3CXBB

Crystal structure of sifa and skip
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
103
structure length
103
Chain Sequence
b'TKEGMLHYKAGTSYLGKEHWKTCFVVLSNGILYQYPDRTDVIPLLSVNMGGEQCGGCRRANTTDRPHAFQVILSDRPCLELSAESEAEMAEWMQHLCQAVSKG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Protein sifA
publication title Structure and function of Salmonella SifA indicate that its interactions with SKIP, SseJ, and RhoA family GTPases induce endosomal tubulation
pubmed doi rcsb
source organism Salmonella typhimurium
molecule tags Signaling protein
total genus 16
structure length 103
sequence length 103
ec nomenclature
pdb deposition date 2008-04-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 3cxbB00
3SYXA 1Q67A 1DDVA 2RNRB 4F7GA 2RUKB 1BWNA 4GMXB 1ZSQA 4EJNA 2LYDA 2K2UA 2NZ8B 2K2JA 3BJIA 3UZTA 1X1FA 3PVWA 4Y94A 2LG1A 2GCJA 2LOZA 1B55A 2J0JA 1TXDA 5C5BA 2IFSA 2M38A 1ISNA 1XR0B 3A98B 2LOXA 1P5TA 2P0HA 4HAVB 4PQ0A 3AU5A 2DYQA 2DFKA 1P3RA 2DHJA 3T06A 1AWEA 2L1CA 1W1GA 1FOEA 3FEHA 5C16A 3IVFA 1IRSA 5C5BB 2ROVA 1FHWA 3A8PA 3HQCA 2D4QA 1V89A 4KHBB 1U29A 4WJ7A 2YVCA 1NI2A 1XCGA 2ELBA 4TYZA 3TCAA 3U7DA 3SV1A 1PFJA 4HATB 5FI1A 2H7EA 4GZUA 2P0FA 1W1DA 3SNHA 2I5FA 1MPHA 4TKNA 3PZDA 2EC1A 5JHGA 1ZM0A 2ELAA 2H7DA 3PEGA 1J19A 3SUZA 3DXDA 3D8EA 3KSYA 4WSFA 4K2PA 1UPRA 3U8ZA 2DX5A 3ULBA 4GXBA 2I5CA 2Z0PA 2MDXA 2Y8GA 2J0KA 2VSZA 1XD4A 5CLQB 4B6HA 4CHMA 4HHVA 4A6KA 4A6FA 2KCJA 2N23A 4GPTB 2Q13A 3FSSA 5KQ4A 1MKEA 2D9YA 5DIFB 2GS0A 1M7EA 2AL6A 2NMBA 3TO1A 1UNQA 2DHIA 1K5DB 1J0WA 3KRWA 1RJ2A 1MIXA 1WJMA 5J3TA 2KGXB 2Z0QA 1OY2A 4A6FB 3MPXA 2P0DA 3D8DA 2Y7BA 3WYFB 1NU2A 1SHCA 1UNRA 1WGUA 1XODA 3FM8C 1V5PA 2Y8FA 1MK7B 1XKEA 1X1GA 4DXAB 1EAZA 4YL8A 2YS5A 4ZRIA 1GG3A 4MK0A 3D8FA 2CRFA 4GN1A 1XX0A 5HE3A 5HE1A 1GC6A 4H8SA 1ZVRA 3GYOA 1BTNA 1FHOA 3ULCA 2I1KA 1V5UA 1V61A 4ZRKA 1EF1A 1KZ7A 2YS3A 4HAWB 5D3XA 4KHAA 3PVLA 4CYEA 4HB0B 3KZ1A 1GC7A 5HE2A 5JP4A 1Y5OA 4HAYB 3WA0A 3AJ4A 1KZGA 5DH9B 1N3HA 5KQ1A 5EFXA 2RGNB 4A5KA 2ADZA 2P8VA 4EKUA 1W1HA 2DA0A 3GYPA 2D9XA 4K17A 5JLJB 4A6HA 1TQZA 1MIZB 2L2IA 3LJUX 4HAXB 5J3YA 4P7IA 4EMOA 2PZ1A 3QIJA 2DN6A 1FB8A 4DX90 3MDBC 3ODXA 4Z2MB 4DBBA 1KI1B 3G9WA 5DHFB 2RVBB 3DXEA 2OQBA 1DBHA 1EVHA 2LULA 1WVHA 2KUPA 2YT1A 4F7UP 3PSCA 2Z0OA 1U5GA 3CXBB 1NTYA 3PP2A 2EMTA 2DKPA 2V76A 1EGXA 4F7HA 4C0AA 4HB2B 4IFSA 3PVUA 4HDQA 4NSWA 2R09A 2MFQA 1WGQA 4GMVA 1Y19B 1SGHA 1U5FA 2QKLA 3VOQA 2UVMA 4D0NB 2D9WA 3M1IB 2CY5A 1UPQA 2QKMA 5KCVA 2JP2A 2YSZA 2VKIA 1DROA 1DDMA 1FGYA 3ODOA 2R0DA 2RLOA 2I1JA 1Z87A 1FGZA 3O96A 2XQNM 1OQNA 1OMWA 2YF0A 2GJYA 2IYBA 2ZPYA 2DKQA 2CODA 4ZRJA 3TVVA 1LB1A 1LW3A 2N0YA 5J3QA 1TJ6A 1QC6A 1U27A 1FHXA 1FAOA 3TW1A 2YRYA 2YS1A 2YT0A 1MAIA 4K81A 3RCPA 3F0WA 1H10A 3DXCA 5D3YA 5D3WA 3ML4A 1K5GB 4MT7A 1ZC3B 5D3VA 4L6EA 2RSGA 5DI9B 1UNPA 3X23A 4HAZB 4DX8A 5LOPB 5C6RA 1P6SA 1BTKA 3SO6A 3PG7A 3HW2B 2COFA 1ZC4B 2COAA 2D11A 3OANA 5LONB 2D9VA 2M14A 2VRWB 5L81A 5JHHA 4IOYX 2MKRA 1UEFA 2DYNA 2GCLA 2MWNB 2EJ8A 3P7ZA 2J59M 4MY6A 3N7CA 1DDWA 1U5EA 2HTHB 4BBKA 2AEHA 1BAKA 5GOWB 1M7RA 1PLSA 3TFMA 4KHOA 4HAUB 3ZVRA 2COCA 3QBVB 2D10A 3CIKA 2D9ZA 1AQCA 2FJLA 4XWXA 2EMSA 2J0MA 1DYNA 2W2XD 2X18A 4HB4B 1MK9B 2BCJA 4KAXB 4KVGB 1X11A 2W2XC 3ZDTA 1V5MA 5DHAB 2UZRA 4HB3B 3KY9A 3V5WA 2HE7A 1WJ1A 2ROZB 5FI0A 1E5WA 2DX1A 2E2XA 1V88A 3F5RA 4PNKA 2CAYA 3KRXA 1I2HA 3A8QA 1H4RA 1RRPB 3AU4A 4WVFB 2G35A 3P6AA 4IAPA 2W2WA 5C79A 5HE0A 2K00A 4Z2NA 1NTVA 1WI1A 2DHKA 2OTXA 2DLWA 1U2BA 2LKOA 2UZSA 1PMSA 4CHJA 3NSUA 1QQGA 2DTCA 2CY4A 4HDOA 4K2OA 3VIAA 1WG7A 1U5DA 5D27A 1X05A 2D2QA 3QWMA 1I7AA 3BINA 4YONA 3ODWA 5CLLB 1X86A 4NY0A 3HK0A
chains in the Genus database with same CATH superfamily
3SYXA 1Q67A 1DDVA 2RNRB 4F7GA 2RUKB 2KUQA 1BWNA 4GMXB 1ZSQA 4EJNA 2LYDA 2K2UA 2NZ8B 2K2JA 5M4YB 3BJIA 3UZTA 1X1FA 2KIGA 3PVWA 4Y94A 2LG1A 2GCJA 2LOZA 1B55A 2J0JA 1TXDA 5C5BA 2IFSA 2M38A 1ISNA 1XR0B 3A98B 4KHBA 2LOXA 1P5TA 2P0HA 4HAVB 4PQ0A 3AU5A 2DYQA 4QXAB 5I2SA 2DFKA 1P3RA 2DHJA 3T06A 1AWEA 2L1CA 1W1GA 1FOEA 3FEHA 4OT1A 5C16A 2YT2A 3IVFA 1IRSA 5C5BB 4QJ5B 2ROVA 1FHWA 3A8PA 3HQCA 2D4QA 2KR0A 1V89A 4KHBB 1U29A 4WJ7A 2YVCA 1NI2A 1XCGA 2ELBA 4TYZA 3TCAA 3U7DA 3SV1A 1PFJA 4HATB 5FI1A 2H7EA 4GZUA 2P0FA 1W1DA 3SNHA 2I5FA 1MPHA 4TKNA 3PZDA 2EC1A 5JHGA 1ZM0A 2ELAA 4HSIA 2H7DA 3PEGA 4GNKB 1J19A 2K8EA 3SUZA 3DXDA 3D8EA 3KSYA 4WSFA 4K2PA 1UPRA 3U8ZA 2DX5A 3ULBA 4GXBA 2I5CA 2Z0PA 2MDXA 2Y8GA 2J0KA 2VSZA 3NWFA 1XD4A 2Z59A 5CLQB 4B6HA 4CHMA 4HHVA 3HSAA 1T77A 4A6FA 4A6KA 2KCJA 2N23A 4GPTB 2Q13A 3FSSA 3FVCA 2K49A 2ZKMX 5KQ4A 1MKEA 2D9YA 5DIFB 2GS0A 1M7EA 2AL6A 3B77A 2NMBA 3NWDA 3TO1A 1UNQA 2DHIA 1K5DB 1J0WA 3KRWA 1RJ2A 1MIXA 1WJMA 5J3TA 2KGXB 2Z0QA 1OY2A 4A6FB 3MPXA 2NBVA 2P0DA 3D8DA 2Y7BA 3WYFB 1NU2A 1SHCA 1UNRA 1WGUA 1XODA 3FM8C 1V5PA 2Y8FA 1MK7B 1XKEA 1X1GA 4DXAB 1EAZA 4YL8A 2YS5A 2Z13A 3NWAA 4ZRIA 1GG3A 4MK0A 3D8FA 2CRFA 4GN1A 1XX0A 5HE3A 5HE1A 1GC6A 4H8SA 1ZVRA 3GYOA 1BTNA 1FHOA 3ULCA 2I1KA 1V5UA 1V61A 4ZRKA 1EF1A 1KZ7A 2YS3A 4HAWB 5D3XA 4KHAA 3PVLA 4CYEA 4HB0B 3KZ1A 1GC7A 5HE2A 5JP4A 2GUMA 5I2MA 4QJ3B 1Y5OA 4HAYB 3WA0A 3AJ4A 1KZGA 4QJ4B 5DH9B 1N3HA 5KQ1A 5EFXA 2RGNB 4A5KA 2ADZA 2P8VA 4EKUA 1W1HA 2DA0A 3GYPA 2D9XA 4K17A 5JLJB 4A6HA 1TQZA 3NW8A 1MIZB 2L2IA 3LJUX 4HAXB 5J3YA 4P7IA 4EMOA 2PZ1A 3QIJA 2DN6A 1FB8A 3OHMB 3MDBC 3ODXA 4Z2MB 4DX90 4DBBA 1ZYIA 1KI1B 3G9WA 5DHFB 2RVBB 3DXEA 2OQBA 1DBHA 1EVHA 2LULA 1WVHA 2KUPA 2YT1A 4F7UP 3PSCA 2Z0OA 1U5GA 3CXBB 1NTYA 3PP2A 2FJUB 2EMTA 2DKPA 2V76A 1EGXA 4F7HA 4C0AA 4HB2B 4IFSA 3PVUA 4HDQA 4NSWA 2R09A 2MFQA 1WGQA 4GMVA 1Y19B 1SGHA 1U5FA 2QKLA 3VOQA 2UVMA 4D0NB 2D9WA 3DCXA 3M1IB 4L1RA 2CY5A 2Z14A 1UPQA 2QKMA 5KCVA 2JP2A 2YSZA 2VKIA 1DROA 1DDMA 1FGYA 3ODOA 2R0DA 2RLOA 2I1JA 1Z87A 1FGZA 3O96A 2XQNM 1OQNA 1OMWA 2YF0A 2GJYA 2IYBA 2ZPYA 2DKQA 2CODA 4ZRJA 3TVVA 1LB1A 1LW3A 2N0YA 5J3QA 1TJ6A 1QC6A 1U27A 1FHXA 1FAOA 3TW1A 2YRYA 2YS1A 2YT0A 1MAIA 1MI1A 4K81A 3RCPA 3F0WA 1H10A 3DXCA 5D3YA 5D3WA 3ML4A 1K5GB 4MT7A 1ZC3B 5D3VA 4L6EA 2RSGA 5DI9B 1UNPA 3X23A 4HAZB 4DX8A 5LOPB 5C6RA 5LG4B 1P6SA 1BTKA 3SO6A 3PG7A 3HW2B 2COFA 1ZC4B 2COAA 2D11A 4OSNA 3OANA 5LONB 2D9VA 2R2YA 2M14A 2VRWB 5L81A 5JHHA 4IOYX 2MKRA 1UEFA 2DYNA 2GCLA 2MWNB 2EJ8A 3P7ZA 2J59M 4MY6A 3N7CA 1DDWA 1U5EA 2HTHB 4BBKA 2AEHA 1BAKA 4GOUA 5GOWB 1M7RA 1PLSA 3TFMA 4KHOA 4HAUB 3ZVRA 2COCA 3QBVB 2D10A 3CIKA 2D9ZA 3A58A 1AQCA 2FJLA 4XWXA 3U12A 2EMSA 2J0MA 1DYNA 2W2XD 2X18A 4HB4B 1MK9B 2BCJA 4KAXB 4KVGB 1X11A 2W2XC 3ZDTA 1V5MA 5DHAB 2UZRA 4HB3B 3KY9A 3V5WA 2HE7A 1WJ1A 2ROZB 5FI0A 1E5WA 2DX1A 2E2XA 2Z4DA 1V88A 3F5RA 4PNKA 2CAYA 3KRXA 1I2HA 3A8QA 1H4RA 1RRPB 3AU4A 4WVFB 2G35A 3P6AA 4IAPA 2W2WA 3HIEA 5C79A 5HE0A 2K00A 4Z2NA 1NTVA 2RRFA 1WI1A 2DHKA 2OTXA 2DLWA 1U2BA 4CSQA 2LKOA 2UZSA 4D6WA 5IRSA 1PMSA 4CHJA 3NSUA 1QQGA 2DTCA 2CY4A 4DIXA 4HDOA 4K2OA 3VIAA 2KIEA 1WG7A 1U5DA 5D27A 1X05A 2D2QA 3QWMA 1I7AA 3BINA 4YONA 3ODWA 5CLLB 1X86A 4NY0A 3HK0A
chains in the Genus database with same CATH topology
3SYXA 1Q67A 1DDVA 2RNRB 4F7GA 2RUKB 1BWNA 4GMXB 1ZSQA 4EJNA 2LYDA 2K2UA 2NZ8B 2K2JA 3BJIA 3UZTA 1X1FA 3PVWA 4Y94A 2LG1A 2GCJA 2LOZA 1B55A 2J0JA 1TXDA 5C5BA 2IFSA 2M38A 1ISNA 1XR0B 3A98B 2LOXA 1P5TA 2P0HA 4HAVB 4PQ0A 3AU5A 2DYQA 2DFKA 1P3RA 2DHJA 3T06A 1AWEA 2L1CA 1W1GA 1FOEA 3FEHA 5C16A 3IVFA 1IRSA 5C5BB 2ROVA 1FHWA 3A8PA 3HQCA 2D4QA 1V89A 4KHBB 1U29A 4WJ7A 2YVCA 1NI2A 1XCGA 2ELBA 4TYZA 3TCAA 3U7DA 3SV1A 1PFJA 4HATB 5FI1A 2H7EA 4GZUA 2P0FA 1W1DA 3SNHA 2I5FA 1MPHA 4TKNA 3PZDA 2EC1A 5JHGA 1ZM0A 2ELAA 2H7DA 3PEGA 1J19A 3SUZA 3DXDA 3D8EA 3KSYA 4WSFA 4K2PA 1UPRA 3U8ZA 2DX5A 3ULBA 4GXBA 2I5CA 2Z0PA 2MDXA 2Y8GA 2J0KA 2VSZA 1XD4A 5CLQB 4B6HA 4CHMA 4HHVA 4A6KA 4A6FA 2KCJA 2N23A 4GPTB 2Q13A 3FSSA 5KQ4A 1MKEA 2D9YA 5DIFB 2GS0A 1M7EA 2AL6A 2NMBA 3TO1A 1UNQA 2DHIA 1K5DB 1J0WA 3KRWA 1RJ2A 1MIXA 1WJMA 5J3TA 2KGXB 2Z0QA 1OY2A 4A6FB 3MPXA 2P0DA 3D8DA 2Y7BA 3WYFB 1NU2A 1SHCA 1UNRA 1WGUA 1XODA 3FM8C 1V5PA 2Y8FA 1MK7B 1XKEA 1X1GA 4DXAB 1EAZA 4YL8A 2YS5A 4ZRIA 1GG3A 4MK0A 3D8FA 2CRFA 4GN1A 1XX0A 5HE3A 5HE1A 1GC6A 4H8SA 1ZVRA 3GYOA 1BTNA 1FHOA 3ULCA 2I1KA 1V5UA 1V61A 4ZRKA 1EF1A 1KZ7A 2YS3A 4HAWB 5D3XA 4KHAA 3PVLA 4CYEA 4HB0B 3KZ1A 1GC7A 5HE2A 5JP4A 1Y5OA 4HAYB 3WA0A 3AJ4A 1KZGA 5DH9B 1N3HA 5KQ1A 5EFXA 2RGNB 4A5KA 2ADZA 2P8VA 4EKUA 1W1HA 2DA0A 3GYPA 2D9XA 4K17A 5JLJB 4A6HA 1TQZA 1MIZB 2L2IA 3LJUX 4HAXB 5J3YA 4P7IA 4EMOA 2PZ1A 3QIJA 2DN6A 1FB8A 4DX90 3MDBC 3ODXA 4Z2MB 4DBBA 1KI1B 3G9WA 5DHFB 2RVBB 3DXEA 2OQBA 1DBHA 1EVHA 2LULA 1WVHA 2KUPA 2YT1A 4F7UP 3PSCA 2Z0OA 1U5GA 3CXBB 1NTYA 3PP2A 2EMTA 2DKPA 2V76A 1EGXA 4F7HA 4C0AA 4HB2B 4IFSA 3PVUA 4HDQA 4NSWA 2R09A 2MFQA 1WGQA 4GMVA 1Y19B 1SGHA 1U5FA 2QKLA 3VOQA 2UVMA 4D0NB 2D9WA 3M1IB 2CY5A 1UPQA 2QKMA 5KCVA 2JP2A 2YSZA 2VKIA 1DROA 1DDMA 1FGYA 3ODOA 2R0DA 2RLOA 2I1JA 1Z87A 1FGZA 3O96A 2XQNM 1OQNA 1OMWA 2YF0A 2GJYA 2IYBA 2ZPYA 2DKQA 2CODA 4ZRJA 3TVVA 1LB1A 1LW3A 2N0YA 5J3QA 1TJ6A 1QC6A 1U27A 1FHXA 1FAOA 3TW1A 2YRYA 2YS1A 2YT0A 1MAIA 4K81A 3RCPA 3F0WA 1H10A 3DXCA 5D3YA 5D3WA 3ML4A 1K5GB 4MT7A 1ZC3B 5D3VA 4L6EA 2RSGA 5DI9B 1UNPA 3X23A 4HAZB 4DX8A 5LOPB 5C6RA 1P6SA 1BTKA 3SO6A 3PG7A 3HW2B 2COFA 1ZC4B 2COAA 2D11A 3OANA 5LONB 2D9VA 2M14A 2VRWB 5L81A 5JHHA 4IOYX 2MKRA 1UEFA 2DYNA 2GCLA 2MWNB 2EJ8A 3P7ZA 2J59M 4MY6A 3N7CA 1DDWA 1U5EA 2HTHB 4BBKA 2AEHA 1BAKA 5GOWB 1M7RA 1PLSA 3TFMA 4KHOA 4HAUB 3ZVRA 2COCA 3QBVB 2D10A 3CIKA 2D9ZA 1AQCA 2FJLA 4XWXA 2EMSA 2J0MA 1DYNA 2W2XD 2X18A 4HB4B 1MK9B 2BCJA 4KAXB 4KVGB 1X11A 2W2XC 3ZDTA 1V5MA 5DHAB 2UZRA 4HB3B 3KY9A 3V5WA 2HE7A 1WJ1A 2ROZB 5FI0A 1E5WA 2DX1A 2E2XA 1V88A 3F5RA 4PNKA 2CAYA 3KRXA 1I2HA 3A8QA 1H4RA 1RRPB 3AU4A 4WVFB 2G35A 3P6AA 4IAPA 2W2WA 5C79A 5HE0A 2K00A 4Z2NA 1NTVA 1WI1A 2DHKA 2OTXA 2DLWA 1U2BA 2LKOA 2UZSA 1PMSA 4CHJA 3NSUA 1QQGA 2DTCA 2CY4A 4HDOA 4K2OA 3VIAA 1WG7A 1U5DA 5D27A 1X05A 2D2QA 3QWMA 1I7AA 3BINA 4YONA 3ODWA 5CLLB 1X86A 4NY0A 3HK0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SYX A;  1Q67 A;  1DDV A;  2RNR B;  4F7G A;  2RUK B;  1BWN A;  4GMX B;  1ZSQ A;  4EJN A;  2LYD A;  2K2U A;  2NZ8 B;  2K2J A;  3BJI A;  3UZT A;  1X1F A;  3PVW A;  4Y94 A;  2LG1 A;  2GCJ A;  2LOZ A;  1B55 A;  2J0J A;  1TXD A;  5C5B A;  2IFS A;  2M38 A;  1ISN A;  1XR0 B;  3A98 B;  2LOX A;  1P5T A;  2P0H A;  4HAV B;  4PQ0 A;  3AU5 A;  2DYQ A;  2DFK A;  1P3R A;  2DHJ A;  3T06 A;  1AWE A;  2L1C A;  1W1G A;  1FOE A;  3FEH A;  5C16 A;  3IVF A;  1IRS A;  5C5B B;  2ROV A;  1FHW A;  3A8P A;  3HQC A;  2D4Q A;  1V89 A;  4KHB B;  1U29 A;  4WJ7 A;  2YVC A;  1NI2 A;  1XCG A;  2ELB A;  4TYZ A;  3TCA A;  3U7D A;  3SV1 A;  1PFJ A;  4HAT B;  5FI1 A;  2H7E A;  4GZU A;  2P0F A;  1W1D A;  3SNH A;  2I5F A;  1MPH A;  4TKN A;  3PZD A;  2EC1 A;  5JHG A;  1ZM0 A;  2ELA A;  2H7D A;  3PEG A;  1J19 A;  3SUZ A;  3DXD A;  3D8E A;  3KSY A;  4WSF A;  4K2P A;  1UPR A;  3U8Z A;  2DX5 A;  3ULB A;  4GXB A;  2I5C A;  2Z0P A;  2MDX A;  2Y8G A;  2J0K A;  2VSZ A;  1XD4 A;  5CLQ B;  4B6H A;  4CHM A;  4HHV A;  4A6K A;  4A6F A;  2KCJ A;  2N23 A;  4GPT B;  2Q13 A;  3FSS A;  5KQ4 A;  1MKE A;  2D9Y A;  5DIF B;  2GS0 A;  1M7E A;  2AL6 A;  2NMB A;  3TO1 A;  1UNQ A;  2DHI A;  1K5D B;  1J0W A;  3KRW A;  1RJ2 A;  1MIX A;  1WJM A;  5J3T A;  2KGX B;  2Z0Q A;  1OY2 A;  4A6F B;  3MPX A;  2P0D A;  3D8D A;  2Y7B A;  3WYF B;  1NU2 A;  1SHC A;  1UNR A;  1WGU A;  1XOD A;  3FM8 C;  1V5P A;  2Y8F A;  1MK7 B;  1XKE A;  1X1G A;  4DXA B;  1EAZ A;  4YL8 A;  2YS5 A;  4ZRI A;  1GG3 A;  4MK0 A;  3D8F A;  2CRF A;  4GN1 A;  1XX0 A;  5HE3 A;  5HE1 A;  1GC6 A;  4H8S A;  1ZVR A;  3GYO A;  1BTN A;  1FHO A;  3ULC A;  2I1K A;  1V5U A;  1V61 A;  4ZRK A;  1EF1 A;  1KZ7 A;  2YS3 A;  4HAW B;  5D3X A;  4KHA A;  3PVL A;  4CYE A;  4HB0 B;  3KZ1 A;  1GC7 A;  5HE2 A;  5JP4 A;  1Y5O A;  4HAY B;  3WA0 A;  3AJ4 A;  1KZG A;  5DH9 B;  1N3H A;  5KQ1 A;  5EFX A;  2RGN B;  4A5K A;  2ADZ A;  2P8V A;  4EKU A;  1W1H A;  2DA0 A;  3GYP A;  2D9X A;  4K17 A;  5JLJ B;  4A6H A;  1TQZ A;  1MIZ B;  2L2I A;  3LJU X;  4HAX B;  5J3Y A;  4P7I A;  4EMO A;  2PZ1 A;  3QIJ A;  2DN6 A;  1FB8 A;  4DX9 0;  3MDB C;  3ODX A;  4Z2M B;  4DBB A;  1KI1 B;  3G9W A;  5DHF B;  2RVB B;  3DXE A;  2OQB A;  1DBH A;  1EVH A;  2LUL A;  1WVH A;  2KUP A;  2YT1 A;  4F7U P;  3PSC A;  2Z0O A;  1U5G A;  3CXB B;  1NTY A;  3PP2 A;  2EMT A;  2DKP A;  2V76 A;  1EGX A;  4F7H A;  4C0A A;  4HB2 B;  4IFS A;  3PVU A;  4HDQ A;  4NSW A;  2R09 A;  2MFQ A;  1WGQ A;  4GMV A;  1Y19 B;  1SGH A;  1U5F A;  2QKL A;  3VOQ A;  2UVM A;  4D0N B;  2D9W A;  3M1I B;  2CY5 A;  1UPQ A;  2QKM A;  5KCV A;  2JP2 A;  2YSZ A;  2VKI A;  1DRO A;  1DDM A;  1FGY A;  3ODO A;  2R0D A;  2RLO A;  2I1J A;  1Z87 A;  1FGZ A;  3O96 A;  2XQN M;  1OQN A;  1OMW A;  2YF0 A;  2GJY A;  2IYB A;  2ZPY A;  2DKQ A;  2COD A;  4ZRJ A;  3TVV A;  1LB1 A;  1LW3 A;  2N0Y A;  5J3Q A;  1TJ6 A;  1QC6 A;  1U27 A;  1FHX A;  1FAO A;  3TW1 A;  2YRY A;  2YS1 A;  2YT0 A;  1MAI A;  4K81 A;  3RCP A;  3F0W A;  1H10 A;  3DXC A;  5D3Y A;  5D3W A;  3ML4 A;  1K5G B;  4MT7 A;  1ZC3 B;  5D3V A;  4L6E A;  2RSG A;  5DI9 B;  1UNP A;  3X23 A;  4HAZ B;  4DX8 A;  5LOP B;  5C6R A;  1P6S A;  1BTK A;  3SO6 A;  3PG7 A;  3HW2 B;  2COF A;  1ZC4 B;  2COA A;  2D11 A;  3OAN A;  5LON B;  2D9V A;  2M14 A;  2VRW B;  5L81 A;  5JHH A;  4IOY X;  2MKR A;  1UEF A;  2DYN A;  2GCL A;  2MWN B;  2EJ8 A;  3P7Z A;  2J59 M;  4MY6 A;  3N7C A;  1DDW A;  1U5E A;  2HTH B;  4BBK A;  2AEH A;  1BAK A;  5GOW B;  1M7R A;  1PLS A;  3TFM A;  4KHO A;  4HAU B;  3ZVR A;  2COC A;  3QBV B;  2D10 A;  3CIK A;  2D9Z A;  1AQC A;  2FJL A;  4XWX A;  2EMS A;  2J0M A;  1DYN A;  2W2X D;  2X18 A;  4HB4 B;  1MK9 B;  2BCJ A;  4KAX B;  4KVG B;  1X11 A;  2W2X C;  3ZDT A;  1V5M A;  5DHA B;  2UZR A;  4HB3 B;  3KY9 A;  3V5W A;  2HE7 A;  1WJ1 A;  2ROZ B;  5FI0 A;  1E5W A;  2DX1 A;  2E2X A;  1V88 A;  3F5R A;  4PNK A;  2CAY A;  3KRX A;  1I2H A;  3A8Q A;  1H4R A;  1RRP B;  3AU4 A;  4WVF B;  2G35 A;  3P6A A;  4IAP A;  2W2W A;  5C79 A;  5HE0 A;  2K00 A;  4Z2N A;  1NTV A;  1WI1 A;  2DHK A;  2OTX A;  2DLW A;  1U2B A;  2LKO A;  2UZS A;  1PMS A;  4CHJ A;  3NSU A;  1QQG A;  2DTC A;  2CY4 A;  4HDO A;  4K2O A;  3VIA A;  1WG7 A;  1U5D A;  5D27 A;  1X05 A;  2D2Q A;  3QWM A;  1I7A A;  3BIN A;  4YON A;  3ODW A;  5CLL B;  1X86 A;  4NY0 A;  3HK0 A; 
#chains in the Genus database with same CATH topology
 3SYX A;  1Q67 A;  1DDV A;  2RNR B;  4F7G A;  2RUK B;  2KUQ A;  1BWN A;  4GMX B;  1ZSQ A;  4EJN A;  2LYD A;  2K2U A;  2NZ8 B;  2K2J A;  5M4Y B;  3BJI A;  3UZT A;  1X1F A;  2KIG A;  3PVW A;  4Y94 A;  2LG1 A;  2GCJ A;  2LOZ A;  1B55 A;  2J0J A;  1TXD A;  5C5B A;  2IFS A;  2M38 A;  1ISN A;  1XR0 B;  3A98 B;  4KHB A;  2LOX A;  1P5T A;  2P0H A;  4HAV B;  4PQ0 A;  3AU5 A;  2DYQ A;  4QXA B;  5I2S A;  2DFK A;  1P3R A;  2DHJ A;  3T06 A;  1AWE A;  2L1C A;  1W1G A;  1FOE A;  3FEH A;  4OT1 A;  5C16 A;  2YT2 A;  3IVF A;  1IRS A;  5C5B B;  4QJ5 B;  2ROV A;  1FHW A;  3A8P A;  3HQC A;  2D4Q A;  2KR0 A;  1V89 A;  4KHB B;  1U29 A;  4WJ7 A;  2YVC A;  1NI2 A;  1XCG A;  2ELB A;  4TYZ A;  3TCA A;  3U7D A;  3SV1 A;  1PFJ A;  4HAT B;  5FI1 A;  2H7E A;  4GZU A;  2P0F A;  1W1D A;  3SNH A;  2I5F A;  1MPH A;  4TKN A;  3PZD A;  2EC1 A;  5JHG A;  1ZM0 A;  2ELA A;  4HSI A;  2H7D A;  3PEG A;  4GNK B;  1J19 A;  2K8E A;  3SUZ A;  3DXD A;  3D8E A;  3KSY A;  4WSF A;  4K2P A;  1UPR A;  3U8Z A;  2DX5 A;  3ULB A;  4GXB A;  2I5C A;  2Z0P A;  2MDX A;  2Y8G A;  2J0K A;  2VSZ A;  3NWF A;  1XD4 A;  2Z59 A;  5CLQ B;  4B6H A;  4CHM A;  4HHV A;  3HSA A;  1T77 A;  4A6F A;  4A6K A;  2KCJ A;  2N23 A;  4GPT B;  2Q13 A;  3FSS A;  3FVC A;  2K49 A;  2ZKM X;  5KQ4 A;  1MKE A;  2D9Y A;  5DIF B;  2GS0 A;  1M7E A;  2AL6 A;  3B77 A;  2NMB A;  3NWD A;  3TO1 A;  1UNQ A;  2DHI A;  1K5D B;  1J0W A;  3KRW A;  1RJ2 A;  1MIX A;  1WJM A;  5J3T A;  2KGX B;  2Z0Q A;  1OY2 A;  4A6F B;  3MPX A;  2NBV A;  2P0D A;  3D8D A;  2Y7B A;  3WYF B;  1NU2 A;  1SHC A;  1UNR A;  1WGU A;  1XOD A;  3FM8 C;  1V5P A;  2Y8F A;  1MK7 B;  1XKE A;  1X1G A;  4DXA B;  1EAZ A;  4YL8 A;  2YS5 A;  2Z13 A;  3NWA A;  4ZRI A;  1GG3 A;  4MK0 A;  3D8F A;  2CRF A;  4GN1 A;  1XX0 A;  5HE3 A;  5HE1 A;  1GC6 A;  4H8S A;  1ZVR A;  3GYO A;  1BTN A;  1FHO A;  3ULC A;  2I1K A;  1V5U A;  1V61 A;  4ZRK A;  1EF1 A;  1KZ7 A;  2YS3 A;  4HAW B;  5D3X A;  4KHA A;  3PVL A;  4CYE A;  4HB0 B;  3KZ1 A;  1GC7 A;  5HE2 A;  5JP4 A;  2GUM A;  5I2M A;  4QJ3 B;  1Y5O A;  4HAY B;  3WA0 A;  3AJ4 A;  1KZG A;  4QJ4 B;  5DH9 B;  1N3H A;  5KQ1 A;  5EFX A;  2RGN B;  4A5K A;  2ADZ A;  2P8V A;  4EKU A;  1W1H A;  2DA0 A;  3GYP A;  2D9X A;  4K17 A;  5JLJ B;  4A6H A;  1TQZ A;  3NW8 A;  1MIZ B;  2L2I A;  3LJU X;  4HAX B;  5J3Y A;  4P7I A;  4EMO A;  2PZ1 A;  3QIJ A;  2DN6 A;  1FB8 A;  3OHM B;  3MDB C;  3ODX A;  4Z2M B;  4DX9 0;  4DBB A;  1ZYI A;  1KI1 B;  3G9W A;  5DHF B;  2RVB B;  3DXE A;  2OQB A;  1DBH A;  1EVH A;  2LUL A;  1WVH A;  2KUP A;  2YT1 A;  4F7U P;  3PSC A;  2Z0O A;  1U5G A;  3CXB B;  1NTY A;  3PP2 A;  2FJU B;  2EMT A;  2DKP A;  2V76 A;  1EGX A;  4F7H A;  4C0A A;  4HB2 B;  4IFS A;  3PVU A;  4HDQ A;  4NSW A;  2R09 A;  2MFQ A;  1WGQ A;  4GMV A;  1Y19 B;  1SGH A;  1U5F A;  2QKL A;  3VOQ A;  2UVM A;  4D0N B;  2D9W A;  3DCX A;  3M1I B;  4L1R A;  2CY5 A;  2Z14 A;  1UPQ A;  2QKM A;  5KCV A;  2JP2 A;  2YSZ A;  2VKI A;  1DRO A;  1DDM A;  1FGY A;  3ODO A;  2R0D A;  2RLO A;  2I1J A;  1Z87 A;  1FGZ A;  3O96 A;  2XQN M;  1OQN A;  1OMW A;  2YF0 A;  2GJY A;  2IYB A;  2ZPY A;  2DKQ A;  2COD A;  4ZRJ A;  3TVV A;  1LB1 A;  1LW3 A;  2N0Y A;  5J3Q A;  1TJ6 A;  1QC6 A;  1U27 A;  1FHX A;  1FAO A;  3TW1 A;  2YRY A;  2YS1 A;  2YT0 A;  1MAI A;  1MI1 A;  4K81 A;  3RCP A;  3F0W A;  1H10 A;  3DXC A;  5D3Y A;  5D3W A;  3ML4 A;  1K5G B;  4MT7 A;  1ZC3 B;  5D3V A;  4L6E A;  2RSG A;  5DI9 B;  1UNP A;  3X23 A;  4HAZ B;  4DX8 A;  5LOP B;  5C6R A;  5LG4 B;  1P6S A;  1BTK A;  3SO6 A;  3PG7 A;  3HW2 B;  2COF A;  1ZC4 B;  2COA A;  2D11 A;  4OSN A;  3OAN A;  5LON B;  2D9V A;  2R2Y A;  2M14 A;  2VRW B;  5L81 A;  5JHH A;  4IOY X;  2MKR A;  1UEF A;  2DYN A;  2GCL A;  2MWN B;  2EJ8 A;  3P7Z A;  2J59 M;  4MY6 A;  3N7C A;  1DDW A;  1U5E A;  2HTH B;  4BBK A;  2AEH A;  1BAK A;  4GOU A;  5GOW B;  1M7R A;  1PLS A;  3TFM A;  4KHO A;  4HAU B;  3ZVR A;  2COC A;  3QBV B;  2D10 A;  3CIK A;  2D9Z A;  3A58 A;  1AQC A;  2FJL A;  4XWX A;  3U12 A;  2EMS A;  2J0M A;  1DYN A;  2W2X D;  2X18 A;  4HB4 B;  1MK9 B;  2BCJ A;  4KAX B;  4KVG B;  1X11 A;  2W2X C;  3ZDT A;  1V5M A;  5DHA B;  2UZR A;  4HB3 B;  3KY9 A;  3V5W A;  2HE7 A;  1WJ1 A;  2ROZ B;  5FI0 A;  1E5W A;  2DX1 A;  2E2X A;  2Z4D A;  1V88 A;  3F5R A;  4PNK A;  2CAY A;  3KRX A;  1I2H A;  3A8Q A;  1H4R A;  1RRP B;  3AU4 A;  4WVF B;  2G35 A;  3P6A A;  4IAP A;  2W2W A;  3HIE A;  5C79 A;  5HE0 A;  2K00 A;  4Z2N A;  1NTV A;  2RRF A;  1WI1 A;  2DHK A;  2OTX A;  2DLW A;  1U2B A;  4CSQ A;  2LKO A;  2UZS A;  4D6W A;  5IRS A;  1PMS A;  4CHJ A;  3NSU A;  1QQG A;  2DTC A;  2CY4 A;  4DIX A;  4HDO A;  4K2O A;  3VIA A;  2KIE A;  1WG7 A;  1U5D A;  5D27 A;  1X05 A;  2D2Q A;  3QWM A;  1I7A A;  3BIN A;  4YON A;  3ODW A;  5CLL B;  1X86 A;  4NY0 A;  3HK0 A; 
#chains in the Genus database with same CATH homology
 3SYX A;  1Q67 A;  1DDV A;  2RNR B;  4F7G A;  2RUK B;  1BWN A;  4GMX B;  1ZSQ A;  4EJN A;  2LYD A;  2K2U A;  2NZ8 B;  2K2J A;  3BJI A;  3UZT A;  1X1F A;  3PVW A;  4Y94 A;  2LG1 A;  2GCJ A;  2LOZ A;  1B55 A;  2J0J A;  1TXD A;  5C5B A;  2IFS A;  2M38 A;  1ISN A;  1XR0 B;  3A98 B;  2LOX A;  1P5T A;  2P0H A;  4HAV B;  4PQ0 A;  3AU5 A;  2DYQ A;  2DFK A;  1P3R A;  2DHJ A;  3T06 A;  1AWE A;  2L1C A;  1W1G A;  1FOE A;  3FEH A;  5C16 A;  3IVF A;  1IRS A;  5C5B B;  2ROV A;  1FHW A;  3A8P A;  3HQC A;  2D4Q A;  1V89 A;  4KHB B;  1U29 A;  4WJ7 A;  2YVC A;  1NI2 A;  1XCG A;  2ELB A;  4TYZ A;  3TCA A;  3U7D A;  3SV1 A;  1PFJ A;  4HAT B;  5FI1 A;  2H7E A;  4GZU A;  2P0F A;  1W1D A;  3SNH A;  2I5F A;  1MPH A;  4TKN A;  3PZD A;  2EC1 A;  5JHG A;  1ZM0 A;  2ELA A;  2H7D A;  3PEG A;  1J19 A;  3SUZ A;  3DXD A;  3D8E A;  3KSY A;  4WSF A;  4K2P A;  1UPR A;  3U8Z A;  2DX5 A;  3ULB A;  4GXB A;  2I5C A;  2Z0P A;  2MDX A;  2Y8G A;  2J0K A;  2VSZ A;  1XD4 A;  5CLQ B;  4B6H A;  4CHM A;  4HHV A;  4A6K A;  4A6F A;  2KCJ A;  2N23 A;  4GPT B;  2Q13 A;  3FSS A;  5KQ4 A;  1MKE A;  2D9Y A;  5DIF B;  2GS0 A;  1M7E A;  2AL6 A;  2NMB A;  3TO1 A;  1UNQ A;  2DHI A;  1K5D B;  1J0W A;  3KRW A;  1RJ2 A;  1MIX A;  1WJM A;  5J3T A;  2KGX B;  2Z0Q A;  1OY2 A;  4A6F B;  3MPX A;  2P0D A;  3D8D A;  2Y7B A;  3WYF B;  1NU2 A;  1SHC A;  1UNR A;  1WGU A;  1XOD A;  3FM8 C;  1V5P A;  2Y8F A;  1MK7 B;  1XKE A;  1X1G A;  4DXA B;  1EAZ A;  4YL8 A;  2YS5 A;  4ZRI A;  1GG3 A;  4MK0 A;  3D8F A;  2CRF A;  4GN1 A;  1XX0 A;  5HE3 A;  5HE1 A;  1GC6 A;  4H8S A;  1ZVR A;  3GYO A;  1BTN A;  1FHO A;  3ULC A;  2I1K A;  1V5U A;  1V61 A;  4ZRK A;  1EF1 A;  1KZ7 A;  2YS3 A;  4HAW B;  5D3X A;  4KHA A;  3PVL A;  4CYE A;  4HB0 B;  3KZ1 A;  1GC7 A;  5HE2 A;  5JP4 A;  1Y5O A;  4HAY B;  3WA0 A;  3AJ4 A;  1KZG A;  5DH9 B;  1N3H A;  5KQ1 A;  5EFX A;  2RGN B;  4A5K A;  2ADZ A;  2P8V A;  4EKU A;  1W1H A;  2DA0 A;  3GYP A;  2D9X A;  4K17 A;  5JLJ B;  4A6H A;  1TQZ A;  1MIZ B;  2L2I A;  3LJU X;  4HAX B;  5J3Y A;  4P7I A;  4EMO A;  2PZ1 A;  3QIJ A;  2DN6 A;  1FB8 A;  4DX9 0;  3MDB C;  3ODX A;  4Z2M B;  4DBB A;  1KI1 B;  3G9W A;  5DHF B;  2RVB B;  3DXE A;  2OQB A;  1DBH A;  1EVH A;  2LUL A;  1WVH A;  2KUP A;  2YT1 A;  4F7U P;  3PSC A;  2Z0O A;  1U5G A;  3CXB B;  1NTY A;  3PP2 A;  2EMT A;  2DKP A;  2V76 A;  1EGX A;  4F7H A;  4C0A A;  4HB2 B;  4IFS A;  3PVU A;  4HDQ A;  4NSW A;  2R09 A;  2MFQ A;  1WGQ A;  4GMV A;  1Y19 B;  1SGH A;  1U5F A;  2QKL A;  3VOQ A;  2UVM A;  4D0N B;  2D9W A;  3M1I B;  2CY5 A;  1UPQ A;  2QKM A;  5KCV A;  2JP2 A;  2YSZ A;  2VKI A;  1DRO A;  1DDM A;  1FGY A;  3ODO A;  2R0D A;  2RLO A;  2I1J A;  1Z87 A;  1FGZ A;  3O96 A;  2XQN M;  1OQN A;  1OMW A;  2YF0 A;  2GJY A;  2IYB A;  2ZPY A;  2DKQ A;  2COD A;  4ZRJ A;  3TVV A;  1LB1 A;  1LW3 A;  2N0Y A;  5J3Q A;  1TJ6 A;  1QC6 A;  1U27 A;  1FHX A;  1FAO A;  3TW1 A;  2YRY A;  2YS1 A;  2YT0 A;  1MAI A;  4K81 A;  3RCP A;  3F0W A;  1H10 A;  3DXC A;  5D3Y A;  5D3W A;  3ML4 A;  1K5G B;  4MT7 A;  1ZC3 B;  5D3V A;  4L6E A;  2RSG A;  5DI9 B;  1UNP A;  3X23 A;  4HAZ B;  4DX8 A;  5LOP B;  5C6R A;  1P6S A;  1BTK A;  3SO6 A;  3PG7 A;  3HW2 B;  2COF A;  1ZC4 B;  2COA A;  2D11 A;  3OAN A;  5LON B;  2D9V A;  2M14 A;  2VRW B;  5L81 A;  5JHH A;  4IOY X;  2MKR A;  1UEF A;  2DYN A;  2GCL A;  2MWN B;  2EJ8 A;  3P7Z A;  2J59 M;  4MY6 A;  3N7C A;  1DDW A;  1U5E A;  2HTH B;  4BBK A;  2AEH A;  1BAK A;  5GOW B;  1M7R A;  1PLS A;  3TFM A;  4KHO A;  4HAU B;  3ZVR A;  2COC A;  3QBV B;  2D10 A;  3CIK A;  2D9Z A;  1AQC A;  2FJL A;  4XWX A;  2EMS A;  2J0M A;  1DYN A;  2W2X D;  2X18 A;  4HB4 B;  1MK9 B;  2BCJ A;  4KAX B;  4KVG B;  1X11 A;  2W2X C;  3ZDT A;  1V5M A;  5DHA B;  2UZR A;  4HB3 B;  3KY9 A;  3V5W A;  2HE7 A;  1WJ1 A;  2ROZ B;  5FI0 A;  1E5W A;  2DX1 A;  2E2X A;  1V88 A;  3F5R A;  4PNK A;  2CAY A;  3KRX A;  1I2H A;  3A8Q A;  1H4R A;  1RRP B;  3AU4 A;  4WVF B;  2G35 A;  3P6A A;  4IAP A;  2W2W A;  5C79 A;  5HE0 A;  2K00 A;  4Z2N A;  1NTV A;  1WI1 A;  2DHK A;  2OTX A;  2DLW A;  1U2B A;  2LKO A;  2UZS A;  1PMS A;  4CHJ A;  3NSU A;  1QQG A;  2DTC A;  2CY4 A;  4HDO A;  4K2O A;  3VIA A;  1WG7 A;  1U5D A;  5D27 A;  1X05 A;  2D2Q A;  3QWM A;  1I7A A;  3BIN A;  4YON A;  3ODW A;  5CLL B;  1X86 A;  4NY0 A;  3HK0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...