2ROVA

The split ph domain of rock ii
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
117
structure length
117
Chain Sequence
SRLEGWLSLPVRNNTKKFGWVKKYVIVSSKKILFYDSEQDKEQSNPYMVLDIDKLFHVRPVTQTDVYRADAKEIPRIFQILYANEGISSAKNLLLLANSTEEQQKWVSRLVKKIPKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Rho-associated protein kinase 2
publication title The split PH domain of ROCK II
rcsb
source organism Rattus norvegicus
molecule tags Transferase
total genus 18
structure length 117
sequence length 117
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2008-04-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2rovA00
2RUKB 2GCJA 4GMVA 1I2HA 1WJMA 2UVMA 3N7CA 2DHIA 1AQCA 2DYNA 1U29A 5FI0A 2I1KA 3OANA 5GOWB 1UNPA 2ELBA 4HB3B 4CHJA 3SYXA 3ZVRA 1SGHA 4TYZA 2LOZA 2L2IA 5D3YA 2DA0A 2QKLA 4GPTB 5C5BB 4HDOA 1W1DA 5KQ4A 1UNRA 3T06A 3SNHA 1WGUA 1SHCA 1V5MA 3AU5A 2D11A 2N23A 2D9ZA 2H7DA 3WYFB 2LG1A 3GYOA 4IAPA 2RGNB 5J3QA 3X23A 2ADZA 3P7ZA 4NSWA 1M7RA 1U27A 2IFSA 4HB2B 4EMOA 2HTHB 2I5CA 3DXDA 1V61A 1P6SA 4HAYB 5EFXA 2D9WA 2YRYA 3NSUA 1ZVRA 4F7UP 5CLLB 4B6HA 3LJUX 1EF1A 1Y5OA 4H8SA 5JHGA 2OTXA 1KI1B 1W1HA 3AJ4A 4DBBA 2CRFA 1J0WA 3CXBB 5HE0A 1U5DA 3TFMA 1X11A 1ZSQA 2GS0A 2RVBB 4YONA 2CODA 3KRWA 4D0NB 5KQ1A 4KHBB 1NTYA 1XR0B 1MK7B 2L1CA 4A6HA 1WVHA 4HHVA 3D8DA 2Y8FA 5LONB 4MK0A 1X1GA 4Z2MB 1PLSA 3TO1A 2CY5A 3PVLA 3M1IB 3SUZA 3A98B 1K5GB 1MK9B 1FOEA 4L6EA 3F5RA 2K00A 2YF0A 5DHAB 3CIKA 1DDWA 3ODXA 1ISNA 2DKPA 3RCPA 1V5UA 3PEGA 1B55A 2DFKA 3O96A 1XODA 1FAOA 2Z0PA 2J0MA 4WSFA 1X86A 3FEHA 4Z2NA 4PQ0A 4Y94A 2DHJA 2OQBA 2COCA 2MFQA 1ZM0A 2YS5A 1TQZA 5D3WA 3AU4A 4K81A 1PMSA 1WG7A 2AL6A 2ZPYA 2D2QA 2VSZA 4ZRJA 2Z0OA 2COAA 1DROA 2LOXA 4HB0B 1RRPB 2N0YA 4IOYX 1K5DB 2J0KA 4KHAA 2W2WA 2PZ1A 2W2XD 3ODOA 2JP2A 4A6KA 2V76A 2Y8GA 5J3YA 4GN1A 3KY9A 1ZC3B 4BBKA 1FGYA 2EMSA 3GYPA 1NU2A 2W2XC 3ULCA 5JHHA 1KZ7A 2CAYA 1LB1A 5HE3A 2RSGA 3QWMA 1WJ1A 3U8ZA 4MY6A 5C16A 1FHOA 1M7EA 3DXEA 1TJ6A 1EGXA 4KAXB 2G35A 2LYDA 2Z0QA 2AEHA 1TXDA 2DX1A 1I7AA 2NZ8B 3PVWA 2FJLA 5JLJB 3PVUA 1FGZA 1ZC4B 4YL8A 1PFJA 4HB4B 5C6RA 3MDBC 1DDMA 2K2JA 2P0FA 1MPHA 2YT0A 3HQCA 2M14A 4DX90 5LOPB 2UZSA 1U5GA 5D3XA 4CYEA 3BINA 1XKEA 3PG7A 4TKNA 2DKQA 1EVHA 2ROZB 3FSSA 1NI2A 1N3HA 2ELAA 4WJ7A 1IRSA 2DN6A 2I5FA 3WA0A 1DYNA 1U5EA 2J59M 2YT1A 1QQGA 4HAWB 1RJ2A 1MKEA 4IFSA 1XD4A 2DX5A 2UZRA 1V5PA 2EC1A 4KVGB 5DHFB 1H10A 3KRXA 3KSYA 1UEFA 3IVFA 4GZUA 3FM8C 4EJNA 2YSZA 1X05A 1LW3A 5C79A 4WVFB 2CY4A 3TW1A 2GCLA 3PZDA 4GMXB 1DDVA 2EJ8A 2D10A 1WGQA 3HK0A 4A6FB 2DHKA 2QKMA 4A6FA 2LULA 3PP2A 3MPXA 2DLWA 3D8FA 4K17A 2MWNB 1X1FA 2ROVA 1UNQA 3D8EA 4HATB 1Y19B 3U7DA 3VIAA 3VOQA 1NTVA 1GG3A 1XX0A 5CLQB 5C5BA 5FI1A 4HDQA 2M38A 2RNRB 5D3VA 4F7GA 5L81A 2YS3A 1WI1A 4F7HA 2Q13A 2XQNM 3F0WA 3BJIA 4A5KA 1QC6A 5HE1A 2R0DA 2YS1A 1UPRA 1U5FA 1P3RA 4C0AA 1J19A 2DYQA 3HW2B 3ML4A 3PSCA 4DX8A 4MT7A 3QIJA 3SO6A 1FB8A 3G9WA 2EMTA 2I1JA 1V89A 2COFA 2MDXA 4K2PA 1E5WA 1AWEA 2YVCA 2VKIA 1P5TA 2GJYA 4CHMA 1BTKA 2BCJA 2J0JA 4GXBA 5HE2A 4PNKA 3A8PA 1U2BA 1EAZA 4DXAB 2VRWB 1Q67A 3P6AA 2KCJA 1V88A 1BWNA 1FHWA 3ULBA 3V5WA 2D9YA 4KHOA 3TCAA 3KZ1A 2X18A 4HAVB 4NY0A 1OQNA 2R09A 2P0HA 2KUPA 1BTNA 3DXCA 4EKUA 3UZTA 4P7IA 1DBHA 2E2XA 1FHXA 1W1GA 4HAZB 5DI9B 2D9XA 1UPQA 2K2UA 1GC6A 2P0DA 1GC7A 3A8QA 4HAXB 2Y7BA 1XCGA 3QBVB 4ZRIA 5KCVA 4HAUB 2RLOA 2LKOA 2NMBA 5D27A 2D9VA 2D4QA 5DH9B 3SV1A 5JP4A 2MKRA 2P8VA 3ZDTA 1OY2A 1Z87A 2IYBA 1MIXA 1MAIA 5DIFB 1BAKA 2KGXB 2DTCA 2H7EA 1KZGA 4ZRKA 1OMWA 1H4RA 3TVVA 3ODWA 2HE7A 1MIZB 5J3TA 4K2OA 4XWXA
chains in the Genus database with same CATH superfamily
2RUKB 1ZYIA 2GCJA 3NWFA 1I2HA 1WJMA 4GMVA 2UVMA 3N7CA 2DHIA 1AQCA 2DYNA 2Z59A 3NWDA 1U29A 5FI0A 2I1KA 3OANA 5GOWB 1UNPA 2ELBA 4HB3B 4CHJA 3SYXA 3ZVRA 1SGHA 4TYZA 2LOZA 2L2IA 5D3YA 2DA0A 2QKLA 4GPTB 5C5BB 4HDOA 1W1DA 4OSNA 5KQ4A 1UNRA 3T06A 3SNHA 1WGUA 1SHCA 1V5MA 3AU5A 2D11A 2N23A 2D9ZA 2H7DA 5I2MA 3WYFB 2LG1A 3GYOA 4XWXA 4IAPA 3NW8A 2RGNB 5J3QA 3X23A 2ADZA 3P7ZA 4NSWA 1M7RA 1U27A 2IFSA 4HB2B 4EMOA 2HTHB 2I5CA 3DXDA 1V61A 1P6SA 4HAYB 5EFXA 2D9WA 2YRYA 3NSUA 1ZVRA 4F7UP 5CLLB 4B6HA 3LJUX 1EF1A 1Y5OA 4D6WA 4H8SA 5JHGA 2OTXA 1KI1B 1W1HA 3AJ4A 4DBBA 3B77A 3HIEA 2CRFA 1J0WA 1MI1A 3CXBB 5HE0A 1U5DA 3TFMA 1X11A 4DIXA 1ZSQA 2GS0A 2RVBB 4YONA 2CODA 3KRWA 4D0NB 5KQ1A 4KHBB 1NTYA 4KHBA 1XR0B 1MK7B 5LG4B 2L1CA 4A6HA 1WVHA 4HHVA 3D8DA 2Y8FA 5LONB 4MK0A 1X1GA 4Z2MB 1PLSA 3TO1A 2CY5A 3PVLA 3M1IB 3SUZA 3A98B 1K5GB 1MK9B 1FOEA 4L6EA 3F5RA 2K00A 2YF0A 5DHAB 3CIKA 1DDWA 3ODXA 1ISNA 2DKPA 2K49A 1V5UA 3NWAA 3PEGA 1B55A 3RCPA 2KIEA 2DFKA 3O96A 1XODA 1FAOA 2Z0PA 2J0MA 4WSFA 1X86A 3FEHA 4Z2NA 4PQ0A 4Y94A 2DHJA 2GUMA 2OQBA 2COCA 2MFQA 1ZM0A 2KUQA 2YS5A 1TQZA 5D3WA 3AU4A 4K81A 1PMSA 1WG7A 2AL6A 2ZPYA 2D2QA 2VSZA 4ZRJA 2Z0OA 2COAA 1DROA 2LOXA 4HB0B 1RRPB 2N0YA 4IOYX 1K5DB 2J0KA 4KHAA 2W2WA 2PZ1A 2W2XD 2Z4DA 4GNKB 3ODOA 2JP2A 4A6KA 2V76A 2Y8GA 5J3YA 4GN1A 3KY9A 1ZC3B 4BBKA 1FGYA 2RRFA 2EMSA 4QJ4B 3GYPA 1NU2A 2W2XC 3ULCA 5JHHA 1KZ7A 2CAYA 1LB1A 5HE3A 2RSGA 3QWMA 1WJ1A 2Z13A 3U8ZA 4MY6A 5C16A 1FHOA 1M7EA 3DXEA 1TJ6A 1EGXA 4KAXB 2G35A 2LYDA 2Z0QA 2AEHA 4CSQA 1TXDA 2DX1A 1I7AA 2NZ8B 3PVWA 2FJLA 5JLJB 2KR0A 3PVUA 1FGZA 1ZC4B 4YL8A 1PFJA 4HB4B 5C6RA 3MDBC 1DDMA 2K2JA 2P0FA 1MPHA 2YT0A 3HQCA 2M14A 4DX90 5LOPB 4QJ5B 2KIGA 1U5GA 2UZSA 5D3XA 4CYEA 3BINA 1XKEA 3PG7A 4QJ3B 4TKNA 2DKQA 1EVHA 2ROZB 3FSSA 1NI2A 1N3HA 2ELAA 4WJ7A 1IRSA 2DN6A 2I5FA 3WA0A 1DYNA 1U5EA 2J59M 2YT1A 1QQGA 4HAWB 1RJ2A 1MKEA 4IFSA 2ZKMX 1XD4A 2DX5A 2UZRA 1V5PA 2EC1A 4KVGB 5DHFB 1H10A 3KRXA 3KSYA 1UEFA 3IVFA 4GOUA 4GZUA 3FM8C 4EJNA 2YSZA 1X05A 1LW3A 5C79A 4WVFB 2CY4A 3TW1A 4QXAB 2GCLA 2Z14A 3PZDA 4GMXB 1DDVA 2EJ8A 2D10A 1WGQA 3HK0A 4A6FB 2DHKA 2QKMA 4A6FA 1T77A 2LULA 3PP2A 3MPXA 2DLWA 3D8FA 4K17A 2MWNB 1X1FA 2ROVA 1UNQA 2NBVA 3D8EA 4HATB 1Y19B 2K8EA 3U7DA 3VIAA 3VOQA 1NTVA 1GG3A 1XX0A 5CLQB 5C5BA 5FI1A 4HDQA 2M38A 2RNRB 5D3VA 4F7GA 5L81A 2YS3A 1WI1A 4F7HA 2Q13A 2XQNM 3F0WA 3BJIA 4A5KA 1QC6A 5HE1A 2R0DA 4L1RA 2YS1A 1UPRA 1U5FA 5IRSA 1P3RA 4C0AA 1J19A 2DYQA 3HW2B 3ML4A 3PSCA 4DX8A 4MT7A 3QIJA 3SO6A 1FB8A 3G9WA 2EMTA 2I1JA 1V89A 2COFA 2MDXA 4HSIA 4K2PA 1E5WA 1AWEA 2YVCA 3FVCA 2VKIA 1P5TA 2GJYA 4CHMA 1BTKA 2BCJA 2J0JA 4GXBA 5M4YB 5HE2A 4PNKA 3A8PA 1U2BA 1EAZA 4DXAB 2VRWB 1Q67A 3P6AA 4OT1A 2KCJA 1V88A 1BWNA 1FHWA 3ULBA 3V5WA 2D9YA 4KHOA 3TCAA 3KZ1A 2X18A 4HAVB 4NY0A 1OQNA 2R09A 2P0HA 2KUPA 3OHMB 1BTNA 3DXCA 4EKUA 3UZTA 4P7IA 1DBHA 2E2XA 1FHXA 1W1GA 4HAZB 5DI9B 2D9XA 1UPQA 2YT2A 2K2UA 1GC6A 2P0DA 1GC7A 3A8QA 4HAXB 2Y7BA 1XCGA 3QBVB 4ZRIA 2R2YA 3U12A 5KCVA 3A58A 2RLOA 2LKOA 2NMBA 4HAUB 5I2SA 5D27A 2D9VA 2D4QA 5DH9B 3SV1A 5JP4A 2MKRA 2P8VA 3ZDTA 1OY2A 1Z87A 2IYBA 1MIXA 1MAIA 5DIFB 1BAKA 2KGXB 3DCXA 2DTCA 2H7EA 1KZGA 4ZRKA 1OMWA 1H4RA 3TVVA 3ODWA 2HE7A 1MIZB 5J3TA 3HSAA 4K2OA 2FJUB
chains in the Genus database with same CATH topology
2RUKB 2GCJA 4GMVA 1I2HA 1WJMA 2UVMA 3N7CA 2DHIA 1AQCA 2DYNA 1U29A 5FI0A 2I1KA 3OANA 5GOWB 1UNPA 2ELBA 4HB3B 4CHJA 3SYXA 3ZVRA 1SGHA 4TYZA 2LOZA 2L2IA 5D3YA 2DA0A 2QKLA 4GPTB 5C5BB 4HDOA 1W1DA 5KQ4A 1UNRA 3T06A 3SNHA 1WGUA 1SHCA 1V5MA 3AU5A 2D11A 2N23A 2D9ZA 2H7DA 3WYFB 2LG1A 3GYOA 4IAPA 2RGNB 5J3QA 3X23A 2ADZA 3P7ZA 4NSWA 1M7RA 1U27A 2IFSA 4HB2B 4EMOA 2HTHB 2I5CA 3DXDA 1V61A 1P6SA 4HAYB 5EFXA 2D9WA 2YRYA 3NSUA 1ZVRA 4F7UP 5CLLB 4B6HA 3LJUX 1EF1A 1Y5OA 4H8SA 5JHGA 2OTXA 1KI1B 1W1HA 3AJ4A 4DBBA 2CRFA 1J0WA 3CXBB 5HE0A 1U5DA 3TFMA 1X11A 1ZSQA 2GS0A 2RVBB 4YONA 2CODA 3KRWA 4D0NB 5KQ1A 4KHBB 1NTYA 1XR0B 1MK7B 2L1CA 4A6HA 1WVHA 4HHVA 3D8DA 2Y8FA 5LONB 4MK0A 1X1GA 4Z2MB 1PLSA 3TO1A 2CY5A 3PVLA 3M1IB 3SUZA 3A98B 1K5GB 1MK9B 1FOEA 4L6EA 3F5RA 2K00A 2YF0A 5DHAB 3CIKA 1DDWA 3ODXA 1ISNA 2DKPA 3RCPA 1V5UA 3PEGA 1B55A 2DFKA 3O96A 1XODA 1FAOA 2Z0PA 2J0MA 4WSFA 1X86A 3FEHA 4Z2NA 4PQ0A 4Y94A 2DHJA 2OQBA 2COCA 2MFQA 1ZM0A 2YS5A 1TQZA 5D3WA 3AU4A 4K81A 1PMSA 1WG7A 2AL6A 2ZPYA 2D2QA 2VSZA 4ZRJA 2Z0OA 2COAA 1DROA 2LOXA 4HB0B 1RRPB 2N0YA 4IOYX 1K5DB 2J0KA 4KHAA 2W2WA 2PZ1A 2W2XD 3ODOA 2JP2A 4A6KA 2V76A 2Y8GA 5J3YA 4GN1A 3KY9A 1ZC3B 4BBKA 1FGYA 2EMSA 3GYPA 1NU2A 2W2XC 3ULCA 5JHHA 1KZ7A 2CAYA 1LB1A 5HE3A 2RSGA 3QWMA 1WJ1A 3U8ZA 4MY6A 5C16A 1FHOA 1M7EA 3DXEA 1TJ6A 1EGXA 4KAXB 2G35A 2LYDA 2Z0QA 2AEHA 1TXDA 2DX1A 1I7AA 2NZ8B 3PVWA 2FJLA 5JLJB 3PVUA 1FGZA 1ZC4B 4YL8A 1PFJA 4HB4B 5C6RA 3MDBC 1DDMA 2K2JA 2P0FA 1MPHA 2YT0A 3HQCA 2M14A 4DX90 5LOPB 2UZSA 1U5GA 5D3XA 4CYEA 3BINA 1XKEA 3PG7A 4TKNA 2DKQA 1EVHA 2ROZB 3FSSA 1NI2A 1N3HA 2ELAA 4WJ7A 1IRSA 2DN6A 2I5FA 3WA0A 1DYNA 1U5EA 2J59M 2YT1A 1QQGA 4HAWB 1RJ2A 1MKEA 4IFSA 1XD4A 2DX5A 2UZRA 1V5PA 2EC1A 4KVGB 5DHFB 1H10A 3KRXA 3KSYA 1UEFA 3IVFA 4GZUA 3FM8C 4EJNA 2YSZA 1X05A 1LW3A 5C79A 4WVFB 2CY4A 3TW1A 2GCLA 3PZDA 4GMXB 1DDVA 2EJ8A 2D10A 1WGQA 3HK0A 4A6FB 2DHKA 2QKMA 4A6FA 2LULA 3PP2A 3MPXA 2DLWA 3D8FA 4K17A 2MWNB 1X1FA 2ROVA 1UNQA 3D8EA 4HATB 1Y19B 3U7DA 3VIAA 3VOQA 1NTVA 1GG3A 1XX0A 5CLQB 5C5BA 5FI1A 4HDQA 2M38A 2RNRB 5D3VA 4F7GA 5L81A 2YS3A 1WI1A 4F7HA 2Q13A 2XQNM 3F0WA 3BJIA 4A5KA 1QC6A 5HE1A 2R0DA 2YS1A 1UPRA 1U5FA 1P3RA 4C0AA 1J19A 2DYQA 3HW2B 3ML4A 3PSCA 4DX8A 4MT7A 3QIJA 3SO6A 1FB8A 3G9WA 2EMTA 2I1JA 1V89A 2COFA 2MDXA 4K2PA 1E5WA 1AWEA 2YVCA 2VKIA 1P5TA 2GJYA 4CHMA 1BTKA 2BCJA 2J0JA 4GXBA 5HE2A 4PNKA 3A8PA 1U2BA 1EAZA 4DXAB 2VRWB 1Q67A 3P6AA 2KCJA 1V88A 1BWNA 1FHWA 3ULBA 3V5WA 2D9YA 4KHOA 3TCAA 3KZ1A 2X18A 4HAVB 4NY0A 1OQNA 2R09A 2P0HA 2KUPA 1BTNA 3DXCA 4EKUA 3UZTA 4P7IA 1DBHA 2E2XA 1FHXA 1W1GA 4HAZB 5DI9B 2D9XA 1UPQA 2K2UA 1GC6A 2P0DA 1GC7A 3A8QA 4HAXB 2Y7BA 1XCGA 3QBVB 4ZRIA 5KCVA 4HAUB 2RLOA 2LKOA 2NMBA 5D27A 2D9VA 2D4QA 5DH9B 3SV1A 5JP4A 2MKRA 2P8VA 3ZDTA 1OY2A 1Z87A 2IYBA 1MIXA 1MAIA 5DIFB 1BAKA 2KGXB 2DTCA 2H7EA 1KZGA 4ZRKA 1OMWA 1H4RA 3TVVA 3ODWA 2HE7A 1MIZB 5J3TA 4K2OA 4XWXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RUK B;  2GCJ A;  4GMV A;  1I2H A;  1WJM A;  2UVM A;  3N7C A;  2DHI A;  1AQC A;  2DYN A;  1U29 A;  5FI0 A;  2I1K A;  3OAN A;  5GOW B;  1UNP A;  2ELB A;  4HB3 B;  4CHJ A;  3SYX A;  3ZVR A;  1SGH A;  4TYZ A;  2LOZ A;  2L2I A;  5D3Y A;  2DA0 A;  2QKL A;  4GPT B;  5C5B B;  4HDO A;  1W1D A;  5KQ4 A;  1UNR A;  3T06 A;  3SNH A;  1WGU A;  1SHC A;  1V5M A;  3AU5 A;  2D11 A;  2N23 A;  2D9Z A;  2H7D A;  3WYF B;  2LG1 A;  3GYO A;  4IAP A;  2RGN B;  5J3Q A;  3X23 A;  2ADZ A;  3P7Z A;  4NSW A;  1M7R A;  1U27 A;  2IFS A;  4HB2 B;  4EMO A;  2HTH B;  2I5C A;  3DXD A;  1V61 A;  1P6S A;  4HAY B;  5EFX A;  2D9W A;  2YRY A;  3NSU A;  1ZVR A;  4F7U P;  5CLL B;  4B6H A;  3LJU X;  1EF1 A;  1Y5O A;  4H8S A;  5JHG A;  2OTX A;  1KI1 B;  1W1H A;  3AJ4 A;  4DBB A;  2CRF A;  1J0W A;  3CXB B;  5HE0 A;  1U5D A;  3TFM A;  1X11 A;  1ZSQ A;  2GS0 A;  2RVB B;  4YON A;  2COD A;  3KRW A;  4D0N B;  5KQ1 A;  4KHB B;  1NTY A;  1XR0 B;  1MK7 B;  2L1C A;  4A6H A;  1WVH A;  4HHV A;  3D8D A;  2Y8F A;  5LON B;  4MK0 A;  1X1G A;  4Z2M B;  1PLS A;  3TO1 A;  2CY5 A;  3PVL A;  3M1I B;  3SUZ A;  3A98 B;  1K5G B;  1MK9 B;  1FOE A;  4L6E A;  3F5R A;  2K00 A;  2YF0 A;  5DHA B;  3CIK A;  1DDW A;  3ODX A;  1ISN A;  2DKP A;  3RCP A;  1V5U A;  3PEG A;  1B55 A;  2DFK A;  3O96 A;  1XOD A;  1FAO A;  2Z0P A;  2J0M A;  4WSF A;  1X86 A;  3FEH A;  4Z2N A;  4PQ0 A;  4Y94 A;  2DHJ A;  2OQB A;  2COC A;  2MFQ A;  1ZM0 A;  2YS5 A;  1TQZ A;  5D3W A;  3AU4 A;  4K81 A;  1PMS A;  1WG7 A;  2AL6 A;  2ZPY A;  2D2Q A;  2VSZ A;  4ZRJ A;  2Z0O A;  2COA A;  1DRO A;  2LOX A;  4HB0 B;  1RRP B;  2N0Y A;  4IOY X;  1K5D B;  2J0K A;  4KHA A;  2W2W A;  2PZ1 A;  2W2X D;  3ODO A;  2JP2 A;  4A6K A;  2V76 A;  2Y8G A;  5J3Y A;  4GN1 A;  3KY9 A;  1ZC3 B;  4BBK A;  1FGY A;  2EMS A;  3GYP A;  1NU2 A;  2W2X C;  3ULC A;  5JHH A;  1KZ7 A;  2CAY A;  1LB1 A;  5HE3 A;  2RSG A;  3QWM A;  1WJ1 A;  3U8Z A;  4MY6 A;  5C16 A;  1FHO A;  1M7E A;  3DXE A;  1TJ6 A;  1EGX A;  4KAX B;  2G35 A;  2LYD A;  2Z0Q A;  2AEH A;  1TXD A;  2DX1 A;  1I7A A;  2NZ8 B;  3PVW A;  2FJL A;  5JLJ B;  3PVU A;  1FGZ A;  1ZC4 B;  4YL8 A;  1PFJ A;  4HB4 B;  5C6R A;  3MDB C;  1DDM A;  2K2J A;  2P0F A;  1MPH A;  2YT0 A;  3HQC A;  2M14 A;  4DX9 0;  5LOP B;  2UZS A;  1U5G A;  5D3X A;  4CYE A;  3BIN A;  1XKE A;  3PG7 A;  4TKN A;  2DKQ A;  1EVH A;  2ROZ B;  3FSS A;  1NI2 A;  1N3H A;  2ELA A;  4WJ7 A;  1IRS A;  2DN6 A;  2I5F A;  3WA0 A;  1DYN A;  1U5E A;  2J59 M;  2YT1 A;  1QQG A;  4HAW B;  1RJ2 A;  1MKE A;  4IFS A;  1XD4 A;  2DX5 A;  2UZR A;  1V5P A;  2EC1 A;  4KVG B;  5DHF B;  1H10 A;  3KRX A;  3KSY A;  1UEF A;  3IVF A;  4GZU A;  3FM8 C;  4EJN A;  2YSZ A;  1X05 A;  1LW3 A;  5C79 A;  4WVF B;  2CY4 A;  3TW1 A;  2GCL A;  3PZD A;  4GMX B;  1DDV A;  2EJ8 A;  2D10 A;  1WGQ A;  3HK0 A;  4A6F B;  2DHK A;  2QKM A;  4A6F A;  2LUL A;  3PP2 A;  3MPX A;  2DLW A;  3D8F A;  4K17 A;  2MWN B;  1X1F A;  2ROV A;  1UNQ A;  3D8E A;  4HAT B;  1Y19 B;  3U7D A;  3VIA A;  3VOQ A;  1NTV A;  1GG3 A;  1XX0 A;  5CLQ B;  5C5B A;  5FI1 A;  4HDQ A;  2M38 A;  2RNR B;  5D3V A;  4F7G A;  5L81 A;  2YS3 A;  1WI1 A;  4F7H A;  2Q13 A;  2XQN M;  3F0W A;  3BJI A;  4A5K A;  1QC6 A;  5HE1 A;  2R0D A;  2YS1 A;  1UPR A;  1U5F A;  1P3R A;  4C0A A;  1J19 A;  2DYQ A;  3HW2 B;  3ML4 A;  3PSC A;  4DX8 A;  4MT7 A;  3QIJ A;  3SO6 A;  1FB8 A;  3G9W A;  2EMT A;  2I1J A;  1V89 A;  2COF A;  2MDX A;  4K2P A;  1E5W A;  1AWE A;  2YVC A;  2VKI A;  1P5T A;  2GJY A;  4CHM A;  1BTK A;  2BCJ A;  2J0J A;  4GXB A;  5HE2 A;  4PNK A;  3A8P A;  1U2B A;  1EAZ A;  4DXA B;  2VRW B;  1Q67 A;  3P6A A;  2KCJ A;  1V88 A;  1BWN A;  1FHW A;  3ULB A;  3V5W A;  2D9Y A;  4KHO A;  3TCA A;  3KZ1 A;  2X18 A;  4HAV B;  4NY0 A;  1OQN A;  2R09 A;  2P0H A;  2KUP A;  1BTN A;  3DXC A;  4EKU A;  3UZT A;  4P7I A;  1DBH A;  2E2X A;  1FHX A;  1W1G A;  4HAZ B;  5DI9 B;  2D9X A;  1UPQ A;  2K2U A;  1GC6 A;  2P0D A;  1GC7 A;  3A8Q A;  4HAX B;  2Y7B A;  1XCG A;  3QBV B;  4ZRI A;  5KCV A;  4HAU B;  2RLO A;  2LKO A;  2NMB A;  5D27 A;  2D9V A;  2D4Q A;  5DH9 B;  3SV1 A;  5JP4 A;  2MKR A;  2P8V A;  3ZDT A;  1OY2 A;  1Z87 A;  2IYB A;  1MIX A;  1MAI A;  5DIF B;  1BAK A;  2KGX B;  2DTC A;  2H7E A;  1KZG A;  4ZRK A;  1OMW A;  1H4R A;  3TVV A;  3ODW A;  2HE7 A;  1MIZ B;  5J3T A;  4K2O A;  4XWX A; 
#chains in the Genus database with same CATH topology
 2RUK B;  1ZYI A;  2GCJ A;  3NWF A;  1I2H A;  1WJM A;  4GMV A;  2UVM A;  3N7C A;  2DHI A;  1AQC A;  2DYN A;  2Z59 A;  3NWD A;  1U29 A;  5FI0 A;  2I1K A;  3OAN A;  5GOW B;  1UNP A;  2ELB A;  4HB3 B;  4CHJ A;  3SYX A;  3ZVR A;  1SGH A;  4TYZ A;  2LOZ A;  2L2I A;  5D3Y A;  2DA0 A;  2QKL A;  4GPT B;  5C5B B;  4HDO A;  1W1D A;  4OSN A;  5KQ4 A;  1UNR A;  3T06 A;  3SNH A;  1WGU A;  1SHC A;  1V5M A;  3AU5 A;  2D11 A;  2N23 A;  2D9Z A;  2H7D A;  5I2M A;  3WYF B;  2LG1 A;  3GYO A;  4XWX A;  4IAP A;  3NW8 A;  2RGN B;  5J3Q A;  3X23 A;  2ADZ A;  3P7Z A;  4NSW A;  1M7R A;  1U27 A;  2IFS A;  4HB2 B;  4EMO A;  2HTH B;  2I5C A;  3DXD A;  1V61 A;  1P6S A;  4HAY B;  5EFX A;  2D9W A;  2YRY A;  3NSU A;  1ZVR A;  4F7U P;  5CLL B;  4B6H A;  3LJU X;  1EF1 A;  1Y5O A;  4D6W A;  4H8S A;  5JHG A;  2OTX A;  1KI1 B;  1W1H A;  3AJ4 A;  4DBB A;  3B77 A;  3HIE A;  2CRF A;  1J0W A;  1MI1 A;  3CXB B;  5HE0 A;  1U5D A;  3TFM A;  1X11 A;  4DIX A;  1ZSQ A;  2GS0 A;  2RVB B;  4YON A;  2COD A;  3KRW A;  4D0N B;  5KQ1 A;  4KHB B;  1NTY A;  4KHB A;  1XR0 B;  1MK7 B;  5LG4 B;  2L1C A;  4A6H A;  1WVH A;  4HHV A;  3D8D A;  2Y8F A;  5LON B;  4MK0 A;  1X1G A;  4Z2M B;  1PLS A;  3TO1 A;  2CY5 A;  3PVL A;  3M1I B;  3SUZ A;  3A98 B;  1K5G B;  1MK9 B;  1FOE A;  4L6E A;  3F5R A;  2K00 A;  2YF0 A;  5DHA B;  3CIK A;  1DDW A;  3ODX A;  1ISN A;  2DKP A;  2K49 A;  1V5U A;  3NWA A;  3PEG A;  1B55 A;  3RCP A;  2KIE A;  2DFK A;  3O96 A;  1XOD A;  1FAO A;  2Z0P A;  2J0M A;  4WSF A;  1X86 A;  3FEH A;  4Z2N A;  4PQ0 A;  4Y94 A;  2DHJ A;  2GUM A;  2OQB A;  2COC A;  2MFQ A;  1ZM0 A;  2KUQ A;  2YS5 A;  1TQZ A;  5D3W A;  3AU4 A;  4K81 A;  1PMS A;  1WG7 A;  2AL6 A;  2ZPY A;  2D2Q A;  2VSZ A;  4ZRJ A;  2Z0O A;  2COA A;  1DRO A;  2LOX A;  4HB0 B;  1RRP B;  2N0Y A;  4IOY X;  1K5D B;  2J0K A;  4KHA A;  2W2W A;  2PZ1 A;  2W2X D;  2Z4D A;  4GNK B;  3ODO A;  2JP2 A;  4A6K A;  2V76 A;  2Y8G A;  5J3Y A;  4GN1 A;  3KY9 A;  1ZC3 B;  4BBK A;  1FGY A;  2RRF A;  2EMS A;  4QJ4 B;  3GYP A;  1NU2 A;  2W2X C;  3ULC A;  5JHH A;  1KZ7 A;  2CAY A;  1LB1 A;  5HE3 A;  2RSG A;  3QWM A;  1WJ1 A;  2Z13 A;  3U8Z A;  4MY6 A;  5C16 A;  1FHO A;  1M7E A;  3DXE A;  1TJ6 A;  1EGX A;  4KAX B;  2G35 A;  2LYD A;  2Z0Q A;  2AEH A;  4CSQ A;  1TXD A;  2DX1 A;  1I7A A;  2NZ8 B;  3PVW A;  2FJL A;  5JLJ B;  2KR0 A;  3PVU A;  1FGZ A;  1ZC4 B;  4YL8 A;  1PFJ A;  4HB4 B;  5C6R A;  3MDB C;  1DDM A;  2K2J A;  2P0F A;  1MPH A;  2YT0 A;  3HQC A;  2M14 A;  4DX9 0;  5LOP B;  4QJ5 B;  2KIG A;  1U5G A;  2UZS A;  5D3X A;  4CYE A;  3BIN A;  1XKE A;  3PG7 A;  4QJ3 B;  4TKN A;  2DKQ A;  1EVH A;  2ROZ B;  3FSS A;  1NI2 A;  1N3H A;  2ELA A;  4WJ7 A;  1IRS A;  2DN6 A;  2I5F A;  3WA0 A;  1DYN A;  1U5E A;  2J59 M;  2YT1 A;  1QQG A;  4HAW B;  1RJ2 A;  1MKE A;  4IFS A;  2ZKM X;  1XD4 A;  2DX5 A;  2UZR A;  1V5P A;  2EC1 A;  4KVG B;  5DHF B;  1H10 A;  3KRX A;  3KSY A;  1UEF A;  3IVF A;  4GOU A;  4GZU A;  3FM8 C;  4EJN A;  2YSZ A;  1X05 A;  1LW3 A;  5C79 A;  4WVF B;  2CY4 A;  3TW1 A;  4QXA B;  2GCL A;  2Z14 A;  3PZD A;  4GMX B;  1DDV A;  2EJ8 A;  2D10 A;  1WGQ A;  3HK0 A;  4A6F B;  2DHK A;  2QKM A;  4A6F A;  1T77 A;  2LUL A;  3PP2 A;  3MPX A;  2DLW A;  3D8F A;  4K17 A;  2MWN B;  1X1F A;  2ROV A;  1UNQ A;  2NBV A;  3D8E A;  4HAT B;  1Y19 B;  2K8E A;  3U7D A;  3VIA A;  3VOQ A;  1NTV A;  1GG3 A;  1XX0 A;  5CLQ B;  5C5B A;  5FI1 A;  4HDQ A;  2M38 A;  2RNR B;  5D3V A;  4F7G A;  5L81 A;  2YS3 A;  1WI1 A;  4F7H A;  2Q13 A;  2XQN M;  3F0W A;  3BJI A;  4A5K A;  1QC6 A;  5HE1 A;  2R0D A;  4L1R A;  2YS1 A;  1UPR A;  1U5F A;  5IRS A;  1P3R A;  4C0A A;  1J19 A;  2DYQ A;  3HW2 B;  3ML4 A;  3PSC A;  4DX8 A;  4MT7 A;  3QIJ A;  3SO6 A;  1FB8 A;  3G9W A;  2EMT A;  2I1J A;  1V89 A;  2COF A;  2MDX A;  4HSI A;  4K2P A;  1E5W A;  1AWE A;  2YVC A;  3FVC A;  2VKI A;  1P5T A;  2GJY A;  4CHM A;  1BTK A;  2BCJ A;  2J0J A;  4GXB A;  5M4Y B;  5HE2 A;  4PNK A;  3A8P A;  1U2B A;  1EAZ A;  4DXA B;  2VRW B;  1Q67 A;  3P6A A;  4OT1 A;  2KCJ A;  1V88 A;  1BWN A;  1FHW A;  3ULB A;  3V5W A;  2D9Y A;  4KHO A;  3TCA A;  3KZ1 A;  2X18 A;  4HAV B;  4NY0 A;  1OQN A;  2R09 A;  2P0H A;  2KUP A;  3OHM B;  1BTN A;  3DXC A;  4EKU A;  3UZT A;  4P7I A;  1DBH A;  2E2X A;  1FHX A;  1W1G A;  4HAZ B;  5DI9 B;  2D9X A;  1UPQ A;  2YT2 A;  2K2U A;  1GC6 A;  2P0D A;  1GC7 A;  3A8Q A;  4HAX B;  2Y7B A;  1XCG A;  3QBV B;  4ZRI A;  2R2Y A;  3U12 A;  5KCV A;  3A58 A;  2RLO A;  2LKO A;  2NMB A;  4HAU B;  5I2S A;  5D27 A;  2D9V A;  2D4Q A;  5DH9 B;  3SV1 A;  5JP4 A;  2MKR A;  2P8V A;  3ZDT A;  1OY2 A;  1Z87 A;  2IYB A;  1MIX A;  1MAI A;  5DIF B;  1BAK A;  2KGX B;  3DCX A;  2DTC A;  2H7E A;  1KZG A;  4ZRK A;  1OMW A;  1H4R A;  3TVV A;  3ODW A;  2HE7 A;  1MIZ B;  5J3T A;  3HSA A;  4K2O A;  2FJU B; 
#chains in the Genus database with same CATH homology
 2RUK B;  2GCJ A;  4GMV A;  1I2H A;  1WJM A;  2UVM A;  3N7C A;  2DHI A;  1AQC A;  2DYN A;  1U29 A;  5FI0 A;  2I1K A;  3OAN A;  5GOW B;  1UNP A;  2ELB A;  4HB3 B;  4CHJ A;  3SYX A;  3ZVR A;  1SGH A;  4TYZ A;  2LOZ A;  2L2I A;  5D3Y A;  2DA0 A;  2QKL A;  4GPT B;  5C5B B;  4HDO A;  1W1D A;  5KQ4 A;  1UNR A;  3T06 A;  3SNH A;  1WGU A;  1SHC A;  1V5M A;  3AU5 A;  2D11 A;  2N23 A;  2D9Z A;  2H7D A;  3WYF B;  2LG1 A;  3GYO A;  4IAP A;  2RGN B;  5J3Q A;  3X23 A;  2ADZ A;  3P7Z A;  4NSW A;  1M7R A;  1U27 A;  2IFS A;  4HB2 B;  4EMO A;  2HTH B;  2I5C A;  3DXD A;  1V61 A;  1P6S A;  4HAY B;  5EFX A;  2D9W A;  2YRY A;  3NSU A;  1ZVR A;  4F7U P;  5CLL B;  4B6H A;  3LJU X;  1EF1 A;  1Y5O A;  4H8S A;  5JHG A;  2OTX A;  1KI1 B;  1W1H A;  3AJ4 A;  4DBB A;  2CRF A;  1J0W A;  3CXB B;  5HE0 A;  1U5D A;  3TFM A;  1X11 A;  1ZSQ A;  2GS0 A;  2RVB B;  4YON A;  2COD A;  3KRW A;  4D0N B;  5KQ1 A;  4KHB B;  1NTY A;  1XR0 B;  1MK7 B;  2L1C A;  4A6H A;  1WVH A;  4HHV A;  3D8D A;  2Y8F A;  5LON B;  4MK0 A;  1X1G A;  4Z2M B;  1PLS A;  3TO1 A;  2CY5 A;  3PVL A;  3M1I B;  3SUZ A;  3A98 B;  1K5G B;  1MK9 B;  1FOE A;  4L6E A;  3F5R A;  2K00 A;  2YF0 A;  5DHA B;  3CIK A;  1DDW A;  3ODX A;  1ISN A;  2DKP A;  3RCP A;  1V5U A;  3PEG A;  1B55 A;  2DFK A;  3O96 A;  1XOD A;  1FAO A;  2Z0P A;  2J0M A;  4WSF A;  1X86 A;  3FEH A;  4Z2N A;  4PQ0 A;  4Y94 A;  2DHJ A;  2OQB A;  2COC A;  2MFQ A;  1ZM0 A;  2YS5 A;  1TQZ A;  5D3W A;  3AU4 A;  4K81 A;  1PMS A;  1WG7 A;  2AL6 A;  2ZPY A;  2D2Q A;  2VSZ A;  4ZRJ A;  2Z0O A;  2COA A;  1DRO A;  2LOX A;  4HB0 B;  1RRP B;  2N0Y A;  4IOY X;  1K5D B;  2J0K A;  4KHA A;  2W2W A;  2PZ1 A;  2W2X D;  3ODO A;  2JP2 A;  4A6K A;  2V76 A;  2Y8G A;  5J3Y A;  4GN1 A;  3KY9 A;  1ZC3 B;  4BBK A;  1FGY A;  2EMS A;  3GYP A;  1NU2 A;  2W2X C;  3ULC A;  5JHH A;  1KZ7 A;  2CAY A;  1LB1 A;  5HE3 A;  2RSG A;  3QWM A;  1WJ1 A;  3U8Z A;  4MY6 A;  5C16 A;  1FHO A;  1M7E A;  3DXE A;  1TJ6 A;  1EGX A;  4KAX B;  2G35 A;  2LYD A;  2Z0Q A;  2AEH A;  1TXD A;  2DX1 A;  1I7A A;  2NZ8 B;  3PVW A;  2FJL A;  5JLJ B;  3PVU A;  1FGZ A;  1ZC4 B;  4YL8 A;  1PFJ A;  4HB4 B;  5C6R A;  3MDB C;  1DDM A;  2K2J A;  2P0F A;  1MPH A;  2YT0 A;  3HQC A;  2M14 A;  4DX9 0;  5LOP B;  2UZS A;  1U5G A;  5D3X A;  4CYE A;  3BIN A;  1XKE A;  3PG7 A;  4TKN A;  2DKQ A;  1EVH A;  2ROZ B;  3FSS A;  1NI2 A;  1N3H A;  2ELA A;  4WJ7 A;  1IRS A;  2DN6 A;  2I5F A;  3WA0 A;  1DYN A;  1U5E A;  2J59 M;  2YT1 A;  1QQG A;  4HAW B;  1RJ2 A;  1MKE A;  4IFS A;  1XD4 A;  2DX5 A;  2UZR A;  1V5P A;  2EC1 A;  4KVG B;  5DHF B;  1H10 A;  3KRX A;  3KSY A;  1UEF A;  3IVF A;  4GZU A;  3FM8 C;  4EJN A;  2YSZ A;  1X05 A;  1LW3 A;  5C79 A;  4WVF B;  2CY4 A;  3TW1 A;  2GCL A;  3PZD A;  4GMX B;  1DDV A;  2EJ8 A;  2D10 A;  1WGQ A;  3HK0 A;  4A6F B;  2DHK A;  2QKM A;  4A6F A;  2LUL A;  3PP2 A;  3MPX A;  2DLW A;  3D8F A;  4K17 A;  2MWN B;  1X1F A;  2ROV A;  1UNQ A;  3D8E A;  4HAT B;  1Y19 B;  3U7D A;  3VIA A;  3VOQ A;  1NTV A;  1GG3 A;  1XX0 A;  5CLQ B;  5C5B A;  5FI1 A;  4HDQ A;  2M38 A;  2RNR B;  5D3V A;  4F7G A;  5L81 A;  2YS3 A;  1WI1 A;  4F7H A;  2Q13 A;  2XQN M;  3F0W A;  3BJI A;  4A5K A;  1QC6 A;  5HE1 A;  2R0D A;  2YS1 A;  1UPR A;  1U5F A;  1P3R A;  4C0A A;  1J19 A;  2DYQ A;  3HW2 B;  3ML4 A;  3PSC A;  4DX8 A;  4MT7 A;  3QIJ A;  3SO6 A;  1FB8 A;  3G9W A;  2EMT A;  2I1J A;  1V89 A;  2COF A;  2MDX A;  4K2P A;  1E5W A;  1AWE A;  2YVC A;  2VKI A;  1P5T A;  2GJY A;  4CHM A;  1BTK A;  2BCJ A;  2J0J A;  4GXB A;  5HE2 A;  4PNK A;  3A8P A;  1U2B A;  1EAZ A;  4DXA B;  2VRW B;  1Q67 A;  3P6A A;  2KCJ A;  1V88 A;  1BWN A;  1FHW A;  3ULB A;  3V5W A;  2D9Y A;  4KHO A;  3TCA A;  3KZ1 A;  2X18 A;  4HAV B;  4NY0 A;  1OQN A;  2R09 A;  2P0H A;  2KUP A;  1BTN A;  3DXC A;  4EKU A;  3UZT A;  4P7I A;  1DBH A;  2E2X A;  1FHX A;  1W1G A;  4HAZ B;  5DI9 B;  2D9X A;  1UPQ A;  2K2U A;  1GC6 A;  2P0D A;  1GC7 A;  3A8Q A;  4HAX B;  2Y7B A;  1XCG A;  3QBV B;  4ZRI A;  5KCV A;  4HAU B;  2RLO A;  2LKO A;  2NMB A;  5D27 A;  2D9V A;  2D4Q A;  5DH9 B;  3SV1 A;  5JP4 A;  2MKR A;  2P8V A;  3ZDT A;  1OY2 A;  1Z87 A;  2IYB A;  1MIX A;  1MAI A;  5DIF B;  1BAK A;  2KGX B;  2DTC A;  2H7E A;  1KZG A;  4ZRK A;  1OMW A;  1H4R A;  3TVV A;  3ODW A;  2HE7 A;  1MIZ B;  5J3T A;  4K2O A;  4XWX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...