4CHJA

Structure of inner membrane complex (imc) sub-compartment protein 3 (isp3) from toxoplasma gondii
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
Knots found
sequence length
139
structure length
123
Chain Sequence
b'ADLEIGREGEVIQVSKEAFDNWMNRYEAGDTMEVLFPDGHRIECNLKIDRPKNFMNLTFNQKVRPIQLDDIAAVLYGSKMLRNPVVGFRLASSGRAIAFSFKDITDAQCFVSFLDDEIKKNQE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords IMC SUB-COMPARTMENT PROTEIN ISP3
publication title The Inner Membrane Complex Sub-Compartment Proteins Critical for Replication of the Apicomplexan Parasite Toxoplasma Gondii Adopt a Pleckstrin Homology Fold
pubmed doi rcsb
source organism Toxoplasma gondii
molecule tags Cell cycle
total genus 33
structure length 123
sequence length 139
other databases KnotProt 2.0: K 41
ec nomenclature
pdb deposition date 2013-12-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18045 ISP3_C ISP3 C-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 4chjA00
4HAYB 1K5DB 5GOWB 5HE1A 2OTXA 1UEFA 4EKUA 5KQ4A 1WI1A 1Y5OA 3AU4A 2VRWB 5CLLB 5JLJB 3P7ZA 4HATB 4C0AA 3SUZA 2M14A 4F7HA 1LW3A 1WJMA 4A6FA 1XODA 4Y94A 3WA0A 1W1GA 1UPRA 3QIJA 1X86A 2E2XA 1FGZA 2ELAA 3TFMA 5JP4A 2DLWA 1U29A 3ODXA 2UVMA 2KCJA 3M1IB 4PNKA 5JHHA 2H7DA 5J3YA 1Y19B 1J0WA 3SO6A 1BAKA 2RUKB 2R0DA 2COFA 1NTVA 1MK7B 1SGHA 3MPXA 4BBKA 5L81A 3SNHA 3BINA 1UNRA 2DKQA 3TVVA 1PFJA 2K00A 2QKMA 2RVBB 1WGUA 2P0DA 2Y7BA 1ISNA 3N7CA 4KVGB 5EFXA 3KSYA 1FAOA 2J0MA 3F0WA 4ZRJA 5KQ1A 4DX90 5C6RA 2DFKA 2ELBA 1I7AA 2Z0QA 2EMSA 1FGYA 2YF0A 1WVHA 2DX5A 4HB4B 3OANA 3UZTA 2DHJA 3O96A 5HE0A 3QWMA 3HQCA 4ZRKA 4HB3B 3RCPA 2LG1A 2M38A 2L2IA 2CY4A 1E5WA 1EVHA 2AEHA 3SYXA 3ZDTA 2CAYA 1V61A 3ODWA 1NI2A 2HE7A 3DXCA 2MFQA 4NSWA 4HB2B 4A6FB 1RRPB 4GMVA 1BWNA 4HDQA 2W2WA 4HB0B 4Z2NA 4WJ7A 1MIZB 1DDWA 3FEHA 3GYOA 3TW1A 3TCAA 2UZSA 2RNRB 5D3VA 4HAWB 2D9YA 1WG7A 2GS0A 2AL6A 4D0NB 2YT1A 1XKEA 1EAZA 2LYDA 2DN6A 4DBBA 2D4QA 2COCA 2UZRA 1KI1B 2KGXB 1V5PA 4ZRIA 4YL8A 1MIXA 4WSFA 3AU5A 1NU2A 1KZ7A 2D9VA 1EGXA 1MPHA 4HHVA 5C5BA 2Q13A 5DIFB 2CY5A 1ZC4B 4NY0A 4CHJA 2KUPA 3KZ1A 4B6HA 4EMOA 2EC1A 2D9XA 5C79A 1X1GA 2DKPA 3PZDA 4DXAB 3HK0A 4MT7A 2DTCA 3PVWA 3TO1A 2HTHB 4KAXB 3PEGA 1KZGA 1U5DA 4HAXB 3KRWA 4A6HA 2IFSA 1V88A 2Z0PA 2X18A 1ZC3B 2D9ZA 2W2XC 4K2PA 2YS1A 2CRFA 5LONB 4IAPA 1J19A 1TQZA 2D10A 2I5FA 2RLOA 2DYNA 1N3HA 4TKNA 1BTNA 1DDVA 1WGQA 1W1DA 4DX8A 3VOQA 2YSZA 3AJ4A 2Z0OA 3D8DA 3PSCA 4MY6A 1TXDA 4MK0A 2ROZB 2DA0A 3ULCA 1OQNA 1MK9B 1XCGA 3ODOA 2P0FA 3CXBB 1UNPA 4F7UP 4L6EA 4F7GA 2D2QA 2GCJA 1FHXA 1K5GB 2MWNB 2OQBA 4A5KA 4P7IA 2J0JA 4Z2MB 1X05A 2ZPYA 2BCJA 2I5CA 5C5BB 2EJ8A 4K17A 3VIAA 1WJ1A 5DI9B 3HW2B 2L1CA 1ZM0A 2N23A 3ML4A 1MAIA 1V5UA 1M7EA 5J3QA 2N0YA 5D27A 3LJUX 2GJYA 2J59M 5LOPB 1OY2A 1LB1A 5JHGA 1SHCA 5FI1A 4GPTB 2LKOA 2YRYA 1ZSQA 4KHBB 2G35A 1GC6A 4CHMA 2DYQA 1Z87A 1Q67A 2R09A 2GCLA 4XWXA 1XD4A 5KCVA 3F5RA 1UNQA 2PZ1A 3IVFA 1DDMA 2I1JA 3P6AA 5DHAB 1P5TA 3D8FA 2CODA 1UPQA 5J3TA 1EF1A 1NTYA 4GMXB 2YT0A 1RJ2A 3FM8C 1DYNA 5D3YA 2K2UA 2QKLA 3SV1A 3U8ZA 2YS5A 2D11A 2VSZA 3WYFB 1FB8A 2Y8GA 3A98B 3GYPA 3NSUA 4IFSA 4A6KA 2D9WA 1V89A 1U5GA 5D3WA 5FI0A 5DHFB 3FSSA 4GN1A 2Y8FA 2K2JA 4YONA 2LOZA 3V5WA 1P6SA 2COAA 4WVFB 3PG7A 2VKIA 1U5FA 4TYZA 2MDXA 4GXBA 1M7RA 2NMBA 5CLQB 3G9WA 1XR0B 1U27A 1B55A 2DHIA 4HAUB 2YS3A 2RSGA 1QQGA 1TJ6A 3MDBC 3A8PA 1H10A 2RGNB 1PMSA 2V76A 3CIKA 1DROA 1ZVRA 4H8SA 4HDOA 4HAVB 2W2XD 2DX1A 2J0KA 5D3XA 1MKEA 1P3RA 3KY9A 2I1KA 2XQNM 1QC6A 2IYBA 1FHWA 1V5MA 3ZVRA 3ULBA 2NZ8B 4KHAA 2MKRA 4KHOA 2DHKA 2LOXA 3X23A 1W1HA 1FHOA 4PQ0A 2P8VA 2ROVA 3DXEA 4IOYX 5DH9B 1U5EA 1X1FA 5HE3A 2H7EA 3PP2A 3A8QA 4GZUA 3PVUA 3QBVB 3D8EA 3T06A 3BJIA 1X11A 4K2OA 3U7DA 3PVLA 1I2HA 3DXDA 2LULA 1IRSA 5HE2A 1PLSA 1H4RA 2EMTA 4K81A 1U2BA 2ADZA 2JP2A 1DBHA 4HAZB 1AQCA 1XX0A 2YVCA 3KRXA 1OMWA 5C16A 1AWEA 1GG3A 4EJNA 2FJLA 1FOEA 4CYEA 2P0HA 1GC7A 1BTKA
chains in the Genus database with same CATH superfamily
4HAYB 1K5DB 5GOWB 5HE1A 2OTXA 1UEFA 4EKUA 5KQ4A 1WI1A 1Y5OA 2YT2A 3AU4A 2VRWB 5CLLB 5JLJB 3P7ZA 4HATB 4C0AA 3SUZA 2M14A 4F7HA 1LW3A 1WJMA 4A6FA 1XODA 4Y94A 3WA0A 1W1GA 1UPRA 3QIJA 1X86A 2E2XA 1FGZA 2ELAA 3TFMA 5JP4A 2DLWA 1U29A 3ODXA 2UVMA 2KCJA 3M1IB 4PNKA 5JHHA 2H7DA 5J3YA 1Y19B 1J0WA 3SO6A 1ZYIA 2RUKB 1BAKA 2R0DA 2COFA 1NTVA 1MK7B 1SGHA 3MPXA 4BBKA 2FJUB 2R2YA 5L81A 3SNHA 3BINA 4L1RA 1UNRA 2DKQA 3TVVA 1PFJA 2K00A 2QKMA 2RVBB 1WGUA 2P0DA 2Y7BA 1ISNA 3N7CA 4KVGB 5EFXA 3KSYA 1FAOA 2J0MA 2Z13A 3F0WA 4ZRJA 5KQ1A 2RRFA 2KIEA 4DX90 2Z59A 5C6RA 2DFKA 2ELBA 1I7AA 2Z0QA 2EMSA 1FGYA 2YF0A 1WVHA 2DX5A 4HB4B 3OANA 3UZTA 2DHJA 3O96A 5HE0A 3QWMA 3FVCA 3HQCA 4ZRKA 4HB3B 3RCPA 2LG1A 2M38A 2L2IA 2CY4A 1E5WA 1EVHA 2AEHA 3SYXA 3ZDTA 2CAYA 1V61A 1NI2A 3ODWA 2HE7A 2KR0A 3DXCA 2MFQA 4NSWA 4HB2B 4A6FB 1RRPB 4GMVA 1BWNA 4HDQA 2W2WA 4HB0B 4Z2NA 4WJ7A 1MIZB 3NWFA 3HIEA 1DDWA 3FEHA 3GYOA 3TW1A 3TCAA 2UZSA 2RNRB 5D3VA 4HAWB 2D9YA 1WG7A 2GS0A 2AL6A 4D0NB 2YT1A 1XKEA 5M4YB 1EAZA 5I2MA 2LYDA 2DN6A 4DBBA 2D4QA 2COCA 2UZRA 1KI1B 2KGXB 1V5PA 4ZRIA 4YL8A 1MIXA 4WSFA 3AU5A 1NU2A 4QJ3B 1KZ7A 2D9VA 1EGXA 1MPHA 4HHVA 5C5BA 2Q13A 5DIFB 2CY5A 1ZC4B 3DCXA 4NY0A 4CHJA 2KUPA 5I2SA 3KZ1A 3HSAA 4B6HA 2K49A 4EMOA 2EC1A 2D9XA 5C79A 1X1GA 2DKPA 3PZDA 4DXAB 3HK0A 4HSIA 4MT7A 2DTCA 3PVWA 3TO1A 2HTHB 4KAXB 2KIGA 3PEGA 1KZGA 1U5DA 4HAXB 3KRWA 4A6HA 2IFSA 1V88A 2Z0PA 2X18A 1ZC3B 2D9ZA 2W2XC 4K2PA 2YS1A 2CRFA 5LONB 4IAPA 1J19A 1TQZA 2D10A 2I5FA 2NBVA 2RLOA 2DYNA 2ZKMX 1N3HA 4TKNA 1BTNA 1DDVA 1WGQA 1W1DA 4DX8A 3VOQA 2YSZA 3AJ4A 2Z0OA 3D8DA 3PSCA 4MY6A 1TXDA 4MK0A 2ROZB 2DA0A 3ULCA 1OQNA 1MK9B 4D6WA 1XCGA 3ODOA 2P0FA 3CXBB 1UNPA 4F7UP 4L6EA 4F7GA 2D2QA 3B77A 2GCJA 1FHXA 1K5GB 2MWNB 2OQBA 4A5KA 4P7IA 2J0JA 4Z2MB 1X05A 2ZPYA 4OT1A 2BCJA 2I5CA 5C5BB 2EJ8A 4CSQA 4K17A 3VIAA 1WJ1A 5DI9B 3HW2B 2L1CA 1ZM0A 2N23A 3ML4A 1MAIA 1V5UA 1M7EA 4GOUA 5J3QA 2N0YA 5D27A 3LJUX 2GJYA 4QXAB 2J59M 5LOPB 1OY2A 1LB1A 5JHGA 1SHCA 5FI1A 4GPTB 2LKOA 4QJ4B 2Z4DA 2YRYA 1ZSQA 4KHBB 2G35A 1GC6A 1MI1A 4CHMA 2DYQA 1Z87A 3U12A 1Q67A 2R09A 2GCLA 4XWXA 1XD4A 5KCVA 3F5RA 1UNQA 2PZ1A 3IVFA 1DDMA 2I1JA 3P6AA 5DHAB 1P5TA 3D8FA 2CODA 1UPQA 5J3TA 1EF1A 1NTYA 4GMXB 2YT0A 1RJ2A 3FM8C 1DYNA 5D3YA 2K2UA 2QKLA 3SV1A 3U8ZA 2YS5A 1T77A 2D11A 2VSZA 3WYFB 1FB8A 2Y8GA 3A98B 3GYPA 3NSUA 4IFSA 4A6KA 2D9WA 4OSNA 1V89A 1U5GA 5D3WA 5FI0A 5DHFB 3FSSA 4GN1A 2Y8FA 2K2JA 4KHBA 2LOZA 4YONA 3V5WA 1P6SA 2COAA 4WVFB 3PG7A 2VKIA 1U5FA 4TYZA 2MDXA 4GXBA 1M7RA 2NMBA 5CLQB 3G9WA 4DIXA 1XR0B 1U27A 1B55A 2DHIA 4HAUB 2YS3A 2RSGA 1QQGA 1TJ6A 3MDBC 3A8PA 1H10A 2RGNB 1PMSA 2V76A 3CIKA 1DROA 1ZVRA 4H8SA 4HDOA 4HAVB 2W2XD 2DX1A 2J0KA 5D3XA 1MKEA 1P3RA 3KY9A 2I1KA 2XQNM 1QC6A 2IYBA 1FHWA 1V5MA 3ZVRA 3ULBA 2NZ8B 4KHAA 5LG4B 2MKRA 4KHOA 2DHKA 2LOXA 3X23A 1W1HA 1FHOA 4PQ0A 2P8VA 2ROVA 3DXEA 4IOYX 5DH9B 1U5EA 1X1FA 5HE3A 2H7EA 3PP2A 3NW8A 3A8QA 4GZUA 2GUMA 3PVUA 3QBVB 3D8EA 3T06A 4QJ5B 3BJIA 1X11A 4K2OA 3U7DA 2KUQA 3PVLA 2K8EA 1I2HA 3DXDA 3A58A 3NWAA 2LULA 1IRSA 5HE2A 1PLSA 1H4RA 3OHMB 2EMTA 2Z14A 4K81A 3NWDA 1U2BA 2ADZA 2JP2A 1DBHA 4HAZB 1AQCA 1XX0A 2YVCA 5IRSA 3KRXA 1OMWA 5C16A 1AWEA 1GG3A 4GNKB 4EJNA 2FJLA 1FOEA 4CYEA 2P0HA 1GC7A 1BTKA
chains in the Genus database with same CATH topology
4HAYB 1K5DB 5GOWB 5HE1A 2OTXA 1UEFA 4EKUA 5KQ4A 1WI1A 1Y5OA 3AU4A 2VRWB 5CLLB 5JLJB 3P7ZA 4HATB 4C0AA 3SUZA 2M14A 4F7HA 1LW3A 1WJMA 4A6FA 1XODA 4Y94A 3WA0A 1W1GA 1UPRA 3QIJA 1X86A 2E2XA 1FGZA 2ELAA 3TFMA 5JP4A 2DLWA 1U29A 3ODXA 2UVMA 2KCJA 3M1IB 4PNKA 5JHHA 2H7DA 5J3YA 1Y19B 1J0WA 3SO6A 1BAKA 2RUKB 2R0DA 2COFA 1NTVA 1MK7B 1SGHA 3MPXA 4BBKA 5L81A 3SNHA 3BINA 1UNRA 2DKQA 3TVVA 1PFJA 2K00A 2QKMA 2RVBB 1WGUA 2P0DA 2Y7BA 1ISNA 3N7CA 4KVGB 5EFXA 3KSYA 1FAOA 2J0MA 3F0WA 4ZRJA 5KQ1A 4DX90 5C6RA 2DFKA 2ELBA 1I7AA 2Z0QA 2EMSA 1FGYA 2YF0A 1WVHA 2DX5A 4HB4B 3OANA 3UZTA 2DHJA 3O96A 5HE0A 3QWMA 3HQCA 4ZRKA 4HB3B 3RCPA 2LG1A 2M38A 2L2IA 2CY4A 1E5WA 1EVHA 2AEHA 3SYXA 3ZDTA 2CAYA 1V61A 3ODWA 1NI2A 2HE7A 3DXCA 2MFQA 4NSWA 4HB2B 4A6FB 1RRPB 4GMVA 1BWNA 4HDQA 2W2WA 4HB0B 4Z2NA 4WJ7A 1MIZB 1DDWA 3FEHA 3GYOA 3TW1A 3TCAA 2UZSA 2RNRB 5D3VA 4HAWB 2D9YA 1WG7A 2GS0A 2AL6A 4D0NB 2YT1A 1XKEA 1EAZA 2LYDA 2DN6A 4DBBA 2D4QA 2COCA 2UZRA 1KI1B 2KGXB 1V5PA 4ZRIA 4YL8A 1MIXA 4WSFA 3AU5A 1NU2A 1KZ7A 2D9VA 1EGXA 1MPHA 4HHVA 5C5BA 2Q13A 5DIFB 2CY5A 1ZC4B 4NY0A 4CHJA 2KUPA 3KZ1A 4B6HA 4EMOA 2EC1A 2D9XA 5C79A 1X1GA 2DKPA 3PZDA 4DXAB 3HK0A 4MT7A 2DTCA 3PVWA 3TO1A 2HTHB 4KAXB 3PEGA 1KZGA 1U5DA 4HAXB 3KRWA 4A6HA 2IFSA 1V88A 2Z0PA 2X18A 1ZC3B 2D9ZA 2W2XC 4K2PA 2YS1A 2CRFA 5LONB 4IAPA 1J19A 1TQZA 2D10A 2I5FA 2RLOA 2DYNA 1N3HA 4TKNA 1BTNA 1DDVA 1WGQA 1W1DA 4DX8A 3VOQA 2YSZA 3AJ4A 2Z0OA 3D8DA 3PSCA 4MY6A 1TXDA 4MK0A 2ROZB 2DA0A 3ULCA 1OQNA 1MK9B 1XCGA 3ODOA 2P0FA 3CXBB 1UNPA 4F7UP 4L6EA 4F7GA 2D2QA 2GCJA 1FHXA 1K5GB 2MWNB 2OQBA 4A5KA 4P7IA 2J0JA 4Z2MB 1X05A 2ZPYA 2BCJA 2I5CA 5C5BB 2EJ8A 4K17A 3VIAA 1WJ1A 5DI9B 3HW2B 2L1CA 1ZM0A 2N23A 3ML4A 1MAIA 1V5UA 1M7EA 5J3QA 2N0YA 5D27A 3LJUX 2GJYA 2J59M 5LOPB 1OY2A 1LB1A 5JHGA 1SHCA 5FI1A 4GPTB 2LKOA 2YRYA 1ZSQA 4KHBB 2G35A 1GC6A 4CHMA 2DYQA 1Z87A 1Q67A 2R09A 2GCLA 4XWXA 1XD4A 5KCVA 3F5RA 1UNQA 2PZ1A 3IVFA 1DDMA 2I1JA 3P6AA 5DHAB 1P5TA 3D8FA 2CODA 1UPQA 5J3TA 1EF1A 1NTYA 4GMXB 2YT0A 1RJ2A 3FM8C 1DYNA 5D3YA 2K2UA 2QKLA 3SV1A 3U8ZA 2YS5A 2D11A 2VSZA 3WYFB 1FB8A 2Y8GA 3A98B 3GYPA 3NSUA 4IFSA 4A6KA 2D9WA 1V89A 1U5GA 5D3WA 5FI0A 5DHFB 3FSSA 4GN1A 2Y8FA 2K2JA 4YONA 2LOZA 3V5WA 1P6SA 2COAA 4WVFB 3PG7A 2VKIA 1U5FA 4TYZA 2MDXA 4GXBA 1M7RA 2NMBA 5CLQB 3G9WA 1XR0B 1U27A 1B55A 2DHIA 4HAUB 2YS3A 2RSGA 1QQGA 1TJ6A 3MDBC 3A8PA 1H10A 2RGNB 1PMSA 2V76A 3CIKA 1DROA 1ZVRA 4H8SA 4HDOA 4HAVB 2W2XD 2DX1A 2J0KA 5D3XA 1MKEA 1P3RA 3KY9A 2I1KA 2XQNM 1QC6A 2IYBA 1FHWA 1V5MA 3ZVRA 3ULBA 2NZ8B 4KHAA 2MKRA 4KHOA 2DHKA 2LOXA 3X23A 1W1HA 1FHOA 4PQ0A 2P8VA 2ROVA 3DXEA 4IOYX 5DH9B 1U5EA 1X1FA 5HE3A 2H7EA 3PP2A 3A8QA 4GZUA 3PVUA 3QBVB 3D8EA 3T06A 3BJIA 1X11A 4K2OA 3U7DA 3PVLA 1I2HA 3DXDA 2LULA 1IRSA 5HE2A 1PLSA 1H4RA 2EMTA 4K81A 1U2BA 2ADZA 2JP2A 1DBHA 4HAZB 1AQCA 1XX0A 2YVCA 3KRXA 1OMWA 5C16A 1AWEA 1GG3A 4EJNA 2FJLA 1FOEA 4CYEA 2P0HA 1GC7A 1BTKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HAY B;  1K5D B;  5GOW B;  5HE1 A;  2OTX A;  1UEF A;  4EKU A;  5KQ4 A;  1WI1 A;  1Y5O A;  3AU4 A;  2VRW B;  5CLL B;  5JLJ B;  3P7Z A;  4HAT B;  4C0A A;  3SUZ A;  2M14 A;  4F7H A;  1LW3 A;  1WJM A;  4A6F A;  1XOD A;  4Y94 A;  3WA0 A;  1W1G A;  1UPR A;  3QIJ A;  1X86 A;  2E2X A;  1FGZ A;  2ELA A;  3TFM A;  5JP4 A;  2DLW A;  1U29 A;  3ODX A;  2UVM A;  2KCJ A;  3M1I B;  4PNK A;  5JHH A;  2H7D A;  5J3Y A;  1Y19 B;  1J0W A;  3SO6 A;  1BAK A;  2RUK B;  2R0D A;  2COF A;  1NTV A;  1MK7 B;  1SGH A;  3MPX A;  4BBK A;  5L81 A;  3SNH A;  3BIN A;  1UNR A;  2DKQ A;  3TVV A;  1PFJ A;  2K00 A;  2QKM A;  2RVB B;  1WGU A;  2P0D A;  2Y7B A;  1ISN A;  3N7C A;  4KVG B;  5EFX A;  3KSY A;  1FAO A;  2J0M A;  3F0W A;  4ZRJ A;  5KQ1 A;  4DX9 0;  5C6R A;  2DFK A;  2ELB A;  1I7A A;  2Z0Q A;  2EMS A;  1FGY A;  2YF0 A;  1WVH A;  2DX5 A;  4HB4 B;  3OAN A;  3UZT A;  2DHJ A;  3O96 A;  5HE0 A;  3QWM A;  3HQC A;  4ZRK A;  4HB3 B;  3RCP A;  2LG1 A;  2M38 A;  2L2I A;  2CY4 A;  1E5W A;  1EVH A;  2AEH A;  3SYX A;  3ZDT A;  2CAY A;  1V61 A;  3ODW A;  1NI2 A;  2HE7 A;  3DXC A;  2MFQ A;  4NSW A;  4HB2 B;  4A6F B;  1RRP B;  4GMV A;  1BWN A;  4HDQ A;  2W2W A;  4HB0 B;  4Z2N A;  4WJ7 A;  1MIZ B;  1DDW A;  3FEH A;  3GYO A;  3TW1 A;  3TCA A;  2UZS A;  2RNR B;  5D3V A;  4HAW B;  2D9Y A;  1WG7 A;  2GS0 A;  2AL6 A;  4D0N B;  2YT1 A;  1XKE A;  1EAZ A;  2LYD A;  2DN6 A;  4DBB A;  2D4Q A;  2COC A;  2UZR A;  1KI1 B;  2KGX B;  1V5P A;  4ZRI A;  4YL8 A;  1MIX A;  4WSF A;  3AU5 A;  1NU2 A;  1KZ7 A;  2D9V A;  1EGX A;  1MPH A;  4HHV A;  5C5B A;  2Q13 A;  5DIF B;  2CY5 A;  1ZC4 B;  4NY0 A;  4CHJ A;  2KUP A;  3KZ1 A;  4B6H A;  4EMO A;  2EC1 A;  2D9X A;  5C79 A;  1X1G A;  2DKP A;  3PZD A;  4DXA B;  3HK0 A;  4MT7 A;  2DTC A;  3PVW A;  3TO1 A;  2HTH B;  4KAX B;  3PEG A;  1KZG A;  1U5D A;  4HAX B;  3KRW A;  4A6H A;  2IFS A;  1V88 A;  2Z0P A;  2X18 A;  1ZC3 B;  2D9Z A;  2W2X C;  4K2P A;  2YS1 A;  2CRF A;  5LON B;  4IAP A;  1J19 A;  1TQZ A;  2D10 A;  2I5F A;  2RLO A;  2DYN A;  1N3H A;  4TKN A;  1BTN A;  1DDV A;  1WGQ A;  1W1D A;  4DX8 A;  3VOQ A;  2YSZ A;  3AJ4 A;  2Z0O A;  3D8D A;  3PSC A;  4MY6 A;  1TXD A;  4MK0 A;  2ROZ B;  2DA0 A;  3ULC A;  1OQN A;  1MK9 B;  1XCG A;  3ODO A;  2P0F A;  3CXB B;  1UNP A;  4F7U P;  4L6E A;  4F7G A;  2D2Q A;  2GCJ A;  1FHX A;  1K5G B;  2MWN B;  2OQB A;  4A5K A;  4P7I A;  2J0J A;  4Z2M B;  1X05 A;  2ZPY A;  2BCJ A;  2I5C A;  5C5B B;  2EJ8 A;  4K17 A;  3VIA A;  1WJ1 A;  5DI9 B;  3HW2 B;  2L1C A;  1ZM0 A;  2N23 A;  3ML4 A;  1MAI A;  1V5U A;  1M7E A;  5J3Q A;  2N0Y A;  5D27 A;  3LJU X;  2GJY A;  2J59 M;  5LOP B;  1OY2 A;  1LB1 A;  5JHG A;  1SHC A;  5FI1 A;  4GPT B;  2LKO A;  2YRY A;  1ZSQ A;  4KHB B;  2G35 A;  1GC6 A;  4CHM A;  2DYQ A;  1Z87 A;  1Q67 A;  2R09 A;  2GCL A;  4XWX A;  1XD4 A;  5KCV A;  3F5R A;  1UNQ A;  2PZ1 A;  3IVF A;  1DDM A;  2I1J A;  3P6A A;  5DHA B;  1P5T A;  3D8F A;  2COD A;  1UPQ A;  5J3T A;  1EF1 A;  1NTY A;  4GMX B;  2YT0 A;  1RJ2 A;  3FM8 C;  1DYN A;  5D3Y A;  2K2U A;  2QKL A;  3SV1 A;  3U8Z A;  2YS5 A;  2D11 A;  2VSZ A;  3WYF B;  1FB8 A;  2Y8G A;  3A98 B;  3GYP A;  3NSU A;  4IFS A;  4A6K A;  2D9W A;  1V89 A;  1U5G A;  5D3W A;  5FI0 A;  5DHF B;  3FSS A;  4GN1 A;  2Y8F A;  2K2J A;  4YON A;  2LOZ A;  3V5W A;  1P6S A;  2COA A;  4WVF B;  3PG7 A;  2VKI A;  1U5F A;  4TYZ A;  2MDX A;  4GXB A;  1M7R A;  2NMB A;  5CLQ B;  3G9W A;  1XR0 B;  1U27 A;  1B55 A;  2DHI A;  4HAU B;  2YS3 A;  2RSG A;  1QQG A;  1TJ6 A;  3MDB C;  3A8P A;  1H10 A;  2RGN B;  1PMS A;  2V76 A;  3CIK A;  1DRO A;  1ZVR A;  4H8S A;  4HDO A;  4HAV B;  2W2X D;  2DX1 A;  2J0K A;  5D3X A;  1MKE A;  1P3R A;  3KY9 A;  2I1K A;  2XQN M;  1QC6 A;  2IYB A;  1FHW A;  1V5M A;  3ZVR A;  3ULB A;  2NZ8 B;  4KHA A;  2MKR A;  4KHO A;  2DHK A;  2LOX A;  3X23 A;  1W1H A;  1FHO A;  4PQ0 A;  2P8V A;  2ROV A;  3DXE A;  4IOY X;  5DH9 B;  1U5E A;  1X1F A;  5HE3 A;  2H7E A;  3PP2 A;  3A8Q A;  4GZU A;  3PVU A;  3QBV B;  3D8E A;  3T06 A;  3BJI A;  1X11 A;  4K2O A;  3U7D A;  3PVL A;  1I2H A;  3DXD A;  2LUL A;  1IRS A;  5HE2 A;  1PLS A;  1H4R A;  2EMT A;  4K81 A;  1U2B A;  2ADZ A;  2JP2 A;  1DBH A;  4HAZ B;  1AQC A;  1XX0 A;  2YVC A;  3KRX A;  1OMW A;  5C16 A;  1AWE A;  1GG3 A;  4EJN A;  2FJL A;  1FOE A;  4CYE A;  2P0H A;  1GC7 A;  1BTK A; 
#chains in the Genus database with same CATH topology
 4HAY B;  1K5D B;  5GOW B;  5HE1 A;  2OTX A;  1UEF A;  4EKU A;  5KQ4 A;  1WI1 A;  1Y5O A;  2YT2 A;  3AU4 A;  2VRW B;  5CLL B;  5JLJ B;  3P7Z A;  4HAT B;  4C0A A;  3SUZ A;  2M14 A;  4F7H A;  1LW3 A;  1WJM A;  4A6F A;  1XOD A;  4Y94 A;  3WA0 A;  1W1G A;  1UPR A;  3QIJ A;  1X86 A;  2E2X A;  1FGZ A;  2ELA A;  3TFM A;  5JP4 A;  2DLW A;  1U29 A;  3ODX A;  2UVM A;  2KCJ A;  3M1I B;  4PNK A;  5JHH A;  2H7D A;  5J3Y A;  1Y19 B;  1J0W A;  3SO6 A;  1ZYI A;  2RUK B;  1BAK A;  2R0D A;  2COF A;  1NTV A;  1MK7 B;  1SGH A;  3MPX A;  4BBK A;  2FJU B;  2R2Y A;  5L81 A;  3SNH A;  3BIN A;  4L1R A;  1UNR A;  2DKQ A;  3TVV A;  1PFJ A;  2K00 A;  2QKM A;  2RVB B;  1WGU A;  2P0D A;  2Y7B A;  1ISN A;  3N7C A;  4KVG B;  5EFX A;  3KSY A;  1FAO A;  2J0M A;  2Z13 A;  3F0W A;  4ZRJ A;  5KQ1 A;  2RRF A;  2KIE A;  4DX9 0;  2Z59 A;  5C6R A;  2DFK A;  2ELB A;  1I7A A;  2Z0Q A;  2EMS A;  1FGY A;  2YF0 A;  1WVH A;  2DX5 A;  4HB4 B;  3OAN A;  3UZT A;  2DHJ A;  3O96 A;  5HE0 A;  3QWM A;  3FVC A;  3HQC A;  4ZRK A;  4HB3 B;  3RCP A;  2LG1 A;  2M38 A;  2L2I A;  2CY4 A;  1E5W A;  1EVH A;  2AEH A;  3SYX A;  3ZDT A;  2CAY A;  1V61 A;  1NI2 A;  3ODW A;  2HE7 A;  2KR0 A;  3DXC A;  2MFQ A;  4NSW A;  4HB2 B;  4A6F B;  1RRP B;  4GMV A;  1BWN A;  4HDQ A;  2W2W A;  4HB0 B;  4Z2N A;  4WJ7 A;  1MIZ B;  3NWF A;  3HIE A;  1DDW A;  3FEH A;  3GYO A;  3TW1 A;  3TCA A;  2UZS A;  2RNR B;  5D3V A;  4HAW B;  2D9Y A;  1WG7 A;  2GS0 A;  2AL6 A;  4D0N B;  2YT1 A;  1XKE A;  5M4Y B;  1EAZ A;  5I2M A;  2LYD A;  2DN6 A;  4DBB A;  2D4Q A;  2COC A;  2UZR A;  1KI1 B;  2KGX B;  1V5P A;  4ZRI A;  4YL8 A;  1MIX A;  4WSF A;  3AU5 A;  1NU2 A;  4QJ3 B;  1KZ7 A;  2D9V A;  1EGX A;  1MPH A;  4HHV A;  5C5B A;  2Q13 A;  5DIF B;  2CY5 A;  1ZC4 B;  3DCX A;  4NY0 A;  4CHJ A;  2KUP A;  5I2S A;  3KZ1 A;  3HSA A;  4B6H A;  2K49 A;  4EMO A;  2EC1 A;  2D9X A;  5C79 A;  1X1G A;  2DKP A;  3PZD A;  4DXA B;  3HK0 A;  4HSI A;  4MT7 A;  2DTC A;  3PVW A;  3TO1 A;  2HTH B;  4KAX B;  2KIG A;  3PEG A;  1KZG A;  1U5D A;  4HAX B;  3KRW A;  4A6H A;  2IFS A;  1V88 A;  2Z0P A;  2X18 A;  1ZC3 B;  2D9Z A;  2W2X C;  4K2P A;  2YS1 A;  2CRF A;  5LON B;  4IAP A;  1J19 A;  1TQZ A;  2D10 A;  2I5F A;  2NBV A;  2RLO A;  2DYN A;  2ZKM X;  1N3H A;  4TKN A;  1BTN A;  1DDV A;  1WGQ A;  1W1D A;  4DX8 A;  3VOQ A;  2YSZ A;  3AJ4 A;  2Z0O A;  3D8D A;  3PSC A;  4MY6 A;  1TXD A;  4MK0 A;  2ROZ B;  2DA0 A;  3ULC A;  1OQN A;  1MK9 B;  4D6W A;  1XCG A;  3ODO A;  2P0F A;  3CXB B;  1UNP A;  4F7U P;  4L6E A;  4F7G A;  2D2Q A;  3B77 A;  2GCJ A;  1FHX A;  1K5G B;  2MWN B;  2OQB A;  4A5K A;  4P7I A;  2J0J A;  4Z2M B;  1X05 A;  2ZPY A;  4OT1 A;  2BCJ A;  2I5C A;  5C5B B;  2EJ8 A;  4CSQ A;  4K17 A;  3VIA A;  1WJ1 A;  5DI9 B;  3HW2 B;  2L1C A;  1ZM0 A;  2N23 A;  3ML4 A;  1MAI A;  1V5U A;  1M7E A;  4GOU A;  5J3Q A;  2N0Y A;  5D27 A;  3LJU X;  2GJY A;  4QXA B;  2J59 M;  5LOP B;  1OY2 A;  1LB1 A;  5JHG A;  1SHC A;  5FI1 A;  4GPT B;  2LKO A;  4QJ4 B;  2Z4D A;  2YRY A;  1ZSQ A;  4KHB B;  2G35 A;  1GC6 A;  1MI1 A;  4CHM A;  2DYQ A;  1Z87 A;  3U12 A;  1Q67 A;  2R09 A;  2GCL A;  4XWX A;  1XD4 A;  5KCV A;  3F5R A;  1UNQ A;  2PZ1 A;  3IVF A;  1DDM A;  2I1J A;  3P6A A;  5DHA B;  1P5T A;  3D8F A;  2COD A;  1UPQ A;  5J3T A;  1EF1 A;  1NTY A;  4GMX B;  2YT0 A;  1RJ2 A;  3FM8 C;  1DYN A;  5D3Y A;  2K2U A;  2QKL A;  3SV1 A;  3U8Z A;  2YS5 A;  1T77 A;  2D11 A;  2VSZ A;  3WYF B;  1FB8 A;  2Y8G A;  3A98 B;  3GYP A;  3NSU A;  4IFS A;  4A6K A;  2D9W A;  4OSN A;  1V89 A;  1U5G A;  5D3W A;  5FI0 A;  5DHF B;  3FSS A;  4GN1 A;  2Y8F A;  2K2J A;  4KHB A;  2LOZ A;  4YON A;  3V5W A;  1P6S A;  2COA A;  4WVF B;  3PG7 A;  2VKI A;  1U5F A;  4TYZ A;  2MDX A;  4GXB A;  1M7R A;  2NMB A;  5CLQ B;  3G9W A;  4DIX A;  1XR0 B;  1U27 A;  1B55 A;  2DHI A;  4HAU B;  2YS3 A;  2RSG A;  1QQG A;  1TJ6 A;  3MDB C;  3A8P A;  1H10 A;  2RGN B;  1PMS A;  2V76 A;  3CIK A;  1DRO A;  1ZVR A;  4H8S A;  4HDO A;  4HAV B;  2W2X D;  2DX1 A;  2J0K A;  5D3X A;  1MKE A;  1P3R A;  3KY9 A;  2I1K A;  2XQN M;  1QC6 A;  2IYB A;  1FHW A;  1V5M A;  3ZVR A;  3ULB A;  2NZ8 B;  4KHA A;  5LG4 B;  2MKR A;  4KHO A;  2DHK A;  2LOX A;  3X23 A;  1W1H A;  1FHO A;  4PQ0 A;  2P8V A;  2ROV A;  3DXE A;  4IOY X;  5DH9 B;  1U5E A;  1X1F A;  5HE3 A;  2H7E A;  3PP2 A;  3NW8 A;  3A8Q A;  4GZU A;  2GUM A;  3PVU A;  3QBV B;  3D8E A;  3T06 A;  4QJ5 B;  3BJI A;  1X11 A;  4K2O A;  3U7D A;  2KUQ A;  3PVL A;  2K8E A;  1I2H A;  3DXD A;  3A58 A;  3NWA A;  2LUL A;  1IRS A;  5HE2 A;  1PLS A;  1H4R A;  3OHM B;  2EMT A;  2Z14 A;  4K81 A;  3NWD A;  1U2B A;  2ADZ A;  2JP2 A;  1DBH A;  4HAZ B;  1AQC A;  1XX0 A;  2YVC A;  5IRS A;  3KRX A;  1OMW A;  5C16 A;  1AWE A;  1GG3 A;  4GNK B;  4EJN A;  2FJL A;  1FOE A;  4CYE A;  2P0H A;  1GC7 A;  1BTK A; 
#chains in the Genus database with same CATH homology
 4HAY B;  1K5D B;  5GOW B;  5HE1 A;  2OTX A;  1UEF A;  4EKU A;  5KQ4 A;  1WI1 A;  1Y5O A;  3AU4 A;  2VRW B;  5CLL B;  5JLJ B;  3P7Z A;  4HAT B;  4C0A A;  3SUZ A;  2M14 A;  4F7H A;  1LW3 A;  1WJM A;  4A6F A;  1XOD A;  4Y94 A;  3WA0 A;  1W1G A;  1UPR A;  3QIJ A;  1X86 A;  2E2X A;  1FGZ A;  2ELA A;  3TFM A;  5JP4 A;  2DLW A;  1U29 A;  3ODX A;  2UVM A;  2KCJ A;  3M1I B;  4PNK A;  5JHH A;  2H7D A;  5J3Y A;  1Y19 B;  1J0W A;  3SO6 A;  1BAK A;  2RUK B;  2R0D A;  2COF A;  1NTV A;  1MK7 B;  1SGH A;  3MPX A;  4BBK A;  5L81 A;  3SNH A;  3BIN A;  1UNR A;  2DKQ A;  3TVV A;  1PFJ A;  2K00 A;  2QKM A;  2RVB B;  1WGU A;  2P0D A;  2Y7B A;  1ISN A;  3N7C A;  4KVG B;  5EFX A;  3KSY A;  1FAO A;  2J0M A;  3F0W A;  4ZRJ A;  5KQ1 A;  4DX9 0;  5C6R A;  2DFK A;  2ELB A;  1I7A A;  2Z0Q A;  2EMS A;  1FGY A;  2YF0 A;  1WVH A;  2DX5 A;  4HB4 B;  3OAN A;  3UZT A;  2DHJ A;  3O96 A;  5HE0 A;  3QWM A;  3HQC A;  4ZRK A;  4HB3 B;  3RCP A;  2LG1 A;  2M38 A;  2L2I A;  2CY4 A;  1E5W A;  1EVH A;  2AEH A;  3SYX A;  3ZDT A;  2CAY A;  1V61 A;  3ODW A;  1NI2 A;  2HE7 A;  3DXC A;  2MFQ A;  4NSW A;  4HB2 B;  4A6F B;  1RRP B;  4GMV A;  1BWN A;  4HDQ A;  2W2W A;  4HB0 B;  4Z2N A;  4WJ7 A;  1MIZ B;  1DDW A;  3FEH A;  3GYO A;  3TW1 A;  3TCA A;  2UZS A;  2RNR B;  5D3V A;  4HAW B;  2D9Y A;  1WG7 A;  2GS0 A;  2AL6 A;  4D0N B;  2YT1 A;  1XKE A;  1EAZ A;  2LYD A;  2DN6 A;  4DBB A;  2D4Q A;  2COC A;  2UZR A;  1KI1 B;  2KGX B;  1V5P A;  4ZRI A;  4YL8 A;  1MIX A;  4WSF A;  3AU5 A;  1NU2 A;  1KZ7 A;  2D9V A;  1EGX A;  1MPH A;  4HHV A;  5C5B A;  2Q13 A;  5DIF B;  2CY5 A;  1ZC4 B;  4NY0 A;  4CHJ A;  2KUP A;  3KZ1 A;  4B6H A;  4EMO A;  2EC1 A;  2D9X A;  5C79 A;  1X1G A;  2DKP A;  3PZD A;  4DXA B;  3HK0 A;  4MT7 A;  2DTC A;  3PVW A;  3TO1 A;  2HTH B;  4KAX B;  3PEG A;  1KZG A;  1U5D A;  4HAX B;  3KRW A;  4A6H A;  2IFS A;  1V88 A;  2Z0P A;  2X18 A;  1ZC3 B;  2D9Z A;  2W2X C;  4K2P A;  2YS1 A;  2CRF A;  5LON B;  4IAP A;  1J19 A;  1TQZ A;  2D10 A;  2I5F A;  2RLO A;  2DYN A;  1N3H A;  4TKN A;  1BTN A;  1DDV A;  1WGQ A;  1W1D A;  4DX8 A;  3VOQ A;  2YSZ A;  3AJ4 A;  2Z0O A;  3D8D A;  3PSC A;  4MY6 A;  1TXD A;  4MK0 A;  2ROZ B;  2DA0 A;  3ULC A;  1OQN A;  1MK9 B;  1XCG A;  3ODO A;  2P0F A;  3CXB B;  1UNP A;  4F7U P;  4L6E A;  4F7G A;  2D2Q A;  2GCJ A;  1FHX A;  1K5G B;  2MWN B;  2OQB A;  4A5K A;  4P7I A;  2J0J A;  4Z2M B;  1X05 A;  2ZPY A;  2BCJ A;  2I5C A;  5C5B B;  2EJ8 A;  4K17 A;  3VIA A;  1WJ1 A;  5DI9 B;  3HW2 B;  2L1C A;  1ZM0 A;  2N23 A;  3ML4 A;  1MAI A;  1V5U A;  1M7E A;  5J3Q A;  2N0Y A;  5D27 A;  3LJU X;  2GJY A;  2J59 M;  5LOP B;  1OY2 A;  1LB1 A;  5JHG A;  1SHC A;  5FI1 A;  4GPT B;  2LKO A;  2YRY A;  1ZSQ A;  4KHB B;  2G35 A;  1GC6 A;  4CHM A;  2DYQ A;  1Z87 A;  1Q67 A;  2R09 A;  2GCL A;  4XWX A;  1XD4 A;  5KCV A;  3F5R A;  1UNQ A;  2PZ1 A;  3IVF A;  1DDM A;  2I1J A;  3P6A A;  5DHA B;  1P5T A;  3D8F A;  2COD A;  1UPQ A;  5J3T A;  1EF1 A;  1NTY A;  4GMX B;  2YT0 A;  1RJ2 A;  3FM8 C;  1DYN A;  5D3Y A;  2K2U A;  2QKL A;  3SV1 A;  3U8Z A;  2YS5 A;  2D11 A;  2VSZ A;  3WYF B;  1FB8 A;  2Y8G A;  3A98 B;  3GYP A;  3NSU A;  4IFS A;  4A6K A;  2D9W A;  1V89 A;  1U5G A;  5D3W A;  5FI0 A;  5DHF B;  3FSS A;  4GN1 A;  2Y8F A;  2K2J A;  4YON A;  2LOZ A;  3V5W A;  1P6S A;  2COA A;  4WVF B;  3PG7 A;  2VKI A;  1U5F A;  4TYZ A;  2MDX A;  4GXB A;  1M7R A;  2NMB A;  5CLQ B;  3G9W A;  1XR0 B;  1U27 A;  1B55 A;  2DHI A;  4HAU B;  2YS3 A;  2RSG A;  1QQG A;  1TJ6 A;  3MDB C;  3A8P A;  1H10 A;  2RGN B;  1PMS A;  2V76 A;  3CIK A;  1DRO A;  1ZVR A;  4H8S A;  4HDO A;  4HAV B;  2W2X D;  2DX1 A;  2J0K A;  5D3X A;  1MKE A;  1P3R A;  3KY9 A;  2I1K A;  2XQN M;  1QC6 A;  2IYB A;  1FHW A;  1V5M A;  3ZVR A;  3ULB A;  2NZ8 B;  4KHA A;  2MKR A;  4KHO A;  2DHK A;  2LOX A;  3X23 A;  1W1H A;  1FHO A;  4PQ0 A;  2P8V A;  2ROV A;  3DXE A;  4IOY X;  5DH9 B;  1U5E A;  1X1F A;  5HE3 A;  2H7E A;  3PP2 A;  3A8Q A;  4GZU A;  3PVU A;  3QBV B;  3D8E A;  3T06 A;  3BJI A;  1X11 A;  4K2O A;  3U7D A;  3PVL A;  1I2H A;  3DXD A;  2LUL A;  1IRS A;  5HE2 A;  1PLS A;  1H4R A;  2EMT A;  4K81 A;  1U2B A;  2ADZ A;  2JP2 A;  1DBH A;  4HAZ B;  1AQC A;  1XX0 A;  2YVC A;  3KRX A;  1OMW A;  5C16 A;  1AWE A;  1GG3 A;  4EJN A;  2FJL A;  1FOE A;  4CYE A;  2P0H A;  1GC7 A;  1BTK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...