4CHJA

Structure of inner membrane complex (imc) sub-compartment protein 3 (isp3) from toxoplasma gondii
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
Knots found
sequence length
139
structure length
123
Chain Sequence
ADLEIGREGEVIQVSKEAFDNWMNRYEAGDTMEVLFPDGHRIECNLKIDRPKNFMNLTFNQKVRPIQLDDIAAVLYGSKMLRNPVVGFRLASSGRAIAFSFKDITDAQCFVSFLDDEIKKNQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords IMC SUB-COMPARTMENT PROTEIN ISP3
publication title The Inner Membrane Complex Sub-Compartment Proteins Critical for Replication of the Apicomplexan Parasite Toxoplasma Gondii Adopt a Pleckstrin Homology Fold
pubmed doi rcsb
source organism Toxoplasma gondii
molecule tags Cell cycle
total genus 33
structure length 123
sequence length 139
other databases KnotProt 2.0: K 41
ec nomenclature
pdb deposition date 2013-12-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18045 ISP3_C ISP3 C-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 4chjA00
4WVFB 3U7DA 1W1HA 4HAUB 4BBKA 4Z2MB 2D2QA 2AEHA 2GCJA 4F7HA 4B6HA 2D9YA 2HE7A 2AL6A 2YSZA 2RNRB 3N7CA 4PQ0A 1P5TA 3SO6A 1U29A 3GYOA 5L81A 1P6SA 4GMXB 1Y5OA 2HTHB 1OMWA 1EGXA 2DTCA 3KRXA 2L2IA 1V5MA 1I7AA 1V5PA 1UEFA 2DX1A 2H7DA 1V61A 3KZ1A 2I1JA 3D8FA 1H4RA 3ML4A 2Y7BA 3BJIA 1XX0A 2KCJA 2DKQA 2D9ZA 1XCGA 3ULBA 1ZM0A 1MKEA 1KZ7A 4D0NB 4ZRIA 4MK0A 2L1CA 2K00A 3VIAA 2J0JA 4HDQA 2UZRA 2Y8FA 2H7EA 1KI1B 1NU2A 1GC7A 1KZGA 1XODA 3HW2B 3NSUA 2Z0OA 3SNHA 4DX90 2DLWA 2XQNM 1TJ6A 2X18A 1U5EA 2LOXA 1FHXA 3UZTA 2EJ8A 2GJYA 5C6RA 2KGXB 1BWNA 1DDWA 5C79A 1P3RA 1NTYA 2Z0QA 2D4QA 3ODWA 5LONB 3HQCA 1FGYA 3SYXA 1LB1A 2YF0A 2E2XA 2DN6A 4P7IA 1XR0B 3F5RA 5KQ4A 4XWXA 4HDOA 1J19A 2YRYA 4F7GA 2EC1A 2DA0A 1E5WA 1N3HA 1EVHA 3AU4A 1EAZA 3P7ZA 3ZVRA 1FB8A 2IYBA 2K2UA 2W2XC 5CLLB 2DHKA 4WSFA 2I1KA 2ZPYA 4A6FB 1IRSA 4MT7A 1MIXA 2D9VA 4DXAB 4KVGB 4KHBB 2J59M 3WA0A 5JHHA 1WGUA 4DX8A 2QKLA 3PVLA 2ROVA 4L6EA 3PP2A 4K81A 5FI0A 4EKUA 1UNQA 5D3WA 2CRFA 2P8VA 2VRWB 1DROA 3KSYA 2R0DA 4HAXB 4HHVA 1ZC3B 4A6KA 3KY9A 1PLSA 3FSSA 3KRWA 2J0KA 2D9XA 4HB0B 1WG7A 1I2HA 4HB2B 1DDMA 1FOEA 1K5GB 3O96A 3AJ4A 4Z2NA 1UNPA 3QWMA 4DBBA 1QQGA 2BCJA 2Q13A 4GMVA 3FM8C 4A5KA 3AU5A 1X11A 4CHJA 4TYZA 3DXDA 2R09A 4KAXB 2J0MA 3PVUA 5LOPB 1DYNA 2JP2A 2OQBA 3PG7A 1WGQA 4KHAA 4CHMA 2YS3A 2P0DA 4HB3B 5J3TA 1J0WA 3DXCA 5D3YA 3SUZA 4EMOA 3SV1A 5J3QA 3M1IB 3V5WA 2NZ8B 1MPHA 3MDBC 4HAVB 1DBHA 2N0YA 4HAWB 2DYQA 5HE1A 3A8PA 1MK7B 1BAKA 1X05A 4ZRJA 4ZRKA 5KQ1A 1V89A 1GG3A 2FJLA 1EF1A 1FHWA 2D10A 4PNKA 4NY0A 3DXEA 1WI1A 1DDVA 3ODOA 1RJ2A 3F0WA 2P0HA 1M7RA 1Z87A 2RGNB 2LYDA 1OY2A 1PFJA 4NSWA 1U27A 2DKPA 2VSZA 2P0FA 3PVWA 2DFKA 2I5FA 2D9WA 4IOYX 4WJ7A 3MPXA 1TXDA 5DHFB 2YS1A 3D8DA 3QBVB 4HAYB 2DYNA 1MK9B 1M7EA 5DIFB 2EMSA 5HE2A 5J3YA 2V76A 2YT1A 5C16A 3FEHA 4C0AA 2D11A 2DHJA 2ROZB 1FHOA 3BINA 2MKRA 4HATB 5FI1A 1X86A 1U5GA 1WVHA 4EJNA 4A6FA 4TKNA 3PEGA 2RUKB 2LULA 2IFSA 4K2PA 2MDXA 2KUPA 3CXBB 5D27A 1PMSA 4HAZB 1BTNA 4YONA 2YS5A 2CAYA 1ISNA 1NI2A 3ULCA 2N23A 4Y94A 1NTVA 2COCA 1K5DB 3X23A 2ELBA 1V88A 5DHAB 2LOZA 3LJUX 2I5CA 3CIKA 2RVBB 2PZ1A 4GZUA 5JLJB 1WJMA 3TCAA 3WYFB 1B55A 5DI9B 2QKMA 3VOQA 4F7UP 3T06A 1WJ1A 1V5UA 2M38A 1SHCA 1X1GA 3D8EA 1X1FA 5JHGA 1FAOA 5GOWB 2GCLA 2YT0A 5C5BB 1AWEA 5HE3A 1Y19B 5D3XA 2ELAA 3A98B 3OANA 5EFXA 1SGHA 3P6AA 5DH9B 4A6HA 1LW3A 1U5FA 2GS0A 2CY5A 5KCVA 1RRPB 4IFSA 1ZSQA 3ZDTA 1W1DA 1XKEA 2VKIA 3TO1A 1UPRA 4HB4B 1AQCA 5C5BA 2G35A 2COFA 4KHOA 3RCPA 1UNRA 3GYPA 1Q67A 2RSGA 2CY4A 3HK0A 2LG1A 1U5DA 4GPTB 4K17A 2RLOA 2EMTA 3IVFA 1W1GA 3G9WA 1UPQA 2NMBA 2W2WA 1ZC4B 3PSCA 4MY6A 2W2XD 4CYEA 1ZVRA 1FGZA 2MWNB 5D3VA 2YVCA 1OQNA 3ODXA 3PZDA 1BTKA 4YL8A 2UVMA 2COAA 4K2OA 3U8ZA 1XD4A 1QC6A 5JP4A 2DX5A 1TQZA 2DHIA 2LKOA 3TW1A 4GXBA 4IAPA 3QIJA 3TFMA 2Y8GA 1MIZB 1H10A 3TVVA 5CLQB 2CODA 1MAIA 2ADZA 4GN1A 1U2BA 1GC6A 2MFQA 5HE0A 2M14A 4H8SA 2OTXA 2UZSA 3A8QA 2K2JA 2Z0PA
chains in the Genus database with same CATH superfamily
5M4YB 4WVFB 4L1RA 3U7DA 1W1HA 4HAUB 4BBKA 4Z2MB 2D2QA 2AEHA 2GCJA 4F7HA 4B6HA 2D9YA 2HE7A 2AL6A 2YSZA 2RNRB 3N7CA 4PQ0A 1P5TA 3SO6A 1U29A 3GYOA 5L81A 1P6SA 4GMXB 1Y5OA 3NWDA 2HTHB 1OMWA 1EGXA 2DTCA 3KRXA 2L2IA 1V5MA 1I7AA 1V5PA 1UEFA 2DX1A 2H7DA 1V61A 3KZ1A 2K8EA 2I1JA 3D8FA 1H4RA 3ML4A 2Y7BA 3BJIA 1XX0A 2KCJA 2DKQA 2D9ZA 1XCGA 3ULBA 1ZM0A 1MKEA 2K49A 1KZ7A 4D0NB 4ZRIA 4MK0A 2Z4DA 2L1CA 4QJ4B 1T77A 2K00A 3VIAA 2J0JA 4HDQA 2UZRA 2Y8FA 2H7EA 1KI1B 1NU2A 1GC7A 1KZGA 1XODA 3HW2B 4D6WA 3NSUA 2Z0OA 3SNHA 4DX90 2DLWA 2XQNM 1TJ6A 2X18A 1U5EA 2LOXA 1FHXA 3UZTA 2EJ8A 2GJYA 5C6RA 2KGXB 1BWNA 1DDWA 5C79A 1P3RA 1NTYA 2Z0QA 2D4QA 3ODWA 4QJ5B 5LONB 3HQCA 1FGYA 3SYXA 1LB1A 2YF0A 2E2XA 2DN6A 2ZKMX 1XR0B 2R2YA 3F5RA 4P7IA 5KQ4A 4XWXA 4HDOA 1MI1A 1J19A 2YRYA 4F7GA 2EC1A 2DA0A 1E5WA 1N3HA 1EVHA 3AU4A 1EAZA 3P7ZA 3ZVRA 1FB8A 2IYBA 2K2UA 2W2XC 5CLLB 2DHKA 4WSFA 2I1KA 2ZPYA 4A6FB 1IRSA 4MT7A 1MIXA 2D9VA 4DXAB 4KVGB 4KHBB 2J59M 3WA0A 5JHHA 1WGUA 4DX8A 2QKLA 3PVLA 2ROVA 4L6EA 3PP2A 4K81A 5FI0A 4EKUA 4GOUA 1UNQA 5D3WA 2CRFA 2P8VA 4QJ3B 2VRWB 1ZYIA 1DROA 3KSYA 2R0DA 4HAXB 4HHVA 1ZC3B 4A6KA 3KY9A 1PLSA 3FSSA 3KRWA 2J0KA 2D9XA 4HB0B 1WG7A 1I2HA 2Z59A 4HB2B 1DDMA 1FOEA 1K5GB 3O96A 3AJ4A 4Z2NA 1UNPA 3QWMA 4DBBA 1QQGA 2BCJA 2Q13A 4GMVA 2KUQA 3FM8C 4A5KA 3AU5A 1X11A 4CHJA 4TYZA 3DXDA 2R09A 4KAXB 2J0MA 3PVUA 5LOPB 1DYNA 2Z14A 2JP2A 2OQBA 3PG7A 1WGQA 4KHAA 4CHMA 2YS3A 5I2MA 2P0DA 4HB3B 5J3TA 1J0WA 3DXCA 5D3YA 3SUZA 4EMOA 3SV1A 5J3QA 3M1IB 3V5WA 2NZ8B 1MPHA 3MDBC 4HAVB 1DBHA 4DIXA 2N0YA 4HAWB 2DYQA 5HE1A 3A8PA 1MK7B 1BAKA 1X05A 4ZRJA 4ZRKA 5KQ1A 1V89A 1GG3A 2FJLA 1EF1A 1FHWA 2D10A 4PNKA 4NY0A 3DXEA 1WI1A 1DDVA 3ODOA 5LG4B 1RJ2A 3F0WA 2P0HA 1M7RA 1Z87A 2RGNB 2LYDA 1OY2A 1PFJA 3DCXA 4NSWA 1U27A 2DKPA 2VSZA 2P0FA 3PVWA 2DFKA 2I5FA 2D9WA 4IOYX 4WJ7A 3MPXA 1TXDA 5DHFB 2YS1A 3D8DA 3QBVB 4HAYB 2DYNA 3OHMB 1MK9B 1M7EA 4OSNA 5DIFB 2EMSA 5HE2A 2YT2A 5J3YA 2V76A 2YT1A 5C16A 3FEHA 4C0AA 4GNKB 2D11A 2DHJA 2ROZB 1FHOA 3BINA 2MKRA 4HATB 5FI1A 1X86A 1U5GA 1WVHA 4EJNA 5I2SA 3U12A 4OT1A 4QXAB 4A6FA 4TKNA 3PEGA 2RUKB 4KHBA 2LULA 2IFSA 4K2PA 2MDXA 2KUPA 2FJUB 3CXBB 5D27A 1PMSA 4HAZB 1BTNA 4YONA 2YS5A 2CAYA 1ISNA 1NI2A 3ULCA 2N23A 4Y94A 1NTVA 2COCA 1K5DB 3X23A 2ELBA 1V88A 5DHAB 2LOZA 3LJUX 2I5CA 3CIKA 2RVBB 2PZ1A 4GZUA 5JLJB 1WJMA 3TCAA 3WYFB 1B55A 5DI9B 2NBVA 2QKMA 3VOQA 4F7UP 3T06A 1WJ1A 1V5UA 2M38A 1SHCA 2KIEA 1X1GA 3D8EA 1X1FA 5JHGA 1FAOA 5GOWB 2GCLA 3HIEA 2YT0A 5C5BB 1AWEA 5HE3A 1Y19B 5D3XA 2ELAA 3A98B 3OANA 5EFXA 1SGHA 3P6AA 5DH9B 4A6HA 1LW3A 2KR0A 1U5FA 2GS0A 2CY5A 5KCVA 1RRPB 3NWFA 4CSQA 4IFSA 1ZSQA 3ZDTA 1W1DA 1XKEA 2VKIA 3TO1A 2GUMA 1UPRA 3NWAA 1AQCA 4HB4B 5C5BA 2KIGA 2G35A 2COFA 4KHOA 3RCPA 1UNRA 3GYPA 1Q67A 2RSGA 2CY4A 3HK0A 2LG1A 1U5DA 4GPTB 4K17A 2RLOA 5IRSA 2EMTA 3IVFA 1W1GA 3G9WA 1UPQA 2NMBA 2W2WA 1ZC4B 3PSCA 4MY6A 2W2XD 4CYEA 1ZVRA 1FGZA 2MWNB 5D3VA 2YVCA 1OQNA 3B77A 3ODXA 3PZDA 1BTKA 4YL8A 2UVMA 2COAA 4K2OA 3U8ZA 2RRFA 1XD4A 1QC6A 5JP4A 2DX5A 1TQZA 2DHIA 2LKOA 2Z13A 3TW1A 3FVCA 4GXBA 4IAPA 3QIJA 3TFMA 2Y8GA 1MIZB 1H10A 3HSAA 3TVVA 5CLQB 2CODA 1MAIA 2ADZA 3A58A 4HSIA 4GN1A 1U2BA 1GC6A 2MFQA 3NW8A 5HE0A 2M14A 4H8SA 2OTXA 2UZSA 3A8QA 2K2JA 2Z0PA
chains in the Genus database with same CATH topology
4WVFB 3U7DA 1W1HA 4HAUB 4BBKA 4Z2MB 2D2QA 2AEHA 2GCJA 4F7HA 4B6HA 2D9YA 2HE7A 2AL6A 2YSZA 2RNRB 3N7CA 4PQ0A 1P5TA 3SO6A 1U29A 3GYOA 5L81A 1P6SA 4GMXB 1Y5OA 2HTHB 1OMWA 1EGXA 2DTCA 3KRXA 2L2IA 1V5MA 1I7AA 1V5PA 1UEFA 2DX1A 2H7DA 1V61A 3KZ1A 2I1JA 3D8FA 1H4RA 3ML4A 2Y7BA 3BJIA 1XX0A 2KCJA 2DKQA 2D9ZA 1XCGA 3ULBA 1ZM0A 1MKEA 1KZ7A 4D0NB 4ZRIA 4MK0A 2L1CA 2K00A 3VIAA 2J0JA 4HDQA 2UZRA 2Y8FA 2H7EA 1KI1B 1NU2A 1GC7A 1KZGA 1XODA 3HW2B 3NSUA 2Z0OA 3SNHA 4DX90 2DLWA 2XQNM 1TJ6A 2X18A 1U5EA 2LOXA 1FHXA 3UZTA 2EJ8A 2GJYA 5C6RA 2KGXB 1BWNA 1DDWA 5C79A 1P3RA 1NTYA 2Z0QA 2D4QA 3ODWA 5LONB 3HQCA 1FGYA 3SYXA 1LB1A 2YF0A 2E2XA 2DN6A 4P7IA 1XR0B 3F5RA 5KQ4A 4XWXA 4HDOA 1J19A 2YRYA 4F7GA 2EC1A 2DA0A 1E5WA 1N3HA 1EVHA 3AU4A 1EAZA 3P7ZA 3ZVRA 1FB8A 2IYBA 2K2UA 2W2XC 5CLLB 2DHKA 4WSFA 2I1KA 2ZPYA 4A6FB 1IRSA 4MT7A 1MIXA 2D9VA 4DXAB 4KVGB 4KHBB 2J59M 3WA0A 5JHHA 1WGUA 4DX8A 2QKLA 3PVLA 2ROVA 4L6EA 3PP2A 4K81A 5FI0A 4EKUA 1UNQA 5D3WA 2CRFA 2P8VA 2VRWB 1DROA 3KSYA 2R0DA 4HAXB 4HHVA 1ZC3B 4A6KA 3KY9A 1PLSA 3FSSA 3KRWA 2J0KA 2D9XA 4HB0B 1WG7A 1I2HA 4HB2B 1DDMA 1FOEA 1K5GB 3O96A 3AJ4A 4Z2NA 1UNPA 3QWMA 4DBBA 1QQGA 2BCJA 2Q13A 4GMVA 3FM8C 4A5KA 3AU5A 1X11A 4CHJA 4TYZA 3DXDA 2R09A 4KAXB 2J0MA 3PVUA 5LOPB 1DYNA 2JP2A 2OQBA 3PG7A 1WGQA 4KHAA 4CHMA 2YS3A 2P0DA 4HB3B 5J3TA 1J0WA 3DXCA 5D3YA 3SUZA 4EMOA 3SV1A 5J3QA 3M1IB 3V5WA 2NZ8B 1MPHA 3MDBC 4HAVB 1DBHA 2N0YA 4HAWB 2DYQA 5HE1A 3A8PA 1MK7B 1BAKA 1X05A 4ZRJA 4ZRKA 5KQ1A 1V89A 1GG3A 2FJLA 1EF1A 1FHWA 2D10A 4PNKA 4NY0A 3DXEA 1WI1A 1DDVA 3ODOA 1RJ2A 3F0WA 2P0HA 1M7RA 1Z87A 2RGNB 2LYDA 1OY2A 1PFJA 4NSWA 1U27A 2DKPA 2VSZA 2P0FA 3PVWA 2DFKA 2I5FA 2D9WA 4IOYX 4WJ7A 3MPXA 1TXDA 5DHFB 2YS1A 3D8DA 3QBVB 4HAYB 2DYNA 1MK9B 1M7EA 5DIFB 2EMSA 5HE2A 5J3YA 2V76A 2YT1A 5C16A 3FEHA 4C0AA 2D11A 2DHJA 2ROZB 1FHOA 3BINA 2MKRA 4HATB 5FI1A 1X86A 1U5GA 1WVHA 4EJNA 4A6FA 4TKNA 3PEGA 2RUKB 2LULA 2IFSA 4K2PA 2MDXA 2KUPA 3CXBB 5D27A 1PMSA 4HAZB 1BTNA 4YONA 2YS5A 2CAYA 1ISNA 1NI2A 3ULCA 2N23A 4Y94A 1NTVA 2COCA 1K5DB 3X23A 2ELBA 1V88A 5DHAB 2LOZA 3LJUX 2I5CA 3CIKA 2RVBB 2PZ1A 4GZUA 5JLJB 1WJMA 3TCAA 3WYFB 1B55A 5DI9B 2QKMA 3VOQA 4F7UP 3T06A 1WJ1A 1V5UA 2M38A 1SHCA 1X1GA 3D8EA 1X1FA 5JHGA 1FAOA 5GOWB 2GCLA 2YT0A 5C5BB 1AWEA 5HE3A 1Y19B 5D3XA 2ELAA 3A98B 3OANA 5EFXA 1SGHA 3P6AA 5DH9B 4A6HA 1LW3A 1U5FA 2GS0A 2CY5A 5KCVA 1RRPB 4IFSA 1ZSQA 3ZDTA 1W1DA 1XKEA 2VKIA 3TO1A 1UPRA 4HB4B 1AQCA 5C5BA 2G35A 2COFA 4KHOA 3RCPA 1UNRA 3GYPA 1Q67A 2RSGA 2CY4A 3HK0A 2LG1A 1U5DA 4GPTB 4K17A 2RLOA 2EMTA 3IVFA 1W1GA 3G9WA 1UPQA 2NMBA 2W2WA 1ZC4B 3PSCA 4MY6A 2W2XD 4CYEA 1ZVRA 1FGZA 2MWNB 5D3VA 2YVCA 1OQNA 3ODXA 3PZDA 1BTKA 4YL8A 2UVMA 2COAA 4K2OA 3U8ZA 1XD4A 1QC6A 5JP4A 2DX5A 1TQZA 2DHIA 2LKOA 3TW1A 4GXBA 4IAPA 3QIJA 3TFMA 2Y8GA 1MIZB 1H10A 3TVVA 5CLQB 2CODA 1MAIA 2ADZA 4GN1A 1U2BA 1GC6A 2MFQA 5HE0A 2M14A 4H8SA 2OTXA 2UZSA 3A8QA 2K2JA 2Z0PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4WVF B;  3U7D A;  1W1H A;  4HAU B;  4BBK A;  4Z2M B;  2D2Q A;  2AEH A;  2GCJ A;  4F7H A;  4B6H A;  2D9Y A;  2HE7 A;  2AL6 A;  2YSZ A;  2RNR B;  3N7C A;  4PQ0 A;  1P5T A;  3SO6 A;  1U29 A;  3GYO A;  5L81 A;  1P6S A;  4GMX B;  1Y5O A;  2HTH B;  1OMW A;  1EGX A;  2DTC A;  3KRX A;  2L2I A;  1V5M A;  1I7A A;  1V5P A;  1UEF A;  2DX1 A;  2H7D A;  1V61 A;  3KZ1 A;  2I1J A;  3D8F A;  1H4R A;  3ML4 A;  2Y7B A;  3BJI A;  1XX0 A;  2KCJ A;  2DKQ A;  2D9Z A;  1XCG A;  3ULB A;  1ZM0 A;  1MKE A;  1KZ7 A;  4D0N B;  4ZRI A;  4MK0 A;  2L1C A;  2K00 A;  3VIA A;  2J0J A;  4HDQ A;  2UZR A;  2Y8F A;  2H7E A;  1KI1 B;  1NU2 A;  1GC7 A;  1KZG A;  1XOD A;  3HW2 B;  3NSU A;  2Z0O A;  3SNH A;  4DX9 0;  2DLW A;  2XQN M;  1TJ6 A;  2X18 A;  1U5E A;  2LOX A;  1FHX A;  3UZT A;  2EJ8 A;  2GJY A;  5C6R A;  2KGX B;  1BWN A;  1DDW A;  5C79 A;  1P3R A;  1NTY A;  2Z0Q A;  2D4Q A;  3ODW A;  5LON B;  3HQC A;  1FGY A;  3SYX A;  1LB1 A;  2YF0 A;  2E2X A;  2DN6 A;  4P7I A;  1XR0 B;  3F5R A;  5KQ4 A;  4XWX A;  4HDO A;  1J19 A;  2YRY A;  4F7G A;  2EC1 A;  2DA0 A;  1E5W A;  1N3H A;  1EVH A;  3AU4 A;  1EAZ A;  3P7Z A;  3ZVR A;  1FB8 A;  2IYB A;  2K2U A;  2W2X C;  5CLL B;  2DHK A;  4WSF A;  2I1K A;  2ZPY A;  4A6F B;  1IRS A;  4MT7 A;  1MIX A;  2D9V A;  4DXA B;  4KVG B;  4KHB B;  2J59 M;  3WA0 A;  5JHH A;  1WGU A;  4DX8 A;  2QKL A;  3PVL A;  2ROV A;  4L6E A;  3PP2 A;  4K81 A;  5FI0 A;  4EKU A;  1UNQ A;  5D3W A;  2CRF A;  2P8V A;  2VRW B;  1DRO A;  3KSY A;  2R0D A;  4HAX B;  4HHV A;  1ZC3 B;  4A6K A;  3KY9 A;  1PLS A;  3FSS A;  3KRW A;  2J0K A;  2D9X A;  4HB0 B;  1WG7 A;  1I2H A;  4HB2 B;  1DDM A;  1FOE A;  1K5G B;  3O96 A;  3AJ4 A;  4Z2N A;  1UNP A;  3QWM A;  4DBB A;  1QQG A;  2BCJ A;  2Q13 A;  4GMV A;  3FM8 C;  4A5K A;  3AU5 A;  1X11 A;  4CHJ A;  4TYZ A;  3DXD A;  2R09 A;  4KAX B;  2J0M A;  3PVU A;  5LOP B;  1DYN A;  2JP2 A;  2OQB A;  3PG7 A;  1WGQ A;  4KHA A;  4CHM A;  2YS3 A;  2P0D A;  4HB3 B;  5J3T A;  1J0W A;  3DXC A;  5D3Y A;  3SUZ A;  4EMO A;  3SV1 A;  5J3Q A;  3M1I B;  3V5W A;  2NZ8 B;  1MPH A;  3MDB C;  4HAV B;  1DBH A;  2N0Y A;  4HAW B;  2DYQ A;  5HE1 A;  3A8P A;  1MK7 B;  1BAK A;  1X05 A;  4ZRJ A;  4ZRK A;  5KQ1 A;  1V89 A;  1GG3 A;  2FJL A;  1EF1 A;  1FHW A;  2D10 A;  4PNK A;  4NY0 A;  3DXE A;  1WI1 A;  1DDV A;  3ODO A;  1RJ2 A;  3F0W A;  2P0H A;  1M7R A;  1Z87 A;  2RGN B;  2LYD A;  1OY2 A;  1PFJ A;  4NSW A;  1U27 A;  2DKP A;  2VSZ A;  2P0F A;  3PVW A;  2DFK A;  2I5F A;  2D9W A;  4IOY X;  4WJ7 A;  3MPX A;  1TXD A;  5DHF B;  2YS1 A;  3D8D A;  3QBV B;  4HAY B;  2DYN A;  1MK9 B;  1M7E A;  5DIF B;  2EMS A;  5HE2 A;  5J3Y A;  2V76 A;  2YT1 A;  5C16 A;  3FEH A;  4C0A A;  2D11 A;  2DHJ A;  2ROZ B;  1FHO A;  3BIN A;  2MKR A;  4HAT B;  5FI1 A;  1X86 A;  1U5G A;  1WVH A;  4EJN A;  4A6F A;  4TKN A;  3PEG A;  2RUK B;  2LUL A;  2IFS A;  4K2P A;  2MDX A;  2KUP A;  3CXB B;  5D27 A;  1PMS A;  4HAZ B;  1BTN A;  4YON A;  2YS5 A;  2CAY A;  1ISN A;  1NI2 A;  3ULC A;  2N23 A;  4Y94 A;  1NTV A;  2COC A;  1K5D B;  3X23 A;  2ELB A;  1V88 A;  5DHA B;  2LOZ A;  3LJU X;  2I5C A;  3CIK A;  2RVB B;  2PZ1 A;  4GZU A;  5JLJ B;  1WJM A;  3TCA A;  3WYF B;  1B55 A;  5DI9 B;  2QKM A;  3VOQ A;  4F7U P;  3T06 A;  1WJ1 A;  1V5U A;  2M38 A;  1SHC A;  1X1G A;  3D8E A;  1X1F A;  5JHG A;  1FAO A;  5GOW B;  2GCL A;  2YT0 A;  5C5B B;  1AWE A;  5HE3 A;  1Y19 B;  5D3X A;  2ELA A;  3A98 B;  3OAN A;  5EFX A;  1SGH A;  3P6A A;  5DH9 B;  4A6H A;  1LW3 A;  1U5F A;  2GS0 A;  2CY5 A;  5KCV A;  1RRP B;  4IFS A;  1ZSQ A;  3ZDT A;  1W1D A;  1XKE A;  2VKI A;  3TO1 A;  1UPR A;  4HB4 B;  1AQC A;  5C5B A;  2G35 A;  2COF A;  4KHO A;  3RCP A;  1UNR A;  3GYP A;  1Q67 A;  2RSG A;  2CY4 A;  3HK0 A;  2LG1 A;  1U5D A;  4GPT B;  4K17 A;  2RLO A;  2EMT A;  3IVF A;  1W1G A;  3G9W A;  1UPQ A;  2NMB A;  2W2W A;  1ZC4 B;  3PSC A;  4MY6 A;  2W2X D;  4CYE A;  1ZVR A;  1FGZ A;  2MWN B;  5D3V A;  2YVC A;  1OQN A;  3ODX A;  3PZD A;  1BTK A;  4YL8 A;  2UVM A;  2COA A;  4K2O A;  3U8Z A;  1XD4 A;  1QC6 A;  5JP4 A;  2DX5 A;  1TQZ A;  2DHI A;  2LKO A;  3TW1 A;  4GXB A;  4IAP A;  3QIJ A;  3TFM A;  2Y8G A;  1MIZ B;  1H10 A;  3TVV A;  5CLQ B;  2COD A;  1MAI A;  2ADZ A;  4GN1 A;  1U2B A;  1GC6 A;  2MFQ A;  5HE0 A;  2M14 A;  4H8S A;  2OTX A;  2UZS A;  3A8Q A;  2K2J A;  2Z0P A; 
#chains in the Genus database with same CATH topology
 5M4Y B;  4WVF B;  4L1R A;  3U7D A;  1W1H A;  4HAU B;  4BBK A;  4Z2M B;  2D2Q A;  2AEH A;  2GCJ A;  4F7H A;  4B6H A;  2D9Y A;  2HE7 A;  2AL6 A;  2YSZ A;  2RNR B;  3N7C A;  4PQ0 A;  1P5T A;  3SO6 A;  1U29 A;  3GYO A;  5L81 A;  1P6S A;  4GMX B;  1Y5O A;  3NWD A;  2HTH B;  1OMW A;  1EGX A;  2DTC A;  3KRX A;  2L2I A;  1V5M A;  1I7A A;  1V5P A;  1UEF A;  2DX1 A;  2H7D A;  1V61 A;  3KZ1 A;  2K8E A;  2I1J A;  3D8F A;  1H4R A;  3ML4 A;  2Y7B A;  3BJI A;  1XX0 A;  2KCJ A;  2DKQ A;  2D9Z A;  1XCG A;  3ULB A;  1ZM0 A;  1MKE A;  2K49 A;  1KZ7 A;  4D0N B;  4ZRI A;  4MK0 A;  2Z4D A;  2L1C A;  4QJ4 B;  1T77 A;  2K00 A;  3VIA A;  2J0J A;  4HDQ A;  2UZR A;  2Y8F A;  2H7E A;  1KI1 B;  1NU2 A;  1GC7 A;  1KZG A;  1XOD A;  3HW2 B;  4D6W A;  3NSU A;  2Z0O A;  3SNH A;  4DX9 0;  2DLW A;  2XQN M;  1TJ6 A;  2X18 A;  1U5E A;  2LOX A;  1FHX A;  3UZT A;  2EJ8 A;  2GJY A;  5C6R A;  2KGX B;  1BWN A;  1DDW A;  5C79 A;  1P3R A;  1NTY A;  2Z0Q A;  2D4Q A;  3ODW A;  4QJ5 B;  5LON B;  3HQC A;  1FGY A;  3SYX A;  1LB1 A;  2YF0 A;  2E2X A;  2DN6 A;  2ZKM X;  1XR0 B;  2R2Y A;  3F5R A;  4P7I A;  5KQ4 A;  4XWX A;  4HDO A;  1MI1 A;  1J19 A;  2YRY A;  4F7G A;  2EC1 A;  2DA0 A;  1E5W A;  1N3H A;  1EVH A;  3AU4 A;  1EAZ A;  3P7Z A;  3ZVR A;  1FB8 A;  2IYB A;  2K2U A;  2W2X C;  5CLL B;  2DHK A;  4WSF A;  2I1K A;  2ZPY A;  4A6F B;  1IRS A;  4MT7 A;  1MIX A;  2D9V A;  4DXA B;  4KVG B;  4KHB B;  2J59 M;  3WA0 A;  5JHH A;  1WGU A;  4DX8 A;  2QKL A;  3PVL A;  2ROV A;  4L6E A;  3PP2 A;  4K81 A;  5FI0 A;  4EKU A;  4GOU A;  1UNQ A;  5D3W A;  2CRF A;  2P8V A;  4QJ3 B;  2VRW B;  1ZYI A;  1DRO A;  3KSY A;  2R0D A;  4HAX B;  4HHV A;  1ZC3 B;  4A6K A;  3KY9 A;  1PLS A;  3FSS A;  3KRW A;  2J0K A;  2D9X A;  4HB0 B;  1WG7 A;  1I2H A;  2Z59 A;  4HB2 B;  1DDM A;  1FOE A;  1K5G B;  3O96 A;  3AJ4 A;  4Z2N A;  1UNP A;  3QWM A;  4DBB A;  1QQG A;  2BCJ A;  2Q13 A;  4GMV A;  2KUQ A;  3FM8 C;  4A5K A;  3AU5 A;  1X11 A;  4CHJ A;  4TYZ A;  3DXD A;  2R09 A;  4KAX B;  2J0M A;  3PVU A;  5LOP B;  1DYN A;  2Z14 A;  2JP2 A;  2OQB A;  3PG7 A;  1WGQ A;  4KHA A;  4CHM A;  2YS3 A;  5I2M A;  2P0D A;  4HB3 B;  5J3T A;  1J0W A;  3DXC A;  5D3Y A;  3SUZ A;  4EMO A;  3SV1 A;  5J3Q A;  3M1I B;  3V5W A;  2NZ8 B;  1MPH A;  3MDB C;  4HAV B;  1DBH A;  4DIX A;  2N0Y A;  4HAW B;  2DYQ A;  5HE1 A;  3A8P A;  1MK7 B;  1BAK A;  1X05 A;  4ZRJ A;  4ZRK A;  5KQ1 A;  1V89 A;  1GG3 A;  2FJL A;  1EF1 A;  1FHW A;  2D10 A;  4PNK A;  4NY0 A;  3DXE A;  1WI1 A;  1DDV A;  3ODO A;  5LG4 B;  1RJ2 A;  3F0W A;  2P0H A;  1M7R A;  1Z87 A;  2RGN B;  2LYD A;  1OY2 A;  1PFJ A;  3DCX A;  4NSW A;  1U27 A;  2DKP A;  2VSZ A;  2P0F A;  3PVW A;  2DFK A;  2I5F A;  2D9W A;  4IOY X;  4WJ7 A;  3MPX A;  1TXD A;  5DHF B;  2YS1 A;  3D8D A;  3QBV B;  4HAY B;  2DYN A;  3OHM B;  1MK9 B;  1M7E A;  4OSN A;  5DIF B;  2EMS A;  5HE2 A;  2YT2 A;  5J3Y A;  2V76 A;  2YT1 A;  5C16 A;  3FEH A;  4C0A A;  4GNK B;  2D11 A;  2DHJ A;  2ROZ B;  1FHO A;  3BIN A;  2MKR A;  4HAT B;  5FI1 A;  1X86 A;  1U5G A;  1WVH A;  4EJN A;  5I2S A;  3U12 A;  4OT1 A;  4QXA B;  4A6F A;  4TKN A;  3PEG A;  2RUK B;  4KHB A;  2LUL A;  2IFS A;  4K2P A;  2MDX A;  2KUP A;  2FJU B;  3CXB B;  5D27 A;  1PMS A;  4HAZ B;  1BTN A;  4YON A;  2YS5 A;  2CAY A;  1ISN A;  1NI2 A;  3ULC A;  2N23 A;  4Y94 A;  1NTV A;  2COC A;  1K5D B;  3X23 A;  2ELB A;  1V88 A;  5DHA B;  2LOZ A;  3LJU X;  2I5C A;  3CIK A;  2RVB B;  2PZ1 A;  4GZU A;  5JLJ B;  1WJM A;  3TCA A;  3WYF B;  1B55 A;  5DI9 B;  2NBV A;  2QKM A;  3VOQ A;  4F7U P;  3T06 A;  1WJ1 A;  1V5U A;  2M38 A;  1SHC A;  2KIE A;  1X1G A;  3D8E A;  1X1F A;  5JHG A;  1FAO A;  5GOW B;  2GCL A;  3HIE A;  2YT0 A;  5C5B B;  1AWE A;  5HE3 A;  1Y19 B;  5D3X A;  2ELA A;  3A98 B;  3OAN A;  5EFX A;  1SGH A;  3P6A A;  5DH9 B;  4A6H A;  1LW3 A;  2KR0 A;  1U5F A;  2GS0 A;  2CY5 A;  5KCV A;  1RRP B;  3NWF A;  4CSQ A;  4IFS A;  1ZSQ A;  3ZDT A;  1W1D A;  1XKE A;  2VKI A;  3TO1 A;  2GUM A;  1UPR A;  3NWA A;  1AQC A;  4HB4 B;  5C5B A;  2KIG A;  2G35 A;  2COF A;  4KHO A;  3RCP A;  1UNR A;  3GYP A;  1Q67 A;  2RSG A;  2CY4 A;  3HK0 A;  2LG1 A;  1U5D A;  4GPT B;  4K17 A;  2RLO A;  5IRS A;  2EMT A;  3IVF A;  1W1G A;  3G9W A;  1UPQ A;  2NMB A;  2W2W A;  1ZC4 B;  3PSC A;  4MY6 A;  2W2X D;  4CYE A;  1ZVR A;  1FGZ A;  2MWN B;  5D3V A;  2YVC A;  1OQN A;  3B77 A;  3ODX A;  3PZD A;  1BTK A;  4YL8 A;  2UVM A;  2COA A;  4K2O A;  3U8Z A;  2RRF A;  1XD4 A;  1QC6 A;  5JP4 A;  2DX5 A;  1TQZ A;  2DHI A;  2LKO A;  2Z13 A;  3TW1 A;  3FVC A;  4GXB A;  4IAP A;  3QIJ A;  3TFM A;  2Y8G A;  1MIZ B;  1H10 A;  3HSA A;  3TVV A;  5CLQ B;  2COD A;  1MAI A;  2ADZ A;  3A58 A;  4HSI A;  4GN1 A;  1U2B A;  1GC6 A;  2MFQ A;  3NW8 A;  5HE0 A;  2M14 A;  4H8S A;  2OTX A;  2UZS A;  3A8Q A;  2K2J A;  2Z0P A; 
#chains in the Genus database with same CATH homology
 4WVF B;  3U7D A;  1W1H A;  4HAU B;  4BBK A;  4Z2M B;  2D2Q A;  2AEH A;  2GCJ A;  4F7H A;  4B6H A;  2D9Y A;  2HE7 A;  2AL6 A;  2YSZ A;  2RNR B;  3N7C A;  4PQ0 A;  1P5T A;  3SO6 A;  1U29 A;  3GYO A;  5L81 A;  1P6S A;  4GMX B;  1Y5O A;  2HTH B;  1OMW A;  1EGX A;  2DTC A;  3KRX A;  2L2I A;  1V5M A;  1I7A A;  1V5P A;  1UEF A;  2DX1 A;  2H7D A;  1V61 A;  3KZ1 A;  2I1J A;  3D8F A;  1H4R A;  3ML4 A;  2Y7B A;  3BJI A;  1XX0 A;  2KCJ A;  2DKQ A;  2D9Z A;  1XCG A;  3ULB A;  1ZM0 A;  1MKE A;  1KZ7 A;  4D0N B;  4ZRI A;  4MK0 A;  2L1C A;  2K00 A;  3VIA A;  2J0J A;  4HDQ A;  2UZR A;  2Y8F A;  2H7E A;  1KI1 B;  1NU2 A;  1GC7 A;  1KZG A;  1XOD A;  3HW2 B;  3NSU A;  2Z0O A;  3SNH A;  4DX9 0;  2DLW A;  2XQN M;  1TJ6 A;  2X18 A;  1U5E A;  2LOX A;  1FHX A;  3UZT A;  2EJ8 A;  2GJY A;  5C6R A;  2KGX B;  1BWN A;  1DDW A;  5C79 A;  1P3R A;  1NTY A;  2Z0Q A;  2D4Q A;  3ODW A;  5LON B;  3HQC A;  1FGY A;  3SYX A;  1LB1 A;  2YF0 A;  2E2X A;  2DN6 A;  4P7I A;  1XR0 B;  3F5R A;  5KQ4 A;  4XWX A;  4HDO A;  1J19 A;  2YRY A;  4F7G A;  2EC1 A;  2DA0 A;  1E5W A;  1N3H A;  1EVH A;  3AU4 A;  1EAZ A;  3P7Z A;  3ZVR A;  1FB8 A;  2IYB A;  2K2U A;  2W2X C;  5CLL B;  2DHK A;  4WSF A;  2I1K A;  2ZPY A;  4A6F B;  1IRS A;  4MT7 A;  1MIX A;  2D9V A;  4DXA B;  4KVG B;  4KHB B;  2J59 M;  3WA0 A;  5JHH A;  1WGU A;  4DX8 A;  2QKL A;  3PVL A;  2ROV A;  4L6E A;  3PP2 A;  4K81 A;  5FI0 A;  4EKU A;  1UNQ A;  5D3W A;  2CRF A;  2P8V A;  2VRW B;  1DRO A;  3KSY A;  2R0D A;  4HAX B;  4HHV A;  1ZC3 B;  4A6K A;  3KY9 A;  1PLS A;  3FSS A;  3KRW A;  2J0K A;  2D9X A;  4HB0 B;  1WG7 A;  1I2H A;  4HB2 B;  1DDM A;  1FOE A;  1K5G B;  3O96 A;  3AJ4 A;  4Z2N A;  1UNP A;  3QWM A;  4DBB A;  1QQG A;  2BCJ A;  2Q13 A;  4GMV A;  3FM8 C;  4A5K A;  3AU5 A;  1X11 A;  4CHJ A;  4TYZ A;  3DXD A;  2R09 A;  4KAX B;  2J0M A;  3PVU A;  5LOP B;  1DYN A;  2JP2 A;  2OQB A;  3PG7 A;  1WGQ A;  4KHA A;  4CHM A;  2YS3 A;  2P0D A;  4HB3 B;  5J3T A;  1J0W A;  3DXC A;  5D3Y A;  3SUZ A;  4EMO A;  3SV1 A;  5J3Q A;  3M1I B;  3V5W A;  2NZ8 B;  1MPH A;  3MDB C;  4HAV B;  1DBH A;  2N0Y A;  4HAW B;  2DYQ A;  5HE1 A;  3A8P A;  1MK7 B;  1BAK A;  1X05 A;  4ZRJ A;  4ZRK A;  5KQ1 A;  1V89 A;  1GG3 A;  2FJL A;  1EF1 A;  1FHW A;  2D10 A;  4PNK A;  4NY0 A;  3DXE A;  1WI1 A;  1DDV A;  3ODO A;  1RJ2 A;  3F0W A;  2P0H A;  1M7R A;  1Z87 A;  2RGN B;  2LYD A;  1OY2 A;  1PFJ A;  4NSW A;  1U27 A;  2DKP A;  2VSZ A;  2P0F A;  3PVW A;  2DFK A;  2I5F A;  2D9W A;  4IOY X;  4WJ7 A;  3MPX A;  1TXD A;  5DHF B;  2YS1 A;  3D8D A;  3QBV B;  4HAY B;  2DYN A;  1MK9 B;  1M7E A;  5DIF B;  2EMS A;  5HE2 A;  5J3Y A;  2V76 A;  2YT1 A;  5C16 A;  3FEH A;  4C0A A;  2D11 A;  2DHJ A;  2ROZ B;  1FHO A;  3BIN A;  2MKR A;  4HAT B;  5FI1 A;  1X86 A;  1U5G A;  1WVH A;  4EJN A;  4A6F A;  4TKN A;  3PEG A;  2RUK B;  2LUL A;  2IFS A;  4K2P A;  2MDX A;  2KUP A;  3CXB B;  5D27 A;  1PMS A;  4HAZ B;  1BTN A;  4YON A;  2YS5 A;  2CAY A;  1ISN A;  1NI2 A;  3ULC A;  2N23 A;  4Y94 A;  1NTV A;  2COC A;  1K5D B;  3X23 A;  2ELB A;  1V88 A;  5DHA B;  2LOZ A;  3LJU X;  2I5C A;  3CIK A;  2RVB B;  2PZ1 A;  4GZU A;  5JLJ B;  1WJM A;  3TCA A;  3WYF B;  1B55 A;  5DI9 B;  2QKM A;  3VOQ A;  4F7U P;  3T06 A;  1WJ1 A;  1V5U A;  2M38 A;  1SHC A;  1X1G A;  3D8E A;  1X1F A;  5JHG A;  1FAO A;  5GOW B;  2GCL A;  2YT0 A;  5C5B B;  1AWE A;  5HE3 A;  1Y19 B;  5D3X A;  2ELA A;  3A98 B;  3OAN A;  5EFX A;  1SGH A;  3P6A A;  5DH9 B;  4A6H A;  1LW3 A;  1U5F A;  2GS0 A;  2CY5 A;  5KCV A;  1RRP B;  4IFS A;  1ZSQ A;  3ZDT A;  1W1D A;  1XKE A;  2VKI A;  3TO1 A;  1UPR A;  4HB4 B;  1AQC A;  5C5B A;  2G35 A;  2COF A;  4KHO A;  3RCP A;  1UNR A;  3GYP A;  1Q67 A;  2RSG A;  2CY4 A;  3HK0 A;  2LG1 A;  1U5D A;  4GPT B;  4K17 A;  2RLO A;  2EMT A;  3IVF A;  1W1G A;  3G9W A;  1UPQ A;  2NMB A;  2W2W A;  1ZC4 B;  3PSC A;  4MY6 A;  2W2X D;  4CYE A;  1ZVR A;  1FGZ A;  2MWN B;  5D3V A;  2YVC A;  1OQN A;  3ODX A;  3PZD A;  1BTK A;  4YL8 A;  2UVM A;  2COA A;  4K2O A;  3U8Z A;  1XD4 A;  1QC6 A;  5JP4 A;  2DX5 A;  1TQZ A;  2DHI A;  2LKO A;  3TW1 A;  4GXB A;  4IAP A;  3QIJ A;  3TFM A;  2Y8G A;  1MIZ B;  1H10 A;  3TVV A;  5CLQ B;  2COD A;  1MAI A;  2ADZ A;  4GN1 A;  1U2B A;  1GC6 A;  2MFQ A;  5HE0 A;  2M14 A;  4H8S A;  2OTX A;  2UZS A;  3A8Q A;  2K2J A;  2Z0P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...