2ROVA

The split ph domain of rock ii
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
117
structure length
117
Chain Sequence
SRLEGWLSLPVRNNTKKFGWVKKYVIVSSKKILFYDSEQDKEQSNPYMVLDIDKLFHVRPVTQTDVYRADAKEIPRIFQILYANEGISSAKNLLLLANSTEEQQKWVSRLVKKIPKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Rho-associated protein kinase 2
publication title The split PH domain of ROCK II
rcsb
source organism Rattus norvegicus
total genus 18
structure length 117
sequence length 117
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2008-04-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2rovA00
2I5FA 4WVFB 5JP4A 3X23A 3M1IB 2COFA 1UEFA 4TYZA 2JP2A 5D27A 1MAIA 3PSCA 4HHVA 2YRYA 2GCLA 1RRPB 1K5GB 4KVGB 1MK9B 2D9ZA 1OQNA 4NSWA 5DHFB 2COCA 3V5WA 2HTHB 3OANA 1FAOA 1I7AA 2HE7A 3PEGA 5DH9B 4IFSA 3SYXA 2I5CA 2H7EA 2DLWA 2R09A 4KHBB 2OTXA 3QWMA 2LOZA 3AU4A 1K5DB 1PFJA 4HAZB 3A98B 1PLSA 2ELBA 2RUKB 5L81A 1DDVA 1XCGA 4HAYB 4MT7A 4ZRJA 4GMVA 2D2QA 4H8SA 3SUZA 3PVUA 1W1DA 2Z0QA 5C79A 5JHGA 2W2WA 2Y8GA 4YONA 1EVHA 1SGHA 4K2PA 4BBKA 1KI1B 3GYPA 1J19A 2D11A 1EGXA 1XKEA 2M14A 2K2UA 2DKQA 1GG3A 2LYDA 2DFKA 3D8FA 5D3VA 2YS1A 1BAKA 2MDXA 1XX0A 1UPQA 4TKNA 1WI1A 3PZDA 3MDBC 2EJ8A 1NTYA 2EMTA 1X86A 2DYNA 1U2BA 3KRWA 2OQBA 2I1KA 1V5UA 1XODA 5DI9B 2ADZA 4A5KA 5J3YA 5LONB 2FJLA 2DA0A 4MK0A 2DHKA 1E5WA 2DHIA 2W2XC 2X18A 5KCVA 1V89A 3RCPA 1P5TA 2P0HA 1X05A 1UNPA 1V5MA 4KHAA 4A6KA 1EAZA 2KUPA 2DX5A 4GN1A 3BJIA 1FGYA 1KZGA 2E2XA 1WJMA 5JLJB 1DROA 1UNQA 1PMSA 1V5PA 5FI1A 4GMXB 3U7DA 3TW1A 2UZRA 1NI2A 1X1GA 1ISNA 3GYOA 5LOPB 3O96A 3UZTA 4CYEA 1UPRA 4K2OA 4PQ0A 2NZ8B 2PZ1A 3PVWA 4EKUA 2DX1A 2MFQA 3P7ZA 2K2JA 1WGUA 4MY6A 5C5BB 2VKIA 2YT1A 1LW3A 4IAPA 1FHXA 1MIZB 1BTKA 1SHCA 1W1GA 4ZRIA 4L6EA 4WJ7A 5KQ1A 4HB2B 2R0DA 3U8ZA 1TJ6A 2DHJA 1TXDA 1Y19B 2IFSA 2KGXB 3F0WA 2ROVA 2CRFA 4F7UP 1GC6A 2AL6A 5C16A 2K00A 4DX8A 3TCAA 3ODWA 4B6HA 2QKLA 2I1JA 2ROZB 1OMWA 1ZC4B 5GOWB 1NTVA 3G9WA 2EMSA 5CLLB 3WA0A 2LOXA 1U27A 5EFXA 5HE3A 3HQCA 3DXCA 3HW2B 3HK0A 1DDWA 1KZ7A 2N23A 2Y8FA 1AWEA 3PVLA 3WYFB 1WGQA 1ZSQA 4HDOA 1DDMA 4CHMA 3N7CA 3T06A 2DKPA 2D9XA 2UZSA 1MKEA 4Z2NA 5J3TA 3ZVRA 1M7EA 4A6FB 2L2IA 1FGZA 2Z0OA 5HE2A 4EMOA 5J3QA 2GCJA 2GJYA 1P3RA 3A8PA 2LULA 5JHHA 3CXBB 3QBVB 4A6HA 2YF0A 2D9YA 5D3YA 4HDQA 1N3HA 2YT0A 4DX90 2CAYA 3F5RA 4DXAB 4WSFA 1H4RA 2QKMA 3AJ4A 2J0KA 2DYQA 4HAXB 1NU2A 1TQZA 1U29A 2D9VA 2N0YA 3AU5A 4GXBA 1BTNA 3TVVA 3FM8C 5C5BA 5FI0A 5D3WA 1FHWA 1W1HA 1QQGA 1FHOA 4KHOA 2ZPYA 2AEHA 2Z0PA 2Q13A 3ODOA 2LKOA 2RVBB 4KAXB 1LB1A 3PP2A 1DBHA 3MPXA 1V88A 4ZRKA 2Y7BA 5D3XA 2RSGA 2ELAA 2NMBA 1WJ1A 3TO1A 3ML4A 1XR0B 3PG7A 2D10A 1WG7A 2YS3A 4C0AA 2J0JA 2YSZA 1DYNA 3P6AA 1M7RA 2EC1A 4PNKA 2G35A 2IYBA 3NSUA 1OY2A 2P0DA 4NY0A 4IOYX 1ZM0A 3ZDTA 4HAWB 3SO6A 4K17A 3CIKA 4F7GA 4Y94A 1J0WA 4HB0B 2J59M 4P7IA 1RJ2A 2LG1A 3BINA 1X11A 2D4QA 1Q67A 3FSSA 4A6FA 5CLQB 1MIXA 2RLOA 2RNRB 3FEHA 1ZVRA 4F7HA 3LJUX 2DTCA 1B55A 2YVCA 1U5GA 3D8EA 3VOQA 4GPTB 2YS5A 2J0MA 4HAVB 5DIFB 1FOEA 3VIAA 4K81A 1MK7B 3KSYA 1U5EA 3QIJA 2DN6A 2W2XD 1MPHA 2UVMA 2CY4A 4HAUB 1H10A 1GC7A 1QC6A 1AQCA 3KY9A 2VRWB 2COAA 2H7DA 4HATB 1BWNA 2P0FA 2M38A 2CODA 1Y5OA 1EF1A 2BCJA 1U5FA 3A8QA 1U5DA 3DXDA 2V76A 2VSZA 2L1CA 3IVFA 2KCJA 1I2HA 1IRSA 2P8VA 1FB8A 5HE0A 5KQ4A 3ULBA 3TFMA 4YL8A 4D0NB 1X1FA 2MKRA 3DXEA 3ODXA 3KRXA 5DHAB 4CHJA 1XD4A 2RGNB 2MWNB 3ULCA 1WVHA 1Z87A 3D8DA 1ZC3B 2D9WA 4GZUA 4HB4B 5C6RA 1V61A 4Z2MB 4DBBA 2CY5A 3SNHA 2XQNM 3KZ1A 4XWXA 3SV1A 2GS0A 1P6SA 4EJNA 5HE1A 1UNRA 4HB3B
chains in the Genus database with same CATH superfamily
4OSNA 2I5FA 4WVFB 5JP4A 3X23A 3M1IB 2COFA 1UEFA 4TYZA 2JP2A 5D27A 4L1RA 1MAIA 3PSCA 4HHVA 2YRYA 2GCLA 1RRPB 1K5GB 4KVGB 1MK9B 2D9ZA 1OQNA 4NSWA 5DHFB 2COCA 3V5WA 2HTHB 3OANA 1FAOA 1I7AA 2HE7A 3PEGA 5DH9B 4IFSA 3SYXA 4HSIA 2I5CA 2H7EA 2DLWA 2R09A 4KHBB 2OTXA 3QWMA 1T77A 2LOZA 3AU4A 1K5DB 1PFJA 4HAZB 3A98B 1PLSA 2ELBA 2RUKB 2ZKMX 5L81A 1DDVA 1XCGA 4HAYB 4MT7A 4ZRJA 4GMVA 2D2QA 4H8SA 3NW8A 3SUZA 3PVUA 5IRSA 1W1DA 2Z0QA 5C79A 5JHGA 4GNKB 2W2WA 2Y8GA 4YONA 1EVHA 1SGHA 4K2PA 4BBKA 1KI1B 2Z4DA 3GYPA 1J19A 2D11A 1EGXA 1XKEA 2KIGA 2M14A 2K2UA 2DKQA 1GG3A 2LYDA 2DFKA 3D8FA 5D3VA 2YS1A 1BAKA 2GUMA 2MDXA 1XX0A 4QJ5B 1UPQA 4TKNA 1WI1A 3PZDA 3MDBC 2EJ8A 1NTYA 2EMTA 1X86A 2R2YA 2DYNA 1U2BA 5LG4B 3KRWA 2OQBA 2I1KA 1ZYIA 1V5UA 1XODA 5DI9B 2ADZA 4A5KA 2NBVA 5J3YA 5LONB 2FJLA 2DA0A 4MK0A 2DHKA 1E5WA 2DHIA 2W2XC 2X18A 5KCVA 1V89A 2K49A 3RCPA 1P5TA 3U12A 2P0HA 1X05A 1UNPA 3A58A 1V5MA 4KHAA 4A6KA 1EAZA 2KUQA 2KUPA 2DX5A 4GN1A 3BJIA 1FGYA 1KZGA 2E2XA 1WJMA 5JLJB 1DROA 1UNQA 1PMSA 1V5PA 3DCXA 5FI1A 4GMXB 3U7DA 3TW1A 4KHBA 2UZRA 1NI2A 1X1GA 1ISNA 3GYOA 5LOPB 3O96A 3NWFA 3UZTA 4CYEA 1UPRA 4K2OA 4PQ0A 2NZ8B 2PZ1A 3PVWA 4EKUA 2DX1A 2MFQA 3P7ZA 2K2JA 1WGUA 4MY6A 5C5BB 2VKIA 3OHMB 2YT1A 1LW3A 2YT2A 4IAPA 1FHXA 1MIZB 1BTKA 1SHCA 1W1GA 4ZRIA 4L6EA 4WJ7A 5KQ1A 4HB2B 3HIEA 2R0DA 3U8ZA 1TJ6A 2DHJA 1TXDA 1Y19B 2IFSA 2KGXB 3F0WA 2ROVA 2CRFA 4F7UP 1GC6A 2AL6A 5C16A 2K00A 2RRFA 4DX8A 3TCAA 3ODWA 4B6HA 2QKLA 2I1JA 2ROZB 1OMWA 1ZC4B 5GOWB 1NTVA 3G9WA 2EMSA 5CLLB 3WA0A 2LOXA 1U27A 5EFXA 5HE3A 3HQCA 3DXCA 3HW2B 3HK0A 1DDWA 1KZ7A 2N23A 2Y8FA 1AWEA 3PVLA 2Z14A 3WYFB 1WGQA 1ZSQA 4HDOA 1DDMA 4CHMA 5I2SA 3N7CA 3T06A 2DKPA 2D9XA 2UZSA 1MKEA 3NWDA 4Z2NA 5J3TA 3ZVRA 1M7EA 4A6FB 2L2IA 1FGZA 2Z0OA 5HE2A 4EMOA 5J3QA 2GCJA 2GJYA 1P3RA 2Z13A 3A8PA 2LULA 5JHHA 3CXBB 3QBVB 4A6HA 2YF0A 2D9YA 5D3YA 1MI1A 4HDQA 1N3HA 2YT0A 5M4YB 4DX90 2CAYA 3F5RA 4DXAB 4WSFA 1H4RA 2QKMA 3AJ4A 2J0KA 2DYQA 4HAXB 1NU2A 1TQZA 1U29A 2D9VA 2N0YA 3FVCA 4QJ3B 3AU5A 4GXBA 1BTNA 3TVVA 4QJ4B 3FM8C 2K8EA 5C5BA 5FI0A 5D3WA 1FHWA 2KIEA 1W1HA 1QQGA 1FHOA 4KHOA 2ZPYA 2AEHA 2Z0PA 2Q13A 3ODOA 2LKOA 2RVBB 4KAXB 1LB1A 1DBHA 3PP2A 3MPXA 1V88A 4ZRKA 2Y7BA 5D3XA 2RSGA 2ELAA 2NMBA 1WJ1A 3HSAA 3TO1A 3ML4A 4GOUA 1XR0B 3PG7A 2D10A 1WG7A 2YS3A 4C0AA 2J0JA 2YSZA 1DYNA 3P6AA 1M7RA 2EC1A 4PNKA 2G35A 2IYBA 3NSUA 1OY2A 2P0DA 4NY0A 4IOYX 4OT1A 1ZM0A 3ZDTA 4HAWB 3SO6A 4K17A 3CIKA 4F7GA 4Y94A 1J0WA 4HB0B 2J59M 4P7IA 1RJ2A 2LG1A 3BINA 1X11A 2D4QA 1Q67A 3FSSA 4A6FA 5CLQB 1MIXA 2RLOA 2RNRB 3FEHA 1ZVRA 4F7HA 3LJUX 2DTCA 1B55A 2YVCA 1U5GA 3D8EA 3VOQA 4GPTB 2YS5A 2J0MA 4HAVB 5DIFB 4D6WA 1FOEA 3VIAA 5I2MA 4K81A 1MK7B 3KSYA 4DIXA 1U5EA 3QIJA 3NWAA 2DN6A 4CSQA 2W2XD 4QXAB 1MPHA 2UVMA 2Z59A 2CY4A 4HAUB 1H10A 1GC7A 1QC6A 1AQCA 3KY9A 2VRWB 2COAA 2H7DA 4HATB 1BWNA 2P0FA 3B77A 2M38A 2CODA 1Y5OA 1EF1A 2BCJA 1U5FA 3A8QA 1U5DA 3DXDA 2V76A 2VSZA 2L1CA 3IVFA 2KCJA 1I2HA 1IRSA 2P8VA 1FB8A 2KR0A 5HE0A 5KQ4A 3ULBA 3TFMA 4YL8A 4D0NB 1X1FA 2MKRA 3DXEA 3ODXA 3KRXA 5DHAB 4CHJA 1XD4A 2RGNB 2MWNB 3ULCA 1WVHA 1Z87A 3D8DA 1ZC3B 2D9WA 4GZUA 4HB4B 5C6RA 1V61A 4Z2MB 4DBBA 2CY5A 3SNHA 2FJUB 2XQNM 3KZ1A 4XWXA 3SV1A 2GS0A 1P6SA 4EJNA 5HE1A 1UNRA 4HB3B
chains in the Genus database with same CATH topology
2I5FA 4WVFB 5JP4A 3X23A 3M1IB 2COFA 1UEFA 4TYZA 2JP2A 5D27A 1MAIA 3PSCA 4HHVA 2YRYA 2GCLA 1RRPB 1K5GB 4KVGB 1MK9B 2D9ZA 1OQNA 4NSWA 5DHFB 2COCA 3V5WA 2HTHB 3OANA 1FAOA 1I7AA 2HE7A 3PEGA 5DH9B 4IFSA 3SYXA 2I5CA 2H7EA 2DLWA 2R09A 4KHBB 2OTXA 3QWMA 2LOZA 3AU4A 1K5DB 1PFJA 4HAZB 3A98B 1PLSA 2ELBA 2RUKB 5L81A 1DDVA 1XCGA 4HAYB 4MT7A 4ZRJA 4GMVA 2D2QA 4H8SA 3SUZA 3PVUA 1W1DA 2Z0QA 5C79A 5JHGA 2W2WA 2Y8GA 4YONA 1EVHA 1SGHA 4K2PA 4BBKA 1KI1B 3GYPA 1J19A 2D11A 1EGXA 1XKEA 2M14A 2K2UA 2DKQA 1GG3A 2LYDA 2DFKA 3D8FA 5D3VA 2YS1A 1BAKA 2MDXA 1XX0A 1UPQA 4TKNA 1WI1A 3PZDA 3MDBC 2EJ8A 1NTYA 2EMTA 1X86A 2DYNA 1U2BA 3KRWA 2OQBA 2I1KA 1V5UA 1XODA 5DI9B 2ADZA 4A5KA 5J3YA 5LONB 2FJLA 2DA0A 4MK0A 2DHKA 1E5WA 2DHIA 2W2XC 2X18A 5KCVA 1V89A 3RCPA 1P5TA 2P0HA 1X05A 1UNPA 1V5MA 4KHAA 4A6KA 1EAZA 2KUPA 2DX5A 4GN1A 3BJIA 1FGYA 1KZGA 2E2XA 1WJMA 5JLJB 1DROA 1UNQA 1PMSA 1V5PA 5FI1A 4GMXB 3U7DA 3TW1A 2UZRA 1NI2A 1X1GA 1ISNA 3GYOA 5LOPB 3O96A 3UZTA 4CYEA 1UPRA 4K2OA 4PQ0A 2NZ8B 2PZ1A 3PVWA 4EKUA 2DX1A 2MFQA 3P7ZA 2K2JA 1WGUA 4MY6A 5C5BB 2VKIA 2YT1A 1LW3A 4IAPA 1FHXA 1MIZB 1BTKA 1SHCA 1W1GA 4ZRIA 4L6EA 4WJ7A 5KQ1A 4HB2B 2R0DA 3U8ZA 1TJ6A 2DHJA 1TXDA 1Y19B 2IFSA 2KGXB 3F0WA 2ROVA 2CRFA 4F7UP 1GC6A 2AL6A 5C16A 2K00A 4DX8A 3TCAA 3ODWA 4B6HA 2QKLA 2I1JA 2ROZB 1OMWA 1ZC4B 5GOWB 1NTVA 3G9WA 2EMSA 5CLLB 3WA0A 2LOXA 1U27A 5EFXA 5HE3A 3HQCA 3DXCA 3HW2B 3HK0A 1DDWA 1KZ7A 2N23A 2Y8FA 1AWEA 3PVLA 3WYFB 1WGQA 1ZSQA 4HDOA 1DDMA 4CHMA 3N7CA 3T06A 2DKPA 2D9XA 2UZSA 1MKEA 4Z2NA 5J3TA 3ZVRA 1M7EA 4A6FB 2L2IA 1FGZA 2Z0OA 5HE2A 4EMOA 5J3QA 2GCJA 2GJYA 1P3RA 3A8PA 2LULA 5JHHA 3CXBB 3QBVB 4A6HA 2YF0A 2D9YA 5D3YA 4HDQA 1N3HA 2YT0A 4DX90 2CAYA 3F5RA 4DXAB 4WSFA 1H4RA 2QKMA 3AJ4A 2J0KA 2DYQA 4HAXB 1NU2A 1TQZA 1U29A 2D9VA 2N0YA 3AU5A 4GXBA 1BTNA 3TVVA 3FM8C 5C5BA 5FI0A 5D3WA 1FHWA 1W1HA 1QQGA 1FHOA 4KHOA 2ZPYA 2AEHA 2Z0PA 2Q13A 3ODOA 2LKOA 2RVBB 4KAXB 1LB1A 3PP2A 1DBHA 3MPXA 1V88A 4ZRKA 2Y7BA 5D3XA 2RSGA 2ELAA 2NMBA 1WJ1A 3TO1A 3ML4A 1XR0B 3PG7A 2D10A 1WG7A 2YS3A 4C0AA 2J0JA 2YSZA 1DYNA 3P6AA 1M7RA 2EC1A 4PNKA 2G35A 2IYBA 3NSUA 1OY2A 2P0DA 4NY0A 4IOYX 1ZM0A 3ZDTA 4HAWB 3SO6A 4K17A 3CIKA 4F7GA 4Y94A 1J0WA 4HB0B 2J59M 4P7IA 1RJ2A 2LG1A 3BINA 1X11A 2D4QA 1Q67A 3FSSA 4A6FA 5CLQB 1MIXA 2RLOA 2RNRB 3FEHA 1ZVRA 4F7HA 3LJUX 2DTCA 1B55A 2YVCA 1U5GA 3D8EA 3VOQA 4GPTB 2YS5A 2J0MA 4HAVB 5DIFB 1FOEA 3VIAA 4K81A 1MK7B 3KSYA 1U5EA 3QIJA 2DN6A 2W2XD 1MPHA 2UVMA 2CY4A 4HAUB 1H10A 1GC7A 1QC6A 1AQCA 3KY9A 2VRWB 2COAA 2H7DA 4HATB 1BWNA 2P0FA 2M38A 2CODA 1Y5OA 1EF1A 2BCJA 1U5FA 3A8QA 1U5DA 3DXDA 2V76A 2VSZA 2L1CA 3IVFA 2KCJA 1I2HA 1IRSA 2P8VA 1FB8A 5HE0A 5KQ4A 3ULBA 3TFMA 4YL8A 4D0NB 1X1FA 2MKRA 3DXEA 3ODXA 3KRXA 5DHAB 4CHJA 1XD4A 2RGNB 2MWNB 3ULCA 1WVHA 1Z87A 3D8DA 1ZC3B 2D9WA 4GZUA 4HB4B 5C6RA 1V61A 4Z2MB 4DBBA 2CY5A 3SNHA 2XQNM 3KZ1A 4XWXA 3SV1A 2GS0A 1P6SA 4EJNA 5HE1A 1UNRA 4HB3B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2I5F A;  4WVF B;  5JP4 A;  3X23 A;  3M1I B;  2COF A;  1UEF A;  4TYZ A;  2JP2 A;  5D27 A;  1MAI A;  3PSC A;  4HHV A;  2YRY A;  2GCL A;  1RRP B;  1K5G B;  4KVG B;  1MK9 B;  2D9Z A;  1OQN A;  4NSW A;  5DHF B;  2COC A;  3V5W A;  2HTH B;  3OAN A;  1FAO A;  1I7A A;  2HE7 A;  3PEG A;  5DH9 B;  4IFS A;  3SYX A;  2I5C A;  2H7E A;  2DLW A;  2R09 A;  4KHB B;  2OTX A;  3QWM A;  2LOZ A;  3AU4 A;  1K5D B;  1PFJ A;  4HAZ B;  3A98 B;  1PLS A;  2ELB A;  2RUK B;  5L81 A;  1DDV A;  1XCG A;  4HAY B;  4MT7 A;  4ZRJ A;  4GMV A;  2D2Q A;  4H8S A;  3SUZ A;  3PVU A;  1W1D A;  2Z0Q A;  5C79 A;  5JHG A;  2W2W A;  2Y8G A;  4YON A;  1EVH A;  1SGH A;  4K2P A;  4BBK A;  1KI1 B;  3GYP A;  1J19 A;  2D11 A;  1EGX A;  1XKE A;  2M14 A;  2K2U A;  2DKQ A;  1GG3 A;  2LYD A;  2DFK A;  3D8F A;  5D3V A;  2YS1 A;  1BAK A;  2MDX A;  1XX0 A;  1UPQ A;  4TKN A;  1WI1 A;  3PZD A;  3MDB C;  2EJ8 A;  1NTY A;  2EMT A;  1X86 A;  2DYN A;  1U2B A;  3KRW A;  2OQB A;  2I1K A;  1V5U A;  1XOD A;  5DI9 B;  2ADZ A;  4A5K A;  5J3Y A;  5LON B;  2FJL A;  2DA0 A;  4MK0 A;  2DHK A;  1E5W A;  2DHI A;  2W2X C;  2X18 A;  5KCV A;  1V89 A;  3RCP A;  1P5T A;  2P0H A;  1X05 A;  1UNP A;  1V5M A;  4KHA A;  4A6K A;  1EAZ A;  2KUP A;  2DX5 A;  4GN1 A;  3BJI A;  1FGY A;  1KZG A;  2E2X A;  1WJM A;  5JLJ B;  1DRO A;  1UNQ A;  1PMS A;  1V5P A;  5FI1 A;  4GMX B;  3U7D A;  3TW1 A;  2UZR A;  1NI2 A;  1X1G A;  1ISN A;  3GYO A;  5LOP B;  3O96 A;  3UZT A;  4CYE A;  1UPR A;  4K2O A;  4PQ0 A;  2NZ8 B;  2PZ1 A;  3PVW A;  4EKU A;  2DX1 A;  2MFQ A;  3P7Z A;  2K2J A;  1WGU A;  4MY6 A;  5C5B B;  2VKI A;  2YT1 A;  1LW3 A;  4IAP A;  1FHX A;  1MIZ B;  1BTK A;  1SHC A;  1W1G A;  4ZRI A;  4L6E A;  4WJ7 A;  5KQ1 A;  4HB2 B;  2R0D A;  3U8Z A;  1TJ6 A;  2DHJ A;  1TXD A;  1Y19 B;  2IFS A;  2KGX B;  3F0W A;  2ROV A;  2CRF A;  4F7U P;  1GC6 A;  2AL6 A;  5C16 A;  2K00 A;  4DX8 A;  3TCA A;  3ODW A;  4B6H A;  2QKL A;  2I1J A;  2ROZ B;  1OMW A;  1ZC4 B;  5GOW B;  1NTV A;  3G9W A;  2EMS A;  5CLL B;  3WA0 A;  2LOX A;  1U27 A;  5EFX A;  5HE3 A;  3HQC A;  3DXC A;  3HW2 B;  3HK0 A;  1DDW A;  1KZ7 A;  2N23 A;  2Y8F A;  1AWE A;  3PVL A;  3WYF B;  1WGQ A;  1ZSQ A;  4HDO A;  1DDM A;  4CHM A;  3N7C A;  3T06 A;  2DKP A;  2D9X A;  2UZS A;  1MKE A;  4Z2N A;  5J3T A;  3ZVR A;  1M7E A;  4A6F B;  2L2I A;  1FGZ A;  2Z0O A;  5HE2 A;  4EMO A;  5J3Q A;  2GCJ A;  2GJY A;  1P3R A;  3A8P A;  2LUL A;  5JHH A;  3CXB B;  3QBV B;  4A6H A;  2YF0 A;  2D9Y A;  5D3Y A;  4HDQ A;  1N3H A;  2YT0 A;  4DX9 0;  2CAY A;  3F5R A;  4DXA B;  4WSF A;  1H4R A;  2QKM A;  3AJ4 A;  2J0K A;  2DYQ A;  4HAX B;  1NU2 A;  1TQZ A;  1U29 A;  2D9V A;  2N0Y A;  3AU5 A;  4GXB A;  1BTN A;  3TVV A;  3FM8 C;  5C5B A;  5FI0 A;  5D3W A;  1FHW A;  1W1H A;  1QQG A;  1FHO A;  4KHO A;  2ZPY A;  2AEH A;  2Z0P A;  2Q13 A;  3ODO A;  2LKO A;  2RVB B;  4KAX B;  1LB1 A;  3PP2 A;  1DBH A;  3MPX A;  1V88 A;  4ZRK A;  2Y7B A;  5D3X A;  2RSG A;  2ELA A;  2NMB A;  1WJ1 A;  3TO1 A;  3ML4 A;  1XR0 B;  3PG7 A;  2D10 A;  1WG7 A;  2YS3 A;  4C0A A;  2J0J A;  2YSZ A;  1DYN A;  3P6A A;  1M7R A;  2EC1 A;  4PNK A;  2G35 A;  2IYB A;  3NSU A;  1OY2 A;  2P0D A;  4NY0 A;  4IOY X;  1ZM0 A;  3ZDT A;  4HAW B;  3SO6 A;  4K17 A;  3CIK A;  4F7G A;  4Y94 A;  1J0W A;  4HB0 B;  2J59 M;  4P7I A;  1RJ2 A;  2LG1 A;  3BIN A;  1X11 A;  2D4Q A;  1Q67 A;  3FSS A;  4A6F A;  5CLQ B;  1MIX A;  2RLO A;  2RNR B;  3FEH A;  1ZVR A;  4F7H A;  3LJU X;  2DTC A;  1B55 A;  2YVC A;  1U5G A;  3D8E A;  3VOQ A;  4GPT B;  2YS5 A;  2J0M A;  4HAV B;  5DIF B;  1FOE A;  3VIA A;  4K81 A;  1MK7 B;  3KSY A;  1U5E A;  3QIJ A;  2DN6 A;  2W2X D;  1MPH A;  2UVM A;  2CY4 A;  4HAU B;  1H10 A;  1GC7 A;  1QC6 A;  1AQC A;  3KY9 A;  2VRW B;  2COA A;  2H7D A;  4HAT B;  1BWN A;  2P0F A;  2M38 A;  2COD A;  1Y5O A;  1EF1 A;  2BCJ A;  1U5F A;  3A8Q A;  1U5D A;  3DXD A;  2V76 A;  2VSZ A;  2L1C A;  3IVF A;  2KCJ A;  1I2H A;  1IRS A;  2P8V A;  1FB8 A;  5HE0 A;  5KQ4 A;  3ULB A;  3TFM A;  4YL8 A;  4D0N B;  1X1F A;  2MKR A;  3DXE A;  3ODX A;  3KRX A;  5DHA B;  4CHJ A;  1XD4 A;  2RGN B;  2MWN B;  3ULC A;  1WVH A;  1Z87 A;  3D8D A;  1ZC3 B;  2D9W A;  4GZU A;  4HB4 B;  5C6R A;  1V61 A;  4Z2M B;  4DBB A;  2CY5 A;  3SNH A;  2XQN M;  3KZ1 A;  4XWX A;  3SV1 A;  2GS0 A;  1P6S A;  4EJN A;  5HE1 A;  1UNR A;  4HB3 B; 
#chains in the Genus database with same CATH topology
 4OSN A;  2I5F A;  4WVF B;  5JP4 A;  3X23 A;  3M1I B;  2COF A;  1UEF A;  4TYZ A;  2JP2 A;  5D27 A;  4L1R A;  1MAI A;  3PSC A;  4HHV A;  2YRY A;  2GCL A;  1RRP B;  1K5G B;  4KVG B;  1MK9 B;  2D9Z A;  1OQN A;  4NSW A;  5DHF B;  2COC A;  3V5W A;  2HTH B;  3OAN A;  1FAO A;  1I7A A;  2HE7 A;  3PEG A;  5DH9 B;  4IFS A;  3SYX A;  4HSI A;  2I5C A;  2H7E A;  2DLW A;  2R09 A;  4KHB B;  2OTX A;  3QWM A;  1T77 A;  2LOZ A;  3AU4 A;  1K5D B;  1PFJ A;  4HAZ B;  3A98 B;  1PLS A;  2ELB A;  2RUK B;  2ZKM X;  5L81 A;  1DDV A;  1XCG A;  4HAY B;  4MT7 A;  4ZRJ A;  4GMV A;  2D2Q A;  4H8S A;  3NW8 A;  3SUZ A;  3PVU A;  5IRS A;  1W1D A;  2Z0Q A;  5C79 A;  5JHG A;  4GNK B;  2W2W A;  2Y8G A;  4YON A;  1EVH A;  1SGH A;  4K2P A;  4BBK A;  1KI1 B;  2Z4D A;  3GYP A;  1J19 A;  2D11 A;  1EGX A;  1XKE A;  2KIG A;  2M14 A;  2K2U A;  2DKQ A;  1GG3 A;  2LYD A;  2DFK A;  3D8F A;  5D3V A;  2YS1 A;  1BAK A;  2GUM A;  2MDX A;  1XX0 A;  4QJ5 B;  1UPQ A;  4TKN A;  1WI1 A;  3PZD A;  3MDB C;  2EJ8 A;  1NTY A;  2EMT A;  1X86 A;  2R2Y A;  2DYN A;  1U2B A;  5LG4 B;  3KRW A;  2OQB A;  2I1K A;  1ZYI A;  1V5U A;  1XOD A;  5DI9 B;  2ADZ A;  4A5K A;  2NBV A;  5J3Y A;  5LON B;  2FJL A;  2DA0 A;  4MK0 A;  2DHK A;  1E5W A;  2DHI A;  2W2X C;  2X18 A;  5KCV A;  1V89 A;  2K49 A;  3RCP A;  1P5T A;  3U12 A;  2P0H A;  1X05 A;  1UNP A;  3A58 A;  1V5M A;  4KHA A;  4A6K A;  1EAZ A;  2KUQ A;  2KUP A;  2DX5 A;  4GN1 A;  3BJI A;  1FGY A;  1KZG A;  2E2X A;  1WJM A;  5JLJ B;  1DRO A;  1UNQ A;  1PMS A;  1V5P A;  3DCX A;  5FI1 A;  4GMX B;  3U7D A;  3TW1 A;  4KHB A;  2UZR A;  1NI2 A;  1X1G A;  1ISN A;  3GYO A;  5LOP B;  3O96 A;  3NWF A;  3UZT A;  4CYE A;  1UPR A;  4K2O A;  4PQ0 A;  2NZ8 B;  2PZ1 A;  3PVW A;  4EKU A;  2DX1 A;  2MFQ A;  3P7Z A;  2K2J A;  1WGU A;  4MY6 A;  5C5B B;  2VKI A;  3OHM B;  2YT1 A;  1LW3 A;  2YT2 A;  4IAP A;  1FHX A;  1MIZ B;  1BTK A;  1SHC A;  1W1G A;  4ZRI A;  4L6E A;  4WJ7 A;  5KQ1 A;  4HB2 B;  3HIE A;  2R0D A;  3U8Z A;  1TJ6 A;  2DHJ A;  1TXD A;  1Y19 B;  2IFS A;  2KGX B;  3F0W A;  2ROV A;  2CRF A;  4F7U P;  1GC6 A;  2AL6 A;  5C16 A;  2K00 A;  2RRF A;  4DX8 A;  3TCA A;  3ODW A;  4B6H A;  2QKL A;  2I1J A;  2ROZ B;  1OMW A;  1ZC4 B;  5GOW B;  1NTV A;  3G9W A;  2EMS A;  5CLL B;  3WA0 A;  2LOX A;  1U27 A;  5EFX A;  5HE3 A;  3HQC A;  3DXC A;  3HW2 B;  3HK0 A;  1DDW A;  1KZ7 A;  2N23 A;  2Y8F A;  1AWE A;  3PVL A;  2Z14 A;  3WYF B;  1WGQ A;  1ZSQ A;  4HDO A;  1DDM A;  4CHM A;  5I2S A;  3N7C A;  3T06 A;  2DKP A;  2D9X A;  2UZS A;  1MKE A;  3NWD A;  4Z2N A;  5J3T A;  3ZVR A;  1M7E A;  4A6F B;  2L2I A;  1FGZ A;  2Z0O A;  5HE2 A;  4EMO A;  5J3Q A;  2GCJ A;  2GJY A;  1P3R A;  2Z13 A;  3A8P A;  2LUL A;  5JHH A;  3CXB B;  3QBV B;  4A6H A;  2YF0 A;  2D9Y A;  5D3Y A;  1MI1 A;  4HDQ A;  1N3H A;  2YT0 A;  5M4Y B;  4DX9 0;  2CAY A;  3F5R A;  4DXA B;  4WSF A;  1H4R A;  2QKM A;  3AJ4 A;  2J0K A;  2DYQ A;  4HAX B;  1NU2 A;  1TQZ A;  1U29 A;  2D9V A;  2N0Y A;  3FVC A;  4QJ3 B;  3AU5 A;  4GXB A;  1BTN A;  3TVV A;  4QJ4 B;  3FM8 C;  2K8E A;  5C5B A;  5FI0 A;  5D3W A;  1FHW A;  2KIE A;  1W1H A;  1QQG A;  1FHO A;  4KHO A;  2ZPY A;  2AEH A;  2Z0P A;  2Q13 A;  3ODO A;  2LKO A;  2RVB B;  4KAX B;  1LB1 A;  1DBH A;  3PP2 A;  3MPX A;  1V88 A;  4ZRK A;  2Y7B A;  5D3X A;  2RSG A;  2ELA A;  2NMB A;  1WJ1 A;  3HSA A;  3TO1 A;  3ML4 A;  4GOU A;  1XR0 B;  3PG7 A;  2D10 A;  1WG7 A;  2YS3 A;  4C0A A;  2J0J A;  2YSZ A;  1DYN A;  3P6A A;  1M7R A;  2EC1 A;  4PNK A;  2G35 A;  2IYB A;  3NSU A;  1OY2 A;  2P0D A;  4NY0 A;  4IOY X;  4OT1 A;  1ZM0 A;  3ZDT A;  4HAW B;  3SO6 A;  4K17 A;  3CIK A;  4F7G A;  4Y94 A;  1J0W A;  4HB0 B;  2J59 M;  4P7I A;  1RJ2 A;  2LG1 A;  3BIN A;  1X11 A;  2D4Q A;  1Q67 A;  3FSS A;  4A6F A;  5CLQ B;  1MIX A;  2RLO A;  2RNR B;  3FEH A;  1ZVR A;  4F7H A;  3LJU X;  2DTC A;  1B55 A;  2YVC A;  1U5G A;  3D8E A;  3VOQ A;  4GPT B;  2YS5 A;  2J0M A;  4HAV B;  5DIF B;  4D6W A;  1FOE A;  3VIA A;  5I2M A;  4K81 A;  1MK7 B;  3KSY A;  4DIX A;  1U5E A;  3QIJ A;  3NWA A;  2DN6 A;  4CSQ A;  2W2X D;  4QXA B;  1MPH A;  2UVM A;  2Z59 A;  2CY4 A;  4HAU B;  1H10 A;  1GC7 A;  1QC6 A;  1AQC A;  3KY9 A;  2VRW B;  2COA A;  2H7D A;  4HAT B;  1BWN A;  2P0F A;  3B77 A;  2M38 A;  2COD A;  1Y5O A;  1EF1 A;  2BCJ A;  1U5F A;  3A8Q A;  1U5D A;  3DXD A;  2V76 A;  2VSZ A;  2L1C A;  3IVF A;  2KCJ A;  1I2H A;  1IRS A;  2P8V A;  1FB8 A;  2KR0 A;  5HE0 A;  5KQ4 A;  3ULB A;  3TFM A;  4YL8 A;  4D0N B;  1X1F A;  2MKR A;  3DXE A;  3ODX A;  3KRX A;  5DHA B;  4CHJ A;  1XD4 A;  2RGN B;  2MWN B;  3ULC A;  1WVH A;  1Z87 A;  3D8D A;  1ZC3 B;  2D9W A;  4GZU A;  4HB4 B;  5C6R A;  1V61 A;  4Z2M B;  4DBB A;  2CY5 A;  3SNH A;  2FJU B;  2XQN M;  3KZ1 A;  4XWX A;  3SV1 A;  2GS0 A;  1P6S A;  4EJN A;  5HE1 A;  1UNR A;  4HB3 B; 
#chains in the Genus database with same CATH homology
 2I5F A;  4WVF B;  5JP4 A;  3X23 A;  3M1I B;  2COF A;  1UEF A;  4TYZ A;  2JP2 A;  5D27 A;  1MAI A;  3PSC A;  4HHV A;  2YRY A;  2GCL A;  1RRP B;  1K5G B;  4KVG B;  1MK9 B;  2D9Z A;  1OQN A;  4NSW A;  5DHF B;  2COC A;  3V5W A;  2HTH B;  3OAN A;  1FAO A;  1I7A A;  2HE7 A;  3PEG A;  5DH9 B;  4IFS A;  3SYX A;  2I5C A;  2H7E A;  2DLW A;  2R09 A;  4KHB B;  2OTX A;  3QWM A;  2LOZ A;  3AU4 A;  1K5D B;  1PFJ A;  4HAZ B;  3A98 B;  1PLS A;  2ELB A;  2RUK B;  5L81 A;  1DDV A;  1XCG A;  4HAY B;  4MT7 A;  4ZRJ A;  4GMV A;  2D2Q A;  4H8S A;  3SUZ A;  3PVU A;  1W1D A;  2Z0Q A;  5C79 A;  5JHG A;  2W2W A;  2Y8G A;  4YON A;  1EVH A;  1SGH A;  4K2P A;  4BBK A;  1KI1 B;  3GYP A;  1J19 A;  2D11 A;  1EGX A;  1XKE A;  2M14 A;  2K2U A;  2DKQ A;  1GG3 A;  2LYD A;  2DFK A;  3D8F A;  5D3V A;  2YS1 A;  1BAK A;  2MDX A;  1XX0 A;  1UPQ A;  4TKN A;  1WI1 A;  3PZD A;  3MDB C;  2EJ8 A;  1NTY A;  2EMT A;  1X86 A;  2DYN A;  1U2B A;  3KRW A;  2OQB A;  2I1K A;  1V5U A;  1XOD A;  5DI9 B;  2ADZ A;  4A5K A;  5J3Y A;  5LON B;  2FJL A;  2DA0 A;  4MK0 A;  2DHK A;  1E5W A;  2DHI A;  2W2X C;  2X18 A;  5KCV A;  1V89 A;  3RCP A;  1P5T A;  2P0H A;  1X05 A;  1UNP A;  1V5M A;  4KHA A;  4A6K A;  1EAZ A;  2KUP A;  2DX5 A;  4GN1 A;  3BJI A;  1FGY A;  1KZG A;  2E2X A;  1WJM A;  5JLJ B;  1DRO A;  1UNQ A;  1PMS A;  1V5P A;  5FI1 A;  4GMX B;  3U7D A;  3TW1 A;  2UZR A;  1NI2 A;  1X1G A;  1ISN A;  3GYO A;  5LOP B;  3O96 A;  3UZT A;  4CYE A;  1UPR A;  4K2O A;  4PQ0 A;  2NZ8 B;  2PZ1 A;  3PVW A;  4EKU A;  2DX1 A;  2MFQ A;  3P7Z A;  2K2J A;  1WGU A;  4MY6 A;  5C5B B;  2VKI A;  2YT1 A;  1LW3 A;  4IAP A;  1FHX A;  1MIZ B;  1BTK A;  1SHC A;  1W1G A;  4ZRI A;  4L6E A;  4WJ7 A;  5KQ1 A;  4HB2 B;  2R0D A;  3U8Z A;  1TJ6 A;  2DHJ A;  1TXD A;  1Y19 B;  2IFS A;  2KGX B;  3F0W A;  2ROV A;  2CRF A;  4F7U P;  1GC6 A;  2AL6 A;  5C16 A;  2K00 A;  4DX8 A;  3TCA A;  3ODW A;  4B6H A;  2QKL A;  2I1J A;  2ROZ B;  1OMW A;  1ZC4 B;  5GOW B;  1NTV A;  3G9W A;  2EMS A;  5CLL B;  3WA0 A;  2LOX A;  1U27 A;  5EFX A;  5HE3 A;  3HQC A;  3DXC A;  3HW2 B;  3HK0 A;  1DDW A;  1KZ7 A;  2N23 A;  2Y8F A;  1AWE A;  3PVL A;  3WYF B;  1WGQ A;  1ZSQ A;  4HDO A;  1DDM A;  4CHM A;  3N7C A;  3T06 A;  2DKP A;  2D9X A;  2UZS A;  1MKE A;  4Z2N A;  5J3T A;  3ZVR A;  1M7E A;  4A6F B;  2L2I A;  1FGZ A;  2Z0O A;  5HE2 A;  4EMO A;  5J3Q A;  2GCJ A;  2GJY A;  1P3R A;  3A8P A;  2LUL A;  5JHH A;  3CXB B;  3QBV B;  4A6H A;  2YF0 A;  2D9Y A;  5D3Y A;  4HDQ A;  1N3H A;  2YT0 A;  4DX9 0;  2CAY A;  3F5R A;  4DXA B;  4WSF A;  1H4R A;  2QKM A;  3AJ4 A;  2J0K A;  2DYQ A;  4HAX B;  1NU2 A;  1TQZ A;  1U29 A;  2D9V A;  2N0Y A;  3AU5 A;  4GXB A;  1BTN A;  3TVV A;  3FM8 C;  5C5B A;  5FI0 A;  5D3W A;  1FHW A;  1W1H A;  1QQG A;  1FHO A;  4KHO A;  2ZPY A;  2AEH A;  2Z0P A;  2Q13 A;  3ODO A;  2LKO A;  2RVB B;  4KAX B;  1LB1 A;  3PP2 A;  1DBH A;  3MPX A;  1V88 A;  4ZRK A;  2Y7B A;  5D3X A;  2RSG A;  2ELA A;  2NMB A;  1WJ1 A;  3TO1 A;  3ML4 A;  1XR0 B;  3PG7 A;  2D10 A;  1WG7 A;  2YS3 A;  4C0A A;  2J0J A;  2YSZ A;  1DYN A;  3P6A A;  1M7R A;  2EC1 A;  4PNK A;  2G35 A;  2IYB A;  3NSU A;  1OY2 A;  2P0D A;  4NY0 A;  4IOY X;  1ZM0 A;  3ZDT A;  4HAW B;  3SO6 A;  4K17 A;  3CIK A;  4F7G A;  4Y94 A;  1J0W A;  4HB0 B;  2J59 M;  4P7I A;  1RJ2 A;  2LG1 A;  3BIN A;  1X11 A;  2D4Q A;  1Q67 A;  3FSS A;  4A6F A;  5CLQ B;  1MIX A;  2RLO A;  2RNR B;  3FEH A;  1ZVR A;  4F7H A;  3LJU X;  2DTC A;  1B55 A;  2YVC A;  1U5G A;  3D8E A;  3VOQ A;  4GPT B;  2YS5 A;  2J0M A;  4HAV B;  5DIF B;  1FOE A;  3VIA A;  4K81 A;  1MK7 B;  3KSY A;  1U5E A;  3QIJ A;  2DN6 A;  2W2X D;  1MPH A;  2UVM A;  2CY4 A;  4HAU B;  1H10 A;  1GC7 A;  1QC6 A;  1AQC A;  3KY9 A;  2VRW B;  2COA A;  2H7D A;  4HAT B;  1BWN A;  2P0F A;  2M38 A;  2COD A;  1Y5O A;  1EF1 A;  2BCJ A;  1U5F A;  3A8Q A;  1U5D A;  3DXD A;  2V76 A;  2VSZ A;  2L1C A;  3IVF A;  2KCJ A;  1I2H A;  1IRS A;  2P8V A;  1FB8 A;  5HE0 A;  5KQ4 A;  3ULB A;  3TFM A;  4YL8 A;  4D0N B;  1X1F A;  2MKR A;  3DXE A;  3ODX A;  3KRX A;  5DHA B;  4CHJ A;  1XD4 A;  2RGN B;  2MWN B;  3ULC A;  1WVH A;  1Z87 A;  3D8D A;  1ZC3 B;  2D9W A;  4GZU A;  4HB4 B;  5C6R A;  1V61 A;  4Z2M B;  4DBB A;  2CY5 A;  3SNH A;  2XQN M;  3KZ1 A;  4XWX A;  3SV1 A;  2GS0 A;  1P6S A;  4EJN A;  5HE1 A;  1UNR A;  4HB3 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...