4CHJA

Structure of inner membrane complex (imc) sub-compartment protein 3 (isp3) from toxoplasma gondii
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
Knots found
sequence length
139
structure length
123
Chain Sequence
ADLEIGREGEVIQVSKEAFDNWMNRYEAGDTMEVLFPDGHRIECNLKIDRPKNFMNLTFNQKVRPIQLDDIAAVLYGSKMLRNPVVGFRLASSGRAIAFSFKDITDAQCFVSFLDDEIKKNQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell cycle
molecule keywords IMC SUB-COMPARTMENT PROTEIN ISP3
publication title The Inner Membrane Complex Sub-Compartment Proteins Critical for Replication of the Apicomplexan Parasite Toxoplasma Gondii Adopt a Pleckstrin Homology Fold
pubmed doi rcsb
source organism Toxoplasma gondii
total genus 33
structure length 123
sequence length 139
other databases KnotProt 2.0: K 41
ec nomenclature
pdb deposition date 2013-12-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18045 ISP3_C ISP3 C-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 4chjA00
2Z0QA 2LULA 1WI1A 2YT0A 3VIAA 3ODOA 1MK9B 3ODXA 4KHOA 1KZGA 1WGUA 3CIKA 1OQNA 2J0KA 4KHBB 2ADZA 2CY4A 2DA0A 2I5CA 1K5DB 4DX8A 2VRWB 3QWMA 1X1FA 4IFSA 4HAXB 3BINA 2D9ZA 4BBKA 2RVBB 1XODA 1FHWA 2Z0PA 4CYEA 1P3RA 2JP2A 2EJ8A 1XD4A 5C5BA 1V5UA 1V5MA 2DTCA 3PSCA 4HAYB 4PQ0A 5J3QA 1ZM0A 3AJ4A 1EVHA 2YSZA 3TVVA 3WA0A 1W1GA 2W2XC 4MK0A 2Z0OA 1E5WA 2UZSA 2NZ8B 1WGQA 2DFKA 2W2WA 1TXDA 2BCJA 5L81A 2XQNM 4YL8A 5KQ4A 2DX5A 3AU5A 2HE7A 1UNRA 4MY6A 2DHIA 1RJ2A 3QIJA 3FM8C 1Y5OA 1I2HA 1NU2A 2ROZB 3CXBB 2N23A 3G9WA 3WYFB 1V88A 4K2OA 2Y8FA 4HAWB 1U27A 3D8FA 1U5DA 2DHJA 1U5FA 1ISNA 1Q67A 1W1DA 4B6HA 2DX1A 2AEHA 4EJNA 3DXCA 3BJIA 4HDQA 2P8VA 1P6SA 5KQ1A 2R0DA 4KAXB 5D3XA 2J59M 2YVCA 3HW2B 4L6EA 2KCJA 3PZDA 2CY5A 5JHGA 4DX90 3O96A 2Q13A 4K17A 2D9XA 2MFQA 1WG7A 1KI1B 3UZTA 3DXDA 2EMTA 1EAZA 2K2UA 3TW1A 1ZVRA 2H7EA 4ZRJA 1J0WA 1FGYA 2P0HA 1XCGA 2I5FA 2YS5A 2Y7BA 3KRXA 3PVLA 2LOZA 1MKEA 4GPTB 2RSGA 1ZC3B 3D8EA 1BTNA 2GS0A 4GMVA 3ODWA 2OTXA 5C6RA 2DYQA 1X05A 2LYDA 3SYXA 2AL6A 2MKRA 3SUZA 2D11A 1SHCA 2VSZA 2VKIA 3LJUX 1MIZB 2MWNB 1GC7A 2MDXA 1X86A 2EC1A 4P7IA 1TJ6A 5LONB 5C79A 2IFSA 2V76A 3M1IB 3NSUA 2YRYA 3HK0A 2DYNA 5D27A 1KZ7A 4K81A 3AU4A 1NTVA 5HE1A 4IAPA 2CAYA 3HQCA 2FJLA 1XR0B 1BAKA 4HATB 2J0JA 2LKOA 5DI9B 2L2IA 3IVFA 5D3WA 3T06A 1V89A 3P6AA 3PVUA 3U7DA 5HE0A 1UPQA 3DXEA 3FSSA 2LOXA 3PVWA 2QKLA 2K00A 2ROVA 4EKUA 4NY0A 1NTYA 1XKEA 1U5GA 2GCLA 1BWNA 1U2BA 2DLWA 4HAVB 1WVHA 4NSWA 3MDBC 4GN1A 1RRPB 2COCA 1OY2A 2I1KA 2K2JA 1EF1A 1FHXA 2ELBA 1IRSA 4GXBA 4CHMA 2IYBA 2YT1A 2YS3A 4Z2MB 1J19A 3P7ZA 1LB1A 3A8QA 4K2PA 1DROA 1WJMA 5HE3A 1DDVA 3OANA 1PLSA 2H7DA 2G35A 2N0YA 3ULCA 5EFXA 5J3YA 1FGZA 3MPXA 3F0WA 4F7HA 1H10A 4ZRIA 3TO1A 1FHOA 5CLQB 1UNQA 2D9WA 4WVFB 5JP4A 3FEHA 5FI1A 1DDMA 3KZ1A 2E2XA 1FOEA 5LOPB 4IOYX 4HDOA 3N7CA 4HHVA 3KSYA 5JLJB 4DXAB 2UZRA 2CODA 3VOQA 4TYZA 3A98B 3X23A 3ML4A 4C0AA 2QKMA 2GJYA 2RGNB 2M38A 1W1HA 1V5PA 2L1CA 1UNPA 5DHAB 4DBBA 1NI2A 1QQGA 1ZC4B 2HTHB 5D3VA 1I7AA 4KHAA 5GOWB 2COAA 4A6FB 4Z2NA 4HAZB 1MIXA 1OMWA 2J0MA 4YONA 4HB0B 2RUKB 3PP2A 2ELAA 4WJ7A 1EGXA 2KGXB 3TCAA 4A6HA 1X1GA 1UEFA 2UVMA 1SGHA 2YF0A 4EMOA 1DBHA 2RNRB 1P5TA 2D9YA 1GC6A 4GZUA 2I1JA 1AQCA 2Y8GA 4CHJA 4HB3B 1MAIA 1UPRA 1Y19B 2NMBA 1MK7B 3D8DA 2COFA 3GYPA 5HE2A 5C16A 5D3YA 1M7EA 2D4QA 4HB4B 1K5GB 3ZDTA 4F7GA 5C5BB 2W2XD 2X18A 4ZRKA 1H4RA 4A6KA 5JHHA 1WJ1A 1QC6A 3U8ZA 2KUPA 3QBVB 1B55A 1U5EA 3SO6A 2YS1A 2DKPA 2CRFA 2DHKA 4MT7A 2D9VA 1V61A 5DHFB 3KY9A 4HAUB 1XX0A 3PEGA 3KRWA 2DN6A 1PFJA 2D10A 4A5KA 1MPHA 5CLLB 2DKQA 1Z87A 3ZVRA 4WSFA 4XWXA 3GYOA 3V5WA 3SNHA 1BTKA 5DH9B 2R09A 2PZ1A 3TFMA 4Y94A 2OQBA 3PG7A 2D2QA 2EMSA 2RLOA 1AWEA 1FAOA 5FI0A 2P0DA 4H8SA 5DIFB 4HB2B 1DDWA 2LG1A 1U29A 3A8PA 2P0FA 1M7RA 1LW3A 2ZPYA 1ZSQA 1FB8A 4KVGB 1N3HA 4F7UP 3SV1A 4PNKA 4D0NB 2GCJA 4GMXB 1X11A 4TKNA 3ULBA 4A6FA 1PMSA 1TQZA 1GG3A 1DYNA 2M14A 3RCPA 5KCVA 5J3TA 3F5RA
chains in the Genus database with same CATH superfamily
2Z0QA 2LULA 1WI1A 2YT0A 3VIAA 3ODOA 1MK9B 3ODXA 4KHOA 1KZGA 1WGUA 3CIKA 1OQNA 2J0KA 4KHBB 2ADZA 2CY4A 2DA0A 2I5CA 1K5DB 4DX8A 2VRWB 4DIXA 4QJ3B 3QWMA 1X1FA 2K49A 2Z59A 4IFSA 4HAXB 3BINA 2D9ZA 4BBKA 2RVBB 1XODA 1FHWA 2Z0PA 4CYEA 1P3RA 2JP2A 3NWAA 3OHMB 2EJ8A 1XD4A 5C5BA 1V5UA 1V5MA 2DTCA 3PSCA 4HAYB 4PQ0A 5J3QA 1ZM0A 3AJ4A 1EVHA 2YSZA 3TVVA 3WA0A 1W1GA 2W2XC 2Z4DA 4MK0A 2Z0OA 1E5WA 3A58A 2UZSA 2NZ8B 1WGQA 2DFKA 2W2WA 1TXDA 2KIEA 2BCJA 5L81A 2XQNM 2KR0A 4YL8A 5KQ4A 2DX5A 3AU5A 2HE7A 3HIEA 2Z13A 1UNRA 4MY6A 2DHIA 1RJ2A 3QIJA 3FM8C 1Y5OA 4QXAB 1I2HA 1NU2A 2ROZB 3CXBB 2N23A 3G9WA 3WYFB 1V88A 4K2OA 2Y8FA 4HAWB 1U27A 3D8FA 1U5DA 2DHJA 1U5FA 1ISNA 1Q67A 1W1DA 4B6HA 5I2SA 2DX1A 2AEHA 2RRFA 4EJNA 3DXCA 3BJIA 4HDQA 2P8VA 1P6SA 5KQ1A 2R0DA 4KAXB 5D3XA 2J59M 2YVCA 3HW2B 2KUQA 4L6EA 2KCJA 3PZDA 2CY5A 5JHGA 4DX90 3O96A 2Q13A 4K17A 2D9XA 2MFQA 1WG7A 1KI1B 3NW8A 3UZTA 3DXDA 2EMTA 1EAZA 1MI1A 2K2UA 3TW1A 1ZVRA 2H7EA 4ZRJA 1J0WA 1FGYA 2P0HA 1XCGA 2I5FA 2YS5A 2Y7BA 3KRXA 3PVLA 2LOZA 1MKEA 4GPTB 2RSGA 1ZC3B 3D8EA 1BTNA 2GS0A 4GMVA 3ODWA 2OTXA 5I2MA 5C6RA 2DYQA 1X05A 2LYDA 3SYXA 2AL6A 2MKRA 3SUZA 2D11A 4KHBA 1SHCA 4GNKB 2VSZA 2VKIA 3LJUX 1MIZB 2MWNB 1GC7A 2MDXA 1X86A 2EC1A 4P7IA 1TJ6A 5LONB 5C79A 2IFSA 2V76A 3M1IB 3NSUA 2YRYA 2K8EA 3HK0A 2DYNA 5D27A 1KZ7A 4K81A 3NWDA 3AU4A 1NTVA 5HE1A 4IAPA 2CAYA 3HQCA 2FJLA 1XR0B 1BAKA 4HATB 2J0JA 2LKOA 5DI9B 2L2IA 4HSIA 1T77A 3IVFA 5D3WA 3T06A 1V89A 3P6AA 3PVUA 3U7DA 5HE0A 1UPQA 3DXEA 3FSSA 2LOXA 3PVWA 2QKLA 5LG4B 2K00A 2ROVA 4EKUA 4NY0A 1NTYA 1XKEA 1U5GA 2GCLA 1BWNA 1U2BA 2DLWA 4HAVB 1WVHA 4NSWA 3MDBC 4GN1A 4OT1A 1RRPB 2COCA 1OY2A 2I1KA 2K2JA 1EF1A 1FHXA 2ELBA 1IRSA 4GXBA 4CHMA 5M4YB 2IYBA 2YT1A 2YS3A 4Z2MB 1J19A 3P7ZA 2KIGA 1LB1A 3A8QA 4K2PA 1DROA 1WJMA 5HE3A 1DDVA 3OANA 1PLSA 4OSNA 2H7DA 2G35A 2N0YA 3ULCA 5EFXA 2NBVA 1FGZA 5J3YA 3MPXA 3NWFA 3F0WA 4F7HA 4QJ4B 1H10A 4ZRIA 3TO1A 1FHOA 5CLQB 1UNQA 2D9WA 4WVFB 5JP4A 3FEHA 5FI1A 1DDMA 3KZ1A 1ZYIA 2FJUB 2E2XA 4GOUA 1FOEA 2R2YA 4IOYX 5LOPB 4HDOA 3N7CA 4HHVA 3KSYA 5JLJB 4DXAB 2UZRA 2CODA 3VOQA 4TYZA 3A98B 3X23A 3ML4A 4C0AA 2QKMA 2GJYA 2RGNB 2M38A 1W1HA 1V5PA 2L1CA 1UNPA 5DHAB 4DBBA 1NI2A 1QQGA 1ZC4B 2HTHB 5D3VA 1I7AA 3HSAA 4KHAA 5GOWB 2COAA 4A6FB 4Z2NA 4L1RA 4HAZB 1MIXA 1OMWA 2J0MA 4YONA 4HB0B 2RUKB 3FVCA 3PP2A 2ELAA 4WJ7A 1EGXA 2KGXB 3TCAA 4A6HA 1X1GA 1UEFA 2UVMA 1SGHA 2YF0A 4EMOA 1DBHA 2RNRB 1P5TA 2D9YA 1GC6A 2GUMA 4GZUA 2I1JA 1AQCA 2Y8GA 4CHJA 4HB3B 1MAIA 1UPRA 1Y19B 2NMBA 1MK7B 3D8DA 2COFA 3GYPA 5HE2A 5C16A 5D3YA 1M7EA 2D4QA 4HB4B 1K5GB 3ZDTA 4F7GA 5C5BB 2W2XD 2X18A 3DCXA 4ZRKA 1H4RA 4A6KA 5JHHA 1WJ1A 1QC6A 3U8ZA 2KUPA 3QBVB 1B55A 1U5EA 3SO6A 2YS1A 2DKPA 2CRFA 3U12A 2DHKA 4MT7A 2D9VA 1V61A 5DHFB 3KY9A 4HAUB 1XX0A 3B77A 3PEGA 2ZKMX 3KRWA 2DN6A 1PFJA 2D10A 4A5KA 1MPHA 5CLLB 5IRSA 2DKQA 1Z87A 3ZVRA 4WSFA 4XWXA 3GYOA 3V5WA 3SNHA 1BTKA 5DH9B 2R09A 2PZ1A 3TFMA 4Y94A 2OQBA 3PG7A 2Z14A 2D2QA 2EMSA 2RLOA 1AWEA 1FAOA 5FI0A 2P0DA 4H8SA 5DIFB 4HB2B 1DDWA 2LG1A 1U29A 3A8PA 2P0FA 1M7RA 1LW3A 2ZPYA 2YT2A 1ZSQA 1FB8A 4KVGB 1N3HA 4F7UP 3SV1A 4PNKA 4D0NB 2GCJA 4GMXB 1X11A 4CSQA 4TKNA 3ULBA 4A6FA 1PMSA 4QJ5B 4D6WA 1TQZA 1GG3A 1DYNA 2M14A 3RCPA 5KCVA 5J3TA 3F5RA
chains in the Genus database with same CATH topology
2Z0QA 2LULA 1WI1A 2YT0A 3VIAA 3ODOA 1MK9B 3ODXA 4KHOA 1KZGA 1WGUA 3CIKA 1OQNA 2J0KA 4KHBB 2ADZA 2CY4A 2DA0A 2I5CA 1K5DB 4DX8A 2VRWB 3QWMA 1X1FA 4IFSA 4HAXB 3BINA 2D9ZA 4BBKA 2RVBB 1XODA 1FHWA 2Z0PA 4CYEA 1P3RA 2JP2A 2EJ8A 1XD4A 5C5BA 1V5UA 1V5MA 2DTCA 3PSCA 4HAYB 4PQ0A 5J3QA 1ZM0A 3AJ4A 1EVHA 2YSZA 3TVVA 3WA0A 1W1GA 2W2XC 4MK0A 2Z0OA 1E5WA 2UZSA 2NZ8B 1WGQA 2DFKA 2W2WA 1TXDA 2BCJA 5L81A 2XQNM 4YL8A 5KQ4A 2DX5A 3AU5A 2HE7A 1UNRA 4MY6A 2DHIA 1RJ2A 3QIJA 3FM8C 1Y5OA 1I2HA 1NU2A 2ROZB 3CXBB 2N23A 3G9WA 3WYFB 1V88A 4K2OA 2Y8FA 4HAWB 1U27A 3D8FA 1U5DA 2DHJA 1U5FA 1ISNA 1Q67A 1W1DA 4B6HA 2DX1A 2AEHA 4EJNA 3DXCA 3BJIA 4HDQA 2P8VA 1P6SA 5KQ1A 2R0DA 4KAXB 5D3XA 2J59M 2YVCA 3HW2B 4L6EA 2KCJA 3PZDA 2CY5A 5JHGA 4DX90 3O96A 2Q13A 4K17A 2D9XA 2MFQA 1WG7A 1KI1B 3UZTA 3DXDA 2EMTA 1EAZA 2K2UA 3TW1A 1ZVRA 2H7EA 4ZRJA 1J0WA 1FGYA 2P0HA 1XCGA 2I5FA 2YS5A 2Y7BA 3KRXA 3PVLA 2LOZA 1MKEA 4GPTB 2RSGA 1ZC3B 3D8EA 1BTNA 2GS0A 4GMVA 3ODWA 2OTXA 5C6RA 2DYQA 1X05A 2LYDA 3SYXA 2AL6A 2MKRA 3SUZA 2D11A 1SHCA 2VSZA 2VKIA 3LJUX 1MIZB 2MWNB 1GC7A 2MDXA 1X86A 2EC1A 4P7IA 1TJ6A 5LONB 5C79A 2IFSA 2V76A 3M1IB 3NSUA 2YRYA 3HK0A 2DYNA 5D27A 1KZ7A 4K81A 3AU4A 1NTVA 5HE1A 4IAPA 2CAYA 3HQCA 2FJLA 1XR0B 1BAKA 4HATB 2J0JA 2LKOA 5DI9B 2L2IA 3IVFA 5D3WA 3T06A 1V89A 3P6AA 3PVUA 3U7DA 5HE0A 1UPQA 3DXEA 3FSSA 2LOXA 3PVWA 2QKLA 2K00A 2ROVA 4EKUA 4NY0A 1NTYA 1XKEA 1U5GA 2GCLA 1BWNA 1U2BA 2DLWA 4HAVB 1WVHA 4NSWA 3MDBC 4GN1A 1RRPB 2COCA 1OY2A 2I1KA 2K2JA 1EF1A 1FHXA 2ELBA 1IRSA 4GXBA 4CHMA 2IYBA 2YT1A 2YS3A 4Z2MB 1J19A 3P7ZA 1LB1A 3A8QA 4K2PA 1DROA 1WJMA 5HE3A 1DDVA 3OANA 1PLSA 2H7DA 2G35A 2N0YA 3ULCA 5EFXA 5J3YA 1FGZA 3MPXA 3F0WA 4F7HA 1H10A 4ZRIA 3TO1A 1FHOA 5CLQB 1UNQA 2D9WA 4WVFB 5JP4A 3FEHA 5FI1A 1DDMA 3KZ1A 2E2XA 1FOEA 5LOPB 4IOYX 4HDOA 3N7CA 4HHVA 3KSYA 5JLJB 4DXAB 2UZRA 2CODA 3VOQA 4TYZA 3A98B 3X23A 3ML4A 4C0AA 2QKMA 2GJYA 2RGNB 2M38A 1W1HA 1V5PA 2L1CA 1UNPA 5DHAB 4DBBA 1NI2A 1QQGA 1ZC4B 2HTHB 5D3VA 1I7AA 4KHAA 5GOWB 2COAA 4A6FB 4Z2NA 4HAZB 1MIXA 1OMWA 2J0MA 4YONA 4HB0B 2RUKB 3PP2A 2ELAA 4WJ7A 1EGXA 2KGXB 3TCAA 4A6HA 1X1GA 1UEFA 2UVMA 1SGHA 2YF0A 4EMOA 1DBHA 2RNRB 1P5TA 2D9YA 1GC6A 4GZUA 2I1JA 1AQCA 2Y8GA 4CHJA 4HB3B 1MAIA 1UPRA 1Y19B 2NMBA 1MK7B 3D8DA 2COFA 3GYPA 5HE2A 5C16A 5D3YA 1M7EA 2D4QA 4HB4B 1K5GB 3ZDTA 4F7GA 5C5BB 2W2XD 2X18A 4ZRKA 1H4RA 4A6KA 5JHHA 1WJ1A 1QC6A 3U8ZA 2KUPA 3QBVB 1B55A 1U5EA 3SO6A 2YS1A 2DKPA 2CRFA 2DHKA 4MT7A 2D9VA 1V61A 5DHFB 3KY9A 4HAUB 1XX0A 3PEGA 3KRWA 2DN6A 1PFJA 2D10A 4A5KA 1MPHA 5CLLB 2DKQA 1Z87A 3ZVRA 4WSFA 4XWXA 3GYOA 3V5WA 3SNHA 1BTKA 5DH9B 2R09A 2PZ1A 3TFMA 4Y94A 2OQBA 3PG7A 2D2QA 2EMSA 2RLOA 1AWEA 1FAOA 5FI0A 2P0DA 4H8SA 5DIFB 4HB2B 1DDWA 2LG1A 1U29A 3A8PA 2P0FA 1M7RA 1LW3A 2ZPYA 1ZSQA 1FB8A 4KVGB 1N3HA 4F7UP 3SV1A 4PNKA 4D0NB 2GCJA 4GMXB 1X11A 4TKNA 3ULBA 4A6FA 1PMSA 1TQZA 1GG3A 1DYNA 2M14A 3RCPA 5KCVA 5J3TA 3F5RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Z0Q A;  2LUL A;  1WI1 A;  2YT0 A;  3VIA A;  3ODO A;  1MK9 B;  3ODX A;  4KHO A;  1KZG A;  1WGU A;  3CIK A;  1OQN A;  2J0K A;  4KHB B;  2ADZ A;  2CY4 A;  2DA0 A;  2I5C A;  1K5D B;  4DX8 A;  2VRW B;  3QWM A;  1X1F A;  4IFS A;  4HAX B;  3BIN A;  2D9Z A;  4BBK A;  2RVB B;  1XOD A;  1FHW A;  2Z0P A;  4CYE A;  1P3R A;  2JP2 A;  2EJ8 A;  1XD4 A;  5C5B A;  1V5U A;  1V5M A;  2DTC A;  3PSC A;  4HAY B;  4PQ0 A;  5J3Q A;  1ZM0 A;  3AJ4 A;  1EVH A;  2YSZ A;  3TVV A;  3WA0 A;  1W1G A;  2W2X C;  4MK0 A;  2Z0O A;  1E5W A;  2UZS A;  2NZ8 B;  1WGQ A;  2DFK A;  2W2W A;  1TXD A;  2BCJ A;  5L81 A;  2XQN M;  4YL8 A;  5KQ4 A;  2DX5 A;  3AU5 A;  2HE7 A;  1UNR A;  4MY6 A;  2DHI A;  1RJ2 A;  3QIJ A;  3FM8 C;  1Y5O A;  1I2H A;  1NU2 A;  2ROZ B;  3CXB B;  2N23 A;  3G9W A;  3WYF B;  1V88 A;  4K2O A;  2Y8F A;  4HAW B;  1U27 A;  3D8F A;  1U5D A;  2DHJ A;  1U5F A;  1ISN A;  1Q67 A;  1W1D A;  4B6H A;  2DX1 A;  2AEH A;  4EJN A;  3DXC A;  3BJI A;  4HDQ A;  2P8V A;  1P6S A;  5KQ1 A;  2R0D A;  4KAX B;  5D3X A;  2J59 M;  2YVC A;  3HW2 B;  4L6E A;  2KCJ A;  3PZD A;  2CY5 A;  5JHG A;  4DX9 0;  3O96 A;  2Q13 A;  4K17 A;  2D9X A;  2MFQ A;  1WG7 A;  1KI1 B;  3UZT A;  3DXD A;  2EMT A;  1EAZ A;  2K2U A;  3TW1 A;  1ZVR A;  2H7E A;  4ZRJ A;  1J0W A;  1FGY A;  2P0H A;  1XCG A;  2I5F A;  2YS5 A;  2Y7B A;  3KRX A;  3PVL A;  2LOZ A;  1MKE A;  4GPT B;  2RSG A;  1ZC3 B;  3D8E A;  1BTN A;  2GS0 A;  4GMV A;  3ODW A;  2OTX A;  5C6R A;  2DYQ A;  1X05 A;  2LYD A;  3SYX A;  2AL6 A;  2MKR A;  3SUZ A;  2D11 A;  1SHC A;  2VSZ A;  2VKI A;  3LJU X;  1MIZ B;  2MWN B;  1GC7 A;  2MDX A;  1X86 A;  2EC1 A;  4P7I A;  1TJ6 A;  5LON B;  5C79 A;  2IFS A;  2V76 A;  3M1I B;  3NSU A;  2YRY A;  3HK0 A;  2DYN A;  5D27 A;  1KZ7 A;  4K81 A;  3AU4 A;  1NTV A;  5HE1 A;  4IAP A;  2CAY A;  3HQC A;  2FJL A;  1XR0 B;  1BAK A;  4HAT B;  2J0J A;  2LKO A;  5DI9 B;  2L2I A;  3IVF A;  5D3W A;  3T06 A;  1V89 A;  3P6A A;  3PVU A;  3U7D A;  5HE0 A;  1UPQ A;  3DXE A;  3FSS A;  2LOX A;  3PVW A;  2QKL A;  2K00 A;  2ROV A;  4EKU A;  4NY0 A;  1NTY A;  1XKE A;  1U5G A;  2GCL A;  1BWN A;  1U2B A;  2DLW A;  4HAV B;  1WVH A;  4NSW A;  3MDB C;  4GN1 A;  1RRP B;  2COC A;  1OY2 A;  2I1K A;  2K2J A;  1EF1 A;  1FHX A;  2ELB A;  1IRS A;  4GXB A;  4CHM A;  2IYB A;  2YT1 A;  2YS3 A;  4Z2M B;  1J19 A;  3P7Z A;  1LB1 A;  3A8Q A;  4K2P A;  1DRO A;  1WJM A;  5HE3 A;  1DDV A;  3OAN A;  1PLS A;  2H7D A;  2G35 A;  2N0Y A;  3ULC A;  5EFX A;  5J3Y A;  1FGZ A;  3MPX A;  3F0W A;  4F7H A;  1H10 A;  4ZRI A;  3TO1 A;  1FHO A;  5CLQ B;  1UNQ A;  2D9W A;  4WVF B;  5JP4 A;  3FEH A;  5FI1 A;  1DDM A;  3KZ1 A;  2E2X A;  1FOE A;  5LOP B;  4IOY X;  4HDO A;  3N7C A;  4HHV A;  3KSY A;  5JLJ B;  4DXA B;  2UZR A;  2COD A;  3VOQ A;  4TYZ A;  3A98 B;  3X23 A;  3ML4 A;  4C0A A;  2QKM A;  2GJY A;  2RGN B;  2M38 A;  1W1H A;  1V5P A;  2L1C A;  1UNP A;  5DHA B;  4DBB A;  1NI2 A;  1QQG A;  1ZC4 B;  2HTH B;  5D3V A;  1I7A A;  4KHA A;  5GOW B;  2COA A;  4A6F B;  4Z2N A;  4HAZ B;  1MIX A;  1OMW A;  2J0M A;  4YON A;  4HB0 B;  2RUK B;  3PP2 A;  2ELA A;  4WJ7 A;  1EGX A;  2KGX B;  3TCA A;  4A6H A;  1X1G A;  1UEF A;  2UVM A;  1SGH A;  2YF0 A;  4EMO A;  1DBH A;  2RNR B;  1P5T A;  2D9Y A;  1GC6 A;  4GZU A;  2I1J A;  1AQC A;  2Y8G A;  4CHJ A;  4HB3 B;  1MAI A;  1UPR A;  1Y19 B;  2NMB A;  1MK7 B;  3D8D A;  2COF A;  3GYP A;  5HE2 A;  5C16 A;  5D3Y A;  1M7E A;  2D4Q A;  4HB4 B;  1K5G B;  3ZDT A;  4F7G A;  5C5B B;  2W2X D;  2X18 A;  4ZRK A;  1H4R A;  4A6K A;  5JHH A;  1WJ1 A;  1QC6 A;  3U8Z A;  2KUP A;  3QBV B;  1B55 A;  1U5E A;  3SO6 A;  2YS1 A;  2DKP A;  2CRF A;  2DHK A;  4MT7 A;  2D9V A;  1V61 A;  5DHF B;  3KY9 A;  4HAU B;  1XX0 A;  3PEG A;  3KRW A;  2DN6 A;  1PFJ A;  2D10 A;  4A5K A;  1MPH A;  5CLL B;  2DKQ A;  1Z87 A;  3ZVR A;  4WSF A;  4XWX A;  3GYO A;  3V5W A;  3SNH A;  1BTK A;  5DH9 B;  2R09 A;  2PZ1 A;  3TFM A;  4Y94 A;  2OQB A;  3PG7 A;  2D2Q A;  2EMS A;  2RLO A;  1AWE A;  1FAO A;  5FI0 A;  2P0D A;  4H8S A;  5DIF B;  4HB2 B;  1DDW A;  2LG1 A;  1U29 A;  3A8P A;  2P0F A;  1M7R A;  1LW3 A;  2ZPY A;  1ZSQ A;  1FB8 A;  4KVG B;  1N3H A;  4F7U P;  3SV1 A;  4PNK A;  4D0N B;  2GCJ A;  4GMX B;  1X11 A;  4TKN A;  3ULB A;  4A6F A;  1PMS A;  1TQZ A;  1GG3 A;  1DYN A;  2M14 A;  3RCP A;  5KCV A;  5J3T A;  3F5R A; 
#chains in the Genus database with same CATH topology
 2Z0Q A;  2LUL A;  1WI1 A;  2YT0 A;  3VIA A;  3ODO A;  1MK9 B;  3ODX A;  4KHO A;  1KZG A;  1WGU A;  3CIK A;  1OQN A;  2J0K A;  4KHB B;  2ADZ A;  2CY4 A;  2DA0 A;  2I5C A;  1K5D B;  4DX8 A;  2VRW B;  4DIX A;  4QJ3 B;  3QWM A;  1X1F A;  2K49 A;  2Z59 A;  4IFS A;  4HAX B;  3BIN A;  2D9Z A;  4BBK A;  2RVB B;  1XOD A;  1FHW A;  2Z0P A;  4CYE A;  1P3R A;  2JP2 A;  3NWA A;  3OHM B;  2EJ8 A;  1XD4 A;  5C5B A;  1V5U A;  1V5M A;  2DTC A;  3PSC A;  4HAY B;  4PQ0 A;  5J3Q A;  1ZM0 A;  3AJ4 A;  1EVH A;  2YSZ A;  3TVV A;  3WA0 A;  1W1G A;  2W2X C;  2Z4D A;  4MK0 A;  2Z0O A;  1E5W A;  3A58 A;  2UZS A;  2NZ8 B;  1WGQ A;  2DFK A;  2W2W A;  1TXD A;  2KIE A;  2BCJ A;  5L81 A;  2XQN M;  2KR0 A;  4YL8 A;  5KQ4 A;  2DX5 A;  3AU5 A;  2HE7 A;  3HIE A;  2Z13 A;  1UNR A;  4MY6 A;  2DHI A;  1RJ2 A;  3QIJ A;  3FM8 C;  1Y5O A;  4QXA B;  1I2H A;  1NU2 A;  2ROZ B;  3CXB B;  2N23 A;  3G9W A;  3WYF B;  1V88 A;  4K2O A;  2Y8F A;  4HAW B;  1U27 A;  3D8F A;  1U5D A;  2DHJ A;  1U5F A;  1ISN A;  1Q67 A;  1W1D A;  4B6H A;  5I2S A;  2DX1 A;  2AEH A;  2RRF A;  4EJN A;  3DXC A;  3BJI A;  4HDQ A;  2P8V A;  1P6S A;  5KQ1 A;  2R0D A;  4KAX B;  5D3X A;  2J59 M;  2YVC A;  3HW2 B;  2KUQ A;  4L6E A;  2KCJ A;  3PZD A;  2CY5 A;  5JHG A;  4DX9 0;  3O96 A;  2Q13 A;  4K17 A;  2D9X A;  2MFQ A;  1WG7 A;  1KI1 B;  3NW8 A;  3UZT A;  3DXD A;  2EMT A;  1EAZ A;  1MI1 A;  2K2U A;  3TW1 A;  1ZVR A;  2H7E A;  4ZRJ A;  1J0W A;  1FGY A;  2P0H A;  1XCG A;  2I5F A;  2YS5 A;  2Y7B A;  3KRX A;  3PVL A;  2LOZ A;  1MKE A;  4GPT B;  2RSG A;  1ZC3 B;  3D8E A;  1BTN A;  2GS0 A;  4GMV A;  3ODW A;  2OTX A;  5I2M A;  5C6R A;  2DYQ A;  1X05 A;  2LYD A;  3SYX A;  2AL6 A;  2MKR A;  3SUZ A;  2D11 A;  4KHB A;  1SHC A;  4GNK B;  2VSZ A;  2VKI A;  3LJU X;  1MIZ B;  2MWN B;  1GC7 A;  2MDX A;  1X86 A;  2EC1 A;  4P7I A;  1TJ6 A;  5LON B;  5C79 A;  2IFS A;  2V76 A;  3M1I B;  3NSU A;  2YRY A;  2K8E A;  3HK0 A;  2DYN A;  5D27 A;  1KZ7 A;  4K81 A;  3NWD A;  3AU4 A;  1NTV A;  5HE1 A;  4IAP A;  2CAY A;  3HQC A;  2FJL A;  1XR0 B;  1BAK A;  4HAT B;  2J0J A;  2LKO A;  5DI9 B;  2L2I A;  4HSI A;  1T77 A;  3IVF A;  5D3W A;  3T06 A;  1V89 A;  3P6A A;  3PVU A;  3U7D A;  5HE0 A;  1UPQ A;  3DXE A;  3FSS A;  2LOX A;  3PVW A;  2QKL A;  5LG4 B;  2K00 A;  2ROV A;  4EKU A;  4NY0 A;  1NTY A;  1XKE A;  1U5G A;  2GCL A;  1BWN A;  1U2B A;  2DLW A;  4HAV B;  1WVH A;  4NSW A;  3MDB C;  4GN1 A;  4OT1 A;  1RRP B;  2COC A;  1OY2 A;  2I1K A;  2K2J A;  1EF1 A;  1FHX A;  2ELB A;  1IRS A;  4GXB A;  4CHM A;  5M4Y B;  2IYB A;  2YT1 A;  2YS3 A;  4Z2M B;  1J19 A;  3P7Z A;  2KIG A;  1LB1 A;  3A8Q A;  4K2P A;  1DRO A;  1WJM A;  5HE3 A;  1DDV A;  3OAN A;  1PLS A;  4OSN A;  2H7D A;  2G35 A;  2N0Y A;  3ULC A;  5EFX A;  2NBV A;  1FGZ A;  5J3Y A;  3MPX A;  3NWF A;  3F0W A;  4F7H A;  4QJ4 B;  1H10 A;  4ZRI A;  3TO1 A;  1FHO A;  5CLQ B;  1UNQ A;  2D9W A;  4WVF B;  5JP4 A;  3FEH A;  5FI1 A;  1DDM A;  3KZ1 A;  1ZYI A;  2FJU B;  2E2X A;  4GOU A;  1FOE A;  2R2Y A;  4IOY X;  5LOP B;  4HDO A;  3N7C A;  4HHV A;  3KSY A;  5JLJ B;  4DXA B;  2UZR A;  2COD A;  3VOQ A;  4TYZ A;  3A98 B;  3X23 A;  3ML4 A;  4C0A A;  2QKM A;  2GJY A;  2RGN B;  2M38 A;  1W1H A;  1V5P A;  2L1C A;  1UNP A;  5DHA B;  4DBB A;  1NI2 A;  1QQG A;  1ZC4 B;  2HTH B;  5D3V A;  1I7A A;  3HSA A;  4KHA A;  5GOW B;  2COA A;  4A6F B;  4Z2N A;  4L1R A;  4HAZ B;  1MIX A;  1OMW A;  2J0M A;  4YON A;  4HB0 B;  2RUK B;  3FVC A;  3PP2 A;  2ELA A;  4WJ7 A;  1EGX A;  2KGX B;  3TCA A;  4A6H A;  1X1G A;  1UEF A;  2UVM A;  1SGH A;  2YF0 A;  4EMO A;  1DBH A;  2RNR B;  1P5T A;  2D9Y A;  1GC6 A;  2GUM A;  4GZU A;  2I1J A;  1AQC A;  2Y8G A;  4CHJ A;  4HB3 B;  1MAI A;  1UPR A;  1Y19 B;  2NMB A;  1MK7 B;  3D8D A;  2COF A;  3GYP A;  5HE2 A;  5C16 A;  5D3Y A;  1M7E A;  2D4Q A;  4HB4 B;  1K5G B;  3ZDT A;  4F7G A;  5C5B B;  2W2X D;  2X18 A;  3DCX A;  4ZRK A;  1H4R A;  4A6K A;  5JHH A;  1WJ1 A;  1QC6 A;  3U8Z A;  2KUP A;  3QBV B;  1B55 A;  1U5E A;  3SO6 A;  2YS1 A;  2DKP A;  2CRF A;  3U12 A;  2DHK A;  4MT7 A;  2D9V A;  1V61 A;  5DHF B;  3KY9 A;  4HAU B;  1XX0 A;  3B77 A;  3PEG A;  2ZKM X;  3KRW A;  2DN6 A;  1PFJ A;  2D10 A;  4A5K A;  1MPH A;  5CLL B;  5IRS A;  2DKQ A;  1Z87 A;  3ZVR A;  4WSF A;  4XWX A;  3GYO A;  3V5W A;  3SNH A;  1BTK A;  5DH9 B;  2R09 A;  2PZ1 A;  3TFM A;  4Y94 A;  2OQB A;  3PG7 A;  2Z14 A;  2D2Q A;  2EMS A;  2RLO A;  1AWE A;  1FAO A;  5FI0 A;  2P0D A;  4H8S A;  5DIF B;  4HB2 B;  1DDW A;  2LG1 A;  1U29 A;  3A8P A;  2P0F A;  1M7R A;  1LW3 A;  2ZPY A;  2YT2 A;  1ZSQ A;  1FB8 A;  4KVG B;  1N3H A;  4F7U P;  3SV1 A;  4PNK A;  4D0N B;  2GCJ A;  4GMX B;  1X11 A;  4CSQ A;  4TKN A;  3ULB A;  4A6F A;  1PMS A;  4QJ5 B;  4D6W A;  1TQZ A;  1GG3 A;  1DYN A;  2M14 A;  3RCP A;  5KCV A;  5J3T A;  3F5R A; 
#chains in the Genus database with same CATH homology
 2Z0Q A;  2LUL A;  1WI1 A;  2YT0 A;  3VIA A;  3ODO A;  1MK9 B;  3ODX A;  4KHO A;  1KZG A;  1WGU A;  3CIK A;  1OQN A;  2J0K A;  4KHB B;  2ADZ A;  2CY4 A;  2DA0 A;  2I5C A;  1K5D B;  4DX8 A;  2VRW B;  3QWM A;  1X1F A;  4IFS A;  4HAX B;  3BIN A;  2D9Z A;  4BBK A;  2RVB B;  1XOD A;  1FHW A;  2Z0P A;  4CYE A;  1P3R A;  2JP2 A;  2EJ8 A;  1XD4 A;  5C5B A;  1V5U A;  1V5M A;  2DTC A;  3PSC A;  4HAY B;  4PQ0 A;  5J3Q A;  1ZM0 A;  3AJ4 A;  1EVH A;  2YSZ A;  3TVV A;  3WA0 A;  1W1G A;  2W2X C;  4MK0 A;  2Z0O A;  1E5W A;  2UZS A;  2NZ8 B;  1WGQ A;  2DFK A;  2W2W A;  1TXD A;  2BCJ A;  5L81 A;  2XQN M;  4YL8 A;  5KQ4 A;  2DX5 A;  3AU5 A;  2HE7 A;  1UNR A;  4MY6 A;  2DHI A;  1RJ2 A;  3QIJ A;  3FM8 C;  1Y5O A;  1I2H A;  1NU2 A;  2ROZ B;  3CXB B;  2N23 A;  3G9W A;  3WYF B;  1V88 A;  4K2O A;  2Y8F A;  4HAW B;  1U27 A;  3D8F A;  1U5D A;  2DHJ A;  1U5F A;  1ISN A;  1Q67 A;  1W1D A;  4B6H A;  2DX1 A;  2AEH A;  4EJN A;  3DXC A;  3BJI A;  4HDQ A;  2P8V A;  1P6S A;  5KQ1 A;  2R0D A;  4KAX B;  5D3X A;  2J59 M;  2YVC A;  3HW2 B;  4L6E A;  2KCJ A;  3PZD A;  2CY5 A;  5JHG A;  4DX9 0;  3O96 A;  2Q13 A;  4K17 A;  2D9X A;  2MFQ A;  1WG7 A;  1KI1 B;  3UZT A;  3DXD A;  2EMT A;  1EAZ A;  2K2U A;  3TW1 A;  1ZVR A;  2H7E A;  4ZRJ A;  1J0W A;  1FGY A;  2P0H A;  1XCG A;  2I5F A;  2YS5 A;  2Y7B A;  3KRX A;  3PVL A;  2LOZ A;  1MKE A;  4GPT B;  2RSG A;  1ZC3 B;  3D8E A;  1BTN A;  2GS0 A;  4GMV A;  3ODW A;  2OTX A;  5C6R A;  2DYQ A;  1X05 A;  2LYD A;  3SYX A;  2AL6 A;  2MKR A;  3SUZ A;  2D11 A;  1SHC A;  2VSZ A;  2VKI A;  3LJU X;  1MIZ B;  2MWN B;  1GC7 A;  2MDX A;  1X86 A;  2EC1 A;  4P7I A;  1TJ6 A;  5LON B;  5C79 A;  2IFS A;  2V76 A;  3M1I B;  3NSU A;  2YRY A;  3HK0 A;  2DYN A;  5D27 A;  1KZ7 A;  4K81 A;  3AU4 A;  1NTV A;  5HE1 A;  4IAP A;  2CAY A;  3HQC A;  2FJL A;  1XR0 B;  1BAK A;  4HAT B;  2J0J A;  2LKO A;  5DI9 B;  2L2I A;  3IVF A;  5D3W A;  3T06 A;  1V89 A;  3P6A A;  3PVU A;  3U7D A;  5HE0 A;  1UPQ A;  3DXE A;  3FSS A;  2LOX A;  3PVW A;  2QKL A;  2K00 A;  2ROV A;  4EKU A;  4NY0 A;  1NTY A;  1XKE A;  1U5G A;  2GCL A;  1BWN A;  1U2B A;  2DLW A;  4HAV B;  1WVH A;  4NSW A;  3MDB C;  4GN1 A;  1RRP B;  2COC A;  1OY2 A;  2I1K A;  2K2J A;  1EF1 A;  1FHX A;  2ELB A;  1IRS A;  4GXB A;  4CHM A;  2IYB A;  2YT1 A;  2YS3 A;  4Z2M B;  1J19 A;  3P7Z A;  1LB1 A;  3A8Q A;  4K2P A;  1DRO A;  1WJM A;  5HE3 A;  1DDV A;  3OAN A;  1PLS A;  2H7D A;  2G35 A;  2N0Y A;  3ULC A;  5EFX A;  5J3Y A;  1FGZ A;  3MPX A;  3F0W A;  4F7H A;  1H10 A;  4ZRI A;  3TO1 A;  1FHO A;  5CLQ B;  1UNQ A;  2D9W A;  4WVF B;  5JP4 A;  3FEH A;  5FI1 A;  1DDM A;  3KZ1 A;  2E2X A;  1FOE A;  5LOP B;  4IOY X;  4HDO A;  3N7C A;  4HHV A;  3KSY A;  5JLJ B;  4DXA B;  2UZR A;  2COD A;  3VOQ A;  4TYZ A;  3A98 B;  3X23 A;  3ML4 A;  4C0A A;  2QKM A;  2GJY A;  2RGN B;  2M38 A;  1W1H A;  1V5P A;  2L1C A;  1UNP A;  5DHA B;  4DBB A;  1NI2 A;  1QQG A;  1ZC4 B;  2HTH B;  5D3V A;  1I7A A;  4KHA A;  5GOW B;  2COA A;  4A6F B;  4Z2N A;  4HAZ B;  1MIX A;  1OMW A;  2J0M A;  4YON A;  4HB0 B;  2RUK B;  3PP2 A;  2ELA A;  4WJ7 A;  1EGX A;  2KGX B;  3TCA A;  4A6H A;  1X1G A;  1UEF A;  2UVM A;  1SGH A;  2YF0 A;  4EMO A;  1DBH A;  2RNR B;  1P5T A;  2D9Y A;  1GC6 A;  4GZU A;  2I1J A;  1AQC A;  2Y8G A;  4CHJ A;  4HB3 B;  1MAI A;  1UPR A;  1Y19 B;  2NMB A;  1MK7 B;  3D8D A;  2COF A;  3GYP A;  5HE2 A;  5C16 A;  5D3Y A;  1M7E A;  2D4Q A;  4HB4 B;  1K5G B;  3ZDT A;  4F7G A;  5C5B B;  2W2X D;  2X18 A;  4ZRK A;  1H4R A;  4A6K A;  5JHH A;  1WJ1 A;  1QC6 A;  3U8Z A;  2KUP A;  3QBV B;  1B55 A;  1U5E A;  3SO6 A;  2YS1 A;  2DKP A;  2CRF A;  2DHK A;  4MT7 A;  2D9V A;  1V61 A;  5DHF B;  3KY9 A;  4HAU B;  1XX0 A;  3PEG A;  3KRW A;  2DN6 A;  1PFJ A;  2D10 A;  4A5K A;  1MPH A;  5CLL B;  2DKQ A;  1Z87 A;  3ZVR A;  4WSF A;  4XWX A;  3GYO A;  3V5W A;  3SNH A;  1BTK A;  5DH9 B;  2R09 A;  2PZ1 A;  3TFM A;  4Y94 A;  2OQB A;  3PG7 A;  2D2Q A;  2EMS A;  2RLO A;  1AWE A;  1FAO A;  5FI0 A;  2P0D A;  4H8S A;  5DIF B;  4HB2 B;  1DDW A;  2LG1 A;  1U29 A;  3A8P A;  2P0F A;  1M7R A;  1LW3 A;  2ZPY A;  1ZSQ A;  1FB8 A;  4KVG B;  1N3H A;  4F7U P;  3SV1 A;  4PNK A;  4D0N B;  2GCJ A;  4GMX B;  1X11 A;  4TKN A;  3ULB A;  4A6F A;  1PMS A;  1TQZ A;  1GG3 A;  1DYN A;  2M14 A;  3RCP A;  5KCV A;  5J3T A;  3F5R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...