  2YS1 A;  1XR0 B;  3AU5 A;  1V5M A;  2J0J A;  2IFS A;  2LKO A;  1FB8 A;  2GCJ A;  1Y5O A;  1FGY A;  1J0W A;  1Q67 A;  1T77 A;  2YT1 A;  2W2W A;  2Z59 A;  1FHO A;  5EFX A;  2H7E A;  1MIX A;  4QJ5 B;  3ULB A;  4WJ7 A;  5M4Y B;  4PQ0 A;  1DYN A;  2Z4D A;  4GMV A;  1TQZ A;  2EMT A;  3DCX A;  3WYF B;  2KR0 A;  3ULC A;  1OY2 A;  5HE0 A;  1X86 A;  2DN6 A;  1U5G A;  2DX1 A;  3TVV A;  1W1H A;  3A98 B;  3GYO A;  1DDW A;  3NWF A;  4MT7 A;  3RCP A;  3ODW A;  3U7D A;  5I2M A;  3ODO A;  2EC1 A;  4HHV A;  1WGU A;  1W1G A;  4QJ3 B;  2OQB A;  2LYD A;  4CYE A;  5LG4 B;  2Y7B A;  2QKL A;  2MKR A;  4A5K A;  4GN1 A;  4GOU A;  1WG7 A;  4ZRI A;  3A58 A;  1I7A A;  2DYQ A;  2MDX A;  3PP2 A;  4HAU B;  1FHX A;  1NTV A;  1WJM A;  2BCJ A;  4MK0 A;  5CLL B;  3DXD A;  1MI1 A;  4KVG B;  2DHI A;  2M14 A;  4ZRK A;  2X18 A;  3KY9 A;  3AU4 A;  2D2Q A;  2KIG A;  4IFS A;  4CHM A;  1RJ2 A;  2YT2 A;  4A6F A;  1V88 A;  2YRY A;  1MIZ B;  2COD A;  2L1C A;  5L81 A;  4OSN A;  3P7Z A;  2D9V A;  1J19 A;  3F5R A;  1PFJ A;  4K2P A;  4F7U P;  2D11 A;  5KQ1 A;  1PLS A;  1DBH A;  2DX5 A;  3OHM B;  5D3V A;  5HE2 A;  4P7I A;  2R2Y A;  1U29 A;  3KSY A;  1DRO A;  2V76 A;  1U5F A;  3ZDT A;  4GZU A;  3HW2 B;  1FGZ A;  1MK7 B;  5C5B B;  1P6S A;  5D3Y A;  1FOE A;  4HB2 B;  3G9W A;  2K2J A;  1ZSQ A;  2GCL A;  3OAN A;  4QJ4 B;  1NU2 A;  2OTX A;  2I1K A;  2ZPY A;  3BJI A;  3KRX A;  3TO1 A;  1ISN A;  4HB0 B;  1QQG A;  2RNR B;  2W2X C;  1U5D A;  2ELA A;  1GG3 A;  4YON A;  2Q13 A;  4TYZ A;  2R0D A;  5J3Q A;  1M7R A;  2RUK B;  3LJU X;  5J3Y A;  2L2I A;  1EAZ A;  1AWE A;  4EJN A;  2RLO A;  3NWD A;  2NBV A;  1BTN A;  3HK0 A;  2Y8F A;  5C16 A;  1WVH A;  3QIJ A;  4HDO A;  1X1F A;  1UEF A;  4NY0 A;  3FVC A;  2K49 A;  3ML4 A;  1M7E A;  1FAO A;  2DHJ A;  1BWN A;  2CY4 A;  2IYB A;  2J0K A;  3U12 A;  2RSG A;  4IOY X;  2HTH B;  1UNQ A;  4A6F B;  4D0N B;  3TFM A;  2LUL A;  4CHJ A;  4L1R A;  1DDM A;  2Y8G A;  3PZD A;  2DKQ A;  2XQN M;  2D10 A;  1V89 A;  4QXA B;  4WSF A;  1ZM0 A;  2ROV A;  3O96 A;  1LW3 A;  4DX8 A;  3A8P A;  2ELB A;  4Z2M B;  1UPQ A;  1DDV A;  3TW1 A;  2KCJ A;  3PG7 A;  1XD4 A;  1MAI A;  2COF A;  1ZYI A;  2P0H A;  2YS3 A;  2P0D A;  2COC A;  2Z0P A;  4HAX B;  2QKM A;  2DA0 A;  2RRF A;  2NZ8 B;  1Y19 B;  2J0M A;  4F7H A;  4D6W A;  1Z87 A;  1WGQ A;  3HIE A;  3MPX A;  1KI1 B;  4HB3 B;  3FSS A;  2I1J A;  2KIE A;  2Z0O A;  3N7C A;  3WA0 A;  1IRS A;  2FJU B;  5LON B;  5CLQ B;  4H8S A;  2DTC A;  4XWX A;  3B77 A;  2UVM A;  2N0Y A;  3HQC A;  5DHF B;  3NW8 A;  2R09 A;  1H4R A;  5C79 A;  1TXD A;  4KHA A;  2DFK A;  5D3X A;  5JP4 A;  1XX0 A;  1N3H A;  4K2O A;  1UPR A;  2PZ1 A;  5J3T A;  3PVL A;  4A6H A;  4ZRJ A;  2AL6 A;  1KZ7 A;  3FM8 C;  1WI1 A;  2Z14 A;  4HAW B;  1FHW A;  4C0A A;  5C6R A;  2RVB B;  2AEH A;  2ROZ B;  4KHB B;  4NSW A;  2I5C A;  3A8Q A;  2D9W A;  4BBK A;  5KQ4 A;  2Z13 A;  5IRS A;  1H10 A;  3F0W A;  1K5G B;  2ZKM X;  3SV1 A;  1V5U A;  2GS0 A;  4GNK B;  4HSI A;  5D27 A;  3UZT A;  1U27 A;  3NSU A;  4Z2N A;  3NWA A;  2CY5 A;  1EF1 A;  2KGX B;  3ODX A;  5DHA B;  3P6A A;  1QC6 A;  1GC6 A;  4L6E A;  2KUQ A;  3SUZ A;  5KCV A;  2EJ8 A;  4DXA B;  5HE1 A;  3BIN A;  5I2S A;  1XCG A;  1MKE A;  4HAV B;  1KZG A;  1UNR A;  5DIF B;  3PVU A;  4B6H A;  1B55 A;  2DKP A;  2I5F A;  1OQN A;  2E2X A;  4DIX A;  3V5W A;  2LOZ A;  2FJL A;  1SHC A;  2VRW B;  5C5B A;  1XKE A;  2YT0 A;  2CRF A;  1MK9 B;  3IVF A;  3FEH A;  5D3W A;  4HB4 B;  3CIK A;  2CAY A;  2YVC A;  2K2U A;  1X05 A;  4GMX B;  2M38 A;  3DXC A;  3VOQ A;  2GJY A;  2HE7 A;  3AJ4 A;  3TCA A;  1LB1 A;  1NTY A;  2UZS A;  1AQC A;  1W1D A;  2K8E A;  1ZC3 B;  2ADZ A;  2LG1 A;  3PSC A;  4EMO A;  2RGN B;  4OT1 A;  4HAY B;  1V5P A;  2DHK A;  3SYX A;  2EMS A;  1RRP B;  1OMW A;  4DBB A;  1U5E A;  5JLJ B;  2DLW A;  2H7D A;  3U8Z A; 
#chains in the Genus database with same CATH homology
 3QWM A;  5HE3 A;  2NMB A;  3DXE A;  4F7G A;  1K5D B;  2D9Z A;  5DI9 B;  1WJ1 A;  1BTK A;  1EVH A;  1ZC4 B;  1P3R A;  1P5T A;  3ZVR A;  3M1I B;  4Y94 A;  2P0F A;  4GPT B;  5DH9 B;  2YS5 A;  1E5W A;  4KAX B;  1EGX A;  4KHO A;  2D4Q A;  2MWN B;  5FI0 A;  1PMS A;  3D8E A;  3QBV B;  2D9X A;  4TKN A;  4HAT B;  2D9Y A;  3VIA A;  5LOP B;  4MY6 A;  2N23 A;  3T06 A;  1X1G A;  1BAK A;  2COA A;  4K81 A;  1MPH A;  4A6K A;  2P8V A;  1ZVR A;  4DX9 0;  3SO6 A;  3KRW A;  2K00 A;  2MFQ A;  2Z0Q A;  4K17 A;  4GXB A;  1I2H A;  4EKU A;  2KUP A;  3MDB C;  2JP2 A;  3PVW A;  2UZR A;  3PEG A;  5JHG A;  3GYP A;  4HAZ B;  4IAP A;  3X23 A;  2LOX A;  3D8F A;  5FI1 A;  1V61 A;  3SNH A;  1GC7 A;  1XOD A;  1UNP A;  3D8D A;  1U2B A;  5JHH A;  2J59 M;  2YF0 A;  3KZ1 A;  2VSZ A;  1SGH A;  2YSZ A;  2DYN A;  4YL8 A;  1X11 A;  4PNK A;  2W2X D;  2G35 A;  4WVF B;  3CXB B;  2VKI A;  5GOW B;  4HDQ A;  1TJ6 A;  1NI2 A;  2YS1 A;  1XR0 B;  3AU5 A;  1V5M A;  2J0J A;  2IFS A;  2LKO A;  1FB8 A;  2GCJ A;  1Y5O A;  1FGY A;  1J0W A;  1Q67 A;  2YT1 A;  2W2W A;  1FHO A;  5EFX A;  2H7E A;  1MIX A;  3ULB A;  4WJ7 A;  4PQ0 A;  1DYN A;  4GMV A;  1TQZ A;  2EMT A;  3WYF B;  3ULC A;  1OY2 A;  5HE0 A;  1X86 A;  2DN6 A;  1U5G A;  2DX1 A;  3TVV A;  1W1H A;  3A98 B;  3GYO A;  1DDW A;  4MT7 A;  3RCP A;  3ODW A;  3U7D A;  3ODO A;  2EC1 A;  4HHV A;  1WGU A;  1W1G A;  2OQB A;  2LYD A;  4CYE A;  2Y7B A;  2QKL A;  2MKR A;  4A5K A;  4GN1 A;  1WG7 A;  4ZRI A;  1I7A A;  2DYQ A;  2MDX A;  3PP2 A;  4HAU B;  1FHX A;  1NTV A;  1WJM A;  2BCJ A;  4MK0 A;  5CLL B;  3DXD A;  4KVG B;  2DHI A;  2M14 A;  4ZRK A;  2X18 A;  3KY9 A;  3AU4 A;  2D2Q A;  4IFS A;  4CHM A;  1RJ2 A;  4A6F A;  1V88 A;  2YRY A;  1MIZ B;  2COD A;  2L1C A;  5L81 A;  3P7Z A;  2D9V A;  1J19 A;  3F5R A;  1PFJ A;  4K2P A;  4F7U P;  2D11 A;  5KQ1 A;  1PLS A;  1DBH A;  2DX5 A;  5HE2 A;  5D3V A;  4P7I A;  1U29 A;  3KSY A;  1DRO A;  2V76 A;  1U5F A;  3ZDT A;  4GZU A;  3HW2 B;  1FGZ A;  1MK7 B;  5C5B B;  1P6S A;  5D3Y A;  1FOE A;  4HB2 B;  3G9W A;  2K2J A;  1ZSQ A;  2GCL A;  3OAN A;  1NU2 A;  2OTX A;  2I1K A;  2ZPY A;  3BJI A;  3KRX A;  3TO1 A;  1ISN A;  4HB0 B;  1QQG A;  2RNR B;  2W2X C;  1U5D A;  2ELA A;  1GG3 A;  4YON A;  2Q13 A;  4TYZ A;  2R0D A;  5J3Q A;  1M7R A;  2RUK B;  3LJU X;  5J3Y A;  2L2I A;  1EAZ A;  1AWE A;  4EJN A;  2RLO A;  1BTN A;  3HK0 A;  2Y8F A;  5C16 A;  1WVH A;  3QIJ A;  4HDO A;  1X1F A;  1UEF A;  4NY0 A;  3ML4 A;  1M7E A;  1FAO A;  2DHJ A;  1BWN A;  2CY4 A;  2IYB A;  2J0K A;  2RSG A;  4IOY X;  2HTH B;  1UNQ A;  4A6F B;  4D0N B;  3TFM A;  2LUL A;  4CHJ A;  1DDM A;  2Y8G A;  3PZD A;  2DKQ A;  2XQN M;  2D10 A;  1V89 A;  4WSF A;  1ZM0 A;  2ROV A;  3O96 A;  1LW3 A;  4DX8 A;  3A8P A;  2ELB A;  4Z2M B;  1UPQ A;  1DDV A;  3TW1 A;  2KCJ A;  3PG7 A;  1XD4 A;  1MAI A;  2COF A;  2P0H A;  2YS3 A;  2P0D A;  2COC A;  2Z0P A;  4HAX B;  2QKM A;  2DA0 A;  2NZ8 B;  1Y19 B;  2J0M A;  4F7H A;  1Z87 A;  1WGQ A;  3MPX A;  1KI1 B;  4HB3 B;  3FSS A;  2I1J A;  2Z0O A;  3N7C A;  3WA0 A;  1IRS A;  5LON B;  5CLQ B;  4H8S A;  2DTC A;  4XWX A;  2UVM A;  2N0Y A;  3HQC A;  5DHF B;  2R09 A;  1H4R A;  5C79 A;  1TXD A;  4KHA A;  2DFK A;  5D3X A;  5JP4 A;  1XX0 A;  1N3H A;  4K2O A;  1UPR A;  2PZ1 A;  5J3T A;  3PVL A;  4A6H A;  4ZRJ A;  2AL6 A;  1KZ7 A;  3FM8 C;  1WI1 A;  4HAW B;  1FHW A;  4C0A A;  5C6R A;  2RVB B;  2AEH A;  2ROZ B;  4KHB B;  4NSW A;  2I5C A;  3A8Q A;  2D9W A;  4BBK A;  5KQ4 A;  1H10 A;  3F0W A;  1K5G B;  3SV1 A;  1V5U A;  2GS0 A;  5D27 A;  3UZT A;  1U27 A;  3NSU A;  4Z2N A;  2CY5 A;  1EF1 A;  2KGX B;  3ODX A;  5DHA B;  3P6A A;  1QC6 A;  1GC6 A;  4L6E A;  3SUZ A;  5KCV A;  2EJ8 A;  4DXA B;  5HE1 A;  3BIN A;  1XCG A;  1MKE A;  4HAV B;  1KZG A;  1UNR A;  5DIF B;  3PVU A;  4B6H A;  1B55 A;  2DKP A;  2I5F A;  1OQN A;  2E2X A;  3V5W A;  2LOZ A;  2FJL A;  1SHC A;  2VRW B;  5C5B A;  1XKE A;  2YT0 A;  2CRF A;  1MK9 B;  3IVF A;  3FEH A;  5D3W A;  4HB4 B;  3CIK A;  2CAY A;  2YVC A;  2K2U A;  1X05 A;  4GMX B;  2M38 A;  3DXC A;  3VOQ A;  2GJY A;  2HE7 A;  3AJ4 A;  3TCA A;  1LB1 A;  1NTY A;  2UZS A;  1AQC A;  1W1D A;  1ZC3 B;  2ADZ A;  2LG1 A;  3PSC A;  4EMO A;  2RGN B;  4HAY B;  1V5P A;  2DHK A;  3SYX A;  2EMS A;  1RRP B;  1OMW A;  4DBB A;  1U5E A;  5JLJ B;  2DLW A;  2H7D A;  3U8Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...