3CXBB

Crystal structure of sifa and skip
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
103
structure length
103
Chain Sequence
TKEGMLHYKAGTSYLGKEHWKTCFVVLSNGILYQYPDRTDVIPLLSVNMGGEQCGGCRRANTTDRPHAFQVILSDRPCLELSAESEAEMAEWMQHLCQAVSKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure and function of Salmonella SifA indicate that its interactions with SKIP, SseJ, and RhoA family GTPases induce endosomal tubulation
pubmed doi rcsb
source organism Salmonella typhimurium
molecule tags Signaling protein
molecule keywords Protein sifA
total genus 16
structure length 103
sequence length 103
ec nomenclature
pdb deposition date 2008-04-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 3cxbB00
3PVLA 1V89A 1EAZA 2YS1A 4HAUB 2DHKA 5C5BB 5LOPB 2NZ8B 4Z2MB 4HB2B 3TVVA 4MY6A 1V5PA 1ZM0A 1BAKA 1XD4A 2EMSA 1RRPB 5DHFB 2M14A 2N23A 4GZUA 2RUKB 2W2XC 1QC6A 1KI1B 1K5GB 5KQ4A 4P7IA 4K17A 4HB3B 4D0NB 3ZDTA 4GXBA 5L81A 1Y19B 2CRFA 3KRWA 2CODA 2YF0A 3OANA 4L6EA 1J19A 1ZVRA 2HTHB 1V5MA 5DH9B 3DXCA 2D9WA 2J59M 5J3YA 4A6HA 2J0KA 1KZGA 4B6HA 2R0DA 4C0AA 5KQ1A 2DN6A 1DROA 2P0HA 4HAYB 3G9WA 2I1KA 3SNHA 3F5RA 3PSCA 4WSFA 3F0WA 2YS5A 3PP2A 2ROZB 4GPTB 1GC7A 1Z87A 2QKMA 1E5WA 3T06A 2MDXA 1FHWA 2YSZA 2K2UA 1WGUA 3ML4A 3A8PA 2VKIA 4F7UP 1DBHA 4XWXA 2MKRA 4ZRKA 2L2IA 1TJ6A 1UNQA 3WA0A 4YL8A 1WVHA 1M7RA 4K2OA 1OY2A 2DX1A 2ROVA 1AQCA 3SO6A 3PEGA 2XQNM 5C6RA 1GC6A 2H7DA 4EKUA 3TO1A 1V5UA 3U8ZA 1ZC4B 4IAPA 2D11A 3CXBB 3GYPA 2LULA 3HK0A 1FGYA 4DBBA 5JHHA 4YONA 2J0MA 1LW3A 4WJ7A 1RJ2A 3KZ1A 3PZDA 2NMBA 2N0YA 2DHJA 1DDVA 1M7EA 1OQNA 1U27A 4CYEA 5HE3A 2P8VA 1EVHA 3PVWA 2ELBA 5D3WA 3VIAA 2YT0A 1U5DA 4HB0B 1XODA 1BTKA 1MIXA 3FM8C 2QKLA 3D8EA 5C79A 2RGNB 1X1GA 1N3HA 4DX90 3TW1A 1WG7A 3ODWA 2LG1A 1MPHA 1OMWA 2BCJA 2D4QA 1UPRA 4GN1A 1W1HA 5CLLB 1Y5OA 4F7HA 3RCPA 1PFJA 4HDQA 5LONB 4A6FA 5JP4A 4A6KA 3LJUX 2IFSA 1QQGA 2RVBB 1WGQA 2E2XA 3KY9A 3A8QA 2D9XA 1X1FA 2K00A 3MPXA 1U2BA 3TCAA 2CAYA 2LOZA 2DA0A 2AEHA 1TXDA 3PG7A 2G35A 2Z0QA 4HDOA 1UEFA 2COCA 5FI1A 4NSWA 3ODOA 4BBKA 4GMXB 3HW2B 4ZRIA 2JP2A 2MWNB 2YS3A 2EMTA 2Q13A 5D3XA 3SUZA 4KHOA 1FAOA 2UZSA 2DHIA 3P7ZA 1MIZB 2FJLA 3A98B 1FHOA 4IOYX 3SV1A 2P0FA 1P6SA 3ZVRA 2Y7BA 1W1DA 2DYQA 2GCLA 5CLQB 1P3RA 1MK9B 2W2XD 3AJ4A 4HAXB 2PZ1A 2ELAA 4F7GA 2KGXB 1ISNA 1LB1A 2YT1A 1X11A 1DDMA 1V88A 3QWMA 4PNKA 4HAVB 4KAXB 2CY5A 4TKNA 1SGHA 5JLJB 1U5FA 1EF1A 4HAZB 1DYNA 2D9YA 2D9ZA 2RSGA 4HATB 2D9VA 1MAIA 5JHGA 2R09A 1U29A 2J0JA 2YVCA 3IVFA 1BWNA 2KCJA 1GG3A 1TQZA 1XKEA 5HE2A 1PMSA 2OQBA 4EJNA 3NSUA 1PLSA 5C5BA 1FB8A 1EGXA 1B55A 2EJ8A 2GCJA 1XCGA 5HE0A 1FHXA 4WVFB 1SHCA 5C16A 2LYDA 2Z0PA 3WYFB 2VRWB 5EFXA 2EC1A 4HHVA 1I7AA 3QBVB 4NY0A 3TFMA 2DKPA 3BINA 3ULBA 1P5TA 2D2QA 3O96A 2OTXA 1V61A 2D10A 3AU5A 4H8SA 4HAWB 1NTVA 2Z0OA 1W1GA 1UNPA 2DLWA 3QIJA 3ULCA 3DXDA 2YRYA 2DX5A 1FOEA 2X18A 4A6FB 4EMOA 4CHMA 1I2HA 4ZRJA 3X23A 2CY4A 3N7CA 1ZSQA 1BTNA 3M1IB 4KVGB 2GJYA 3P6AA 3D8FA 2AL6A 1XX0A 2I5CA 2RNRB 1H4RA 1UNRA 4MT7A 1MK7B 3KSYA 1NTYA 3SYXA 4KHAA 2DFKA 2KUPA 1NU2A 2LKOA 3D8DA 5DHAB 4A5KA 5J3TA 1MKEA 4PQ0A 1H10A 2UVMA 3HQCA 4Y94A 2ZPYA 5GOWB 2ADZA 2DTCA 2I1JA 2H7EA 2MFQA 5D3YA 3CIKA 2VSZA 2DYNA 5D27A 4DXAB 1UPQA 1AWEA 3U7DA 2COAA 3V5WA 3PVUA 2LOXA 2COFA 2IYBA 1X05A 2I5FA 3MDBC 2Y8GA 2W2WA 4MK0A 3KRXA 1U5EA 1DDWA 4K2PA 4DX8A 4K81A 5J3QA 3FSSA 1ZC3B 3AU4A 5DIFB 5D3VA 2M38A 2HE7A 5HE1A 1X86A 2P0DA 1U5GA 3FEHA 5FI0A 4HB4B 4TYZA 2GS0A 3ODXA 4IFSA 2L1CA 1WI1A 1K5DB 3DXEA 1XR0B 2K2JA 1J0WA 3VOQA 1WJ1A 1FGZA 1KZ7A 2UZRA 4CHJA 4Z2NA 5KCVA 1IRSA 3UZTA 2DKQA 1NI2A 3GYOA 1WJMA 2Y8FA 2RLOA 4KHBB 3BJIA 4GMVA 1Q67A 5DI9B 2V76A
chains in the Genus database with same CATH superfamily
2YT2A 3PVLA 1V89A 5I2SA 1EAZA 1T77A 2YS1A 4HAUB 2DHKA 5I2MA 5C5BB 5LOPB 2NZ8B 4Z2MB 4HB2B 3TVVA 4MY6A 2R2YA 1V5PA 1ZM0A 1BAKA 1XD4A 2EMSA 1RRPB 5DHFB 2M14A 2N23A 4GZUA 5IRSA 2RUKB 2W2XC 1QC6A 1KI1B 1K5GB 5KQ4A 4P7IA 4K17A 4HB3B 4D0NB 3ZDTA 4GXBA 5L81A 1Y19B 4QJ4B 2CRFA 3KRWA 2CODA 2YF0A 3OANA 4L6EA 1J19A 1ZVRA 2KIGA 2HTHB 1V5MA 5DH9B 3DXCA 2D9WA 2J59M 5J3YA 1ZYIA 4A6HA 2J0KA 1KZGA 4B6HA 2R0DA 4C0AA 5KQ1A 2DN6A 1DROA 2P0HA 4HAYB 3G9WA 2I1KA 3SNHA 3F5RA 3PSCA 4WSFA 3F0WA 2YS5A 3PP2A 5M4YB 2ROZB 4GPTB 1GC7A 1Z87A 2QKMA 1E5WA 3T06A 2MDXA 1FHWA 2YSZA 2K2UA 4D6WA 4QJ3B 1WGUA 3ML4A 3A8PA 2VKIA 4F7UP 1DBHA 4XWXA 2MKRA 4ZRKA 2L2IA 1TJ6A 4QJ5B 2Z14A 1UNQA 3WA0A 4YL8A 1WVHA 1M7RA 1OY2A 2DX1A 2ROVA 4K2OA 1AQCA 3SO6A 3PEGA 2XQNM 5C6RA 1GC6A 2H7DA 4EKUA 3HIEA 3TO1A 1V5UA 3U8ZA 1ZC4B 4IAPA 2D11A 3CXBB 1MI1A 3GYPA 2LULA 3HK0A 1FGYA 4DBBA 5JHHA 4YONA 2J0MA 1LW3A 2ZKMX 4WJ7A 1RJ2A 3KZ1A 3PZDA 2NMBA 2N0YA 2DHJA 1DDVA 1M7EA 1OQNA 1U27A 2KR0A 3HSAA 4CYEA 5HE3A 2P8VA 1EVHA 3PVWA 2ELBA 5D3WA 3VIAA 2YT0A 1U5DA 4HB0B 1XODA 1BTKA 2K8EA 1MIXA 3FM8C 2QKLA 4DIXA 3B77A 3D8EA 5C79A 2RGNB 1X1GA 1N3HA 2RRFA 4QXAB 4DX90 3TW1A 1WG7A 2Z13A 3ODWA 2LG1A 1MPHA 1OMWA 2BCJA 2D4QA 1UPRA 4GN1A 1W1HA 5CLLB 1Y5OA 4F7HA 3RCPA 1PFJA 4HDQA 5LONB 4A6FA 5JP4A 4A6KA 3LJUX 2IFSA 1QQGA 2RVBB 1WGQA 2E2XA 3KY9A 3A8QA 2D9XA 1X1FA 2FJUB 2K00A 3MPXA 1U2BA 3TCAA 2CAYA 2LOZA 2DA0A 2AEHA 1TXDA 3PG7A 2G35A 2Z0QA 4HDOA 1UEFA 2COCA 2KIEA 5FI1A 4NSWA 3ODOA 4BBKA 4GMXB 3HW2B 4ZRIA 2JP2A 2MWNB 2YS3A 2EMTA 2Q13A 5D3XA 3SUZA 4KHOA 1FAOA 2UZSA 2NBVA 2DHIA 3P7ZA 1MIZB 2FJLA 3A98B 1FHOA 4IOYX 3SV1A 2P0FA 1P6SA 3ZVRA 2Y7BA 1W1DA 2DYQA 2GUMA 2K49A 2GCLA 5CLQB 1P3RA 1MK9B 2W2XD 3AJ4A 4HAXB 2PZ1A 2ELAA 4F7GA 2KGXB 1ISNA 1LB1A 2YT1A 1X11A 4GNKB 1DDMA 1V88A 3QWMA 4PNKA 4HAVB 4KAXB 2CY5A 4TKNA 1SGHA 5JLJB 1U5FA 1EF1A 4HAZB 1DYNA 5LG4B 2D9YA 2D9ZA 2RSGA 4HATB 2D9VA 3DCXA 1MAIA 5JHGA 4GOUA 2R09A 1U29A 2J0JA 2YVCA 3IVFA 1BWNA 2KCJA 1GG3A 1TQZA 1XKEA 5HE2A 1PMSA 2OQBA 4EJNA 3NSUA 1PLSA 3NWFA 5C5BA 1FB8A 1EGXA 1B55A 2EJ8A 2GCJA 1XCGA 5HE0A 1FHXA 4WVFB 3NWDA 1SHCA 5C16A 2LYDA 2Z0PA 3WYFB 2VRWB 4OT1A 5EFXA 2EC1A 4HHVA 4L1RA 1I7AA 3QBVB 4NY0A 3TFMA 2DKPA 3BINA 3A58A 3ULBA 1P5TA 2D2QA 3O96A 2OTXA 1V61A 2D10A 3AU5A 3FVCA 4H8SA 4HAWB 1NTVA 2Z0OA 3NW8A 1W1GA 1UNPA 2DLWA 3QIJA 3ULCA 3DXDA 2YRYA 2DX5A 1FOEA 2Z4DA 2X18A 4A6FB 4EMOA 4CHMA 1I2HA 4ZRJA 3X23A 2CY4A 3N7CA 1ZSQA 1BTNA 3M1IB 4KVGB 2GJYA 3P6AA 3D8FA 2AL6A 1XX0A 2I5CA 2RNRB 1H4RA 1UNRA 4MT7A 3OHMB 1MK7B 3KSYA 1NTYA 3SYXA 4KHAA 4OSNA 2DFKA 2KUPA 1NU2A 2LKOA 3D8DA 5DHAB 4A5KA 5J3TA 1MKEA 4PQ0A 1H10A 2UVMA 3HQCA 4Y94A 2ZPYA 5GOWB 2ADZA 2DTCA 2I1JA 2H7EA 2MFQA 5D3YA 3U12A 3CIKA 2VSZA 2DYNA 5D27A 4DXAB 1UPQA 1AWEA 3U7DA 2COAA 3V5WA 3PVUA 2LOXA 2COFA 2IYBA 1X05A 2I5FA 3MDBC 2Y8GA 4HSIA 2W2WA 4MK0A 3KRXA 1U5EA 1DDWA 4K2PA 4DX8A 4K81A 5J3QA 3FSSA 1ZC3B 3AU4A 5DIFB 5D3VA 2Z59A 4CSQA 2M38A 2HE7A 5HE1A 4KHBA 1X86A 2P0DA 1U5GA 3FEHA 5FI0A 4HB4B 4TYZA 2GS0A 3ODXA 4IFSA 2L1CA 1WI1A 1K5DB 3DXEA 1XR0B 2K2JA 1J0WA 3VOQA 1WJ1A 1FGZA 1KZ7A 2UZRA 4CHJA 4Z2NA 5KCVA 1IRSA 3UZTA 2DKQA 3NWAA 1NI2A 2KUQA 3GYOA 1WJMA 2Y8FA 2RLOA 4KHBB 3BJIA 4GMVA 1Q67A 5DI9B 2V76A
chains in the Genus database with same CATH topology
3PVLA 1V89A 1EAZA 2YS1A 4HAUB 2DHKA 5C5BB 5LOPB 2NZ8B 4Z2MB 4HB2B 3TVVA 4MY6A 1V5PA 1ZM0A 1BAKA 1XD4A 2EMSA 1RRPB 5DHFB 2M14A 2N23A 4GZUA 2RUKB 2W2XC 1QC6A 1KI1B 1K5GB 5KQ4A 4P7IA 4K17A 4HB3B 4D0NB 3ZDTA 4GXBA 5L81A 1Y19B 2CRFA 3KRWA 2CODA 2YF0A 3OANA 4L6EA 1J19A 1ZVRA 2HTHB 1V5MA 5DH9B 3DXCA 2D9WA 2J59M 5J3YA 4A6HA 2J0KA 1KZGA 4B6HA 2R0DA 4C0AA 5KQ1A 2DN6A 1DROA 2P0HA 4HAYB 3G9WA 2I1KA 3SNHA 3F5RA 3PSCA 4WSFA 3F0WA 2YS5A 3PP2A 2ROZB 4GPTB 1GC7A 1Z87A 2QKMA 1E5WA 3T06A 2MDXA 1FHWA 2YSZA 2K2UA 1WGUA 3ML4A 3A8PA 2VKIA 4F7UP 1DBHA 4XWXA 2MKRA 4ZRKA 2L2IA 1TJ6A 1UNQA 3WA0A 4YL8A 1WVHA 1M7RA 4K2OA 1OY2A 2DX1A 2ROVA 1AQCA 3SO6A 3PEGA 2XQNM 5C6RA 1GC6A 2H7DA 4EKUA 3TO1A 1V5UA 3U8ZA 1ZC4B 4IAPA 2D11A 3CXBB 3GYPA 2LULA 3HK0A 1FGYA 4DBBA 5JHHA 4YONA 2J0MA 1LW3A 4WJ7A 1RJ2A 3KZ1A 3PZDA 2NMBA 2N0YA 2DHJA 1DDVA 1M7EA 1OQNA 1U27A 4CYEA 5HE3A 2P8VA 1EVHA 3PVWA 2ELBA 5D3WA 3VIAA 2YT0A 1U5DA 4HB0B 1XODA 1BTKA 1MIXA 3FM8C 2QKLA 3D8EA 5C79A 2RGNB 1X1GA 1N3HA 4DX90 3TW1A 1WG7A 3ODWA 2LG1A 1MPHA 1OMWA 2BCJA 2D4QA 1UPRA 4GN1A 1W1HA 5CLLB 1Y5OA 4F7HA 3RCPA 1PFJA 4HDQA 5LONB 4A6FA 5JP4A 4A6KA 3LJUX 2IFSA 1QQGA 2RVBB 1WGQA 2E2XA 3KY9A 3A8QA 2D9XA 1X1FA 2K00A 3MPXA 1U2BA 3TCAA 2CAYA 2LOZA 2DA0A 2AEHA 1TXDA 3PG7A 2G35A 2Z0QA 4HDOA 1UEFA 2COCA 5FI1A 4NSWA 3ODOA 4BBKA 4GMXB 3HW2B 4ZRIA 2JP2A 2MWNB 2YS3A 2EMTA 2Q13A 5D3XA 3SUZA 4KHOA 1FAOA 2UZSA 2DHIA 3P7ZA 1MIZB 2FJLA 3A98B 1FHOA 4IOYX 3SV1A 2P0FA 1P6SA 3ZVRA 2Y7BA 1W1DA 2DYQA 2GCLA 5CLQB 1P3RA 1MK9B 2W2XD 3AJ4A 4HAXB 2PZ1A 2ELAA 4F7GA 2KGXB 1ISNA 1LB1A 2YT1A 1X11A 1DDMA 1V88A 3QWMA 4PNKA 4HAVB 4KAXB 2CY5A 4TKNA 1SGHA 5JLJB 1U5FA 1EF1A 4HAZB 1DYNA 2D9YA 2D9ZA 2RSGA 4HATB 2D9VA 1MAIA 5JHGA 2R09A 1U29A 2J0JA 2YVCA 3IVFA 1BWNA 2KCJA 1GG3A 1TQZA 1XKEA 5HE2A 1PMSA 2OQBA 4EJNA 3NSUA 1PLSA 5C5BA 1FB8A 1EGXA 1B55A 2EJ8A 2GCJA 1XCGA 5HE0A 1FHXA 4WVFB 1SHCA 5C16A 2LYDA 2Z0PA 3WYFB 2VRWB 5EFXA 2EC1A 4HHVA 1I7AA 3QBVB 4NY0A 3TFMA 2DKPA 3BINA 3ULBA 1P5TA 2D2QA 3O96A 2OTXA 1V61A 2D10A 3AU5A 4H8SA 4HAWB 1NTVA 2Z0OA 1W1GA 1UNPA 2DLWA 3QIJA 3ULCA 3DXDA 2YRYA 2DX5A 1FOEA 2X18A 4A6FB 4EMOA 4CHMA 1I2HA 4ZRJA 3X23A 2CY4A 3N7CA 1ZSQA 1BTNA 3M1IB 4KVGB 2GJYA 3P6AA 3D8FA 2AL6A 1XX0A 2I5CA 2RNRB 1H4RA 1UNRA 4MT7A 1MK7B 3KSYA 1NTYA 3SYXA 4KHAA 2DFKA 2KUPA 1NU2A 2LKOA 3D8DA 5DHAB 4A5KA 5J3TA 1MKEA 4PQ0A 1H10A 2UVMA 3HQCA 4Y94A 2ZPYA 5GOWB 2ADZA 2DTCA 2I1JA 2H7EA 2MFQA 5D3YA 3CIKA 2VSZA 2DYNA 5D27A 4DXAB 1UPQA 1AWEA 3U7DA 2COAA 3V5WA 3PVUA 2LOXA 2COFA 2IYBA 1X05A 2I5FA 3MDBC 2Y8GA 2W2WA 4MK0A 3KRXA 1U5EA 1DDWA 4K2PA 4DX8A 4K81A 5J3QA 3FSSA 1ZC3B 3AU4A 5DIFB 5D3VA 2M38A 2HE7A 5HE1A 1X86A 2P0DA 1U5GA 3FEHA 5FI0A 4HB4B 4TYZA 2GS0A 3ODXA 4IFSA 2L1CA 1WI1A 1K5DB 3DXEA 1XR0B 2K2JA 1J0WA 3VOQA 1WJ1A 1FGZA 1KZ7A 2UZRA 4CHJA 4Z2NA 5KCVA 1IRSA 3UZTA 2DKQA 1NI2A 3GYOA 1WJMA 2Y8FA 2RLOA 4KHBB 3BJIA 4GMVA 1Q67A 5DI9B 2V76A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PVL A;  1V89 A;  1EAZ A;  2YS1 A;  4HAU B;  2DHK A;  5C5B B;  5LOP B;  2NZ8 B;  4Z2M B;  4HB2 B;  3TVV A;  4MY6 A;  1V5P A;  1ZM0 A;  1BAK A;  1XD4 A;  2EMS A;  1RRP B;  5DHF B;  2M14 A;  2N23 A;  4GZU A;  2RUK B;  2W2X C;  1QC6 A;  1KI1 B;  1K5G B;  5KQ4 A;  4P7I A;  4K17 A;  4HB3 B;  4D0N B;  3ZDT A;  4GXB A;  5L81 A;  1Y19 B;  2CRF A;  3KRW A;  2COD A;  2YF0 A;  3OAN A;  4L6E A;  1J19 A;  1ZVR A;  2HTH B;  1V5M A;  5DH9 B;  3DXC A;  2D9W A;  2J59 M;  5J3Y A;  4A6H A;  2J0K A;  1KZG A;  4B6H A;  2R0D A;  4C0A A;  5KQ1 A;  2DN6 A;  1DRO A;  2P0H A;  4HAY B;  3G9W A;  2I1K A;  3SNH A;  3F5R A;  3PSC A;  4WSF A;  3F0W A;  2YS5 A;  3PP2 A;  2ROZ B;  4GPT B;  1GC7 A;  1Z87 A;  2QKM A;  1E5W A;  3T06 A;  2MDX A;  1FHW A;  2YSZ A;  2K2U A;  1WGU A;  3ML4 A;  3A8P A;  2VKI A;  4F7U P;  1DBH A;  4XWX A;  2MKR A;  4ZRK A;  2L2I A;  1TJ6 A;  1UNQ A;  3WA0 A;  4YL8 A;  1WVH A;  1M7R A;  4K2O A;  1OY2 A;  2DX1 A;  2ROV A;  1AQC A;  3SO6 A;  3PEG A;  2XQN M;  5C6R A;  1GC6 A;  2H7D A;  4EKU A;  3TO1 A;  1V5U A;  3U8Z A;  1ZC4 B;  4IAP A;  2D11 A;  3CXB B;  3GYP A;  2LUL A;  3HK0 A;  1FGY A;  4DBB A;  5JHH A;  4YON A;  2J0M A;  1LW3 A;  4WJ7 A;  1RJ2 A;  3KZ1 A;  3PZD A;  2NMB A;  2N0Y A;  2DHJ A;  1DDV A;  1M7E A;  1OQN A;  1U27 A;  4CYE A;  5HE3 A;  2P8V A;  1EVH A;  3PVW A;  2ELB A;  5D3W A;  3VIA A;  2YT0 A;  1U5D A;  4HB0 B;  1XOD A;  1BTK A;  1MIX A;  3FM8 C;  2QKL A;  3D8E A;  5C79 A;  2RGN B;  1X1G A;  1N3H A;  4DX9 0;  3TW1 A;  1WG7 A;  3ODW A;  2LG1 A;  1MPH A;  1OMW A;  2BCJ A;  2D4Q A;  1UPR A;  4GN1 A;  1W1H A;  5CLL B;  1Y5O A;  4F7H A;  3RCP A;  1PFJ A;  4HDQ A;  5LON B;  4A6F A;  5JP4 A;  4A6K A;  3LJU X;  2IFS A;  1QQG A;  2RVB B;  1WGQ A;  2E2X A;  3KY9 A;  3A8Q A;  2D9X A;  1X1F A;  2K00 A;  3MPX A;  1U2B A;  3TCA A;  2CAY A;  2LOZ A;  2DA0 A;  2AEH A;  1TXD A;  3PG7 A;  2G35 A;  2Z0Q A;  4HDO A;  1UEF A;  2COC A;  5FI1 A;  4NSW A;  3ODO A;  4BBK A;  4GMX B;  3HW2 B;  4ZRI A;  2JP2 A;  2MWN B;  2YS3 A;  2EMT A;  2Q13 A;  5D3X A;  3SUZ A;  4KHO A;  1FAO A;  2UZS A;  2DHI A;  3P7Z A;  1MIZ B;  2FJL A;  3A98 B;  1FHO A;  4IOY X;  3SV1 A;  2P0F A;  1P6S A;  3ZVR A;  2Y7B A;  1W1D A;  2DYQ A;  2GCL A;  5CLQ B;  1P3R A;  1MK9 B;  2W2X D;  3AJ4 A;  4HAX B;  2PZ1 A;  2ELA A;  4F7G A;  2KGX B;  1ISN A;  1LB1 A;  2YT1 A;  1X11 A;  1DDM A;  1V88 A;  3QWM A;  4PNK A;  4HAV B;  4KAX B;  2CY5 A;  4TKN A;  1SGH A;  5JLJ B;  1U5F A;  1EF1 A;  4HAZ B;  1DYN A;  2D9Y A;  2D9Z A;  2RSG A;  4HAT B;  2D9V A;  1MAI A;  5JHG A;  2R09 A;  1U29 A;  2J0J A;  2YVC A;  3IVF A;  1BWN A;  2KCJ A;  1GG3 A;  1TQZ A;  1XKE A;  5HE2 A;  1PMS A;  2OQB A;  4EJN A;  3NSU A;  1PLS A;  5C5B A;  1FB8 A;  1EGX A;  1B55 A;  2EJ8 A;  2GCJ A;  1XCG A;  5HE0 A;  1FHX A;  4WVF B;  1SHC A;  5C16 A;  2LYD A;  2Z0P A;  3WYF B;  2VRW B;  5EFX A;  2EC1 A;  4HHV A;  1I7A A;  3QBV B;  4NY0 A;  3TFM A;  2DKP A;  3BIN A;  3ULB A;  1P5T A;  2D2Q A;  3O96 A;  2OTX A;  1V61 A;  2D10 A;  3AU5 A;  4H8S A;  4HAW B;  1NTV A;  2Z0O A;  1W1G A;  1UNP A;  2DLW A;  3QIJ A;  3ULC A;  3DXD A;  2YRY A;  2DX5 A;  1FOE A;  2X18 A;  4A6F B;  4EMO A;  4CHM A;  1I2H A;  4ZRJ A;  3X23 A;  2CY4 A;  3N7C A;  1ZSQ A;  1BTN A;  3M1I B;  4KVG B;  2GJY A;  3P6A A;  3D8F A;  2AL6 A;  1XX0 A;  2I5C A;  2RNR B;  1H4R A;  1UNR A;  4MT7 A;  1MK7 B;  3KSY A;  1NTY A;  3SYX A;  4KHA A;  2DFK A;  2KUP A;  1NU2 A;  2LKO A;  3D8D A;  5DHA B;  4A5K A;  5J3T A;  1MKE A;  4PQ0 A;  1H10 A;  2UVM A;  3HQC A;  4Y94 A;  2ZPY A;  5GOW B;  2ADZ A;  2DTC A;  2I1J A;  2H7E A;  2MFQ A;  5D3Y A;  3CIK A;  2VSZ A;  2DYN A;  5D27 A;  4DXA B;  1UPQ A;  1AWE A;  3U7D A;  2COA A;  3V5W A;  3PVU A;  2LOX A;  2COF A;  2IYB A;  1X05 A;  2I5F A;  3MDB C;  2Y8G A;  2W2W A;  4MK0 A;  3KRX A;  1U5E A;  1DDW A;  4K2P A;  4DX8 A;  4K81 A;  5J3Q A;  3FSS A;  1ZC3 B;  3AU4 A;  5DIF B;  5D3V A;  2M38 A;  2HE7 A;  5HE1 A;  1X86 A;  2P0D A;  1U5G A;  3FEH A;  5FI0 A;  4HB4 B;  4TYZ A;  2GS0 A;  3ODX A;  4IFS A;  2L1C A;  1WI1 A;  1K5D B;  3DXE A;  1XR0 B;  2K2J A;  1J0W A;  3VOQ A;  1WJ1 A;  1FGZ A;  1KZ7 A;  2UZR A;  4CHJ A;  4Z2N A;  5KCV A;  1IRS A;  3UZT A;  2DKQ A;  1NI2 A;  3GYO A;  1WJM A;  2Y8F A;  2RLO A;  4KHB B;  3BJI A;  4GMV A;  1Q67 A;  5DI9 B;  2V76 A; 
#chains in the Genus database with same CATH topology
 2YT2 A;  3PVL A;  1V89 A;  5I2S A;  1EAZ A;  1T77 A;  2YS1 A;  4HAU B;  2DHK A;  5I2M A;  5C5B B;  5LOP B;  2NZ8 B;  4Z2M B;  4HB2 B;  3TVV A;  4MY6 A;  2R2Y A;  1V5P A;  1ZM0 A;  1BAK A;  1XD4 A;  2EMS A;  1RRP B;  5DHF B;  2M14 A;  2N23 A;  4GZU A;  5IRS A;  2RUK B;  2W2X C;  1QC6 A;  1KI1 B;  1K5G B;  5KQ4 A;  4P7I A;  4K17 A;  4HB3 B;  4D0N B;  3ZDT A;  4GXB A;  5L81 A;  1Y19 B;  4QJ4 B;  2CRF A;  3KRW A;  2COD A;  2YF0 A;  3OAN A;  4L6E A;  1J19 A;  1ZVR A;  2KIG A;  2HTH B;  1V5M A;  5DH9 B;  3DXC A;  2D9W A;  2J59 M;  5J3Y A;  1ZYI A;  4A6H A;  2J0K A;  1KZG A;  4B6H A;  2R0D A;  4C0A A;  5KQ1 A;  2DN6 A;  1DRO A;  2P0H A;  4HAY B;  3G9W A;  2I1K A;  3SNH A;  3F5R A;  3PSC A;  4WSF A;  3F0W A;  2YS5 A;  3PP2 A;  5M4Y B;  2ROZ B;  4GPT B;  1GC7 A;  1Z87 A;  2QKM A;  1E5W A;  3T06 A;  2MDX A;  1FHW A;  2YSZ A;  2K2U A;  4D6W A;  4QJ3 B;  1WGU A;  3ML4 A;  3A8P A;  2VKI A;  4F7U P;  1DBH A;  4XWX A;  2MKR A;  4ZRK A;  2L2I A;  1TJ6 A;  4QJ5 B;  2Z14 A;  1UNQ A;  3WA0 A;  4YL8 A;  1WVH A;  1M7R A;  1OY2 A;  2DX1 A;  2ROV A;  4K2O A;  1AQC A;  3SO6 A;  3PEG A;  2XQN M;  5C6R A;  1GC6 A;  2H7D A;  4EKU A;  3HIE A;  3TO1 A;  1V5U A;  3U8Z A;  1ZC4 B;  4IAP A;  2D11 A;  3CXB B;  1MI1 A;  3GYP A;  2LUL A;  3HK0 A;  1FGY A;  4DBB A;  5JHH A;  4YON A;  2J0M A;  1LW3 A;  2ZKM X;  4WJ7 A;  1RJ2 A;  3KZ1 A;  3PZD A;  2NMB A;  2N0Y A;  2DHJ A;  1DDV A;  1M7E A;  1OQN A;  1U27 A;  2KR0 A;  3HSA A;  4CYE A;  5HE3 A;  2P8V A;  1EVH A;  3PVW A;  2ELB A;  5D3W A;  3VIA A;  2YT0 A;  1U5D A;  4HB0 B;  1XOD A;  1BTK A;  2K8E A;  1MIX A;  3FM8 C;  2QKL A;  4DIX A;  3B77 A;  3D8E A;  5C79 A;  2RGN B;  1X1G A;  1N3H A;  2RRF A;  4QXA B;  4DX9 0;  3TW1 A;  1WG7 A;  2Z13 A;  3ODW A;  2LG1 A;  1MPH A;  1OMW A;  2BCJ A;  2D4Q A;  1UPR A;  4GN1 A;  1W1H A;  5CLL B;  1Y5O A;  4F7H A;  3RCP A;  1PFJ A;  4HDQ A;  5LON B;  4A6F A;  5JP4 A;  4A6K A;  3LJU X;  2IFS A;  1QQG A;  2RVB B;  1WGQ A;  2E2X A;  3KY9 A;  3A8Q A;  2D9X A;  1X1F A;  2FJU B;  2K00 A;  3MPX A;  1U2B A;  3TCA A;  2CAY A;  2LOZ A;  2DA0 A;  2AEH A;  1TXD A;  3PG7 A;  2G35 A;  2Z0Q A;  4HDO A;  1UEF A;  2COC A;  2KIE A;  5FI1 A;  4NSW A;  3ODO A;  4BBK A;  4GMX B;  3HW2 B;  4ZRI A;  2JP2 A;  2MWN B;  2YS3 A;  2EMT A;  2Q13 A;  5D3X A;  3SUZ A;  4KHO A;  1FAO A;  2UZS A;  2NBV A;  2DHI A;  3P7Z A;  1MIZ B;  2FJL A;  3A98 B;  1FHO A;  4IOY X;  3SV1 A;  2P0F A;  1P6S A;  3ZVR A;  2Y7B A;  1W1D A;  2DYQ A;  2GUM A;  2K49 A;  2GCL A;  5CLQ B;  1P3R A;  1MK9 B;  2W2X D;  3AJ4 A;  4HAX B;  2PZ1 A;  2ELA A;  4F7G A;  2KGX B;  1ISN A;  1LB1 A;  2YT1 A;  1X11 A;  4GNK B;  1DDM A;  1V88 A;  3QWM A;  4PNK A;  4HAV B;  4KAX B;  2CY5 A;  4TKN A;  1SGH A;  5JLJ B;  1U5F A;  1EF1 A;  4HAZ B;  1DYN A;  5LG4 B;  2D9Y A;  2D9Z A;  2RSG A;  4HAT B;  2D9V A;  3DCX A;  1MAI A;  5JHG A;  4GOU A;  2R09 A;  1U29 A;  2J0J A;  2YVC A;  3IVF A;  1BWN A;  2KCJ A;  1GG3 A;  1TQZ A;  1XKE A;  5HE2 A;  1PMS A;  2OQB A;  4EJN A;  3NSU A;  1PLS A;  3NWF A;  5C5B A;  1FB8 A;  1EGX A;  1B55 A;  2EJ8 A;  2GCJ A;  1XCG A;  5HE0 A;  1FHX A;  4WVF B;  3NWD A;  1SHC A;  5C16 A;  2LYD A;  2Z0P A;  3WYF B;  2VRW B;  4OT1 A;  5EFX A;  2EC1 A;  4HHV A;  4L1R A;  1I7A A;  3QBV B;  4NY0 A;  3TFM A;  2DKP A;  3BIN A;  3A58 A;  3ULB A;  1P5T A;  2D2Q A;  3O96 A;  2OTX A;  1V61 A;  2D10 A;  3AU5 A;  3FVC A;  4H8S A;  4HAW B;  1NTV A;  2Z0O A;  3NW8 A;  1W1G A;  1UNP A;  2DLW A;  3QIJ A;  3ULC A;  3DXD A;  2YRY A;  2DX5 A;  1FOE A;  2Z4D A;  2X18 A;  4A6F B;  4EMO A;  4CHM A;  1I2H A;  4ZRJ A;  3X23 A;  2CY4 A;  3N7C A;  1ZSQ A;  1BTN A;  3M1I B;  4KVG B;  2GJY A;  3P6A A;  3D8F A;  2AL6 A;  1XX0 A;  2I5C A;  2RNR B;  1H4R A;  1UNR A;  4MT7 A;  3OHM B;  1MK7 B;  3KSY A;  1NTY A;  3SYX A;  4KHA A;  4OSN A;  2DFK A;  2KUP A;  1NU2 A;  2LKO A;  3D8D A;  5DHA B;  4A5K A;  5J3T A;  1MKE A;  4PQ0 A;  1H10 A;  2UVM A;  3HQC A;  4Y94 A;  2ZPY A;  5GOW B;  2ADZ A;  2DTC A;  2I1J A;  2H7E A;  2MFQ A;  5D3Y A;  3U12 A;  3CIK A;  2VSZ A;  2DYN A;  5D27 A;  4DXA B;  1UPQ A;  1AWE A;  3U7D A;  2COA A;  3V5W A;  3PVU A;  2LOX A;  2COF A;  2IYB A;  1X05 A;  2I5F A;  3MDB C;  2Y8G A;  4HSI A;  2W2W A;  4MK0 A;  3KRX A;  1U5E A;  1DDW A;  4K2P A;  4DX8 A;  4K81 A;  5J3Q A;  3FSS A;  1ZC3 B;  3AU4 A;  5DIF B;  5D3V A;  2Z59 A;  4CSQ A;  2M38 A;  2HE7 A;  5HE1 A;  4KHB A;  1X86 A;  2P0D A;  1U5G A;  3FEH A;  5FI0 A;  4HB4 B;  4TYZ A;  2GS0 A;  3ODX A;  4IFS A;  2L1C A;  1WI1 A;  1K5D B;  3DXE A;  1XR0 B;  2K2J A;  1J0W A;  3VOQ A;  1WJ1 A;  1FGZ A;  1KZ7 A;  2UZR A;  4CHJ A;  4Z2N A;  5KCV A;  1IRS A;  3UZT A;  2DKQ A;  3NWA A;  1NI2 A;  2KUQ A;  3GYO A;  1WJM A;  2Y8F A;  2RLO A;  4KHB B;  3BJI A;  4GMV A;  1Q67 A;  5DI9 B;  2V76 A; 
#chains in the Genus database with same CATH homology
 3PVL A;  1V89 A;  1EAZ A;  2YS1 A;  4HAU B;  2DHK A;  5C5B B;  5LOP B;  2NZ8 B;  4Z2M B;  4HB2 B;  3TVV A;  4MY6 A;  1V5P A;  1ZM0 A;  1BAK A;  1XD4 A;  2EMS A;  1RRP B;  5DHF B;  2M14 A;  2N23 A;  4GZU A;  2RUK B;  2W2X C;  1QC6 A;  1KI1 B;  1K5G B;  5KQ4 A;  4P7I A;  4K17 A;  4HB3 B;  4D0N B;  3ZDT A;  4GXB A;  5L81 A;  1Y19 B;  2CRF A;  3KRW A;  2COD A;  2YF0 A;  3OAN A;  4L6E A;  1J19 A;  1ZVR A;  2HTH B;  1V5M A;  5DH9 B;  3DXC A;  2D9W A;  2J59 M;  5J3Y A;  4A6H A;  2J0K A;  1KZG A;  4B6H A;  2R0D A;  4C0A A;  5KQ1 A;  2DN6 A;  1DRO A;  2P0H A;  4HAY B;  3G9W A;  2I1K A;  3SNH A;  3F5R A;  3PSC A;  4WSF A;  3F0W A;  2YS5 A;  3PP2 A;  2ROZ B;  4GPT B;  1GC7 A;  1Z87 A;  2QKM A;  1E5W A;  3T06 A;  2MDX A;  1FHW A;  2YSZ A;  2K2U A;  1WGU A;  3ML4 A;  3A8P A;  2VKI A;  4F7U P;  1DBH A;  4XWX A;  2MKR A;  4ZRK A;  2L2I A;  1TJ6 A;  1UNQ A;  3WA0 A;  4YL8 A;  1WVH A;  1M7R A;  4K2O A;  1OY2 A;  2DX1 A;  2ROV A;  1AQC A;  3SO6 A;  3PEG A;  2XQN M;  5C6R A;  1GC6 A;  2H7D A;  4EKU A;  3TO1 A;  1V5U A;  3U8Z A;  1ZC4 B;  4IAP A;  2D11 A;  3CXB B;  3GYP A;  2LUL A;  3HK0 A;  1FGY A;  4DBB A;  5JHH A;  4YON A;  2J0M A;  1LW3 A;  4WJ7 A;  1RJ2 A;  3KZ1 A;  3PZD A;  2NMB A;  2N0Y A;  2DHJ A;  1DDV A;  1M7E A;  1OQN A;  1U27 A;  4CYE A;  5HE3 A;  2P8V A;  1EVH A;  3PVW A;  2ELB A;  5D3W A;  3VIA A;  2YT0 A;  1U5D A;  4HB0 B;  1XOD A;  1BTK A;  1MIX A;  3FM8 C;  2QKL A;  3D8E A;  5C79 A;  2RGN B;  1X1G A;  1N3H A;  4DX9 0;  3TW1 A;  1WG7 A;  3ODW A;  2LG1 A;  1MPH A;  1OMW A;  2BCJ A;  2D4Q A;  1UPR A;  4GN1 A;  1W1H A;  5CLL B;  1Y5O A;  4F7H A;  3RCP A;  1PFJ A;  4HDQ A;  5LON B;  4A6F A;  5JP4 A;  4A6K A;  3LJU X;  2IFS A;  1QQG A;  2RVB B;  1WGQ A;  2E2X A;  3KY9 A;  3A8Q A;  2D9X A;  1X1F A;  2K00 A;  3MPX A;  1U2B A;  3TCA A;  2CAY A;  2LOZ A;  2DA0 A;  2AEH A;  1TXD A;  3PG7 A;  2G35 A;  2Z0Q A;  4HDO A;  1UEF A;  2COC A;  5FI1 A;  4NSW A;  3ODO A;  4BBK A;  4GMX B;  3HW2 B;  4ZRI A;  2JP2 A;  2MWN B;  2YS3 A;  2EMT A;  2Q13 A;  5D3X A;  3SUZ A;  4KHO A;  1FAO A;  2UZS A;  2DHI A;  3P7Z A;  1MIZ B;  2FJL A;  3A98 B;  1FHO A;  4IOY X;  3SV1 A;  2P0F A;  1P6S A;  3ZVR A;  2Y7B A;  1W1D A;  2DYQ A;  2GCL A;  5CLQ B;  1P3R A;  1MK9 B;  2W2X D;  3AJ4 A;  4HAX B;  2PZ1 A;  2ELA A;  4F7G A;  2KGX B;  1ISN A;  1LB1 A;  2YT1 A;  1X11 A;  1DDM A;  1V88 A;  3QWM A;  4PNK A;  4HAV B;  4KAX B;  2CY5 A;  4TKN A;  1SGH A;  5JLJ B;  1U5F A;  1EF1 A;  4HAZ B;  1DYN A;  2D9Y A;  2D9Z A;  2RSG A;  4HAT B;  2D9V A;  1MAI A;  5JHG A;  2R09 A;  1U29 A;  2J0J A;  2YVC A;  3IVF A;  1BWN A;  2KCJ A;  1GG3 A;  1TQZ A;  1XKE A;  5HE2 A;  1PMS A;  2OQB A;  4EJN A;  3NSU A;  1PLS A;  5C5B A;  1FB8 A;  1EGX A;  1B55 A;  2EJ8 A;  2GCJ A;  1XCG A;  5HE0 A;  1FHX A;  4WVF B;  1SHC A;  5C16 A;  2LYD A;  2Z0P A;  3WYF B;  2VRW B;  5EFX A;  2EC1 A;  4HHV A;  1I7A A;  3QBV B;  4NY0 A;  3TFM A;  2DKP A;  3BIN A;  3ULB A;  1P5T A;  2D2Q A;  3O96 A;  2OTX A;  1V61 A;  2D10 A;  3AU5 A;  4H8S A;  4HAW B;  1NTV A;  2Z0O A;  1W1G A;  1UNP A;  2DLW A;  3QIJ A;  3ULC A;  3DXD A;  2YRY A;  2DX5 A;  1FOE A;  2X18 A;  4A6F B;  4EMO A;  4CHM A;  1I2H A;  4ZRJ A;  3X23 A;  2CY4 A;  3N7C A;  1ZSQ A;  1BTN A;  3M1I B;  4KVG B;  2GJY A;  3P6A A;  3D8F A;  2AL6 A;  1XX0 A;  2I5C A;  2RNR B;  1H4R A;  1UNR A;  4MT7 A;  1MK7 B;  3KSY A;  1NTY A;  3SYX A;  4KHA A;  2DFK A;  2KUP A;  1NU2 A;  2LKO A;  3D8D A;  5DHA B;  4A5K A;  5J3T A;  1MKE A;  4PQ0 A;  1H10 A;  2UVM A;  3HQC A;  4Y94 A;  2ZPY A;  5GOW B;  2ADZ A;  2DTC A;  2I1J A;  2H7E A;  2MFQ A;  5D3Y A;  3CIK A;  2VSZ A;  2DYN A;  5D27 A;  4DXA B;  1UPQ A;  1AWE A;  3U7D A;  2COA A;  3V5W A;  3PVU A;  2LOX A;  2COF A;  2IYB A;  1X05 A;  2I5F A;  3MDB C;  2Y8G A;  2W2W A;  4MK0 A;  3KRX A;  1U5E A;  1DDW A;  4K2P A;  4DX8 A;  4K81 A;  5J3Q A;  3FSS A;  1ZC3 B;  3AU4 A;  5DIF B;  5D3V A;  2M38 A;  2HE7 A;  5HE1 A;  1X86 A;  2P0D A;  1U5G A;  3FEH A;  5FI0 A;  4HB4 B;  4TYZ A;  2GS0 A;  3ODX A;  4IFS A;  2L1C A;  1WI1 A;  1K5D B;  3DXE A;  1XR0 B;  2K2J A;  1J0W A;  3VOQ A;  1WJ1 A;  1FGZ A;  1KZ7 A;  2UZR A;  4CHJ A;  4Z2N A;  5KCV A;  1IRS A;  3UZT A;  2DKQ A;  1NI2 A;  3GYO A;  1WJM A;  2Y8F A;  2RLO A;  4KHB B;  3BJI A;  4GMV A;  1Q67 A;  5DI9 B;  2V76 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...