3CXBB

Crystal structure of sifa and skip
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
103
structure length
103
Chain Sequence
TKEGMLHYKAGTSYLGKEHWKTCFVVLSNGILYQYPDRTDVIPLLSVNMGGEQCGGCRRANTTDRPHAFQVILSDRPCLELSAESEAEMAEWMQHLCQAVSKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Protein sifA
publication title Structure and function of Salmonella SifA indicate that its interactions with SKIP, SseJ, and RhoA family GTPases induce endosomal tubulation
pubmed doi rcsb
source organism Salmonella typhimurium
molecule tags Signaling protein
total genus 16
structure length 103
sequence length 103
ec nomenclature
pdb deposition date 2008-04-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 3cxbB00
1UPRA 2G35A 4NSWA 2DTCA 1U27A 3ULBA 5C6RA 5HE0A 2YF0A 3FEHA 1X1GA 3CXBB 1X11A 2J0JA 4BBKA 3T06A 1Y19B 2LOZA 2QKLA 4A6HA 2HTHB 3KY9A 1J0WA 1WVHA 2YS3A 5EFXA 2D9YA 1U2BA 3DXEA 2DN6A 2DFKA 4EKUA 1EF1A 1M7EA 4GMVA 3OANA 3TCAA 3PVWA 2RGNB 3ZVRA 4KVGB 2DKQA 2Z0QA 3G9WA 2RLOA 2D2QA 2YT0A 1MKEA 5KQ1A 5C5BB 2YRYA 3F5RA 1V88A 2HE7A 2CRFA 1DDVA 3AJ4A 2RSGA 3KSYA 3PSCA 2EC1A 4HAXB 2ELAA 4PNKA 5JHHA 2YT1A 2VRWB 2Z0PA 5CLLB 2YS1A 3ULCA 3ODXA 2DKPA 1FOEA 3A98B 2DHJA 2LOXA 5DHFB 1V5UA 5LOPB 2LKOA 1I2HA 2QKMA 1TQZA 2P0FA 2M14A 3U8ZA 4B6HA 4HAVB 2KGXB 1ZC3B 2Y8FA 4A5KA 1BAKA 4GN1A 1UEFA 3BINA 3D8EA 1UNPA 4HB2B 1X1FA 2D9WA 2P0HA 1DDMA 2COFA 4GXBA 1J19A 1FGZA 2CODA 2OTXA 4MK0A 4MY6A 3HK0A 4DBBA 1UNQA 4HAUB 4Z2MB 2ELBA 4C0AA 2LYDA 3ZDTA 4F7GA 1Q67A 2CY5A 2M38A 1OY2A 2V76A 2JP2A 3QBVB 2ROVA 2X18A 4K2OA 4IOYX 1Y5OA 3X23A 2OQBA 4H8SA 1AWEA 4DX8A 3M1IB 1NTVA 5JP4A 2D10A 3HW2B 1XCGA 4HAZB 2E2XA 1U5GA 2ROZB 4TKNA 3N7CA 1DYNA 1P5TA 5FI0A 3SUZA 1WJMA 4ZRKA 2D4QA 2COAA 2YSZA 5GOWB 3GYOA 2K2JA 3MPXA 1NI2A 1KZ7A 1MIXA 4MT7A 1WG7A 4HDOA 3WA0A 3V5WA 5J3QA 1BTNA 4NY0A 2LG1A 3IVFA 1PFJA 4F7UP 2H7DA 3QIJA 2W2WA 2L1CA 3DXCA 4IFSA 2EMSA 2VSZA 5FI1A 2ADZA 1P6SA 2RVBB 2UVMA 1B55A 3WYFB 3TVVA 1WJ1A 5D3XA 1XD4A 1Z87A 4EMOA 1XKEA 3FM8C 4KAXB 2DX5A 4K17A 1W1HA 1KZGA 1W1DA 3TW1A 2GCJA 3TO1A 5D3WA 1WI1A 3VIAA 5DHAB 2DA0A 4A6KA 1ZSQA 1U29A 2W2XC 5J3TA 2COCA 3PEGA 3PVUA 4KHBB 2P8VA 4PQ0A 2I5CA 2Q13A 1WGUA 2AL6A 3LJUX 4HB3B 1WGQA 3D8DA 3BJIA 2GS0A 1ZVRA 4IAPA 1GG3A 3VOQA 3KRXA 3CIKA 5DI9B 5L81A 4HAWB 5C5BA 1FHOA 2N23A 2I5FA 1E5WA 3DXDA 1MK7B 2I1JA 1FHXA 5HE1A 1RRPB 2BCJA 1K5DB 2KCJA 4YONA 5C16A 3A8QA 5HE3A 2YS5A 2K2UA 1I7AA 2J59M 4DXAB 4WSFA 3SYXA 4WJ7A 1P3RA 4D0NB 1UNRA 4CYEA 2VKIA 2Y8GA 2EJ8A 1FB8A 1X86A 5JHGA 2MDXA 4P7IA 5LONB 2N0YA 4WVFB 1FHWA 1IRSA 5D3VA 2EMTA 4KHAA 2RUKB 1EGXA 1XR0B 1MK9B 4DX90 1EAZA 1ISNA 3O96A 5KQ4A 2CAYA 2DX1A 1KI1B 2NMBA 4A6FA 1W1GA 1XODA 2J0KA 2J0MA 4HHVA 3PZDA 1NTYA 1RJ2A 1NU2A 4YL8A 1SGHA 4HDQA 2KUPA 3QWMA 3D8FA 4KHOA 4XWXA 3MDBC 1SHCA 2W2XD 1DDWA 1GC6A 1QC6A 1ZM0A 1TJ6A 1LW3A 4CHMA 3ODWA 1V61A 2YVCA 2DYNA 2DLWA 1FAOA 2D9VA 2D9ZA 1TXDA 1V5MA 1BTKA 4HAYB 5C79A 2AEHA 1U5FA 1FGYA 5JLJB 5DIFB 3NSUA 1U5DA 4L6EA 1DROA 1XX0A 3GYPA 4ZRJA 2D11A 1N3HA 1U5EA 3TFMA 1QQGA 1K5GB 4EJNA 2DHIA 4Y94A 2ZPYA 4Z2NA 3KRWA 2CY4A 5D27A 1UPQA 2DHKA 1GC7A 1M7RA 3HQCA 4K81A 2RNRB 2D9XA 2P0DA 3ODOA 3AU5A 4HATB 3SV1A 2MFQA 2MKRA 2GCLA 4GMXB 3RCPA 2FJLA 1PLSA 4ZRIA 2XQNM 1LB1A 1PMSA 2Y7BA 4TYZA 1BWNA 1AQCA 1V5PA 3PP2A 3SNHA 1MAIA 4CHJA 1H10A 1V89A 1ZC4B 4GZUA 3U7DA 2UZSA 2K00A 3AU4A 2I1KA 2UZRA 2NZ8B 4A6FB 5D3YA 1H4RA 1OQNA 2DYQA 3F0WA 2LULA 3P6AA 2GJYA 2MWNB 2L2IA 5KCVA 2IFSA 2IYBA 3PG7A 4HB0B 3SO6A 5CLQB 4HB4B 3FSSA 2R09A 5DH9B 3UZTA 4GPTB 1MIZB 1DBHA 1OMWA 5J3YA 1EVHA 2H7EA 3PVLA 3P7ZA 1X05A 2R0DA 3KZ1A 3ML4A 2Z0OA 2PZ1A 4K2PA 5HE2A 4F7HA 1MPHA 3A8PA
chains in the Genus database with same CATH superfamily
1UPRA 2G35A 4NSWA 2Z13A 2DTCA 1U27A 3ULBA 5C6RA 5HE0A 2YF0A 3FEHA 1X1GA 3CXBB 4D6WA 1X11A 2J0JA 4BBKA 3T06A 1Y19B 2LOZA 2QKLA 4A6HA 2HTHB 3KY9A 1J0WA 1WVHA 2YS3A 5EFXA 2D9YA 1U2BA 3DXEA 2DN6A 2DFKA 4EKUA 1EF1A 1M7EA 4GMVA 3OANA 3TCAA 3PVWA 2RGNB 3ZVRA 4KVGB 2DKQA 2Z0QA 3G9WA 2RLOA 2D2QA 2YT0A 1MKEA 5KQ1A 5C5BB 2YRYA 3F5RA 1V88A 2HE7A 2CRFA 1DDVA 3AJ4A 2RSGA 3KSYA 3PSCA 2EC1A 4HAXB 2ELAA 4PNKA 5JHHA 2YT1A 2VRWB 2Z0PA 2KIGA 2Z14A 5CLLB 2YS1A 3ULCA 3ODXA 2DKPA 1FOEA 3A98B 2K8EA 2DHJA 2LOXA 5DHFB 1V5UA 5LOPB 2LKOA 1I2HA 2QKMA 1TQZA 2P0FA 2M14A 3U8ZA 4B6HA 4HAVB 2KGXB 1ZC3B 2Y8FA 4A5KA 1BAKA 4GN1A 1UEFA 3BINA 3D8EA 1UNPA 4HB2B 1X1FA 2D9WA 2P0HA 1DDMA 2COFA 2R2YA 2NBVA 4GXBA 2Z4DA 1J19A 1FGZA 2CODA 2OTXA 4MK0A 4MY6A 4OSNA 3HK0A 4DBBA 1UNQA 4KHBA 4HAUB 4Z2MB 2ELBA 4C0AA 2LYDA 3ZDTA 4F7GA 1Q67A 2CY5A 3DCXA 2M38A 1OY2A 2V76A 2JP2A 3QBVB 2ROVA 2X18A 4K2OA 4IOYX 1Y5OA 3X23A 1T77A 1ZYIA 2OQBA 4GOUA 4H8SA 1AWEA 4DX8A 2Z59A 3M1IB 1NTVA 5JP4A 2D10A 3HW2B 1XCGA 4HAZB 2E2XA 1U5GA 3U12A 2ROZB 4TKNA 3N7CA 1DYNA 1P5TA 5FI0A 3SUZA 1WJMA 4ZRKA 2D4QA 5I2MA 2COAA 2YSZA 5GOWB 3GYOA 2K2JA 3MPXA 1NI2A 1KZ7A 1MIXA 4MT7A 1WG7A 4HDOA 3WA0A 3V5WA 5J3QA 1BTNA 4QJ3B 4NY0A 2GUMA 4QJ4B 2LG1A 3IVFA 1PFJA 4F7UP 2H7DA 2ZKMX 3FVCA 3QIJA 2W2WA 2L1CA 3DXCA 4IFSA 2EMSA 2VSZA 5FI1A 3A58A 2ADZA 1P6SA 2RVBB 2UVMA 1B55A 3WYFB 3TVVA 1WJ1A 5D3XA 1XD4A 2YT2A 1Z87A 4EMOA 4OT1A 1XKEA 3FM8C 3HIEA 4KAXB 2DX5A 4K17A 1W1HA 1KZGA 1W1DA 3TW1A 2GCJA 3TO1A 5D3WA 1WI1A 3VIAA 5DHAB 2DA0A 4A6KA 1ZSQA 1U29A 2W2XC 5J3TA 2COCA 3PEGA 3PVUA 2FJUB 4KHBB 2P8VA 4PQ0A 2I5CA 2Q13A 1WGUA 2AL6A 3LJUX 4HB3B 1WGQA 3D8DA 3BJIA 2GS0A 1ZVRA 2KUQA 4IAPA 1GG3A 3VOQA 3KRXA 3CIKA 5DI9B 5LG4B 5L81A 4HAWB 5C5BA 1FHOA 2N23A 2I5FA 1E5WA 3DXDA 2K49A 1MK7B 2I1JA 1FHXA 5HE1A 3B77A 1RRPB 2BCJA 1K5DB 2KCJA 4YONA 5C16A 3A8QA 5HE3A 2YS5A 2K2UA 1I7AA 2J59M 4DXAB 4WSFA 2KR0A 3SYXA 4WJ7A 1P3RA 4D0NB 1UNRA 4CYEA 2VKIA 2Y8GA 2EJ8A 1FB8A 1X86A 5JHGA 2MDXA 4P7IA 5LONB 2N0YA 4WVFB 4QJ5B 1FHWA 1IRSA 1MI1A 5D3VA 2EMTA 2KIEA 4KHAA 2RUKB 1EGXA 1XR0B 1MK9B 4DX90 1EAZA 1ISNA 3O96A 5KQ4A 2CAYA 2DX1A 1KI1B 3OHMB 2NMBA 4A6FA 1W1GA 1XODA 2J0KA 2J0MA 4HHVA 3PZDA 1NTYA 1RJ2A 1NU2A 4YL8A 1SGHA 4HDQA 2KUPA 4QXAB 3QWMA 3D8FA 4KHOA 4XWXA 3MDBC 1SHCA 2W2XD 1DDWA 1GC6A 1QC6A 1ZM0A 1TJ6A 1LW3A 4CHMA 3ODWA 1V61A 2YVCA 2DYNA 2DLWA 1FAOA 2D9VA 2D9ZA 1TXDA 1V5MA 3NW8A 1BTKA 4HAYB 5C79A 2AEHA 1U5FA 1FGYA 5JLJB 5DIFB 3NSUA 1U5DA 4L6EA 1DROA 1XX0A 3GYPA 4ZRJA 2D11A 1N3HA 1U5EA 3TFMA 1QQGA 1K5GB 4EJNA 2DHIA 4Y94A 2ZPYA 4Z2NA 3KRWA 2CY4A 2RRFA 5D27A 1UPQA 2DHKA 1GC7A 1M7RA 3HQCA 4K81A 2RNRB 2D9XA 2P0DA 3ODOA 3AU5A 4HATB 3SV1A 2MFQA 2MKRA 2GCLA 4GMXB 4HSIA 3RCPA 2FJLA 1PLSA 4ZRIA 2XQNM 3NWAA 1LB1A 3NWDA 1PMSA 2Y7BA 4TYZA 1BWNA 1AQCA 1V5PA 3PP2A 3SNHA 1MAIA 4CHJA 5M4YB 1H10A 1V89A 1ZC4B 4GZUA 4L1RA 3U7DA 2UZSA 2K00A 3AU4A 2I1KA 2UZRA 5IRSA 2NZ8B 4A6FB 3NWFA 5D3YA 1H4RA 1OQNA 2DYQA 3F0WA 2LULA 5I2SA 3P6AA 2GJYA 2MWNB 2L2IA 5KCVA 2IFSA 2IYBA 3PG7A 4HB0B 3SO6A 5CLQB 4HB4B 3FSSA 2R09A 5DH9B 3UZTA 4GPTB 1MIZB 1DBHA 1OMWA 5J3YA 1EVHA 3HSAA 2H7EA 3PVLA 3P7ZA 1X05A 2R0DA 3KZ1A 3ML4A 4DIXA 4GNKB 2Z0OA 2PZ1A 4CSQA 4K2PA 5HE2A 4F7HA 1MPHA 3A8PA
chains in the Genus database with same CATH topology
1UPRA 2G35A 4NSWA 2DTCA 1U27A 3ULBA 5C6RA 5HE0A 2YF0A 3FEHA 1X1GA 3CXBB 1X11A 2J0JA 4BBKA 3T06A 1Y19B 2LOZA 2QKLA 4A6HA 2HTHB 3KY9A 1J0WA 1WVHA 2YS3A 5EFXA 2D9YA 1U2BA 3DXEA 2DN6A 2DFKA 4EKUA 1EF1A 1M7EA 4GMVA 3OANA 3TCAA 3PVWA 2RGNB 3ZVRA 4KVGB 2DKQA 2Z0QA 3G9WA 2RLOA 2D2QA 2YT0A 1MKEA 5KQ1A 5C5BB 2YRYA 3F5RA 1V88A 2HE7A 2CRFA 1DDVA 3AJ4A 2RSGA 3KSYA 3PSCA 2EC1A 4HAXB 2ELAA 4PNKA 5JHHA 2YT1A 2VRWB 2Z0PA 5CLLB 2YS1A 3ULCA 3ODXA 2DKPA 1FOEA 3A98B 2DHJA 2LOXA 5DHFB 1V5UA 5LOPB 2LKOA 1I2HA 2QKMA 1TQZA 2P0FA 2M14A 3U8ZA 4B6HA 4HAVB 2KGXB 1ZC3B 2Y8FA 4A5KA 1BAKA 4GN1A 1UEFA 3BINA 3D8EA 1UNPA 4HB2B 1X1FA 2D9WA 2P0HA 1DDMA 2COFA 4GXBA 1J19A 1FGZA 2CODA 2OTXA 4MK0A 4MY6A 3HK0A 4DBBA 1UNQA 4HAUB 4Z2MB 2ELBA 4C0AA 2LYDA 3ZDTA 4F7GA 1Q67A 2CY5A 2M38A 1OY2A 2V76A 2JP2A 3QBVB 2ROVA 2X18A 4K2OA 4IOYX 1Y5OA 3X23A 2OQBA 4H8SA 1AWEA 4DX8A 3M1IB 1NTVA 5JP4A 2D10A 3HW2B 1XCGA 4HAZB 2E2XA 1U5GA 2ROZB 4TKNA 3N7CA 1DYNA 1P5TA 5FI0A 3SUZA 1WJMA 4ZRKA 2D4QA 2COAA 2YSZA 5GOWB 3GYOA 2K2JA 3MPXA 1NI2A 1KZ7A 1MIXA 4MT7A 1WG7A 4HDOA 3WA0A 3V5WA 5J3QA 1BTNA 4NY0A 2LG1A 3IVFA 1PFJA 4F7UP 2H7DA 3QIJA 2W2WA 2L1CA 3DXCA 4IFSA 2EMSA 2VSZA 5FI1A 2ADZA 1P6SA 2RVBB 2UVMA 1B55A 3WYFB 3TVVA 1WJ1A 5D3XA 1XD4A 1Z87A 4EMOA 1XKEA 3FM8C 4KAXB 2DX5A 4K17A 1W1HA 1KZGA 1W1DA 3TW1A 2GCJA 3TO1A 5D3WA 1WI1A 3VIAA 5DHAB 2DA0A 4A6KA 1ZSQA 1U29A 2W2XC 5J3TA 2COCA 3PEGA 3PVUA 4KHBB 2P8VA 4PQ0A 2I5CA 2Q13A 1WGUA 2AL6A 3LJUX 4HB3B 1WGQA 3D8DA 3BJIA 2GS0A 1ZVRA 4IAPA 1GG3A 3VOQA 3KRXA 3CIKA 5DI9B 5L81A 4HAWB 5C5BA 1FHOA 2N23A 2I5FA 1E5WA 3DXDA 1MK7B 2I1JA 1FHXA 5HE1A 1RRPB 2BCJA 1K5DB 2KCJA 4YONA 5C16A 3A8QA 5HE3A 2YS5A 2K2UA 1I7AA 2J59M 4DXAB 4WSFA 3SYXA 4WJ7A 1P3RA 4D0NB 1UNRA 4CYEA 2VKIA 2Y8GA 2EJ8A 1FB8A 1X86A 5JHGA 2MDXA 4P7IA 5LONB 2N0YA 4WVFB 1FHWA 1IRSA 5D3VA 2EMTA 4KHAA 2RUKB 1EGXA 1XR0B 1MK9B 4DX90 1EAZA 1ISNA 3O96A 5KQ4A 2CAYA 2DX1A 1KI1B 2NMBA 4A6FA 1W1GA 1XODA 2J0KA 2J0MA 4HHVA 3PZDA 1NTYA 1RJ2A 1NU2A 4YL8A 1SGHA 4HDQA 2KUPA 3QWMA 3D8FA 4KHOA 4XWXA 3MDBC 1SHCA 2W2XD 1DDWA 1GC6A 1QC6A 1ZM0A 1TJ6A 1LW3A 4CHMA 3ODWA 1V61A 2YVCA 2DYNA 2DLWA 1FAOA 2D9VA 2D9ZA 1TXDA 1V5MA 1BTKA 4HAYB 5C79A 2AEHA 1U5FA 1FGYA 5JLJB 5DIFB 3NSUA 1U5DA 4L6EA 1DROA 1XX0A 3GYPA 4ZRJA 2D11A 1N3HA 1U5EA 3TFMA 1QQGA 1K5GB 4EJNA 2DHIA 4Y94A 2ZPYA 4Z2NA 3KRWA 2CY4A 5D27A 1UPQA 2DHKA 1GC7A 1M7RA 3HQCA 4K81A 2RNRB 2D9XA 2P0DA 3ODOA 3AU5A 4HATB 3SV1A 2MFQA 2MKRA 2GCLA 4GMXB 3RCPA 2FJLA 1PLSA 4ZRIA 2XQNM 1LB1A 1PMSA 2Y7BA 4TYZA 1BWNA 1AQCA 1V5PA 3PP2A 3SNHA 1MAIA 4CHJA 1H10A 1V89A 1ZC4B 4GZUA 3U7DA 2UZSA 2K00A 3AU4A 2I1KA 2UZRA 2NZ8B 4A6FB 5D3YA 1H4RA 1OQNA 2DYQA 3F0WA 2LULA 3P6AA 2GJYA 2MWNB 2L2IA 5KCVA 2IFSA 2IYBA 3PG7A 4HB0B 3SO6A 5CLQB 4HB4B 3FSSA 2R09A 5DH9B 3UZTA 4GPTB 1MIZB 1DBHA 1OMWA 5J3YA 1EVHA 2H7EA 3PVLA 3P7ZA 1X05A 2R0DA 3KZ1A 3ML4A 2Z0OA 2PZ1A 4K2PA 5HE2A 4F7HA 1MPHA 3A8PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UPR A;  2G35 A;  4NSW A;  2DTC A;  1U27 A;  3ULB A;  5C6R A;  5HE0 A;  2YF0 A;  3FEH A;  1X1G A;  3CXB B;  1X11 A;  2J0J A;  4BBK A;  3T06 A;  1Y19 B;  2LOZ A;  2QKL A;  4A6H A;  2HTH B;  3KY9 A;  1J0W A;  1WVH A;  2YS3 A;  5EFX A;  2D9Y A;  1U2B A;  3DXE A;  2DN6 A;  2DFK A;  4EKU A;  1EF1 A;  1M7E A;  4GMV A;  3OAN A;  3TCA A;  3PVW A;  2RGN B;  3ZVR A;  4KVG B;  2DKQ A;  2Z0Q A;  3G9W A;  2RLO A;  2D2Q A;  2YT0 A;  1MKE A;  5KQ1 A;  5C5B B;  2YRY A;  3F5R A;  1V88 A;  2HE7 A;  2CRF A;  1DDV A;  3AJ4 A;  2RSG A;  3KSY A;  3PSC A;  2EC1 A;  4HAX B;  2ELA A;  4PNK A;  5JHH A;  2YT1 A;  2VRW B;  2Z0P A;  5CLL B;  2YS1 A;  3ULC A;  3ODX A;  2DKP A;  1FOE A;  3A98 B;  2DHJ A;  2LOX A;  5DHF B;  1V5U A;  5LOP B;  2LKO A;  1I2H A;  2QKM A;  1TQZ A;  2P0F A;  2M14 A;  3U8Z A;  4B6H A;  4HAV B;  2KGX B;  1ZC3 B;  2Y8F A;  4A5K A;  1BAK A;  4GN1 A;  1UEF A;  3BIN A;  3D8E A;  1UNP A;  4HB2 B;  1X1F A;  2D9W A;  2P0H A;  1DDM A;  2COF A;  4GXB A;  1J19 A;  1FGZ A;  2COD A;  2OTX A;  4MK0 A;  4MY6 A;  3HK0 A;  4DBB A;  1UNQ A;  4HAU B;  4Z2M B;  2ELB A;  4C0A A;  2LYD A;  3ZDT A;  4F7G A;  1Q67 A;  2CY5 A;  2M38 A;  1OY2 A;  2V76 A;  2JP2 A;  3QBV B;  2ROV A;  2X18 A;  4K2O A;  4IOY X;  1Y5O A;  3X23 A;  2OQB A;  4H8S A;  1AWE A;  4DX8 A;  3M1I B;  1NTV A;  5JP4 A;  2D10 A;  3HW2 B;  1XCG A;  4HAZ B;  2E2X A;  1U5G A;  2ROZ B;  4TKN A;  3N7C A;  1DYN A;  1P5T A;  5FI0 A;  3SUZ A;  1WJM A;  4ZRK A;  2D4Q A;  2COA A;  2YSZ A;  5GOW B;  3GYO A;  2K2J A;  3MPX A;  1NI2 A;  1KZ7 A;  1MIX A;  4MT7 A;  1WG7 A;  4HDO A;  3WA0 A;  3V5W A;  5J3Q A;  1BTN A;  4NY0 A;  2LG1 A;  3IVF A;  1PFJ A;  4F7U P;  2H7D A;  3QIJ A;  2W2W A;  2L1C A;  3DXC A;  4IFS A;  2EMS A;  2VSZ A;  5FI1 A;  2ADZ A;  1P6S A;  2RVB B;  2UVM A;  1B55 A;  3WYF B;  3TVV A;  1WJ1 A;  5D3X A;  1XD4 A;  1Z87 A;  4EMO A;  1XKE A;  3FM8 C;  4KAX B;  2DX5 A;  4K17 A;  1W1H A;  1KZG A;  1W1D A;  3TW1 A;  2GCJ A;  3TO1 A;  5D3W A;  1WI1 A;  3VIA A;  5DHA B;  2DA0 A;  4A6K A;  1ZSQ A;  1U29 A;  2W2X C;  5J3T A;  2COC A;  3PEG A;  3PVU A;  4KHB B;  2P8V A;  4PQ0 A;  2I5C A;  2Q13 A;  1WGU A;  2AL6 A;  3LJU X;  4HB3 B;  1WGQ A;  3D8D A;  3BJI A;  2GS0 A;  1ZVR A;  4IAP A;  1GG3 A;  3VOQ A;  3KRX A;  3CIK A;  5DI9 B;  5L81 A;  4HAW B;  5C5B A;  1FHO A;  2N23 A;  2I5F A;  1E5W A;  3DXD A;  1MK7 B;  2I1J A;  1FHX A;  5HE1 A;  1RRP B;  2BCJ A;  1K5D B;  2KCJ A;  4YON A;  5C16 A;  3A8Q A;  5HE3 A;  2YS5 A;  2K2U A;  1I7A A;  2J59 M;  4DXA B;  4WSF A;  3SYX A;  4WJ7 A;  1P3R A;  4D0N B;  1UNR A;  4CYE A;  2VKI A;  2Y8G A;  2EJ8 A;  1FB8 A;  1X86 A;  5JHG A;  2MDX A;  4P7I A;  5LON B;  2N0Y A;  4WVF B;  1FHW A;  1IRS A;  5D3V A;  2EMT A;  4KHA A;  2RUK B;  1EGX A;  1XR0 B;  1MK9 B;  4DX9 0;  1EAZ A;  1ISN A;  3O96 A;  5KQ4 A;  2CAY A;  2DX1 A;  1KI1 B;  2NMB A;  4A6F A;  1W1G A;  1XOD A;  2J0K A;  2J0M A;  4HHV A;  3PZD A;  1NTY A;  1RJ2 A;  1NU2 A;  4YL8 A;  1SGH A;  4HDQ A;  2KUP A;  3QWM A;  3D8F A;  4KHO A;  4XWX A;  3MDB C;  1SHC A;  2W2X D;  1DDW A;  1GC6 A;  1QC6 A;  1ZM0 A;  1TJ6 A;  1LW3 A;  4CHM A;  3ODW A;  1V61 A;  2YVC A;  2DYN A;  2DLW A;  1FAO A;  2D9V A;  2D9Z A;  1TXD A;  1V5M A;  1BTK A;  4HAY B;  5C79 A;  2AEH A;  1U5F A;  1FGY A;  5JLJ B;  5DIF B;  3NSU A;  1U5D A;  4L6E A;  1DRO A;  1XX0 A;  3GYP A;  4ZRJ A;  2D11 A;  1N3H A;  1U5E A;  3TFM A;  1QQG A;  1K5G B;  4EJN A;  2DHI A;  4Y94 A;  2ZPY A;  4Z2N A;  3KRW A;  2CY4 A;  5D27 A;  1UPQ A;  2DHK A;  1GC7 A;  1M7R A;  3HQC A;  4K81 A;  2RNR B;  2D9X A;  2P0D A;  3ODO A;  3AU5 A;  4HAT B;  3SV1 A;  2MFQ A;  2MKR A;  2GCL A;  4GMX B;  3RCP A;  2FJL A;  1PLS A;  4ZRI A;  2XQN M;  1LB1 A;  1PMS A;  2Y7B A;  4TYZ A;  1BWN A;  1AQC A;  1V5P A;  3PP2 A;  3SNH A;  1MAI A;  4CHJ A;  1H10 A;  1V89 A;  1ZC4 B;  4GZU A;  3U7D A;  2UZS A;  2K00 A;  3AU4 A;  2I1K A;  2UZR A;  2NZ8 B;  4A6F B;  5D3Y A;  1H4R A;  1OQN A;  2DYQ A;  3F0W A;  2LUL A;  3P6A A;  2GJY A;  2MWN B;  2L2I A;  5KCV A;  2IFS A;  2IYB A;  3PG7 A;  4HB0 B;  3SO6 A;  5CLQ B;  4HB4 B;  3FSS A;  2R09 A;  5DH9 B;  3UZT A;  4GPT B;  1MIZ B;  1DBH A;  1OMW A;  5J3Y A;  1EVH A;  2H7E A;  3PVL A;  3P7Z A;  1X05 A;  2R0D A;  3KZ1 A;  3ML4 A;  2Z0O A;  2PZ1 A;  4K2P A;  5HE2 A;  4F7H A;  1MPH A;  3A8P A; 
#chains in the Genus database with same CATH topology
 1UPR A;  2G35 A;  4NSW A;  2Z13 A;  2DTC A;  1U27 A;  3ULB A;  5C6R A;  5HE0 A;  2YF0 A;  3FEH A;  1X1G A;  3CXB B;  4D6W A;  1X11 A;  2J0J A;  4BBK A;  3T06 A;  1Y19 B;  2LOZ A;  2QKL A;  4A6H A;  2HTH B;  3KY9 A;  1J0W A;  1WVH A;  2YS3 A;  5EFX A;  2D9Y A;  1U2B A;  3DXE A;  2DN6 A;  2DFK A;  4EKU A;  1EF1 A;  1M7E A;  4GMV A;  3OAN A;  3TCA A;  3PVW A;  2RGN B;  3ZVR A;  4KVG B;  2DKQ A;  2Z0Q A;  3G9W A;  2RLO A;  2D2Q A;  2YT0 A;  1MKE A;  5KQ1 A;  5C5B B;  2YRY A;  3F5R A;  1V88 A;  2HE7 A;  2CRF A;  1DDV A;  3AJ4 A;  2RSG A;  3KSY A;  3PSC A;  2EC1 A;  4HAX B;  2ELA A;  4PNK A;  5JHH A;  2YT1 A;  2VRW B;  2Z0P A;  2KIG A;  2Z14 A;  5CLL B;  2YS1 A;  3ULC A;  3ODX A;  2DKP A;  1FOE A;  3A98 B;  2K8E A;  2DHJ A;  2LOX A;  5DHF B;  1V5U A;  5LOP B;  2LKO A;  1I2H A;  2QKM A;  1TQZ A;  2P0F A;  2M14 A;  3U8Z A;  4B6H A;  4HAV B;  2KGX B;  1ZC3 B;  2Y8F A;  4A5K A;  1BAK A;  4GN1 A;  1UEF A;  3BIN A;  3D8E A;  1UNP A;  4HB2 B;  1X1F A;  2D9W A;  2P0H A;  1DDM A;  2COF A;  2R2Y A;  2NBV A;  4GXB A;  2Z4D A;  1J19 A;  1FGZ A;  2COD A;  2OTX A;  4MK0 A;  4MY6 A;  4OSN A;  3HK0 A;  4DBB A;  1UNQ A;  4KHB A;  4HAU B;  4Z2M B;  2ELB A;  4C0A A;  2LYD A;  3ZDT A;  4F7G A;  1Q67 A;  2CY5 A;  3DCX A;  2M38 A;  1OY2 A;  2V76 A;  2JP2 A;  3QBV B;  2ROV A;  2X18 A;  4K2O A;  4IOY X;  1Y5O A;  3X23 A;  1T77 A;  1ZYI A;  2OQB A;  4GOU A;  4H8S A;  1AWE A;  4DX8 A;  2Z59 A;  3M1I B;  1NTV A;  5JP4 A;  2D10 A;  3HW2 B;  1XCG A;  4HAZ B;  2E2X A;  1U5G A;  3U12 A;  2ROZ B;  4TKN A;  3N7C A;  1DYN A;  1P5T A;  5FI0 A;  3SUZ A;  1WJM A;  4ZRK A;  2D4Q A;  5I2M A;  2COA A;  2YSZ A;  5GOW B;  3GYO A;  2K2J A;  3MPX A;  1NI2 A;  1KZ7 A;  1MIX A;  4MT7 A;  1WG7 A;  4HDO A;  3WA0 A;  3V5W A;  5J3Q A;  1BTN A;  4QJ3 B;  4NY0 A;  2GUM A;  4QJ4 B;  2LG1 A;  3IVF A;  1PFJ A;  4F7U P;  2H7D A;  2ZKM X;  3FVC A;  3QIJ A;  2W2W A;  2L1C A;  3DXC A;  4IFS A;  2EMS A;  2VSZ A;  5FI1 A;  3A58 A;  2ADZ A;  1P6S A;  2RVB B;  2UVM A;  1B55 A;  3WYF B;  3TVV A;  1WJ1 A;  5D3X A;  1XD4 A;  2YT2 A;  1Z87 A;  4EMO A;  4OT1 A;  1XKE A;  3FM8 C;  3HIE A;  4KAX B;  2DX5 A;  4K17 A;  1W1H A;  1KZG A;  1W1D A;  3TW1 A;  2GCJ A;  3TO1 A;  5D3W A;  1WI1 A;  3VIA A;  5DHA B;  2DA0 A;  4A6K A;  1ZSQ A;  1U29 A;  2W2X C;  5J3T A;  2COC A;  3PEG A;  3PVU A;  2FJU B;  4KHB B;  2P8V A;  4PQ0 A;  2I5C A;  2Q13 A;  1WGU A;  2AL6 A;  3LJU X;  4HB3 B;  1WGQ A;  3D8D A;  3BJI A;  2GS0 A;  1ZVR A;  2KUQ A;  4IAP A;  1GG3 A;  3VOQ A;  3KRX A;  3CIK A;  5DI9 B;  5LG4 B;  5L81 A;  4HAW B;  5C5B A;  1FHO A;  2N23 A;  2I5F A;  1E5W A;  3DXD A;  2K49 A;  1MK7 B;  2I1J A;  1FHX A;  5HE1 A;  3B77 A;  1RRP B;  2BCJ A;  1K5D B;  2KCJ A;  4YON A;  5C16 A;  3A8Q A;  5HE3 A;  2YS5 A;  2K2U A;  1I7A A;  2J59 M;  4DXA B;  4WSF A;  2KR0 A;  3SYX A;  4WJ7 A;  1P3R A;  4D0N B;  1UNR A;  4CYE A;  2VKI A;  2Y8G A;  2EJ8 A;  1FB8 A;  1X86 A;  5JHG A;  2MDX A;  4P7I A;  5LON B;  2N0Y A;  4WVF B;  4QJ5 B;  1FHW A;  1IRS A;  1MI1 A;  5D3V A;  2EMT A;  2KIE A;  4KHA A;  2RUK B;  1EGX A;  1XR0 B;  1MK9 B;  4DX9 0;  1EAZ A;  1ISN A;  3O96 A;  5KQ4 A;  2CAY A;  2DX1 A;  1KI1 B;  3OHM B;  2NMB A;  4A6F A;  1W1G A;  1XOD A;  2J0K A;  2J0M A;  4HHV A;  3PZD A;  1NTY A;  1RJ2 A;  1NU2 A;  4YL8 A;  1SGH A;  4HDQ A;  2KUP A;  4QXA B;  3QWM A;  3D8F A;  4KHO A;  4XWX A;  3MDB C;  1SHC A;  2W2X D;  1DDW A;  1GC6 A;  1QC6 A;  1ZM0 A;  1TJ6 A;  1LW3 A;  4CHM A;  3ODW A;  1V61 A;  2YVC A;  2DYN A;  2DLW A;  1FAO A;  2D9V A;  2D9Z A;  1TXD A;  1V5M A;  3NW8 A;  1BTK A;  4HAY B;  5C79 A;  2AEH A;  1U5F A;  1FGY A;  5JLJ B;  5DIF B;  3NSU A;  1U5D A;  4L6E A;  1DRO A;  1XX0 A;  3GYP A;  4ZRJ A;  2D11 A;  1N3H A;  1U5E A;  3TFM A;  1QQG A;  1K5G B;  4EJN A;  2DHI A;  4Y94 A;  2ZPY A;  4Z2N A;  3KRW A;  2CY4 A;  2RRF A;  5D27 A;  1UPQ A;  2DHK A;  1GC7 A;  1M7R A;  3HQC A;  4K81 A;  2RNR B;  2D9X A;  2P0D A;  3ODO A;  3AU5 A;  4HAT B;  3SV1 A;  2MFQ A;  2MKR A;  2GCL A;  4GMX B;  4HSI A;  3RCP A;  2FJL A;  1PLS A;  4ZRI A;  2XQN M;  3NWA A;  1LB1 A;  3NWD A;  1PMS A;  2Y7B A;  4TYZ A;  1BWN A;  1AQC A;  1V5P A;  3PP2 A;  3SNH A;  1MAI A;  4CHJ A;  5M4Y B;  1H10 A;  1V89 A;  1ZC4 B;  4GZU A;  4L1R A;  3U7D A;  2UZS A;  2K00 A;  3AU4 A;  2I1K A;  2UZR A;  5IRS A;  2NZ8 B;  4A6F B;  3NWF A;  5D3Y A;  1H4R A;  1OQN A;  2DYQ A;  3F0W A;  2LUL A;  5I2S A;  3P6A A;  2GJY A;  2MWN B;  2L2I A;  5KCV A;  2IFS A;  2IYB A;  3PG7 A;  4HB0 B;  3SO6 A;  5CLQ B;  4HB4 B;  3FSS A;  2R09 A;  5DH9 B;  3UZT A;  4GPT B;  1MIZ B;  1DBH A;  1OMW A;  5J3Y A;  1EVH A;  3HSA A;  2H7E A;  3PVL A;  3P7Z A;  1X05 A;  2R0D A;  3KZ1 A;  3ML4 A;  4DIX A;  4GNK B;  2Z0O A;  2PZ1 A;  4CSQ A;  4K2P A;  5HE2 A;  4F7H A;  1MPH A;  3A8P A; 
#chains in the Genus database with same CATH homology
 1UPR A;  2G35 A;  4NSW A;  2DTC A;  1U27 A;  3ULB A;  5C6R A;  5HE0 A;  2YF0 A;  3FEH A;  1X1G A;  3CXB B;  1X11 A;  2J0J A;  4BBK A;  3T06 A;  1Y19 B;  2LOZ A;  2QKL A;  4A6H A;  2HTH B;  3KY9 A;  1J0W A;  1WVH A;  2YS3 A;  5EFX A;  2D9Y A;  1U2B A;  3DXE A;  2DN6 A;  2DFK A;  4EKU A;  1EF1 A;  1M7E A;  4GMV A;  3OAN A;  3TCA A;  3PVW A;  2RGN B;  3ZVR A;  4KVG B;  2DKQ A;  2Z0Q A;  3G9W A;  2RLO A;  2D2Q A;  2YT0 A;  1MKE A;  5KQ1 A;  5C5B B;  2YRY A;  3F5R A;  1V88 A;  2HE7 A;  2CRF A;  1DDV A;  3AJ4 A;  2RSG A;  3KSY A;  3PSC A;  2EC1 A;  4HAX B;  2ELA A;  4PNK A;  5JHH A;  2YT1 A;  2VRW B;  2Z0P A;  5CLL B;  2YS1 A;  3ULC A;  3ODX A;  2DKP A;  1FOE A;  3A98 B;  2DHJ A;  2LOX A;  5DHF B;  1V5U A;  5LOP B;  2LKO A;  1I2H A;  2QKM A;  1TQZ A;  2P0F A;  2M14 A;  3U8Z A;  4B6H A;  4HAV B;  2KGX B;  1ZC3 B;  2Y8F A;  4A5K A;  1BAK A;  4GN1 A;  1UEF A;  3BIN A;  3D8E A;  1UNP A;  4HB2 B;  1X1F A;  2D9W A;  2P0H A;  1DDM A;  2COF A;  4GXB A;  1J19 A;  1FGZ A;  2COD A;  2OTX A;  4MK0 A;  4MY6 A;  3HK0 A;  4DBB A;  1UNQ A;  4HAU B;  4Z2M B;  2ELB A;  4C0A A;  2LYD A;  3ZDT A;  4F7G A;  1Q67 A;  2CY5 A;  2M38 A;  1OY2 A;  2V76 A;  2JP2 A;  3QBV B;  2ROV A;  2X18 A;  4K2O A;  4IOY X;  1Y5O A;  3X23 A;  2OQB A;  4H8S A;  1AWE A;  4DX8 A;  3M1I B;  1NTV A;  5JP4 A;  2D10 A;  3HW2 B;  1XCG A;  4HAZ B;  2E2X A;  1U5G A;  2ROZ B;  4TKN A;  3N7C A;  1DYN A;  1P5T A;  5FI0 A;  3SUZ A;  1WJM A;  4ZRK A;  2D4Q A;  2COA A;  2YSZ A;  5GOW B;  3GYO A;  2K2J A;  3MPX A;  1NI2 A;  1KZ7 A;  1MIX A;  4MT7 A;  1WG7 A;  4HDO A;  3WA0 A;  3V5W A;  5J3Q A;  1BTN A;  4NY0 A;  2LG1 A;  3IVF A;  1PFJ A;  4F7U P;  2H7D A;  3QIJ A;  2W2W A;  2L1C A;  3DXC A;  4IFS A;  2EMS A;  2VSZ A;  5FI1 A;  2ADZ A;  1P6S A;  2RVB B;  2UVM A;  1B55 A;  3WYF B;  3TVV A;  1WJ1 A;  5D3X A;  1XD4 A;  1Z87 A;  4EMO A;  1XKE A;  3FM8 C;  4KAX B;  2DX5 A;  4K17 A;  1W1H A;  1KZG A;  1W1D A;  3TW1 A;  2GCJ A;  3TO1 A;  5D3W A;  1WI1 A;  3VIA A;  5DHA B;  2DA0 A;  4A6K A;  1ZSQ A;  1U29 A;  2W2X C;  5J3T A;  2COC A;  3PEG A;  3PVU A;  4KHB B;  2P8V A;  4PQ0 A;  2I5C A;  2Q13 A;  1WGU A;  2AL6 A;  3LJU X;  4HB3 B;  1WGQ A;  3D8D A;  3BJI A;  2GS0 A;  1ZVR A;  4IAP A;  1GG3 A;  3VOQ A;  3KRX A;  3CIK A;  5DI9 B;  5L81 A;  4HAW B;  5C5B A;  1FHO A;  2N23 A;  2I5F A;  1E5W A;  3DXD A;  1MK7 B;  2I1J A;  1FHX A;  5HE1 A;  1RRP B;  2BCJ A;  1K5D B;  2KCJ A;  4YON A;  5C16 A;  3A8Q A;  5HE3 A;  2YS5 A;  2K2U A;  1I7A A;  2J59 M;  4DXA B;  4WSF A;  3SYX A;  4WJ7 A;  1P3R A;  4D0N B;  1UNR A;  4CYE A;  2VKI A;  2Y8G A;  2EJ8 A;  1FB8 A;  1X86 A;  5JHG A;  2MDX A;  4P7I A;  5LON B;  2N0Y A;  4WVF B;  1FHW A;  1IRS A;  5D3V A;  2EMT A;  4KHA A;  2RUK B;  1EGX A;  1XR0 B;  1MK9 B;  4DX9 0;  1EAZ A;  1ISN A;  3O96 A;  5KQ4 A;  2CAY A;  2DX1 A;  1KI1 B;  2NMB A;  4A6F A;  1W1G A;  1XOD A;  2J0K A;  2J0M A;  4HHV A;  3PZD A;  1NTY A;  1RJ2 A;  1NU2 A;  4YL8 A;  1SGH A;  4HDQ A;  2KUP A;  3QWM A;  3D8F A;  4KHO A;  4XWX A;  3MDB C;  1SHC A;  2W2X D;  1DDW A;  1GC6 A;  1QC6 A;  1ZM0 A;  1TJ6 A;  1LW3 A;  4CHM A;  3ODW A;  1V61 A;  2YVC A;  2DYN A;  2DLW A;  1FAO A;  2D9V A;  2D9Z A;  1TXD A;  1V5M A;  1BTK A;  4HAY B;  5C79 A;  2AEH A;  1U5F A;  1FGY A;  5JLJ B;  5DIF B;  3NSU A;  1U5D A;  4L6E A;  1DRO A;  1XX0 A;  3GYP A;  4ZRJ A;  2D11 A;  1N3H A;  1U5E A;  3TFM A;  1QQG A;  1K5G B;  4EJN A;  2DHI A;  4Y94 A;  2ZPY A;  4Z2N A;  3KRW A;  2CY4 A;  5D27 A;  1UPQ A;  2DHK A;  1GC7 A;  1M7R A;  3HQC A;  4K81 A;  2RNR B;  2D9X A;  2P0D A;  3ODO A;  3AU5 A;  4HAT B;  3SV1 A;  2MFQ A;  2MKR A;  2GCL A;  4GMX B;  3RCP A;  2FJL A;  1PLS A;  4ZRI A;  2XQN M;  1LB1 A;  1PMS A;  2Y7B A;  4TYZ A;  1BWN A;  1AQC A;  1V5P A;  3PP2 A;  3SNH A;  1MAI A;  4CHJ A;  1H10 A;  1V89 A;  1ZC4 B;  4GZU A;  3U7D A;  2UZS A;  2K00 A;  3AU4 A;  2I1K A;  2UZR A;  2NZ8 B;  4A6F B;  5D3Y A;  1H4R A;  1OQN A;  2DYQ A;  3F0W A;  2LUL A;  3P6A A;  2GJY A;  2MWN B;  2L2I A;  5KCV A;  2IFS A;  2IYB A;  3PG7 A;  4HB0 B;  3SO6 A;  5CLQ B;  4HB4 B;  3FSS A;  2R09 A;  5DH9 B;  3UZT A;  4GPT B;  1MIZ B;  1DBH A;  1OMW A;  5J3Y A;  1EVH A;  2H7E A;  3PVL A;  3P7Z A;  1X05 A;  2R0D A;  3KZ1 A;  3ML4 A;  2Z0O A;  2PZ1 A;  4K2P A;  5HE2 A;  4F7H A;  1MPH A;  3A8P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...