3CXBB

Crystal structure of sifa and skip
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
103
structure length
103
Chain Sequence
TKEGMLHYKAGTSYLGKEHWKTCFVVLSNGILYQYPDRTDVIPLLSVNMGGEQCGGCRRANTTDRPHAFQVILSDRPCLELSAESEAEMAEWMQHLCQAVSKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Signaling protein
molecule keywords Protein sifA
publication title Structure and function of Salmonella SifA indicate that its interactions with SKIP, SseJ, and RhoA family GTPases induce endosomal tubulation
pubmed doi rcsb
source organism Salmonella typhimurium
total genus 16
structure length 103
sequence length 103
ec nomenclature
pdb deposition date 2008-04-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 3cxbB00
3ODWA 1ZC4B 2L1CA 4KHBB 4DX90 4ZRJA 4EJNA 5JLJB 1V5UA 3DXCA 1FB8A 2NMBA 2YS1A 2UVMA 2P0HA 2GCJA 2I1KA 3MDBC 5KQ1A 2DX1A 4HAWB 4B6HA 1KZGA 3P7ZA 3FM8C 1Q67A 4D0NB 2ELBA 5LOPB 2LOZA 5J3QA 3SUZA 5C5BB 2KCJA 1FOEA 3GYPA 3T06A 2HTHB 3PEGA 4GN1A 3OANA 1DDMA 4XWXA 1X11A 2P8VA 3AU5A 2YF0A 3PG7A 4IOYX 2RGNB 1U5GA 1ISNA 4A6FB 1SHCA 1SGHA 4MY6A 1P3RA 1V88A 1ZSQA 1U5DA 2CAYA 2COFA 1UNRA 1EVHA 3VIAA 2RNRB 3WYFB 2CY5A 2MFQA 4NY0A 1X86A 2Z0QA 3KRWA 4BBKA 1X1GA 1WG7A 3D8DA 1DBHA 5DHFB 1OY2A 1QC6A 2RUKB 2FJLA 1J0WA 1ZC3B 5EFXA 1FGZA 1MIXA 2DN6A 3DXDA 2DHKA 1DDWA 2D9XA 2AEHA 5C79A 2UZRA 2ELAA 2EMTA 4IFSA 3RCPA 4HAYB 3A98B 2VRWB 1QQGA 4F7GA 4P7IA 2UZSA 4A6HA 1I7AA 1TJ6A 4C0AA 1WVHA 3KSYA 2RVBB 4EMOA 4HB3B 2L2IA 1UNQA 2LG1A 4CHMA 3N7CA 5C6RA 1BAKA 1E5WA 2W2XD 5DHAB 1UNPA 2ZPYA 3NSUA 4DX8A 1OQNA 5J3TA 2N23A 4PQ0A 4EKUA 2VKIA 2Y8GA 3HQCA 2E2XA 2Z0PA 4TYZA 1U29A 3F0WA 1EF1A 4KAXB 1U5FA 1P5TA 1GC7A 2M38A 2GCLA 2I1JA 5L81A 3CXBB 2DKQA 1DYNA 2X18A 1XKEA 1FGYA 2QKMA 3CIKA 3PVLA 4A6FA 2KGXB 1Y19B 3FSSA 3ODOA 3MPXA 4K81A 4WVFB 1W1HA 1NU2A 2QKLA 2ROVA 1WGQA 2P0FA 5D3WA 3WA0A 1MK9B 1H10A 1MIZB 1X05A 1DROA 1V61A 5JHHA 2LYDA 2H7DA 2EC1A 4HHVA 2MWNB 1U5EA 2EMSA 2H7EA 5JP4A 3QIJA 1KZ7A 1AWEA 2J59M 4KHAA 2K2UA 2Z0OA 4GXBA 1EAZA 1XODA 2COCA 3GYOA 1K5GB 3ML4A 3BINA 2DLWA 1XCGA 1GG3A 5KCVA 3PVUA 1KI1B 4DBBA 3TVVA 1AQCA 4F7HA 5FI1A 4ZRIA 2D9VA 4IAPA 1PFJA 2XQNM 1MPHA 4K2OA 2EJ8A 3ULBA 1X1FA 5LONB 3QWMA 2YS5A 3VOQA 4GMXB 4PNKA 1V89A 5CLLB 2G35A 2YT0A 1PLSA 3D8EA 3ODXA 4A6KA 3KZ1A 5CLQB 5HE3A 2JP2A 1FHXA 3TO1A 1TXDA 2COAA 3HK0A 3AU4A 1V5MA 2YS3A 2DYNA 2M14A 5D3YA 2CY4A 2D9YA 2DYQA 2J0JA 2MDXA 2CRFA 1MK7B 1BWNA 1FHWA 5HE2A 3PSCA 1MKEA 4HDQA 2DX5A 1ZM0A 4HB0B 2P0DA 1UPQA 3LJUX 4CYEA 4GZUA 3TFMA 3PP2A 2YT1A 4GPTB 4TKNA 4GMVA 3ZDTA 1RRPB 2DHIA 1FAOA 3TCAA 3DXEA 2YVCA 4HAUB 3KRXA 1H4RA 1LB1A 4HAVB 4NSWA 2DHJA 5FI0A 1RJ2A 4K17A 1UEFA 2D11A 3A8QA 3P6AA 1B55A 2ADZA 1P6SA 3U8ZA 2OQBA 1WGUA 4H8SA 2IFSA 4HATB 5HE0A 2R09A 1U27A 1LW3A 4HDOA 2YSZA 5HE1A 3HW2B 2Q13A 3F5RA 2VSZA 2IYBA 2Y8FA 4ZRKA 4Z2NA 1I2HA 1OMWA 3QBVB 4HB2B 1BTNA 1DDVA 4DXAB 4KHOA 4Z2MB 1M7RA 5J3YA 2KUPA 1XR0B 4KVGB 2D10A 1TQZA 4HB4B 2PZ1A 5DIFB 5JHGA 3KY9A 4F7UP 2D9WA 2DA0A 3TW1A 2DKPA 1NTVA 1WJ1A 1W1GA 4L6EA 2BCJA 2YRYA 3ULCA 4MK0A 5DH9B 1PMSA 5DI9B 1WI1A 3SNHA 3PZDA 2ROZB 1MAIA 2I5FA 3BJIA 4WSFA 1UPRA 2CODA 5D27A 5C16A 4HAXB 1N3HA 3ZVRA 3G9WA 1GC6A 2W2XC 1Y5OA 1NTYA 2NZ8B 2K00A 2D9ZA 3IVFA 4MT7A 3SYXA 1Z87A 5D3VA 2Y7BA 1K5DB 4CHJA 4WJ7A 3SO6A 2MKRA 1NI2A 1XD4A 4YL8A 1WJMA 2K2JA 2W2WA 3O96A 2AL6A 1J19A 1V5PA 2I5CA 3V5WA 2HE7A 3UZTA 1XX0A 2RSGA 4YONA 5KQ4A 2RLOA 2LULA 3SV1A 2J0MA 2GJYA 2LOXA 3X23A 2R0DA 3U7DA 3PVWA 2DTCA 4K2PA 1ZVRA 1BTKA 2D2QA 4HAZB 2DFKA 5C5BA 3AJ4A 3M1IB 2LKOA 5GOWB 4A5KA 1EGXA 1M7EA 1U2BA 2N0YA 3FEHA 2V76A 4Y94A 2D4QA 2J0KA 1W1DA 1FHOA 1IRSA 3D8FA 5D3XA 2GS0A 3A8PA 2OTXA
chains in the Genus database with same CATH superfamily
3ODWA 1ZC4B 2L1CA 4KHBB 4DX90 4ZRJA 4EJNA 5JLJB 1V5UA 3DXCA 1FB8A 2NMBA 4HSIA 2YS1A 2UVMA 2P0HA 2GCJA 2I1KA 3MDBC 3OHMB 4GOUA 5KQ1A 2DX1A 4HAWB 4B6HA 1KZGA 3P7ZA 3FM8C 1Q67A 4D0NB 2ELBA 5LOPB 2LOZA 5J3QA 3SUZA 5C5BB 2KCJA 2KIGA 1FOEA 3GYPA 3T06A 2HTHB 3PEGA 4GN1A 3OANA 1DDMA 4QJ3B 4XWXA 1X11A 2P8VA 3AU5A 2YF0A 3PG7A 4IOYX 2KR0A 2RGNB 1U5GA 1ISNA 4A6FB 2Z13A 1SHCA 1SGHA 4MY6A 1P3RA 1V88A 1ZSQA 1U5DA 2CAYA 2COFA 1UNRA 1EVHA 3VIAA 2RNRB 3WYFB 2CY5A 2MFQA 4NY0A 1X86A 2Z0QA 3KRWA 4BBKA 1X1GA 1WG7A 3D8DA 1DBHA 5DHFB 1OY2A 1QC6A 2RUKB 2FJLA 1J0WA 1ZC3B 5EFXA 1FGZA 1MIXA 2DN6A 3DXDA 2DHKA 1DDWA 2D9XA 2AEHA 5C79A 2UZRA 2ELAA 2EMTA 3A58A 4OSNA 4IFSA 3RCPA 4HAYB 3A98B 2VRWB 1QQGA 4F7GA 3NWAA 4P7IA 2UZSA 4A6HA 1I7AA 1TJ6A 4C0AA 1WVHA 2Z59A 3KSYA 2RVBB 5LG4B 4EMOA 4HB3B 2L2IA 1UNQA 2GUMA 2LG1A 4CHMA 3N7CA 5C6RA 1BAKA 2K49A 1E5WA 2W2XD 5DHAB 1UNPA 2ZPYA 3NSUA 4DX8A 1OQNA 5J3TA 2N23A 4PQ0A 4CSQA 4EKUA 4QJ4B 2VKIA 2Y8GA 3HQCA 2E2XA 2Z0PA 4TYZA 1U29A 3F0WA 1EF1A 4KAXB 1U5FA 1P5TA 1GC7A 2FJUB 2M38A 2GCLA 2I1JA 3HIEA 2ZKMX 5L81A 3CXBB 2DKQA 1DYNA 2X18A 1XKEA 1FGYA 2QKMA 3CIKA 2Z4DA 3PVLA 4A6FA 2KGXB 1Y19B 3FSSA 3ODOA 3MPXA 4K81A 4WVFB 1W1HA 1NU2A 2QKLA 2ROVA 1WGQA 2P0FA 5D3WA 3WA0A 1MK9B 1H10A 1MIZB 1X05A 1DROA 1V61A 5JHHA 2LYDA 2H7DA 2EC1A 5M4YB 4HHVA 2MWNB 1U5EA 2EMSA 2H7EA 5JP4A 3QIJA 1KZ7A 1AWEA 2J59M 4KHAA 2K2UA 2Z0OA 4GXBA 1EAZA 1XODA 2COCA 3GYOA 4OT1A 1K5GB 3ML4A 3BINA 2DLWA 1XCGA 4D6WA 1GG3A 5KCVA 3PVUA 1KI1B 4DBBA 3TVVA 1AQCA 1ZYIA 4F7HA 5FI1A 4ZRIA 2D9VA 2K8EA 4IAPA 1PFJA 2XQNM 1MPHA 4K2OA 2EJ8A 3ULBA 1X1FA 5LONB 3QWMA 2YS5A 3VOQA 4GMXB 4PNKA 1V89A 5CLLB 2G35A 2YT0A 1PLSA 3D8EA 3ODXA 4A6KA 3KZ1A 5CLQB 5HE3A 3B77A 2JP2A 1FHXA 3TO1A 1TXDA 2COAA 3HK0A 3AU4A 1V5MA 1T77A 1MI1A 2NBVA 2YS3A 3NWFA 2DYNA 2M14A 5D3YA 2CY4A 2D9YA 2DYQA 2J0JA 2MDXA 2CRFA 1MK7B 1BWNA 1FHWA 5HE2A 3PSCA 1MKEA 4HDQA 2DX5A 1ZM0A 4HB0B 4QJ5B 2P0DA 1UPQA 3LJUX 4CYEA 2YT2A 4GZUA 3TFMA 3PP2A 2YT1A 4GPTB 4TKNA 4GMVA 5I2SA 3ZDTA 1RRPB 2DHIA 1FAOA 3TCAA 3DXEA 2YVCA 4HAUB 4DIXA 3KRXA 1H4RA 1LB1A 4HAVB 4NSWA 2DHJA 3NWDA 5FI0A 1RJ2A 4K17A 1UEFA 2D11A 3A8QA 3DCXA 3P6AA 1B55A 2ADZA 1P6SA 3U8ZA 2OQBA 1WGUA 4H8SA 2IFSA 4HATB 5HE0A 2R09A 1U27A 1LW3A 4HDOA 2YSZA 5HE1A 3HW2B 2Q13A 3F5RA 2VSZA 2IYBA 2Y8FA 4ZRKA 5I2MA 4Z2NA 1I2HA 1OMWA 3QBVB 4HB2B 1BTNA 1DDVA 3FVCA 4DXAB 4KHOA 4Z2MB 1M7RA 5J3YA 2KUPA 1XR0B 4KVGB 2D10A 1TQZA 4HB4B 2PZ1A 5DIFB 3HSAA 5JHGA 3KY9A 4F7UP 2Z14A 2D9WA 5IRSA 2DA0A 2KIEA 3TW1A 2DKPA 1NTVA 1WJ1A 1W1GA 4L6EA 2BCJA 2YRYA 3ULCA 4MK0A 5DH9B 1PMSA 5DI9B 1WI1A 3SNHA 2RRFA 3PZDA 2ROZB 1MAIA 2I5FA 3BJIA 2KUQA 4WSFA 1UPRA 2CODA 5D27A 5C16A 4HAXB 1N3HA 3ZVRA 3G9WA 1GC6A 2W2XC 1Y5OA 1NTYA 2NZ8B 2K00A 2D9ZA 3IVFA 4MT7A 3SYXA 1Z87A 5D3VA 2Y7BA 3NW8A 1K5DB 4CHJA 4WJ7A 3SO6A 2MKRA 1NI2A 1XD4A 4YL8A 1WJMA 2K2JA 4KHBA 2W2WA 3O96A 2AL6A 1J19A 1V5PA 3U12A 2I5CA 3V5WA 2HE7A 3UZTA 1XX0A 2RSGA 4YONA 2R2YA 5KQ4A 2RLOA 4QXAB 2LULA 3SV1A 2J0MA 2GJYA 2LOXA 3X23A 2R0DA 3U7DA 3PVWA 2DTCA 4K2PA 1ZVRA 1BTKA 2D2QA 4HAZB 2DFKA 5C5BA 3AJ4A 3M1IB 2LKOA 5GOWB 4A5KA 1EGXA 1M7EA 1U2BA 2N0YA 3FEHA 2V76A 4Y94A 2D4QA 2J0KA 4L1RA 1W1DA 1FHOA 1IRSA 3D8FA 5D3XA 2GS0A 3A8PA 4GNKB 2OTXA
chains in the Genus database with same CATH topology
3ODWA 1ZC4B 2L1CA 4KHBB 4DX90 4ZRJA 4EJNA 5JLJB 1V5UA 3DXCA 1FB8A 2NMBA 2YS1A 2UVMA 2P0HA 2GCJA 2I1KA 3MDBC 5KQ1A 2DX1A 4HAWB 4B6HA 1KZGA 3P7ZA 3FM8C 1Q67A 4D0NB 2ELBA 5LOPB 2LOZA 5J3QA 3SUZA 5C5BB 2KCJA 1FOEA 3GYPA 3T06A 2HTHB 3PEGA 4GN1A 3OANA 1DDMA 4XWXA 1X11A 2P8VA 3AU5A 2YF0A 3PG7A 4IOYX 2RGNB 1U5GA 1ISNA 4A6FB 1SHCA 1SGHA 4MY6A 1P3RA 1V88A 1ZSQA 1U5DA 2CAYA 2COFA 1UNRA 1EVHA 3VIAA 2RNRB 3WYFB 2CY5A 2MFQA 4NY0A 1X86A 2Z0QA 3KRWA 4BBKA 1X1GA 1WG7A 3D8DA 1DBHA 5DHFB 1OY2A 1QC6A 2RUKB 2FJLA 1J0WA 1ZC3B 5EFXA 1FGZA 1MIXA 2DN6A 3DXDA 2DHKA 1DDWA 2D9XA 2AEHA 5C79A 2UZRA 2ELAA 2EMTA 4IFSA 3RCPA 4HAYB 3A98B 2VRWB 1QQGA 4F7GA 4P7IA 2UZSA 4A6HA 1I7AA 1TJ6A 4C0AA 1WVHA 3KSYA 2RVBB 4EMOA 4HB3B 2L2IA 1UNQA 2LG1A 4CHMA 3N7CA 5C6RA 1BAKA 1E5WA 2W2XD 5DHAB 1UNPA 2ZPYA 3NSUA 4DX8A 1OQNA 5J3TA 2N23A 4PQ0A 4EKUA 2VKIA 2Y8GA 3HQCA 2E2XA 2Z0PA 4TYZA 1U29A 3F0WA 1EF1A 4KAXB 1U5FA 1P5TA 1GC7A 2M38A 2GCLA 2I1JA 5L81A 3CXBB 2DKQA 1DYNA 2X18A 1XKEA 1FGYA 2QKMA 3CIKA 3PVLA 4A6FA 2KGXB 1Y19B 3FSSA 3ODOA 3MPXA 4K81A 4WVFB 1W1HA 1NU2A 2QKLA 2ROVA 1WGQA 2P0FA 5D3WA 3WA0A 1MK9B 1H10A 1MIZB 1X05A 1DROA 1V61A 5JHHA 2LYDA 2H7DA 2EC1A 4HHVA 2MWNB 1U5EA 2EMSA 2H7EA 5JP4A 3QIJA 1KZ7A 1AWEA 2J59M 4KHAA 2K2UA 2Z0OA 4GXBA 1EAZA 1XODA 2COCA 3GYOA 1K5GB 3ML4A 3BINA 2DLWA 1XCGA 1GG3A 5KCVA 3PVUA 1KI1B 4DBBA 3TVVA 1AQCA 4F7HA 5FI1A 4ZRIA 2D9VA 4IAPA 1PFJA 2XQNM 1MPHA 4K2OA 2EJ8A 3ULBA 1X1FA 5LONB 3QWMA 2YS5A 3VOQA 4GMXB 4PNKA 1V89A 5CLLB 2G35A 2YT0A 1PLSA 3D8EA 3ODXA 4A6KA 3KZ1A 5CLQB 5HE3A 2JP2A 1FHXA 3TO1A 1TXDA 2COAA 3HK0A 3AU4A 1V5MA 2YS3A 2DYNA 2M14A 5D3YA 2CY4A 2D9YA 2DYQA 2J0JA 2MDXA 2CRFA 1MK7B 1BWNA 1FHWA 5HE2A 3PSCA 1MKEA 4HDQA 2DX5A 1ZM0A 4HB0B 2P0DA 1UPQA 3LJUX 4CYEA 4GZUA 3TFMA 3PP2A 2YT1A 4GPTB 4TKNA 4GMVA 3ZDTA 1RRPB 2DHIA 1FAOA 3TCAA 3DXEA 2YVCA 4HAUB 3KRXA 1H4RA 1LB1A 4HAVB 4NSWA 2DHJA 5FI0A 1RJ2A 4K17A 1UEFA 2D11A 3A8QA 3P6AA 1B55A 2ADZA 1P6SA 3U8ZA 2OQBA 1WGUA 4H8SA 2IFSA 4HATB 5HE0A 2R09A 1U27A 1LW3A 4HDOA 2YSZA 5HE1A 3HW2B 2Q13A 3F5RA 2VSZA 2IYBA 2Y8FA 4ZRKA 4Z2NA 1I2HA 1OMWA 3QBVB 4HB2B 1BTNA 1DDVA 4DXAB 4KHOA 4Z2MB 1M7RA 5J3YA 2KUPA 1XR0B 4KVGB 2D10A 1TQZA 4HB4B 2PZ1A 5DIFB 5JHGA 3KY9A 4F7UP 2D9WA 2DA0A 3TW1A 2DKPA 1NTVA 1WJ1A 1W1GA 4L6EA 2BCJA 2YRYA 3ULCA 4MK0A 5DH9B 1PMSA 5DI9B 1WI1A 3SNHA 3PZDA 2ROZB 1MAIA 2I5FA 3BJIA 4WSFA 1UPRA 2CODA 5D27A 5C16A 4HAXB 1N3HA 3ZVRA 3G9WA 1GC6A 2W2XC 1Y5OA 1NTYA 2NZ8B 2K00A 2D9ZA 3IVFA 4MT7A 3SYXA 1Z87A 5D3VA 2Y7BA 1K5DB 4CHJA 4WJ7A 3SO6A 2MKRA 1NI2A 1XD4A 4YL8A 1WJMA 2K2JA 2W2WA 3O96A 2AL6A 1J19A 1V5PA 2I5CA 3V5WA 2HE7A 3UZTA 1XX0A 2RSGA 4YONA 5KQ4A 2RLOA 2LULA 3SV1A 2J0MA 2GJYA 2LOXA 3X23A 2R0DA 3U7DA 3PVWA 2DTCA 4K2PA 1ZVRA 1BTKA 2D2QA 4HAZB 2DFKA 5C5BA 3AJ4A 3M1IB 2LKOA 5GOWB 4A5KA 1EGXA 1M7EA 1U2BA 2N0YA 3FEHA 2V76A 4Y94A 2D4QA 2J0KA 1W1DA 1FHOA 1IRSA 3D8FA 5D3XA 2GS0A 3A8PA 2OTXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ODW A;  1ZC4 B;  2L1C A;  4KHB B;  4DX9 0;  4ZRJ A;  4EJN A;  5JLJ B;  1V5U A;  3DXC A;  1FB8 A;  2NMB A;  2YS1 A;  2UVM A;  2P0H A;  2GCJ A;  2I1K A;  3MDB C;  5KQ1 A;  2DX1 A;  4HAW B;  4B6H A;  1KZG A;  3P7Z A;  3FM8 C;  1Q67 A;  4D0N B;  2ELB A;  5LOP B;  2LOZ A;  5J3Q A;  3SUZ A;  5C5B B;  2KCJ A;  1FOE A;  3GYP A;  3T06 A;  2HTH B;  3PEG A;  4GN1 A;  3OAN A;  1DDM A;  4XWX A;  1X11 A;  2P8V A;  3AU5 A;  2YF0 A;  3PG7 A;  4IOY X;  2RGN B;  1U5G A;  1ISN A;  4A6F B;  1SHC A;  1SGH A;  4MY6 A;  1P3R A;  1V88 A;  1ZSQ A;  1U5D A;  2CAY A;  2COF A;  1UNR A;  1EVH A;  3VIA A;  2RNR B;  3WYF B;  2CY5 A;  2MFQ A;  4NY0 A;  1X86 A;  2Z0Q A;  3KRW A;  4BBK A;  1X1G A;  1WG7 A;  3D8D A;  1DBH A;  5DHF B;  1OY2 A;  1QC6 A;  2RUK B;  2FJL A;  1J0W A;  1ZC3 B;  5EFX A;  1FGZ A;  1MIX A;  2DN6 A;  3DXD A;  2DHK A;  1DDW A;  2D9X A;  2AEH A;  5C79 A;  2UZR A;  2ELA A;  2EMT A;  4IFS A;  3RCP A;  4HAY B;  3A98 B;  2VRW B;  1QQG A;  4F7G A;  4P7I A;  2UZS A;  4A6H A;  1I7A A;  1TJ6 A;  4C0A A;  1WVH A;  3KSY A;  2RVB B;  4EMO A;  4HB3 B;  2L2I A;  1UNQ A;  2LG1 A;  4CHM A;  3N7C A;  5C6R A;  1BAK A;  1E5W A;  2W2X D;  5DHA B;  1UNP A;  2ZPY A;  3NSU A;  4DX8 A;  1OQN A;  5J3T A;  2N23 A;  4PQ0 A;  4EKU A;  2VKI A;  2Y8G A;  3HQC A;  2E2X A;  2Z0P A;  4TYZ A;  1U29 A;  3F0W A;  1EF1 A;  4KAX B;  1U5F A;  1P5T A;  1GC7 A;  2M38 A;  2GCL A;  2I1J A;  5L81 A;  3CXB B;  2DKQ A;  1DYN A;  2X18 A;  1XKE A;  1FGY A;  2QKM A;  3CIK A;  3PVL A;  4A6F A;  2KGX B;  1Y19 B;  3FSS A;  3ODO A;  3MPX A;  4K81 A;  4WVF B;  1W1H A;  1NU2 A;  2QKL A;  2ROV A;  1WGQ A;  2P0F A;  5D3W A;  3WA0 A;  1MK9 B;  1H10 A;  1MIZ B;  1X05 A;  1DRO A;  1V61 A;  5JHH A;  2LYD A;  2H7D A;  2EC1 A;  4HHV A;  2MWN B;  1U5E A;  2EMS A;  2H7E A;  5JP4 A;  3QIJ A;  1KZ7 A;  1AWE A;  2J59 M;  4KHA A;  2K2U A;  2Z0O A;  4GXB A;  1EAZ A;  1XOD A;  2COC A;  3GYO A;  1K5G B;  3ML4 A;  3BIN A;  2DLW A;  1XCG A;  1GG3 A;  5KCV A;  3PVU A;  1KI1 B;  4DBB A;  3TVV A;  1AQC A;  4F7H A;  5FI1 A;  4ZRI A;  2D9V A;  4IAP A;  1PFJ A;  2XQN M;  1MPH A;  4K2O A;  2EJ8 A;  3ULB A;  1X1F A;  5LON B;  3QWM A;  2YS5 A;  3VOQ A;  4GMX B;  4PNK A;  1V89 A;  5CLL B;  2G35 A;  2YT0 A;  1PLS A;  3D8E A;  3ODX A;  4A6K A;  3KZ1 A;  5CLQ B;  5HE3 A;  2JP2 A;  1FHX A;  3TO1 A;  1TXD A;  2COA A;  3HK0 A;  3AU4 A;  1V5M A;  2YS3 A;  2DYN A;  2M14 A;  5D3Y A;  2CY4 A;  2D9Y A;  2DYQ A;  2J0J A;  2MDX A;  2CRF A;  1MK7 B;  1BWN A;  1FHW A;  5HE2 A;  3PSC A;  1MKE A;  4HDQ A;  2DX5 A;  1ZM0 A;  4HB0 B;  2P0D A;  1UPQ A;  3LJU X;  4CYE A;  4GZU A;  3TFM A;  3PP2 A;  2YT1 A;  4GPT B;  4TKN A;  4GMV A;  3ZDT A;  1RRP B;  2DHI A;  1FAO A;  3TCA A;  3DXE A;  2YVC A;  4HAU B;  3KRX A;  1H4R A;  1LB1 A;  4HAV B;  4NSW A;  2DHJ A;  5FI0 A;  1RJ2 A;  4K17 A;  1UEF A;  2D11 A;  3A8Q A;  3P6A A;  1B55 A;  2ADZ A;  1P6S A;  3U8Z A;  2OQB A;  1WGU A;  4H8S A;  2IFS A;  4HAT B;  5HE0 A;  2R09 A;  1U27 A;  1LW3 A;  4HDO A;  2YSZ A;  5HE1 A;  3HW2 B;  2Q13 A;  3F5R A;  2VSZ A;  2IYB A;  2Y8F A;  4ZRK A;  4Z2N A;  1I2H A;  1OMW A;  3QBV B;  4HB2 B;  1BTN A;  1DDV A;  4DXA B;  4KHO A;  4Z2M B;  1M7R A;  5J3Y A;  2KUP A;  1XR0 B;  4KVG B;  2D10 A;  1TQZ A;  4HB4 B;  2PZ1 A;  5DIF B;  5JHG A;  3KY9 A;  4F7U P;  2D9W A;  2DA0 A;  3TW1 A;  2DKP A;  1NTV A;  1WJ1 A;  1W1G A;  4L6E A;  2BCJ A;  2YRY A;  3ULC A;  4MK0 A;  5DH9 B;  1PMS A;  5DI9 B;  1WI1 A;  3SNH A;  3PZD A;  2ROZ B;  1MAI A;  2I5F A;  3BJI A;  4WSF A;  1UPR A;  2COD A;  5D27 A;  5C16 A;  4HAX B;  1N3H A;  3ZVR A;  3G9W A;  1GC6 A;  2W2X C;  1Y5O A;  1NTY A;  2NZ8 B;  2K00 A;  2D9Z A;  3IVF A;  4MT7 A;  3SYX A;  1Z87 A;  5D3V A;  2Y7B A;  1K5D B;  4CHJ A;  4WJ7 A;  3SO6 A;  2MKR A;  1NI2 A;  1XD4 A;  4YL8 A;  1WJM A;  2K2J A;  2W2W A;  3O96 A;  2AL6 A;  1J19 A;  1V5P A;  2I5C A;  3V5W A;  2HE7 A;  3UZT A;  1XX0 A;  2RSG A;  4YON A;  5KQ4 A;  2RLO A;  2LUL A;  3SV1 A;  2J0M A;  2GJY A;  2LOX A;  3X23 A;  2R0D A;  3U7D A;  3PVW A;  2DTC A;  4K2P A;  1ZVR A;  1BTK A;  2D2Q A;  4HAZ B;  2DFK A;  5C5B A;  3AJ4 A;  3M1I B;  2LKO A;  5GOW B;  4A5K A;  1EGX A;  1M7E A;  1U2B A;  2N0Y A;  3FEH A;  2V76 A;  4Y94 A;  2D4Q A;  2J0K A;  1W1D A;  1FHO A;  1IRS A;  3D8F A;  5D3X A;  2GS0 A;  3A8P A;  2OTX A; 
#chains in the Genus database with same CATH topology
 3ODW A;  1ZC4 B;  2L1C A;  4KHB B;  4DX9 0;  4ZRJ A;  4EJN A;  5JLJ B;  1V5U A;  3DXC A;  1FB8 A;  2NMB A;  4HSI A;  2YS1 A;  2UVM A;  2P0H A;  2GCJ A;  2I1K A;  3MDB C;  3OHM B;  4GOU A;  5KQ1 A;  2DX1 A;  4HAW B;  4B6H A;  1KZG A;  3P7Z A;  3FM8 C;  1Q67 A;  4D0N B;  2ELB A;  5LOP B;  2LOZ A;  5J3Q A;  3SUZ A;  5C5B B;  2KCJ A;  2KIG A;  1FOE A;  3GYP A;  3T06 A;  2HTH B;  3PEG A;  4GN1 A;  3OAN A;  1DDM A;  4QJ3 B;  4XWX A;  1X11 A;  2P8V A;  3AU5 A;  2YF0 A;  3PG7 A;  4IOY X;  2KR0 A;  2RGN B;  1U5G A;  1ISN A;  4A6F B;  2Z13 A;  1SHC A;  1SGH A;  4MY6 A;  1P3R A;  1V88 A;  1ZSQ A;  1U5D A;  2CAY A;  2COF A;  1UNR A;  1EVH A;  3VIA A;  2RNR B;  3WYF B;  2CY5 A;  2MFQ A;  4NY0 A;  1X86 A;  2Z0Q A;  3KRW A;  4BBK A;  1X1G A;  1WG7 A;  3D8D A;  1DBH A;  5DHF B;  1OY2 A;  1QC6 A;  2RUK B;  2FJL A;  1J0W A;  1ZC3 B;  5EFX A;  1FGZ A;  1MIX A;  2DN6 A;  3DXD A;  2DHK A;  1DDW A;  2D9X A;  2AEH A;  5C79 A;  2UZR A;  2ELA A;  2EMT A;  3A58 A;  4OSN A;  4IFS A;  3RCP A;  4HAY B;  3A98 B;  2VRW B;  1QQG A;  4F7G A;  3NWA A;  4P7I A;  2UZS A;  4A6H A;  1I7A A;  1TJ6 A;  4C0A A;  1WVH A;  2Z59 A;  3KSY A;  2RVB B;  5LG4 B;  4EMO A;  4HB3 B;  2L2I A;  1UNQ A;  2GUM A;  2LG1 A;  4CHM A;  3N7C A;  5C6R A;  1BAK A;  2K49 A;  1E5W A;  2W2X D;  5DHA B;  1UNP A;  2ZPY A;  3NSU A;  4DX8 A;  1OQN A;  5J3T A;  2N23 A;  4PQ0 A;  4CSQ A;  4EKU A;  4QJ4 B;  2VKI A;  2Y8G A;  3HQC A;  2E2X A;  2Z0P A;  4TYZ A;  1U29 A;  3F0W A;  1EF1 A;  4KAX B;  1U5F A;  1P5T A;  1GC7 A;  2FJU B;  2M38 A;  2GCL A;  2I1J A;  3HIE A;  2ZKM X;  5L81 A;  3CXB B;  2DKQ A;  1DYN A;  2X18 A;  1XKE A;  1FGY A;  2QKM A;  3CIK A;  2Z4D A;  3PVL A;  4A6F A;  2KGX B;  1Y19 B;  3FSS A;  3ODO A;  3MPX A;  4K81 A;  4WVF B;  1W1H A;  1NU2 A;  2QKL A;  2ROV A;  1WGQ A;  2P0F A;  5D3W A;  3WA0 A;  1MK9 B;  1H10 A;  1MIZ B;  1X05 A;  1DRO A;  1V61 A;  5JHH A;  2LYD A;  2H7D A;  2EC1 A;  5M4Y B;  4HHV A;  2MWN B;  1U5E A;  2EMS A;  2H7E A;  5JP4 A;  3QIJ A;  1KZ7 A;  1AWE A;  2J59 M;  4KHA A;  2K2U A;  2Z0O A;  4GXB A;  1EAZ A;  1XOD A;  2COC A;  3GYO A;  4OT1 A;  1K5G B;  3ML4 A;  3BIN A;  2DLW A;  1XCG A;  4D6W A;  1GG3 A;  5KCV A;  3PVU A;  1KI1 B;  4DBB A;  3TVV A;  1AQC A;  1ZYI A;  4F7H A;  5FI1 A;  4ZRI A;  2D9V A;  2K8E A;  4IAP A;  1PFJ A;  2XQN M;  1MPH A;  4K2O A;  2EJ8 A;  3ULB A;  1X1F A;  5LON B;  3QWM A;  2YS5 A;  3VOQ A;  4GMX B;  4PNK A;  1V89 A;  5CLL B;  2G35 A;  2YT0 A;  1PLS A;  3D8E A;  3ODX A;  4A6K A;  3KZ1 A;  5CLQ B;  5HE3 A;  3B77 A;  2JP2 A;  1FHX A;  3TO1 A;  1TXD A;  2COA A;  3HK0 A;  3AU4 A;  1V5M A;  1T77 A;  1MI1 A;  2NBV A;  2YS3 A;  3NWF A;  2DYN A;  2M14 A;  5D3Y A;  2CY4 A;  2D9Y A;  2DYQ A;  2J0J A;  2MDX A;  2CRF A;  1MK7 B;  1BWN A;  1FHW A;  5HE2 A;  3PSC A;  1MKE A;  4HDQ A;  2DX5 A;  1ZM0 A;  4HB0 B;  4QJ5 B;  2P0D A;  1UPQ A;  3LJU X;  4CYE A;  2YT2 A;  4GZU A;  3TFM A;  3PP2 A;  2YT1 A;  4GPT B;  4TKN A;  4GMV A;  5I2S A;  3ZDT A;  1RRP B;  2DHI A;  1FAO A;  3TCA A;  3DXE A;  2YVC A;  4HAU B;  4DIX A;  3KRX A;  1H4R A;  1LB1 A;  4HAV B;  4NSW A;  2DHJ A;  3NWD A;  5FI0 A;  1RJ2 A;  4K17 A;  1UEF A;  2D11 A;  3A8Q A;  3DCX A;  3P6A A;  1B55 A;  2ADZ A;  1P6S A;  3U8Z A;  2OQB A;  1WGU A;  4H8S A;  2IFS A;  4HAT B;  5HE0 A;  2R09 A;  1U27 A;  1LW3 A;  4HDO A;  2YSZ A;  5HE1 A;  3HW2 B;  2Q13 A;  3F5R A;  2VSZ A;  2IYB A;  2Y8F A;  4ZRK A;  5I2M A;  4Z2N A;  1I2H A;  1OMW A;  3QBV B;  4HB2 B;  1BTN A;  1DDV A;  3FVC A;  4DXA B;  4KHO A;  4Z2M B;  1M7R A;  5J3Y A;  2KUP A;  1XR0 B;  4KVG B;  2D10 A;  1TQZ A;  4HB4 B;  2PZ1 A;  5DIF B;  3HSA A;  5JHG A;  3KY9 A;  4F7U P;  2Z14 A;  2D9W A;  5IRS A;  2DA0 A;  2KIE A;  3TW1 A;  2DKP A;  1NTV A;  1WJ1 A;  1W1G A;  4L6E A;  2BCJ A;  2YRY A;  3ULC A;  4MK0 A;  5DH9 B;  1PMS A;  5DI9 B;  1WI1 A;  3SNH A;  2RRF A;  3PZD A;  2ROZ B;  1MAI A;  2I5F A;  3BJI A;  2KUQ A;  4WSF A;  1UPR A;  2COD A;  5D27 A;  5C16 A;  4HAX B;  1N3H A;  3ZVR A;  3G9W A;  1GC6 A;  2W2X C;  1Y5O A;  1NTY A;  2NZ8 B;  2K00 A;  2D9Z A;  3IVF A;  4MT7 A;  3SYX A;  1Z87 A;  5D3V A;  2Y7B A;  3NW8 A;  1K5D B;  4CHJ A;  4WJ7 A;  3SO6 A;  2MKR A;  1NI2 A;  1XD4 A;  4YL8 A;  1WJM A;  2K2J A;  4KHB A;  2W2W A;  3O96 A;  2AL6 A;  1J19 A;  1V5P A;  3U12 A;  2I5C A;  3V5W A;  2HE7 A;  3UZT A;  1XX0 A;  2RSG A;  4YON A;  2R2Y A;  5KQ4 A;  2RLO A;  4QXA B;  2LUL A;  3SV1 A;  2J0M A;  2GJY A;  2LOX A;  3X23 A;  2R0D A;  3U7D A;  3PVW A;  2DTC A;  4K2P A;  1ZVR A;  1BTK A;  2D2Q A;  4HAZ B;  2DFK A;  5C5B A;  3AJ4 A;  3M1I B;  2LKO A;  5GOW B;  4A5K A;  1EGX A;  1M7E A;  1U2B A;  2N0Y A;  3FEH A;  2V76 A;  4Y94 A;  2D4Q A;  2J0K A;  4L1R A;  1W1D A;  1FHO A;  1IRS A;  3D8F A;  5D3X A;  2GS0 A;  3A8P A;  4GNK B;  2OTX A; 
#chains in the Genus database with same CATH homology
 3ODW A;  1ZC4 B;  2L1C A;  4KHB B;  4DX9 0;  4ZRJ A;  4EJN A;  5JLJ B;  1V5U A;  3DXC A;  1FB8 A;  2NMB A;  2YS1 A;  2UVM A;  2P0H A;  2GCJ A;  2I1K A;  3MDB C;  5KQ1 A;  2DX1 A;  4HAW B;  4B6H A;  1KZG A;  3P7Z A;  3FM8 C;  1Q67 A;  4D0N B;  2ELB A;  5LOP B;  2LOZ A;  5J3Q A;  3SUZ A;  5C5B B;  2KCJ A;  1FOE A;  3GYP A;  3T06 A;  2HTH B;  3PEG A;  4GN1 A;  3OAN A;  1DDM A;  4XWX A;  1X11 A;  2P8V A;  3AU5 A;  2YF0 A;  3PG7 A;  4IOY X;  2RGN B;  1U5G A;  1ISN A;  4A6F B;  1SHC A;  1SGH A;  4MY6 A;  1P3R A;  1V88 A;  1ZSQ A;  1U5D A;  2CAY A;  2COF A;  1UNR A;  1EVH A;  3VIA A;  2RNR B;  3WYF B;  2CY5 A;  2MFQ A;  4NY0 A;  1X86 A;  2Z0Q A;  3KRW A;  4BBK A;  1X1G A;  1WG7 A;  3D8D A;  1DBH A;  5DHF B;  1OY2 A;  1QC6 A;  2RUK B;  2FJL A;  1J0W A;  1ZC3 B;  5EFX A;  1FGZ A;  1MIX A;  2DN6 A;  3DXD A;  2DHK A;  1DDW A;  2D9X A;  2AEH A;  5C79 A;  2UZR A;  2ELA A;  2EMT A;  4IFS A;  3RCP A;  4HAY B;  3A98 B;  2VRW B;  1QQG A;  4F7G A;  4P7I A;  2UZS A;  4A6H A;  1I7A A;  1TJ6 A;  4C0A A;  1WVH A;  3KSY A;  2RVB B;  4EMO A;  4HB3 B;  2L2I A;  1UNQ A;  2LG1 A;  4CHM A;  3N7C A;  5C6R A;  1BAK A;  1E5W A;  2W2X D;  5DHA B;  1UNP A;  2ZPY A;  3NSU A;  4DX8 A;  1OQN A;  5J3T A;  2N23 A;  4PQ0 A;  4EKU A;  2VKI A;  2Y8G A;  3HQC A;  2E2X A;  2Z0P A;  4TYZ A;  1U29 A;  3F0W A;  1EF1 A;  4KAX B;  1U5F A;  1P5T A;  1GC7 A;  2M38 A;  2GCL A;  2I1J A;  5L81 A;  3CXB B;  2DKQ A;  1DYN A;  2X18 A;  1XKE A;  1FGY A;  2QKM A;  3CIK A;  3PVL A;  4A6F A;  2KGX B;  1Y19 B;  3FSS A;  3ODO A;  3MPX A;  4K81 A;  4WVF B;  1W1H A;  1NU2 A;  2QKL A;  2ROV A;  1WGQ A;  2P0F A;  5D3W A;  3WA0 A;  1MK9 B;  1H10 A;  1MIZ B;  1X05 A;  1DRO A;  1V61 A;  5JHH A;  2LYD A;  2H7D A;  2EC1 A;  4HHV A;  2MWN B;  1U5E A;  2EMS A;  2H7E A;  5JP4 A;  3QIJ A;  1KZ7 A;  1AWE A;  2J59 M;  4KHA A;  2K2U A;  2Z0O A;  4GXB A;  1EAZ A;  1XOD A;  2COC A;  3GYO A;  1K5G B;  3ML4 A;  3BIN A;  2DLW A;  1XCG A;  1GG3 A;  5KCV A;  3PVU A;  1KI1 B;  4DBB A;  3TVV A;  1AQC A;  4F7H A;  5FI1 A;  4ZRI A;  2D9V A;  4IAP A;  1PFJ A;  2XQN M;  1MPH A;  4K2O A;  2EJ8 A;  3ULB A;  1X1F A;  5LON B;  3QWM A;  2YS5 A;  3VOQ A;  4GMX B;  4PNK A;  1V89 A;  5CLL B;  2G35 A;  2YT0 A;  1PLS A;  3D8E A;  3ODX A;  4A6K A;  3KZ1 A;  5CLQ B;  5HE3 A;  2JP2 A;  1FHX A;  3TO1 A;  1TXD A;  2COA A;  3HK0 A;  3AU4 A;  1V5M A;  2YS3 A;  2DYN A;  2M14 A;  5D3Y A;  2CY4 A;  2D9Y A;  2DYQ A;  2J0J A;  2MDX A;  2CRF A;  1MK7 B;  1BWN A;  1FHW A;  5HE2 A;  3PSC A;  1MKE A;  4HDQ A;  2DX5 A;  1ZM0 A;  4HB0 B;  2P0D A;  1UPQ A;  3LJU X;  4CYE A;  4GZU A;  3TFM A;  3PP2 A;  2YT1 A;  4GPT B;  4TKN A;  4GMV A;  3ZDT A;  1RRP B;  2DHI A;  1FAO A;  3TCA A;  3DXE A;  2YVC A;  4HAU B;  3KRX A;  1H4R A;  1LB1 A;  4HAV B;  4NSW A;  2DHJ A;  5FI0 A;  1RJ2 A;  4K17 A;  1UEF A;  2D11 A;  3A8Q A;  3P6A A;  1B55 A;  2ADZ A;  1P6S A;  3U8Z A;  2OQB A;  1WGU A;  4H8S A;  2IFS A;  4HAT B;  5HE0 A;  2R09 A;  1U27 A;  1LW3 A;  4HDO A;  2YSZ A;  5HE1 A;  3HW2 B;  2Q13 A;  3F5R A;  2VSZ A;  2IYB A;  2Y8F A;  4ZRK A;  4Z2N A;  1I2H A;  1OMW A;  3QBV B;  4HB2 B;  1BTN A;  1DDV A;  4DXA B;  4KHO A;  4Z2M B;  1M7R A;  5J3Y A;  2KUP A;  1XR0 B;  4KVG B;  2D10 A;  1TQZ A;  4HB4 B;  2PZ1 A;  5DIF B;  5JHG A;  3KY9 A;  4F7U P;  2D9W A;  2DA0 A;  3TW1 A;  2DKP A;  1NTV A;  1WJ1 A;  1W1G A;  4L6E A;  2BCJ A;  2YRY A;  3ULC A;  4MK0 A;  5DH9 B;  1PMS A;  5DI9 B;  1WI1 A;  3SNH A;  3PZD A;  2ROZ B;  1MAI A;  2I5F A;  3BJI A;  4WSF A;  1UPR A;  2COD A;  5D27 A;  5C16 A;  4HAX B;  1N3H A;  3ZVR A;  3G9W A;  1GC6 A;  2W2X C;  1Y5O A;  1NTY A;  2NZ8 B;  2K00 A;  2D9Z A;  3IVF A;  4MT7 A;  3SYX A;  1Z87 A;  5D3V A;  2Y7B A;  1K5D B;  4CHJ A;  4WJ7 A;  3SO6 A;  2MKR A;  1NI2 A;  1XD4 A;  4YL8 A;  1WJM A;  2K2J A;  2W2W A;  3O96 A;  2AL6 A;  1J19 A;  1V5P A;  2I5C A;  3V5W A;  2HE7 A;  3UZT A;  1XX0 A;  2RSG A;  4YON A;  5KQ4 A;  2RLO A;  2LUL A;  3SV1 A;  2J0M A;  2GJY A;  2LOX A;  3X23 A;  2R0D A;  3U7D A;  3PVW A;  2DTC A;  4K2P A;  1ZVR A;  1BTK A;  2D2Q A;  4HAZ B;  2DFK A;  5C5B A;  3AJ4 A;  3M1I B;  2LKO A;  5GOW B;  4A5K A;  1EGX A;  1M7E A;  1U2B A;  2N0Y A;  3FEH A;  2V76 A;  4Y94 A;  2D4Q A;  2J0K A;  1W1D A;  1FHO A;  1IRS A;  3D8F A;  5D3X A;  2GS0 A;  3A8P A;  2OTX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...