4CHJA

Structure of inner membrane complex (imc) sub-compartment protein 3 (isp3) from toxoplasma gondii
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
Knots found
sequence length
139
structure length
123
Chain Sequence
ADLEIGREGEVIQVSKEAFDNWMNRYEAGDTMEVLFPDGHRIECNLKIDRPKNFMNLTFNQKVRPIQLDDIAAVLYGSKMLRNPVVGFRLASSGRAIAFSFKDITDAQCFVSFLDDEIKKNQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Inner Membrane Complex Sub-Compartment Proteins Critical for Replication of the Apicomplexan Parasite Toxoplasma Gondii Adopt a Pleckstrin Homology Fold
pubmed doi rcsb
source organism Toxoplasma gondii
molecule tags Cell cycle
molecule keywords IMC SUB-COMPARTMENT PROTEIN ISP3
total genus 33
structure length 123
sequence length 139
other databases KnotProt 2.0: K 41
ec nomenclature
pdb deposition date 2013-12-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18045 ISP3_C ISP3 C-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 4chjA00
3BINA 3CIKA 3G9WA 2MDXA 5KQ4A 2DX1A 2UZRA 4HAXB 5JLJB 1ISNA 2RSGA 5LOPB 1V88A 1DDMA 3HQCA 1PFJA 4GN1A 3D8FA 5JHHA 1XCGA 1UPRA 1KZGA 2R09A 4KHOA 2M14A 2YS3A 3SUZA 2J0MA 2ROZB 3ZDTA 4Z2NA 1TQZA 2D9WA 2FJLA 3VIAA 1ZC4B 2Z0QA 3PVLA 4A6HA 3VOQA 3SYXA 2V76A 5C79A 2YT0A 4WSFA 2Z0PA 4ZRKA 4NSWA 2X18A 3QWMA 5EFXA 1X05A 1FOEA 1MK9B 1V61A 2LG1A 1UEFA 1M7EA 2CRFA 4K17A 2DX5A 4B6HA 1XR0B 2LYDA 5C5BB 5C16A 1PMSA 2OTXA 4HB2B 2PZ1A 1QQGA 3LJUX 3A98B 1X11A 2UVMA 5D3WA 4KAXB 1U5EA 2VRWB 2YS1A 2IYBA 2YT1A 4EMOA 2MWNB 4EJNA 2I5CA 3O96A 2D9VA 1M7RA 5FI1A 2P0DA 3U7DA 2LOZA 1DYNA 1NTVA 2ELBA 4HAUB 2M38A 1TJ6A 4GMVA 2K00A 3KRXA 5JHGA 4H8SA 1AQCA 3PZDA 3U8ZA 3MPXA 1W1DA 1EVHA 3F5RA 5DH9B 3TVVA 2VKIA 4HAZB 4HB3B 3V5WA 3KZ1A 1NTYA 1X1GA 2CY4A 4PQ0A 1J19A 2DLWA 1RJ2A 4K81A 2Y8GA 2DHJA 1GG3A 4KVGB 4A6FB 1K5DB 1J0WA 1WGUA 3AU4A 4EKUA 2DYQA 2CAYA 1FHWA 2Q13A 1DDVA 2GS0A 1MIZB 1AWEA 3M1IB 1ZM0A 1MIXA 1B55A 2D4QA 1WI1A 4KHBB 1BTKA 2N0YA 1Q67A 1WVHA 1EGXA 3X23A 2W2WA 1ZVRA 1X1FA 4GPTB 3SV1A 3QIJA 1FB8A 1NI2A 2GJYA 2W2XD 5HE1A 5KQ1A 2UZSA 5D3VA 2EC1A 2P0FA 4TYZA 2G35A 3ML4A 2J59M 1XX0A 2LOXA 4YL8A 1FGYA 2DFKA 2NZ8B 2RGNB 2YRYA 4HB0B 4WVFB 3P7ZA 5D27A 2H7DA 4A6FA 4C0AA 2EMTA 4A6KA 1E5WA 1WG7A 1SGHA 2J0KA 1LB1A 2J0JA 4YONA 1W1HA 4KHAA 3FM8C 4ZRJA 1I7AA 1QC6A 5DHAB 5C6RA 4D0NB 3PSCA 5DIFB 1KZ7A 1H10A 1FAOA 5D3XA 4TKNA 1Y19B 4HHVA 1DDWA 3ODXA 2K2UA 2LULA 1OMWA 1FGZA 1XD4A 2HTHB 1PLSA 2ROVA 4HAVB 3P6AA 3WA0A 1MKEA 4HB4B 3ZVRA 2ZPYA 1Y5OA 3DXEA 2L1CA 2D9ZA 4GXBA 2QKMA 2DKPA 3NSUA 2P0HA 1MK7B 4GZUA 1DBHA 5DI9B 1XKEA 4DX90 4DXAB 1P3RA 4IFSA 4NY0A 2H7EA 3KY9A 1FHOA 2I5FA 3IVFA 2P8VA 4Y94A 2KCJA 3KSYA 2BCJA 2AEHA 4MT7A 1V89A 1I2HA 1OQNA 2R0DA 3MDBC 1ZC3B 2HE7A 2DHIA 2D2QA 2L2IA 1RRPB 3TO1A 2I1JA 5CLLB 1V5UA 1XODA 1NU2A 4DBBA 2ELAA 2COAA 4HDOA 5FI0A 3ODWA 5J3YA 4BBKA 2I1KA 1P5TA 2COFA 2CODA 1V5PA 3WYFB 3SO6A 1GC6A 3SNHA 5J3QA 4MY6A 3D8DA 4A5KA 1K5GB 2EJ8A 2E2XA 2GCJA 4F7HA 4Z2MB 5JP4A 2NMBA 1OY2A 2DTCA 2Y8FA 2KUPA 5J3TA 1P6SA 1V5MA 1UNPA 2DHKA 2Z0OA 3FEHA 1BTNA 3AU5A 2D10A 1WJ1A 4K2PA 3PG7A 3TW1A 2D9YA 3BJIA 3T06A 2OQBA 2KGXB 4CYEA 3GYPA 3KRWA 1MAIA 1U5DA 3HK0A 2DN6A 2JP2A 1N3HA 3CXBB 4ZRIA 1UNRA 3TFMA 4GMXB 4CHMA 5LONB 2RUKB 3FSSA 3HW2B 3TCAA 1U27A 3DXDA 2YS5A 3PVWA 1UPQA 1BWNA 2AL6A 1ZSQA 5HE0A 1SHCA 2QKLA 2D11A 5CLQB 2D9XA 3D8EA 2EMSA 4PNKA 3PEGA 2YF0A 5HE2A 5L81A 1WJMA 4DX8A 1U5GA 4IAPA 1LW3A 2RNRB 2RVBB 1WGQA 3ULCA 3A8QA 3QBVB 3RCPA 2Y7BA 1DROA 1IRSA 3PP2A 4HDQA 2GCLA 1U29A 3A8PA 2VSZA 3GYOA 3DXCA 5D3YA 2XQNM 2MFQA 1TXDA 2YVCA 1H4RA 1FHXA 4CHJA 3F0WA 3OANA 2K2JA 1Z87A 2DA0A 4XWXA 2W2XC 5DHFB 3ULBA 3UZTA 3AJ4A 4HAWB 4F7GA 1UNQA 4HATB 1KI1B 2COCA 2RLOA 1U2BA 2MKRA 3ODOA 2CY5A 1W1GA 1MPHA 5GOWB 5C5BA 4IOYX 1U5FA 3PVUA 1EAZA 1X86A 2N23A 4WJ7A 1GC7A 2DKQA 4F7UP 2IFSA 2LKOA 4MK0A 2ADZA 4K2OA 2DYNA 5HE3A 4P7IA 4HAYB 5KCVA 1EF1A 1BAKA 4L6EA 2YSZA 3N7CA
chains in the Genus database with same CATH superfamily
3BINA 3CIKA 3G9WA 2MDXA 5KQ4A 2DX1A 2UZRA 4HAXB 5JLJB 1ISNA 2RSGA 5LOPB 1V88A 1DDMA 3HQCA 1PFJA 4GN1A 3U12A 3D8FA 5JHHA 1XCGA 1UPRA 1KZGA 2R09A 4KHOA 2M14A 2K49A 2YS3A 3SUZA 2J0MA 2ROZB 3ZDTA 4Z2NA 1TQZA 1ZYIA 2D9WA 2FJLA 3VIAA 1ZC4B 2Z0QA 3PVLA 4A6HA 4CSQA 3VOQA 3SYXA 2V76A 5C79A 2YT0A 4WSFA 2Z0PA 4ZRKA 2GUMA 4NSWA 2X18A 3QWMA 5EFXA 1X05A 1FOEA 1MK9B 1V61A 2LG1A 1UEFA 1M7EA 2CRFA 4K17A 2DX5A 4B6HA 1XR0B 2LYDA 5C5BB 5C16A 1PMSA 2OTXA 4HB2B 2PZ1A 1QQGA 3LJUX 3A98B 1X11A 2UVMA 5D3WA 4KAXB 1U5EA 2VRWB 2YS1A 2IYBA 2YT1A 4EMOA 2MWNB 4EJNA 4GNKB 2I5CA 2FJUB 3O96A 2D9VA 1M7RA 5FI1A 2P0DA 3U7DA 2LOZA 1DYNA 1NTVA 2ELBA 4HAUB 2M38A 1TJ6A 4GMVA 2K00A 3KRXA 5JHGA 4H8SA 1AQCA 3PZDA 3U8ZA 3MPXA 1W1DA 1EVHA 3F5RA 5DH9B 3TVVA 2VKIA 4HAZB 4HB3B 4HSIA 3V5WA 3KZ1A 1NTYA 1X1GA 2CY4A 4PQ0A 1J19A 2DLWA 1RJ2A 4K81A 2Y8GA 2DHJA 1GG3A 4KVGB 4A6FB 1K5DB 1J0WA 1WGUA 3AU4A 4EKUA 2DYQA 2CAYA 1FHWA 2Q13A 1DDVA 2GS0A 1MIZB 1AWEA 2KIGA 3M1IB 1ZM0A 1MIXA 1B55A 2D4QA 1WI1A 4KHBB 1BTKA 2N0YA 1Q67A 1WVHA 1EGXA 2ZKMX 3X23A 2W2WA 1ZVRA 2NBVA 5M4YB 1X1FA 4GPTB 3SV1A 3QIJA 1FB8A 1NI2A 2GJYA 2W2XD 5HE1A 4KHBA 5KQ1A 2UZSA 5D3VA 2EC1A 2P0FA 4TYZA 2G35A 3ML4A 2J59M 1XX0A 2LOXA 4YL8A 1FGYA 2DFKA 2NZ8B 2RGNB 2YRYA 4HB0B 4WVFB 2R2YA 3P7ZA 5D27A 4QXAB 5LG4B 2H7DA 4A6FA 4C0AA 2EMTA 4A6KA 1E5WA 1WG7A 1SGHA 3NWFA 2J0KA 3A58A 1LB1A 2J0JA 4YONA 1W1HA 4KHAA 3FM8C 4ZRJA 1I7AA 5I2SA 1QC6A 5DHAB 5C6RA 4D0NB 3PSCA 2KUQA 5DIFB 1KZ7A 1H10A 1FAOA 5D3XA 4TKNA 1Y19B 4HHVA 1DDWA 3ODXA 3NWDA 2K2UA 2LULA 2RRFA 1OMWA 1FGZA 1XD4A 2HTHB 1PLSA 2ROVA 4HAVB 3P6AA 3WA0A 1MKEA 4HB4B 3ZVRA 2ZPYA 1Y5OA 3DXEA 2L1CA 3OHMB 2D9ZA 4GXBA 2QKMA 2DKPA 3NWAA 3NSUA 2P0HA 1MK7B 4GZUA 4D6WA 1DBHA 5DI9B 1XKEA 4DX90 4DXAB 1P3RA 4IFSA 4NY0A 4QJ4B 2Z14A 3B77A 2H7EA 3KY9A 1FHOA 4GOUA 2I5FA 3IVFA 2P8VA 4Y94A 2KCJA 3KSYA 3HIEA 2BCJA 2AEHA 4QJ3B 4MT7A 1V89A 1I2HA 2R0DA 1OQNA 3MDBC 1T77A 1ZC3B 2DHIA 2HE7A 2D2QA 2L2IA 1RRPB 3TO1A 2I1JA 5CLLB 4OT1A 1V5UA 1XODA 1NU2A 4DBBA 2ELAA 2COAA 4HDOA 5FI0A 2K8EA 3ODWA 5J3YA 4BBKA 2I1KA 1P5TA 2COFA 2CODA 1V5PA 3WYFB 3SO6A 1GC6A 3HSAA 3SNHA 5J3QA 4MY6A 3D8DA 4A5KA 1K5GB 2EJ8A 2E2XA 2GCJA 2KIEA 4F7HA 4Z2MB 5JP4A 2NMBA 1OY2A 2DTCA 2Y8FA 2KUPA 5J3TA 1P6SA 1V5MA 1UNPA 2DHKA 2Z0OA 3FEHA 1BTNA 3AU5A 2D10A 1WJ1A 4K2PA 3PG7A 3TW1A 2D9YA 3BJIA 4OSNA 3T06A 3FVCA 2OQBA 2KGXB 4CYEA 3GYPA 3KRWA 1MAIA 1U5DA 2KR0A 3HK0A 2DN6A 2YT2A 2JP2A 1N3HA 2Z4DA 3CXBB 4ZRIA 1UNRA 3TFMA 4GMXB 4CHMA 5LONB 2RUKB 3FSSA 3HW2B 5IRSA 3TCAA 1U27A 3DXDA 3NW8A 2YS5A 3PVWA 1UPQA 1BWNA 2AL6A 1ZSQA 4QJ5B 5HE0A 4DIXA 1SHCA 2QKLA 2D11A 5CLQB 2D9XA 3D8EA 2EMSA 4PNKA 3PEGA 2YF0A 5HE2A 5L81A 1WJMA 4DX8A 1U5GA 4IAPA 1LW3A 2RNRB 2RVBB 1WGQA 3ULCA 3A8QA 3QBVB 5I2MA 3RCPA 2Y7BA 1DROA 1IRSA 3PP2A 4HDQA 2GCLA 1U29A 3A8PA 2VSZA 3GYOA 3DXCA 5D3YA 2XQNM 2MFQA 1TXDA 2YVCA 1H4RA 2Z13A 1FHXA 4L1RA 3F0WA 4CHJA 3OANA 2K2JA 1Z87A 2DA0A 2Z59A 4XWXA 2W2XC 5DHFB 3ULBA 3UZTA 3AJ4A 4HAWB 4F7GA 1UNQA 4HATB 1KI1B 3DCXA 2COCA 2RLOA 1U2BA 2MKRA 3ODOA 2CY5A 1W1GA 1MPHA 5GOWB 5C5BA 4IOYX 1U5FA 3PVUA 1EAZA 1X86A 2N23A 4WJ7A 1GC7A 2DKQA 4F7UP 2IFSA 2LKOA 4MK0A 2ADZA 4K2OA 2DYNA 5HE3A 1MI1A 4P7IA 4HAYB 5KCVA 1EF1A 1BAKA 4L6EA 2YSZA 3N7CA
chains in the Genus database with same CATH topology
3BINA 3CIKA 3G9WA 2MDXA 5KQ4A 2DX1A 2UZRA 4HAXB 5JLJB 1ISNA 2RSGA 5LOPB 1V88A 1DDMA 3HQCA 1PFJA 4GN1A 3D8FA 5JHHA 1XCGA 1UPRA 1KZGA 2R09A 4KHOA 2M14A 2YS3A 3SUZA 2J0MA 2ROZB 3ZDTA 4Z2NA 1TQZA 2D9WA 2FJLA 3VIAA 1ZC4B 2Z0QA 3PVLA 4A6HA 3VOQA 3SYXA 2V76A 5C79A 2YT0A 4WSFA 2Z0PA 4ZRKA 4NSWA 2X18A 3QWMA 5EFXA 1X05A 1FOEA 1MK9B 1V61A 2LG1A 1UEFA 1M7EA 2CRFA 4K17A 2DX5A 4B6HA 1XR0B 2LYDA 5C5BB 5C16A 1PMSA 2OTXA 4HB2B 2PZ1A 1QQGA 3LJUX 3A98B 1X11A 2UVMA 5D3WA 4KAXB 1U5EA 2VRWB 2YS1A 2IYBA 2YT1A 4EMOA 2MWNB 4EJNA 2I5CA 3O96A 2D9VA 1M7RA 5FI1A 2P0DA 3U7DA 2LOZA 1DYNA 1NTVA 2ELBA 4HAUB 2M38A 1TJ6A 4GMVA 2K00A 3KRXA 5JHGA 4H8SA 1AQCA 3PZDA 3U8ZA 3MPXA 1W1DA 1EVHA 3F5RA 5DH9B 3TVVA 2VKIA 4HAZB 4HB3B 3V5WA 3KZ1A 1NTYA 1X1GA 2CY4A 4PQ0A 1J19A 2DLWA 1RJ2A 4K81A 2Y8GA 2DHJA 1GG3A 4KVGB 4A6FB 1K5DB 1J0WA 1WGUA 3AU4A 4EKUA 2DYQA 2CAYA 1FHWA 2Q13A 1DDVA 2GS0A 1MIZB 1AWEA 3M1IB 1ZM0A 1MIXA 1B55A 2D4QA 1WI1A 4KHBB 1BTKA 2N0YA 1Q67A 1WVHA 1EGXA 3X23A 2W2WA 1ZVRA 1X1FA 4GPTB 3SV1A 3QIJA 1FB8A 1NI2A 2GJYA 2W2XD 5HE1A 5KQ1A 2UZSA 5D3VA 2EC1A 2P0FA 4TYZA 2G35A 3ML4A 2J59M 1XX0A 2LOXA 4YL8A 1FGYA 2DFKA 2NZ8B 2RGNB 2YRYA 4HB0B 4WVFB 3P7ZA 5D27A 2H7DA 4A6FA 4C0AA 2EMTA 4A6KA 1E5WA 1WG7A 1SGHA 2J0KA 1LB1A 2J0JA 4YONA 1W1HA 4KHAA 3FM8C 4ZRJA 1I7AA 1QC6A 5DHAB 5C6RA 4D0NB 3PSCA 5DIFB 1KZ7A 1H10A 1FAOA 5D3XA 4TKNA 1Y19B 4HHVA 1DDWA 3ODXA 2K2UA 2LULA 1OMWA 1FGZA 1XD4A 2HTHB 1PLSA 2ROVA 4HAVB 3P6AA 3WA0A 1MKEA 4HB4B 3ZVRA 2ZPYA 1Y5OA 3DXEA 2L1CA 2D9ZA 4GXBA 2QKMA 2DKPA 3NSUA 2P0HA 1MK7B 4GZUA 1DBHA 5DI9B 1XKEA 4DX90 4DXAB 1P3RA 4IFSA 4NY0A 2H7EA 3KY9A 1FHOA 2I5FA 3IVFA 2P8VA 4Y94A 2KCJA 3KSYA 2BCJA 2AEHA 4MT7A 1V89A 1I2HA 1OQNA 2R0DA 3MDBC 1ZC3B 2HE7A 2DHIA 2D2QA 2L2IA 1RRPB 3TO1A 2I1JA 5CLLB 1V5UA 1XODA 1NU2A 4DBBA 2ELAA 2COAA 4HDOA 5FI0A 3ODWA 5J3YA 4BBKA 2I1KA 1P5TA 2COFA 2CODA 1V5PA 3WYFB 3SO6A 1GC6A 3SNHA 5J3QA 4MY6A 3D8DA 4A5KA 1K5GB 2EJ8A 2E2XA 2GCJA 4F7HA 4Z2MB 5JP4A 2NMBA 1OY2A 2DTCA 2Y8FA 2KUPA 5J3TA 1P6SA 1V5MA 1UNPA 2DHKA 2Z0OA 3FEHA 1BTNA 3AU5A 2D10A 1WJ1A 4K2PA 3PG7A 3TW1A 2D9YA 3BJIA 3T06A 2OQBA 2KGXB 4CYEA 3GYPA 3KRWA 1MAIA 1U5DA 3HK0A 2DN6A 2JP2A 1N3HA 3CXBB 4ZRIA 1UNRA 3TFMA 4GMXB 4CHMA 5LONB 2RUKB 3FSSA 3HW2B 3TCAA 1U27A 3DXDA 2YS5A 3PVWA 1UPQA 1BWNA 2AL6A 1ZSQA 5HE0A 1SHCA 2QKLA 2D11A 5CLQB 2D9XA 3D8EA 2EMSA 4PNKA 3PEGA 2YF0A 5HE2A 5L81A 1WJMA 4DX8A 1U5GA 4IAPA 1LW3A 2RNRB 2RVBB 1WGQA 3ULCA 3A8QA 3QBVB 3RCPA 2Y7BA 1DROA 1IRSA 3PP2A 4HDQA 2GCLA 1U29A 3A8PA 2VSZA 3GYOA 3DXCA 5D3YA 2XQNM 2MFQA 1TXDA 2YVCA 1H4RA 1FHXA 4CHJA 3F0WA 3OANA 2K2JA 1Z87A 2DA0A 4XWXA 2W2XC 5DHFB 3ULBA 3UZTA 3AJ4A 4HAWB 4F7GA 1UNQA 4HATB 1KI1B 2COCA 2RLOA 1U2BA 2MKRA 3ODOA 2CY5A 1W1GA 1MPHA 5GOWB 5C5BA 4IOYX 1U5FA 3PVUA 1EAZA 1X86A 2N23A 4WJ7A 1GC7A 2DKQA 4F7UP 2IFSA 2LKOA 4MK0A 2ADZA 4K2OA 2DYNA 5HE3A 4P7IA 4HAYB 5KCVA 1EF1A 1BAKA 4L6EA 2YSZA 3N7CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BIN A;  3CIK A;  3G9W A;  2MDX A;  5KQ4 A;  2DX1 A;  2UZR A;  4HAX B;  5JLJ B;  1ISN A;  2RSG A;  5LOP B;  1V88 A;  1DDM A;  3HQC A;  1PFJ A;  4GN1 A;  3D8F A;  5JHH A;  1XCG A;  1UPR A;  1KZG A;  2R09 A;  4KHO A;  2M14 A;  2YS3 A;  3SUZ A;  2J0M A;  2ROZ B;  3ZDT A;  4Z2N A;  1TQZ A;  2D9W A;  2FJL A;  3VIA A;  1ZC4 B;  2Z0Q A;  3PVL A;  4A6H A;  3VOQ A;  3SYX A;  2V76 A;  5C79 A;  2YT0 A;  4WSF A;  2Z0P A;  4ZRK A;  4NSW A;  2X18 A;  3QWM A;  5EFX A;  1X05 A;  1FOE A;  1MK9 B;  1V61 A;  2LG1 A;  1UEF A;  1M7E A;  2CRF A;  4K17 A;  2DX5 A;  4B6H A;  1XR0 B;  2LYD A;  5C5B B;  5C16 A;  1PMS A;  2OTX A;  4HB2 B;  2PZ1 A;  1QQG A;  3LJU X;  3A98 B;  1X11 A;  2UVM A;  5D3W A;  4KAX B;  1U5E A;  2VRW B;  2YS1 A;  2IYB A;  2YT1 A;  4EMO A;  2MWN B;  4EJN A;  2I5C A;  3O96 A;  2D9V A;  1M7R A;  5FI1 A;  2P0D A;  3U7D A;  2LOZ A;  1DYN A;  1NTV A;  2ELB A;  4HAU B;  2M38 A;  1TJ6 A;  4GMV A;  2K00 A;  3KRX A;  5JHG A;  4H8S A;  1AQC A;  3PZD A;  3U8Z A;  3MPX A;  1W1D A;  1EVH A;  3F5R A;  5DH9 B;  3TVV A;  2VKI A;  4HAZ B;  4HB3 B;  3V5W A;  3KZ1 A;  1NTY A;  1X1G A;  2CY4 A;  4PQ0 A;  1J19 A;  2DLW A;  1RJ2 A;  4K81 A;  2Y8G A;  2DHJ A;  1GG3 A;  4KVG B;  4A6F B;  1K5D B;  1J0W A;  1WGU A;  3AU4 A;  4EKU A;  2DYQ A;  2CAY A;  1FHW A;  2Q13 A;  1DDV A;  2GS0 A;  1MIZ B;  1AWE A;  3M1I B;  1ZM0 A;  1MIX A;  1B55 A;  2D4Q A;  1WI1 A;  4KHB B;  1BTK A;  2N0Y A;  1Q67 A;  1WVH A;  1EGX A;  3X23 A;  2W2W A;  1ZVR A;  1X1F A;  4GPT B;  3SV1 A;  3QIJ A;  1FB8 A;  1NI2 A;  2GJY A;  2W2X D;  5HE1 A;  5KQ1 A;  2UZS A;  5D3V A;  2EC1 A;  2P0F A;  4TYZ A;  2G35 A;  3ML4 A;  2J59 M;  1XX0 A;  2LOX A;  4YL8 A;  1FGY A;  2DFK A;  2NZ8 B;  2RGN B;  2YRY A;  4HB0 B;  4WVF B;  3P7Z A;  5D27 A;  2H7D A;  4A6F A;  4C0A A;  2EMT A;  4A6K A;  1E5W A;  1WG7 A;  1SGH A;  2J0K A;  1LB1 A;  2J0J A;  4YON A;  1W1H A;  4KHA A;  3FM8 C;  4ZRJ A;  1I7A A;  1QC6 A;  5DHA B;  5C6R A;  4D0N B;  3PSC A;  5DIF B;  1KZ7 A;  1H10 A;  1FAO A;  5D3X A;  4TKN A;  1Y19 B;  4HHV A;  1DDW A;  3ODX A;  2K2U A;  2LUL A;  1OMW A;  1FGZ A;  1XD4 A;  2HTH B;  1PLS A;  2ROV A;  4HAV B;  3P6A A;  3WA0 A;  1MKE A;  4HB4 B;  3ZVR A;  2ZPY A;  1Y5O A;  3DXE A;  2L1C A;  2D9Z A;  4GXB A;  2QKM A;  2DKP A;  3NSU A;  2P0H A;  1MK7 B;  4GZU A;  1DBH A;  5DI9 B;  1XKE A;  4DX9 0;  4DXA B;  1P3R A;  4IFS A;  4NY0 A;  2H7E A;  3KY9 A;  1FHO A;  2I5F A;  3IVF A;  2P8V A;  4Y94 A;  2KCJ A;  3KSY A;  2BCJ A;  2AEH A;  4MT7 A;  1V89 A;  1I2H A;  1OQN A;  2R0D A;  3MDB C;  1ZC3 B;  2HE7 A;  2DHI A;  2D2Q A;  2L2I A;  1RRP B;  3TO1 A;  2I1J A;  5CLL B;  1V5U A;  1XOD A;  1NU2 A;  4DBB A;  2ELA A;  2COA A;  4HDO A;  5FI0 A;  3ODW A;  5J3Y A;  4BBK A;  2I1K A;  1P5T A;  2COF A;  2COD A;  1V5P A;  3WYF B;  3SO6 A;  1GC6 A;  3SNH A;  5J3Q A;  4MY6 A;  3D8D A;  4A5K A;  1K5G B;  2EJ8 A;  2E2X A;  2GCJ A;  4F7H A;  4Z2M B;  5JP4 A;  2NMB A;  1OY2 A;  2DTC A;  2Y8F A;  2KUP A;  5J3T A;  1P6S A;  1V5M A;  1UNP A;  2DHK A;  2Z0O A;  3FEH A;  1BTN A;  3AU5 A;  2D10 A;  1WJ1 A;  4K2P A;  3PG7 A;  3TW1 A;  2D9Y A;  3BJI A;  3T06 A;  2OQB A;  2KGX B;  4CYE A;  3GYP A;  3KRW A;  1MAI A;  1U5D A;  3HK0 A;  2DN6 A;  2JP2 A;  1N3H A;  3CXB B;  4ZRI A;  1UNR A;  3TFM A;  4GMX B;  4CHM A;  5LON B;  2RUK B;  3FSS A;  3HW2 B;  3TCA A;  1U27 A;  3DXD A;  2YS5 A;  3PVW A;  1UPQ A;  1BWN A;  2AL6 A;  1ZSQ A;  5HE0 A;  1SHC A;  2QKL A;  2D11 A;  5CLQ B;  2D9X A;  3D8E A;  2EMS A;  4PNK A;  3PEG A;  2YF0 A;  5HE2 A;  5L81 A;  1WJM A;  4DX8 A;  1U5G A;  4IAP A;  1LW3 A;  2RNR B;  2RVB B;  1WGQ A;  3ULC A;  3A8Q A;  3QBV B;  3RCP A;  2Y7B A;  1DRO A;  1IRS A;  3PP2 A;  4HDQ A;  2GCL A;  1U29 A;  3A8P A;  2VSZ A;  3GYO A;  3DXC A;  5D3Y A;  2XQN M;  2MFQ A;  1TXD A;  2YVC A;  1H4R A;  1FHX A;  4CHJ A;  3F0W A;  3OAN A;  2K2J A;  1Z87 A;  2DA0 A;  4XWX A;  2W2X C;  5DHF B;  3ULB A;  3UZT A;  3AJ4 A;  4HAW B;  4F7G A;  1UNQ A;  4HAT B;  1KI1 B;  2COC A;  2RLO A;  1U2B A;  2MKR A;  3ODO A;  2CY5 A;  1W1G A;  1MPH A;  5GOW B;  5C5B A;  4IOY X;  1U5F A;  3PVU A;  1EAZ A;  1X86 A;  2N23 A;  4WJ7 A;  1GC7 A;  2DKQ A;  4F7U P;  2IFS A;  2LKO A;  4MK0 A;  2ADZ A;  4K2O A;  2DYN A;  5HE3 A;  4P7I A;  4HAY B;  5KCV A;  1EF1 A;  1BAK A;  4L6E A;  2YSZ A;  3N7C A; 
#chains in the Genus database with same CATH topology
 3BIN A;  3CIK A;  3G9W A;  2MDX A;  5KQ4 A;  2DX1 A;  2UZR A;  4HAX B;  5JLJ B;  1ISN A;  2RSG A;  5LOP B;  1V88 A;  1DDM A;  3HQC A;  1PFJ A;  4GN1 A;  3U12 A;  3D8F A;  5JHH A;  1XCG A;  1UPR A;  1KZG A;  2R09 A;  4KHO A;  2M14 A;  2K49 A;  2YS3 A;  3SUZ A;  2J0M A;  2ROZ B;  3ZDT A;  4Z2N A;  1TQZ A;  1ZYI A;  2D9W A;  2FJL A;  3VIA A;  1ZC4 B;  2Z0Q A;  3PVL A;  4A6H A;  4CSQ A;  3VOQ A;  3SYX A;  2V76 A;  5C79 A;  2YT0 A;  4WSF A;  2Z0P A;  4ZRK A;  2GUM A;  4NSW A;  2X18 A;  3QWM A;  5EFX A;  1X05 A;  1FOE A;  1MK9 B;  1V61 A;  2LG1 A;  1UEF A;  1M7E A;  2CRF A;  4K17 A;  2DX5 A;  4B6H A;  1XR0 B;  2LYD A;  5C5B B;  5C16 A;  1PMS A;  2OTX A;  4HB2 B;  2PZ1 A;  1QQG A;  3LJU X;  3A98 B;  1X11 A;  2UVM A;  5D3W A;  4KAX B;  1U5E A;  2VRW B;  2YS1 A;  2IYB A;  2YT1 A;  4EMO A;  2MWN B;  4EJN A;  4GNK B;  2I5C A;  2FJU B;  3O96 A;  2D9V A;  1M7R A;  5FI1 A;  2P0D A;  3U7D A;  2LOZ A;  1DYN A;  1NTV A;  2ELB A;  4HAU B;  2M38 A;  1TJ6 A;  4GMV A;  2K00 A;  3KRX A;  5JHG A;  4H8S A;  1AQC A;  3PZD A;  3U8Z A;  3MPX A;  1W1D A;  1EVH A;  3F5R A;  5DH9 B;  3TVV A;  2VKI A;  4HAZ B;  4HB3 B;  4HSI A;  3V5W A;  3KZ1 A;  1NTY A;  1X1G A;  2CY4 A;  4PQ0 A;  1J19 A;  2DLW A;  1RJ2 A;  4K81 A;  2Y8G A;  2DHJ A;  1GG3 A;  4KVG B;  4A6F B;  1K5D B;  1J0W A;  1WGU A;  3AU4 A;  4EKU A;  2DYQ A;  2CAY A;  1FHW A;  2Q13 A;  1DDV A;  2GS0 A;  1MIZ B;  1AWE A;  2KIG A;  3M1I B;  1ZM0 A;  1MIX A;  1B55 A;  2D4Q A;  1WI1 A;  4KHB B;  1BTK A;  2N0Y A;  1Q67 A;  1WVH A;  1EGX A;  2ZKM X;  3X23 A;  2W2W A;  1ZVR A;  2NBV A;  5M4Y B;  1X1F A;  4GPT B;  3SV1 A;  3QIJ A;  1FB8 A;  1NI2 A;  2GJY A;  2W2X D;  5HE1 A;  4KHB A;  5KQ1 A;  2UZS A;  5D3V A;  2EC1 A;  2P0F A;  4TYZ A;  2G35 A;  3ML4 A;  2J59 M;  1XX0 A;  2LOX A;  4YL8 A;  1FGY A;  2DFK A;  2NZ8 B;  2RGN B;  2YRY A;  4HB0 B;  4WVF B;  2R2Y A;  3P7Z A;  5D27 A;  4QXA B;  5LG4 B;  2H7D A;  4A6F A;  4C0A A;  2EMT A;  4A6K A;  1E5W A;  1WG7 A;  1SGH A;  3NWF A;  2J0K A;  3A58 A;  1LB1 A;  2J0J A;  4YON A;  1W1H A;  4KHA A;  3FM8 C;  4ZRJ A;  1I7A A;  5I2S A;  1QC6 A;  5DHA B;  5C6R A;  4D0N B;  3PSC A;  2KUQ A;  5DIF B;  1KZ7 A;  1H10 A;  1FAO A;  5D3X A;  4TKN A;  1Y19 B;  4HHV A;  1DDW A;  3ODX A;  3NWD A;  2K2U A;  2LUL A;  2RRF A;  1OMW A;  1FGZ A;  1XD4 A;  2HTH B;  1PLS A;  2ROV A;  4HAV B;  3P6A A;  3WA0 A;  1MKE A;  4HB4 B;  3ZVR A;  2ZPY A;  1Y5O A;  3DXE A;  2L1C A;  3OHM B;  2D9Z A;  4GXB A;  2QKM A;  2DKP A;  3NWA A;  3NSU A;  2P0H A;  1MK7 B;  4GZU A;  4D6W A;  1DBH A;  5DI9 B;  1XKE A;  4DX9 0;  4DXA B;  1P3R A;  4IFS A;  4NY0 A;  4QJ4 B;  2Z14 A;  3B77 A;  2H7E A;  3KY9 A;  1FHO A;  4GOU A;  2I5F A;  3IVF A;  2P8V A;  4Y94 A;  2KCJ A;  3KSY A;  3HIE A;  2BCJ A;  2AEH A;  4QJ3 B;  4MT7 A;  1V89 A;  1I2H A;  2R0D A;  1OQN A;  3MDB C;  1T77 A;  1ZC3 B;  2DHI A;  2HE7 A;  2D2Q A;  2L2I A;  1RRP B;  3TO1 A;  2I1J A;  5CLL B;  4OT1 A;  1V5U A;  1XOD A;  1NU2 A;  4DBB A;  2ELA A;  2COA A;  4HDO A;  5FI0 A;  2K8E A;  3ODW A;  5J3Y A;  4BBK A;  2I1K A;  1P5T A;  2COF A;  2COD A;  1V5P A;  3WYF B;  3SO6 A;  1GC6 A;  3HSA A;  3SNH A;  5J3Q A;  4MY6 A;  3D8D A;  4A5K A;  1K5G B;  2EJ8 A;  2E2X A;  2GCJ A;  2KIE A;  4F7H A;  4Z2M B;  5JP4 A;  2NMB A;  1OY2 A;  2DTC A;  2Y8F A;  2KUP A;  5J3T A;  1P6S A;  1V5M A;  1UNP A;  2DHK A;  2Z0O A;  3FEH A;  1BTN A;  3AU5 A;  2D10 A;  1WJ1 A;  4K2P A;  3PG7 A;  3TW1 A;  2D9Y A;  3BJI A;  4OSN A;  3T06 A;  3FVC A;  2OQB A;  2KGX B;  4CYE A;  3GYP A;  3KRW A;  1MAI A;  1U5D A;  2KR0 A;  3HK0 A;  2DN6 A;  2YT2 A;  2JP2 A;  1N3H A;  2Z4D A;  3CXB B;  4ZRI A;  1UNR A;  3TFM A;  4GMX B;  4CHM A;  5LON B;  2RUK B;  3FSS A;  3HW2 B;  5IRS A;  3TCA A;  1U27 A;  3DXD A;  3NW8 A;  2YS5 A;  3PVW A;  1UPQ A;  1BWN A;  2AL6 A;  1ZSQ A;  4QJ5 B;  5HE0 A;  4DIX A;  1SHC A;  2QKL A;  2D11 A;  5CLQ B;  2D9X A;  3D8E A;  2EMS A;  4PNK A;  3PEG A;  2YF0 A;  5HE2 A;  5L81 A;  1WJM A;  4DX8 A;  1U5G A;  4IAP A;  1LW3 A;  2RNR B;  2RVB B;  1WGQ A;  3ULC A;  3A8Q A;  3QBV B;  5I2M A;  3RCP A;  2Y7B A;  1DRO A;  1IRS A;  3PP2 A;  4HDQ A;  2GCL A;  1U29 A;  3A8P A;  2VSZ A;  3GYO A;  3DXC A;  5D3Y A;  2XQN M;  2MFQ A;  1TXD A;  2YVC A;  1H4R A;  2Z13 A;  1FHX A;  4L1R A;  3F0W A;  4CHJ A;  3OAN A;  2K2J A;  1Z87 A;  2DA0 A;  2Z59 A;  4XWX A;  2W2X C;  5DHF B;  3ULB A;  3UZT A;  3AJ4 A;  4HAW B;  4F7G A;  1UNQ A;  4HAT B;  1KI1 B;  3DCX A;  2COC A;  2RLO A;  1U2B A;  2MKR A;  3ODO A;  2CY5 A;  1W1G A;  1MPH A;  5GOW B;  5C5B A;  4IOY X;  1U5F A;  3PVU A;  1EAZ A;  1X86 A;  2N23 A;  4WJ7 A;  1GC7 A;  2DKQ A;  4F7U P;  2IFS A;  2LKO A;  4MK0 A;  2ADZ A;  4K2O A;  2DYN A;  5HE3 A;  1MI1 A;  4P7I A;  4HAY B;  5KCV A;  1EF1 A;  1BAK A;  4L6E A;  2YSZ A;  3N7C A; 
#chains in the Genus database with same CATH homology
 3BIN A;  3CIK A;  3G9W A;  2MDX A;  5KQ4 A;  2DX1 A;  2UZR A;  4HAX B;  5JLJ B;  1ISN A;  2RSG A;  5LOP B;  1V88 A;  1DDM A;  3HQC A;  1PFJ A;  4GN1 A;  3D8F A;  5JHH A;  1XCG A;  1UPR A;  1KZG A;  2R09 A;  4KHO A;  2M14 A;  2YS3 A;  3SUZ A;  2J0M A;  2ROZ B;  3ZDT A;  4Z2N A;  1TQZ A;  2D9W A;  2FJL A;  3VIA A;  1ZC4 B;  2Z0Q A;  3PVL A;  4A6H A;  3VOQ A;  3SYX A;  2V76 A;  5C79 A;  2YT0 A;  4WSF A;  2Z0P A;  4ZRK A;  4NSW A;  2X18 A;  3QWM A;  5EFX A;  1X05 A;  1FOE A;  1MK9 B;  1V61 A;  2LG1 A;  1UEF A;  1M7E A;  2CRF A;  4K17 A;  2DX5 A;  4B6H A;  1XR0 B;  2LYD A;  5C5B B;  5C16 A;  1PMS A;  2OTX A;  4HB2 B;  2PZ1 A;  1QQG A;  3LJU X;  3A98 B;  1X11 A;  2UVM A;  5D3W A;  4KAX B;  1U5E A;  2VRW B;  2YS1 A;  2IYB A;  2YT1 A;  4EMO A;  2MWN B;  4EJN A;  2I5C A;  3O96 A;  2D9V A;  1M7R A;  5FI1 A;  2P0D A;  3U7D A;  2LOZ A;  1DYN A;  1NTV A;  2ELB A;  4HAU B;  2M38 A;  1TJ6 A;  4GMV A;  2K00 A;  3KRX A;  5JHG A;  4H8S A;  1AQC A;  3PZD A;  3U8Z A;  3MPX A;  1W1D A;  1EVH A;  3F5R A;  5DH9 B;  3TVV A;  2VKI A;  4HAZ B;  4HB3 B;  3V5W A;  3KZ1 A;  1NTY A;  1X1G A;  2CY4 A;  4PQ0 A;  1J19 A;  2DLW A;  1RJ2 A;  4K81 A;  2Y8G A;  2DHJ A;  1GG3 A;  4KVG B;  4A6F B;  1K5D B;  1J0W A;  1WGU A;  3AU4 A;  4EKU A;  2DYQ A;  2CAY A;  1FHW A;  2Q13 A;  1DDV A;  2GS0 A;  1MIZ B;  1AWE A;  3M1I B;  1ZM0 A;  1MIX A;  1B55 A;  2D4Q A;  1WI1 A;  4KHB B;  1BTK A;  2N0Y A;  1Q67 A;  1WVH A;  1EGX A;  3X23 A;  2W2W A;  1ZVR A;  1X1F A;  4GPT B;  3SV1 A;  3QIJ A;  1FB8 A;  1NI2 A;  2GJY A;  2W2X D;  5HE1 A;  5KQ1 A;  2UZS A;  5D3V A;  2EC1 A;  2P0F A;  4TYZ A;  2G35 A;  3ML4 A;  2J59 M;  1XX0 A;  2LOX A;  4YL8 A;  1FGY A;  2DFK A;  2NZ8 B;  2RGN B;  2YRY A;  4HB0 B;  4WVF B;  3P7Z A;  5D27 A;  2H7D A;  4A6F A;  4C0A A;  2EMT A;  4A6K A;  1E5W A;  1WG7 A;  1SGH A;  2J0K A;  1LB1 A;  2J0J A;  4YON A;  1W1H A;  4KHA A;  3FM8 C;  4ZRJ A;  1I7A A;  1QC6 A;  5DHA B;  5C6R A;  4D0N B;  3PSC A;  5DIF B;  1KZ7 A;  1H10 A;  1FAO A;  5D3X A;  4TKN A;  1Y19 B;  4HHV A;  1DDW A;  3ODX A;  2K2U A;  2LUL A;  1OMW A;  1FGZ A;  1XD4 A;  2HTH B;  1PLS A;  2ROV A;  4HAV B;  3P6A A;  3WA0 A;  1MKE A;  4HB4 B;  3ZVR A;  2ZPY A;  1Y5O A;  3DXE A;  2L1C A;  2D9Z A;  4GXB A;  2QKM A;  2DKP A;  3NSU A;  2P0H A;  1MK7 B;  4GZU A;  1DBH A;  5DI9 B;  1XKE A;  4DX9 0;  4DXA B;  1P3R A;  4IFS A;  4NY0 A;  2H7E A;  3KY9 A;  1FHO A;  2I5F A;  3IVF A;  2P8V A;  4Y94 A;  2KCJ A;  3KSY A;  2BCJ A;  2AEH A;  4MT7 A;  1V89 A;  1I2H A;  1OQN A;  2R0D A;  3MDB C;  1ZC3 B;  2HE7 A;  2DHI A;  2D2Q A;  2L2I A;  1RRP B;  3TO1 A;  2I1J A;  5CLL B;  1V5U A;  1XOD A;  1NU2 A;  4DBB A;  2ELA A;  2COA A;  4HDO A;  5FI0 A;  3ODW A;  5J3Y A;  4BBK A;  2I1K A;  1P5T A;  2COF A;  2COD A;  1V5P A;  3WYF B;  3SO6 A;  1GC6 A;  3SNH A;  5J3Q A;  4MY6 A;  3D8D A;  4A5K A;  1K5G B;  2EJ8 A;  2E2X A;  2GCJ A;  4F7H A;  4Z2M B;  5JP4 A;  2NMB A;  1OY2 A;  2DTC A;  2Y8F A;  2KUP A;  5J3T A;  1P6S A;  1V5M A;  1UNP A;  2DHK A;  2Z0O A;  3FEH A;  1BTN A;  3AU5 A;  2D10 A;  1WJ1 A;  4K2P A;  3PG7 A;  3TW1 A;  2D9Y A;  3BJI A;  3T06 A;  2OQB A;  2KGX B;  4CYE A;  3GYP A;  3KRW A;  1MAI A;  1U5D A;  3HK0 A;  2DN6 A;  2JP2 A;  1N3H A;  3CXB B;  4ZRI A;  1UNR A;  3TFM A;  4GMX B;  4CHM A;  5LON B;  2RUK B;  3FSS A;  3HW2 B;  3TCA A;  1U27 A;  3DXD A;  2YS5 A;  3PVW A;  1UPQ A;  1BWN A;  2AL6 A;  1ZSQ A;  5HE0 A;  1SHC A;  2QKL A;  2D11 A;  5CLQ B;  2D9X A;  3D8E A;  2EMS A;  4PNK A;  3PEG A;  2YF0 A;  5HE2 A;  5L81 A;  1WJM A;  4DX8 A;  1U5G A;  4IAP A;  1LW3 A;  2RNR B;  2RVB B;  1WGQ A;  3ULC A;  3A8Q A;  3QBV B;  3RCP A;  2Y7B A;  1DRO A;  1IRS A;  3PP2 A;  4HDQ A;  2GCL A;  1U29 A;  3A8P A;  2VSZ A;  3GYO A;  3DXC A;  5D3Y A;  2XQN M;  2MFQ A;  1TXD A;  2YVC A;  1H4R A;  1FHX A;  4CHJ A;  3F0W A;  3OAN A;  2K2J A;  1Z87 A;  2DA0 A;  4XWX A;  2W2X C;  5DHF B;  3ULB A;  3UZT A;  3AJ4 A;  4HAW B;  4F7G A;  1UNQ A;  4HAT B;  1KI1 B;  2COC A;  2RLO A;  1U2B A;  2MKR A;  3ODO A;  2CY5 A;  1W1G A;  1MPH A;  5GOW B;  5C5B A;  4IOY X;  1U5F A;  3PVU A;  1EAZ A;  1X86 A;  2N23 A;  4WJ7 A;  1GC7 A;  2DKQ A;  4F7U P;  2IFS A;  2LKO A;  4MK0 A;  2ADZ A;  4K2O A;  2DYN A;  5HE3 A;  4P7I A;  4HAY B;  5KCV A;  1EF1 A;  1BAK A;  4L6E A;  2YSZ A;  3N7C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...