4HATB

Crystal structure of crm1 inhibitor leptomycin b in complex with crm1-ran-ranbp1
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
121
structure length
121
Chain Sequence
EEDEEVLYKVRAKLFRFDKDAKEWKERGTGDCKFLKNKKTNKVRILMRRDKTLKICANHIIAPEYTLKPNVGSDRSWVYACTADIAEGEAEAFTFAIRFGSKENADKFKEEFEKAQEINKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Nuclear export inhibition through covalent conjugation and hydrolysis of Leptomycin B by CRM1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport/antibiotic
molecule keywords GTP-binding nuclear protein Ran
total genus 35
structure length 121
sequence length 121
ec nomenclature
pdb deposition date 2012-09-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00638 Ran_BP1 RanBP1 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 4hatB00
1UNRA 1X11A 4EKUA 2DA0A 1MAIA 1MPHA 3D8DA 3G9WA 2P8VA 5D3YA 1XKEA 3HW2B 3N7CA 2IYBA 4KHBB 4KHOA 1U27A 2K2UA 5JLJB 3IVFA 4DBBA 1MIXA 3FEHA 2LG1A 4A6HA 2DHIA 4K2OA 1WI1A 1V88A 2P0FA 2FJLA 2DX1A 1I7AA 3P7ZA 3KRWA 2OQBA 1V89A 1XR0B 3PVUA 4KAXB 4MY6A 2E2XA 4HB3B 2YF0A 5C5BA 4K17A 1W1HA 2ADZA 1H4RA 2OTXA 1ZM0A 5C6RA 5CLQB 4HB0B 1W1DA 2UZRA 2DLWA 3P6AA 2QKMA 1GC6A 5FI1A 4B6HA 4Z2MB 1BTKA 3BJIA 1XODA 1V5PA 4KVGB 1XCGA 4A6KA 2MWNB 1V61A 1IRSA 3TW1A 3TVVA 4HAXB 4NSWA 4F7UP 2GCLA 3RCPA 4NY0A 2RLOA 2RVBB 4HB2B 2YRYA 3D8FA 2W2XC 5HE1A 4MK0A 2CY4A 2GS0A 2J0MA 1KZ7A 4P7IA 3WYFB 1GG3A 2CRFA 5JP4A 1P3RA 3FM8C 2Y8FA 2ELBA 4EJNA 5KCVA 2H7EA 2M38A 4H8SA 2D9YA 1NI2A 1UPQA 4HDQA 3QBVB 2XQNM 2D9ZA 4L6EA 3ML4A 5GOWB 2LULA 1TQZA 2LYDA 1XD4A 4F7GA 1MK9B 1TXDA 1B55A 2YT1A 2Y7BA 4WSFA 1J0WA 2GJYA 2VRWB 4DX90 1X86A 1FB8A 3KY9A 3NSUA 3D8EA 1MKEA 1J19A 4Z2NA 3T06A 4A6FA 4DX8A 1EAZA 1UNQA 2DYNA 4WJ7A 1UNPA 1W1GA 3AJ4A 5L81A 2EMSA 1E5WA 4ZRKA 2D9WA 2ZPYA 2DKQA 1UEFA 2M14A 1P6SA 2W2XD 1U2BA 5EFXA 1FHXA 1FHWA 2RUKB 3QIJA 4GMXB 5DH9B 2D10A 1DDWA 1EF1A 5HE2A 1K5DB 4XWXA 4CYEA 1WJ1A 5C79A 1TJ6A 2L1CA 3ULBA 1BAKA 1NTYA 2BCJA 2V76A 4DXAB 2RGNB 3SO6A 4ZRJA 2X18A 2DHKA 3X23A 2DYQA 2I1JA 1DBHA 3PVLA 1OMWA 4CHMA 1DDMA 3ULCA 1WGUA 1WGQA 1M7RA 2K2JA 1QC6A 4K2PA 2P0HA 1U5DA 1FHOA 5J3YA 1U5FA 2NZ8B 1ZSQA 2J0KA 2I1KA 2EJ8A 1EGXA 5CLLB 4F7HA 2CODA 1X1FA 2K00A 4GZUA 3ZVRA 1M7EA 1ZC4B 4PQ0A 4A6FB 2R09A 4GMVA 1GC7A 1AQCA 4ZRIA 4HDOA 1SGHA 2ELAA 3SYXA 2COFA 2YVCA 2DHJA 2DKPA 3F5RA 1U29A 2Z0PA 2I5FA 1FAOA 2DN6A 3MDBC 3LJUX 1UPRA 3ODWA 2Z0OA 4TKNA 2D9VA 1SHCA 1P5TA 2RSGA 1EVHA 4C0AA 2COAA 2J59M 2YT0A 5J3QA 1I2HA 3AU4A 1U5GA 3TO1A 3KSYA 5DI9B 5LONB 3GYOA 1V5MA 3V5WA 3MPXA 3KZ1A 1QQGA 5D3XA 2NMBA 5HE3A 4HAZB 2YS1A 1U5EA 2D4QA 1K5GB 1XX0A 2LKOA 4GXBA 1AWEA 2AEHA 2DFKA 3PEGA 1ZC3B 2KCJA 3O96A 4HAUB 2QKLA 5JHGA 1PMSA 2D9XA 4EMOA 2Z0QA 4HAVB 1ZVRA 3A8PA 5LOPB 3F0WA 1X1GA 2N0YA 4HAWB 2GCJA 5DHAB 2D11A 3GYPA 3KRXA 2KGXB 4YONA 4WVFB 2YS5A 3BINA 2L2IA 3QWMA 2Q13A 5DHFB 3PVWA 1Y5OA 3A8QA 2VKIA 3SNHA 5KQ4A 1MK7B 3WA0A 3HK0A 2DTCA 1X05A 3PG7A 2G35A 2HTHB 1BTNA 3HQCA 4D0NB 2MFQA 5KQ1A 2W2WA 4A5KA 5D3WA 2VSZA 5D3VA 1ISNA 1BWNA 4Y94A 1KZGA 1PLSA 3TFMA 1Z87A 5C16A 1OQNA 2MKRA 2D2QA 2JP2A 5JHHA 1DDVA 1LB1A 3PP2A 2UVMA 1WJMA 3UZTA 2EC1A 2IFSA 3ZDTA 1RRPB 3CXBB 2P0DA 3VIAA 4HHVA 3AU5A 4HATB 2PZ1A 3DXEA 1FGZA 4YL8A 3FSSA 5FI0A 1FGYA 2YS3A 3OANA 4TYZA 3U7DA 1OY2A 1WG7A 3U8ZA 3SV1A 2LOXA 2J0JA 4CHJA 4BBKA 1RJ2A 3DXDA 3M1IB 2DX5A 1V5UA 2HE7A 2Y8GA 1KI1B 2I5CA 3TCAA 2ROZB 5C5BB 3ODXA 1MIZB 4PNKA 2LOZA 4HAYB 1N3HA 1WVHA 2AL6A 3ODOA 5HE0A 2N23A 1FOEA 5D27A 1DYNA 2CAYA 2MDXA 4GN1A 1PFJA 3PSCA 3CIKA 1LW3A 3PZDA 2RNRB 3A98B 2CY5A 2EMTA 1DROA 4IOYX 4KHAA 5DIFB 4HB4B 2ROVA 2YSZA 1H10A 4MT7A 3SUZA 4K81A 2R0DA 4GPTB 1Y19B 4IAPA 3DXCA 2COCA 4IFSA 2UZSA 1NTVA 2KUPA 2H7DA 5J3TA 1Q67A 3VOQA 1NU2A
chains in the Genus database with same CATH superfamily
1UNRA 1X11A 4EKUA 2DA0A 1MAIA 1MPHA 3D8DA 3G9WA 2P8VA 5D3YA 1XKEA 3HW2B 3N7CA 2IYBA 4KHBB 4KHOA 1U27A 2K2UA 5JLJB 3IVFA 4DBBA 1MIXA 3FEHA 2LG1A 4A6HA 2DHIA 4K2OA 1WI1A 1V88A 2P0FA 2FJLA 2DX1A 1I7AA 2KUQA 3P7ZA 3KRWA 2OQBA 1V89A 1XR0B 3PVUA 4KAXB 4MY6A 2E2XA 4HB3B 2YF0A 3NWAA 5C5BA 4K17A 1W1HA 2ADZA 1H4RA 2OTXA 1ZM0A 5C6RA 5CLQB 4HB0B 1W1DA 2UZRA 2DLWA 3P6AA 2QKMA 1GC6A 5FI1A 4CSQA 4B6HA 4Z2MB 1BTKA 3BJIA 1XODA 1V5PA 4KVGB 1XCGA 4A6KA 2MWNB 1V61A 1IRSA 3TW1A 3TVVA 4HAXB 4NSWA 4F7UP 5LG4B 2GCLA 3RCPA 4NY0A 2RLOA 2RVBB 4HB2B 2YRYA 3D8FA 2W2XC 5HE1A 2Z4DA 4MK0A 2CY4A 4L1RA 2GS0A 2J0MA 1KZ7A 4P7IA 3WYFB 1GG3A 2CRFA 5JP4A 1P3RA 3FM8C 2Y8FA 2ELBA 4EJNA 5KCVA 2H7EA 2M38A 4H8SA 2D9YA 4D6WA 1NI2A 1UPQA 4HDQA 3QBVB 2XQNM 2D9ZA 4L6EA 3ML4A 5GOWB 2LULA 1TQZA 2LYDA 1XD4A 2ZKMX 3HSAA 4F7GA 1MK9B 1TXDA 1B55A 2YT1A 2Y7BA 4WSFA 5M4YB 1J0WA 2GJYA 2VRWB 4DX90 1X86A 1FB8A 2K8EA 4DIXA 3HIEA 3KY9A 3NSUA 3D8EA 1MKEA 1J19A 4Z2NA 3T06A 4A6FA 4DX8A 1EAZA 2Z13A 1UNQA 2DYNA 4WJ7A 1UNPA 2FJUB 1W1GA 3AJ4A 5L81A 2EMSA 1E5WA 4ZRKA 2D9WA 2ZPYA 2DKQA 1UEFA 2M14A 1P6SA 4QJ5B 3B77A 2W2XD 1U2BA 5EFXA 1FHXA 4QJ4B 1FHWA 2RUKB 2GUMA 3QIJA 4GMXB 3DCXA 5DH9B 2D10A 1DDWA 1EF1A 5HE2A 1K5DB 4XWXA 4CYEA 1WJ1A 5C79A 1TJ6A 2L1CA 3ULBA 1BAKA 1NTYA 2BCJA 2V76A 4DXAB 2RGNB 3SO6A 4ZRJA 2X18A 2DHKA 3X23A 2DYQA 2I1JA 1DBHA 3PVLA 1OMWA 4CHMA 3NWDA 1DDMA 3ULCA 4GNKB 1WGUA 1WGQA 3A58A 1M7RA 2K2JA 1QC6A 4K2PA 2P0HA 1U5DA 1FHOA 5J3YA 1U5FA 2NZ8B 1ZSQA 2J0KA 2I1KA 2EJ8A 1EGXA 5CLLB 4F7HA 2CODA 4OT1A 1X1FA 2K00A 4GZUA 3ZVRA 1M7EA 1ZC4B 4PQ0A 4A6FB 2R09A 4GMVA 1GC7A 3U12A 1AQCA 2Z59A 4ZRIA 4HDOA 1SGHA 2ELAA 3SYXA 2COFA 3NW8A 2YVCA 2DHJA 2DKPA 3F5RA 1U29A 2Z0PA 5IRSA 1ZYIA 2I5FA 1FAOA 2DN6A 3MDBC 4HSIA 3LJUX 1UPRA 3ODWA 4GOUA 2Z0OA 4TKNA 2D9VA 1SHCA 1P5TA 2RSGA 1EVHA 4C0AA 2COAA 2J59M 2YT0A 5I2SA 5J3QA 1I2HA 3AU4A 1U5GA 3TO1A 3KSYA 5DI9B 2KR0A 3GYOA 1V5MA 5LONB 3V5WA 3MPXA 3KZ1A 1QQGA 5D3XA 2NMBA 5HE3A 4HAZB 2YS1A 1U5EA 2D4QA 1K5GB 1XX0A 2LKOA 2R2YA 4GXBA 1AWEA 2AEHA 2DFKA 3PEGA 1ZC3B 2KCJA 3O96A 4HAUB 2QKLA 5JHGA 1PMSA 2D9XA 3NWFA 4EMOA 2Z0QA 4HAVB 1ZVRA 3A8PA 5LOPB 3F0WA 1X1GA 4QXAB 2N0YA 4HAWB 2GCJA 5DHAB 2D11A 3GYPA 3KRXA 2YT2A 2KGXB 4YONA 4WVFB 2YS5A 3BINA 2L2IA 3QWMA 2Q13A 2K49A 5DHFB 3PVWA 1Y5OA 3A8QA 2VKIA 3SNHA 5KQ4A 1MK7B 3WA0A 3HK0A 2DTCA 1X05A 3PG7A 2G35A 2HTHB 1BTNA 3HQCA 4D0NB 2MFQA 5KQ1A 2W2WA 2NBVA 4A5KA 5D3WA 2VSZA 5D3VA 2KIEA 1ISNA 1MI1A 1BWNA 4Y94A 1KZGA 3OHMB 1PLSA 3TFMA 4QJ3B 1Z87A 5C16A 1OQNA 2MKRA 2D2QA 2JP2A 5JHHA 1DDVA 1LB1A 3PP2A 2UVMA 1WJMA 3UZTA 2EC1A 2IFSA 3ZDTA 1RRPB 3CXBB 2P0DA 3VIAA 4HHVA 3AU5A 4HATB 2PZ1A 3DXEA 1FGZA 4YL8A 3FSSA 5I2MA 5FI0A 1FGYA 2YS3A 3OANA 4TYZA 3U7DA 1OY2A 2RRFA 1WG7A 3U8ZA 3SV1A 2LOXA 2J0JA 4CHJA 4BBKA 1RJ2A 3DXDA 3M1IB 2DX5A 1V5UA 2HE7A 2Y8GA 1KI1B 2I5CA 3TCAA 2ROZB 5C5BB 3ODXA 1MIZB 4PNKA 2LOZA 4HAYB 1N3HA 1WVHA 2AL6A 3ODOA 5HE0A 2Z14A 3FVCA 2N23A 1FOEA 5D27A 1DYNA 2CAYA 2MDXA 4GN1A 1PFJA 3PSCA 1T77A 3CIKA 1LW3A 3PZDA 2RNRB 3A98B 2CY5A 2EMTA 1DROA 4IOYX 4KHAA 5DIFB 4HB4B 2ROVA 2YSZA 1H10A 4KHBA 4MT7A 2KIGA 3SUZA 4K81A 2R0DA 4GPTB 1Y19B 4IAPA 3DXCA 2COCA 4IFSA 2UZSA 1NTVA 2KUPA 2H7DA 5J3TA 4OSNA 1Q67A 3VOQA 1NU2A
chains in the Genus database with same CATH topology
1UNRA 1X11A 4EKUA 2DA0A 1MAIA 1MPHA 3D8DA 3G9WA 2P8VA 5D3YA 1XKEA 3HW2B 3N7CA 2IYBA 4KHBB 4KHOA 1U27A 2K2UA 5JLJB 3IVFA 4DBBA 1MIXA 3FEHA 2LG1A 4A6HA 2DHIA 4K2OA 1WI1A 1V88A 2P0FA 2FJLA 2DX1A 1I7AA 3P7ZA 3KRWA 2OQBA 1V89A 1XR0B 3PVUA 4KAXB 4MY6A 2E2XA 4HB3B 2YF0A 5C5BA 4K17A 1W1HA 2ADZA 1H4RA 2OTXA 1ZM0A 5C6RA 5CLQB 4HB0B 1W1DA 2UZRA 2DLWA 3P6AA 2QKMA 1GC6A 5FI1A 4B6HA 4Z2MB 1BTKA 3BJIA 1XODA 1V5PA 4KVGB 1XCGA 4A6KA 2MWNB 1V61A 1IRSA 3TW1A 3TVVA 4HAXB 4NSWA 4F7UP 2GCLA 3RCPA 4NY0A 2RLOA 2RVBB 4HB2B 2YRYA 3D8FA 2W2XC 5HE1A 4MK0A 2CY4A 2GS0A 2J0MA 1KZ7A 4P7IA 3WYFB 1GG3A 2CRFA 5JP4A 1P3RA 3FM8C 2Y8FA 2ELBA 4EJNA 5KCVA 2H7EA 2M38A 4H8SA 2D9YA 1NI2A 1UPQA 4HDQA 3QBVB 2XQNM 2D9ZA 4L6EA 3ML4A 5GOWB 2LULA 1TQZA 2LYDA 1XD4A 4F7GA 1MK9B 1TXDA 1B55A 2YT1A 2Y7BA 4WSFA 1J0WA 2GJYA 2VRWB 4DX90 1X86A 1FB8A 3KY9A 3NSUA 3D8EA 1MKEA 1J19A 4Z2NA 3T06A 4A6FA 4DX8A 1EAZA 1UNQA 2DYNA 4WJ7A 1UNPA 1W1GA 3AJ4A 5L81A 2EMSA 1E5WA 4ZRKA 2D9WA 2ZPYA 2DKQA 1UEFA 2M14A 1P6SA 2W2XD 1U2BA 5EFXA 1FHXA 1FHWA 2RUKB 3QIJA 4GMXB 5DH9B 2D10A 1DDWA 1EF1A 5HE2A 1K5DB 4XWXA 4CYEA 1WJ1A 5C79A 1TJ6A 2L1CA 3ULBA 1BAKA 1NTYA 2BCJA 2V76A 4DXAB 2RGNB 3SO6A 4ZRJA 2X18A 2DHKA 3X23A 2DYQA 2I1JA 1DBHA 3PVLA 1OMWA 4CHMA 1DDMA 3ULCA 1WGUA 1WGQA 1M7RA 2K2JA 1QC6A 4K2PA 2P0HA 1U5DA 1FHOA 5J3YA 1U5FA 2NZ8B 1ZSQA 2J0KA 2I1KA 2EJ8A 1EGXA 5CLLB 4F7HA 2CODA 1X1FA 2K00A 4GZUA 3ZVRA 1M7EA 1ZC4B 4PQ0A 4A6FB 2R09A 4GMVA 1GC7A 1AQCA 4ZRIA 4HDOA 1SGHA 2ELAA 3SYXA 2COFA 2YVCA 2DHJA 2DKPA 3F5RA 1U29A 2Z0PA 2I5FA 1FAOA 2DN6A 3MDBC 3LJUX 1UPRA 3ODWA 2Z0OA 4TKNA 2D9VA 1SHCA 1P5TA 2RSGA 1EVHA 4C0AA 2COAA 2J59M 2YT0A 5J3QA 1I2HA 3AU4A 1U5GA 3TO1A 3KSYA 5DI9B 5LONB 3GYOA 1V5MA 3V5WA 3MPXA 3KZ1A 1QQGA 5D3XA 2NMBA 5HE3A 4HAZB 2YS1A 1U5EA 2D4QA 1K5GB 1XX0A 2LKOA 4GXBA 1AWEA 2AEHA 2DFKA 3PEGA 1ZC3B 2KCJA 3O96A 4HAUB 2QKLA 5JHGA 1PMSA 2D9XA 4EMOA 2Z0QA 4HAVB 1ZVRA 3A8PA 5LOPB 3F0WA 1X1GA 2N0YA 4HAWB 2GCJA 5DHAB 2D11A 3GYPA 3KRXA 2KGXB 4YONA 4WVFB 2YS5A 3BINA 2L2IA 3QWMA 2Q13A 5DHFB 3PVWA 1Y5OA 3A8QA 2VKIA 3SNHA 5KQ4A 1MK7B 3WA0A 3HK0A 2DTCA 1X05A 3PG7A 2G35A 2HTHB 1BTNA 3HQCA 4D0NB 2MFQA 5KQ1A 2W2WA 4A5KA 5D3WA 2VSZA 5D3VA 1ISNA 1BWNA 4Y94A 1KZGA 1PLSA 3TFMA 1Z87A 5C16A 1OQNA 2MKRA 2D2QA 2JP2A 5JHHA 1DDVA 1LB1A 3PP2A 2UVMA 1WJMA 3UZTA 2EC1A 2IFSA 3ZDTA 1RRPB 3CXBB 2P0DA 3VIAA 4HHVA 3AU5A 4HATB 2PZ1A 3DXEA 1FGZA 4YL8A 3FSSA 5FI0A 1FGYA 2YS3A 3OANA 4TYZA 3U7DA 1OY2A 1WG7A 3U8ZA 3SV1A 2LOXA 2J0JA 4CHJA 4BBKA 1RJ2A 3DXDA 3M1IB 2DX5A 1V5UA 2HE7A 2Y8GA 1KI1B 2I5CA 3TCAA 2ROZB 5C5BB 3ODXA 1MIZB 4PNKA 2LOZA 4HAYB 1N3HA 1WVHA 2AL6A 3ODOA 5HE0A 2N23A 1FOEA 5D27A 1DYNA 2CAYA 2MDXA 4GN1A 1PFJA 3PSCA 3CIKA 1LW3A 3PZDA 2RNRB 3A98B 2CY5A 2EMTA 1DROA 4IOYX 4KHAA 5DIFB 4HB4B 2ROVA 2YSZA 1H10A 4MT7A 3SUZA 4K81A 2R0DA 4GPTB 1Y19B 4IAPA 3DXCA 2COCA 4IFSA 2UZSA 1NTVA 2KUPA 2H7DA 5J3TA 1Q67A 3VOQA 1NU2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UNR A;  1X11 A;  4EKU A;  2DA0 A;  1MAI A;  1MPH A;  3D8D A;  3G9W A;  2P8V A;  5D3Y A;  1XKE A;  3HW2 B;  3N7C A;  2IYB A;  4KHB B;  4KHO A;  1U27 A;  2K2U A;  5JLJ B;  3IVF A;  4DBB A;  1MIX A;  3FEH A;  2LG1 A;  4A6H A;  2DHI A;  4K2O A;  1WI1 A;  1V88 A;  2P0F A;  2FJL A;  2DX1 A;  1I7A A;  3P7Z A;  3KRW A;  2OQB A;  1V89 A;  1XR0 B;  3PVU A;  4KAX B;  4MY6 A;  2E2X A;  4HB3 B;  2YF0 A;  5C5B A;  4K17 A;  1W1H A;  2ADZ A;  1H4R A;  2OTX A;  1ZM0 A;  5C6R A;  5CLQ B;  4HB0 B;  1W1D A;  2UZR A;  2DLW A;  3P6A A;  2QKM A;  1GC6 A;  5FI1 A;  4B6H A;  4Z2M B;  1BTK A;  3BJI A;  1XOD A;  1V5P A;  4KVG B;  1XCG A;  4A6K A;  2MWN B;  1V61 A;  1IRS A;  3TW1 A;  3TVV A;  4HAX B;  4NSW A;  4F7U P;  2GCL A;  3RCP A;  4NY0 A;  2RLO A;  2RVB B;  4HB2 B;  2YRY A;  3D8F A;  2W2X C;  5HE1 A;  4MK0 A;  2CY4 A;  2GS0 A;  2J0M A;  1KZ7 A;  4P7I A;  3WYF B;  1GG3 A;  2CRF A;  5JP4 A;  1P3R A;  3FM8 C;  2Y8F A;  2ELB A;  4EJN A;  5KCV A;  2H7E A;  2M38 A;  4H8S A;  2D9Y A;  1NI2 A;  1UPQ A;  4HDQ A;  3QBV B;  2XQN M;  2D9Z A;  4L6E A;  3ML4 A;  5GOW B;  2LUL A;  1TQZ A;  2LYD A;  1XD4 A;  4F7G A;  1MK9 B;  1TXD A;  1B55 A;  2YT1 A;  2Y7B A;  4WSF A;  1J0W A;  2GJY A;  2VRW B;  4DX9 0;  1X86 A;  1FB8 A;  3KY9 A;  3NSU A;  3D8E A;  1MKE A;  1J19 A;  4Z2N A;  3T06 A;  4A6F A;  4DX8 A;  1EAZ A;  1UNQ A;  2DYN A;  4WJ7 A;  1UNP A;  1W1G A;  3AJ4 A;  5L81 A;  2EMS A;  1E5W A;  4ZRK A;  2D9W A;  2ZPY A;  2DKQ A;  1UEF A;  2M14 A;  1P6S A;  2W2X D;  1U2B A;  5EFX A;  1FHX A;  1FHW A;  2RUK B;  3QIJ A;  4GMX B;  5DH9 B;  2D10 A;  1DDW A;  1EF1 A;  5HE2 A;  1K5D B;  4XWX A;  4CYE A;  1WJ1 A;  5C79 A;  1TJ6 A;  2L1C A;  3ULB A;  1BAK A;  1NTY A;  2BCJ A;  2V76 A;  4DXA B;  2RGN B;  3SO6 A;  4ZRJ A;  2X18 A;  2DHK A;  3X23 A;  2DYQ A;  2I1J A;  1DBH A;  3PVL A;  1OMW A;  4CHM A;  1DDM A;  3ULC A;  1WGU A;  1WGQ A;  1M7R A;  2K2J A;  1QC6 A;  4K2P A;  2P0H A;  1U5D A;  1FHO A;  5J3Y A;  1U5F A;  2NZ8 B;  1ZSQ A;  2J0K A;  2I1K A;  2EJ8 A;  1EGX A;  5CLL B;  4F7H A;  2COD A;  1X1F A;  2K00 A;  4GZU A;  3ZVR A;  1M7E A;  1ZC4 B;  4PQ0 A;  4A6F B;  2R09 A;  4GMV A;  1GC7 A;  1AQC A;  4ZRI A;  4HDO A;  1SGH A;  2ELA A;  3SYX A;  2COF A;  2YVC A;  2DHJ A;  2DKP A;  3F5R A;  1U29 A;  2Z0P A;  2I5F A;  1FAO A;  2DN6 A;  3MDB C;  3LJU X;  1UPR A;  3ODW A;  2Z0O A;  4TKN A;  2D9V A;  1SHC A;  1P5T A;  2RSG A;  1EVH A;  4C0A A;  2COA A;  2J59 M;  2YT0 A;  5J3Q A;  1I2H A;  3AU4 A;  1U5G A;  3TO1 A;  3KSY A;  5DI9 B;  5LON B;  3GYO A;  1V5M A;  3V5W A;  3MPX A;  3KZ1 A;  1QQG A;  5D3X A;  2NMB A;  5HE3 A;  4HAZ B;  2YS1 A;  1U5E A;  2D4Q A;  1K5G B;  1XX0 A;  2LKO A;  4GXB A;  1AWE A;  2AEH A;  2DFK A;  3PEG A;  1ZC3 B;  2KCJ A;  3O96 A;  4HAU B;  2QKL A;  5JHG A;  1PMS A;  2D9X A;  4EMO A;  2Z0Q A;  4HAV B;  1ZVR A;  3A8P A;  5LOP B;  3F0W A;  1X1G A;  2N0Y A;  4HAW B;  2GCJ A;  5DHA B;  2D11 A;  3GYP A;  3KRX A;  2KGX B;  4YON A;  4WVF B;  2YS5 A;  3BIN A;  2L2I A;  3QWM A;  2Q13 A;  5DHF B;  3PVW A;  1Y5O A;  3A8Q A;  2VKI A;  3SNH A;  5KQ4 A;  1MK7 B;  3WA0 A;  3HK0 A;  2DTC A;  1X05 A;  3PG7 A;  2G35 A;  2HTH B;  1BTN A;  3HQC A;  4D0N B;  2MFQ A;  5KQ1 A;  2W2W A;  4A5K A;  5D3W A;  2VSZ A;  5D3V A;  1ISN A;  1BWN A;  4Y94 A;  1KZG A;  1PLS A;  3TFM A;  1Z87 A;  5C16 A;  1OQN A;  2MKR A;  2D2Q A;  2JP2 A;  5JHH A;  1DDV A;  1LB1 A;  3PP2 A;  2UVM A;  1WJM A;  3UZT A;  2EC1 A;  2IFS A;  3ZDT A;  1RRP B;  3CXB B;  2P0D A;  3VIA A;  4HHV A;  3AU5 A;  4HAT B;  2PZ1 A;  3DXE A;  1FGZ A;  4YL8 A;  3FSS A;  5FI0 A;  1FGY A;  2YS3 A;  3OAN A;  4TYZ A;  3U7D A;  1OY2 A;  1WG7 A;  3U8Z A;  3SV1 A;  2LOX A;  2J0J A;  4CHJ A;  4BBK A;  1RJ2 A;  3DXD A;  3M1I B;  2DX5 A;  1V5U A;  2HE7 A;  2Y8G A;  1KI1 B;  2I5C A;  3TCA A;  2ROZ B;  5C5B B;  3ODX A;  1MIZ B;  4PNK A;  2LOZ A;  4HAY B;  1N3H A;  1WVH A;  2AL6 A;  3ODO A;  5HE0 A;  2N23 A;  1FOE A;  5D27 A;  1DYN A;  2CAY A;  2MDX A;  4GN1 A;  1PFJ A;  3PSC A;  3CIK A;  1LW3 A;  3PZD A;  2RNR B;  3A98 B;  2CY5 A;  2EMT A;  1DRO A;  4IOY X;  4KHA A;  5DIF B;  4HB4 B;  2ROV A;  2YSZ A;  1H10 A;  4MT7 A;  3SUZ A;  4K81 A;  2R0D A;  4GPT B;  1Y19 B;  4IAP A;  3DXC A;  2COC A;  4IFS A;  2UZS A;  1NTV A;  2KUP A;  2H7D A;  5J3T A;  1Q67 A;  3VOQ A;  1NU2 A; 
#chains in the Genus database with same CATH topology
 1UNR A;  1X11 A;  4EKU A;  2DA0 A;  1MAI A;  1MPH A;  3D8D A;  3G9W A;  2P8V A;  5D3Y A;  1XKE A;  3HW2 B;  3N7C A;  2IYB A;  4KHB B;  4KHO A;  1U27 A;  2K2U A;  5JLJ B;  3IVF A;  4DBB A;  1MIX A;  3FEH A;  2LG1 A;  4A6H A;  2DHI A;  4K2O A;  1WI1 A;  1V88 A;  2P0F A;  2FJL A;  2DX1 A;  1I7A A;  2KUQ A;  3P7Z A;  3KRW A;  2OQB A;  1V89 A;  1XR0 B;  3PVU A;  4KAX B;  4MY6 A;  2E2X A;  4HB3 B;  2YF0 A;  3NWA A;  5C5B A;  4K17 A;  1W1H A;  2ADZ A;  1H4R A;  2OTX A;  1ZM0 A;  5C6R A;  5CLQ B;  4HB0 B;  1W1D A;  2UZR A;  2DLW A;  3P6A A;  2QKM A;  1GC6 A;  5FI1 A;  4CSQ A;  4B6H A;  4Z2M B;  1BTK A;  3BJI A;  1XOD A;  1V5P A;  4KVG B;  1XCG A;  4A6K A;  2MWN B;  1V61 A;  1IRS A;  3TW1 A;  3TVV A;  4HAX B;  4NSW A;  4F7U P;  5LG4 B;  2GCL A;  3RCP A;  4NY0 A;  2RLO A;  2RVB B;  4HB2 B;  2YRY A;  3D8F A;  2W2X C;  5HE1 A;  2Z4D A;  4MK0 A;  2CY4 A;  4L1R A;  2GS0 A;  2J0M A;  1KZ7 A;  4P7I A;  3WYF B;  1GG3 A;  2CRF A;  5JP4 A;  1P3R A;  3FM8 C;  2Y8F A;  2ELB A;  4EJN A;  5KCV A;  2H7E A;  2M38 A;  4H8S A;  2D9Y A;  4D6W A;  1NI2 A;  1UPQ A;  4HDQ A;  3QBV B;  2XQN M;  2D9Z A;  4L6E A;  3ML4 A;  5GOW B;  2LUL A;  1TQZ A;  2LYD A;  1XD4 A;  2ZKM X;  3HSA A;  4F7G A;  1MK9 B;  1TXD A;  1B55 A;  2YT1 A;  2Y7B A;  4WSF A;  5M4Y B;  1J0W A;  2GJY A;  2VRW B;  4DX9 0;  1X86 A;  1FB8 A;  2K8E A;  4DIX A;  3HIE A;  3KY9 A;  3NSU A;  3D8E A;  1MKE A;  1J19 A;  4Z2N A;  3T06 A;  4A6F A;  4DX8 A;  1EAZ A;  2Z13 A;  1UNQ A;  2DYN A;  4WJ7 A;  1UNP A;  2FJU B;  1W1G A;  3AJ4 A;  5L81 A;  2EMS A;  1E5W A;  4ZRK A;  2D9W A;  2ZPY A;  2DKQ A;  1UEF A;  2M14 A;  1P6S A;  4QJ5 B;  3B77 A;  2W2X D;  1U2B A;  5EFX A;  1FHX A;  4QJ4 B;  1FHW A;  2RUK B;  2GUM A;  3QIJ A;  4GMX B;  3DCX A;  5DH9 B;  2D10 A;  1DDW A;  1EF1 A;  5HE2 A;  1K5D B;  4XWX A;  4CYE A;  1WJ1 A;  5C79 A;  1TJ6 A;  2L1C A;  3ULB A;  1BAK A;  1NTY A;  2BCJ A;  2V76 A;  4DXA B;  2RGN B;  3SO6 A;  4ZRJ A;  2X18 A;  2DHK A;  3X23 A;  2DYQ A;  2I1J A;  1DBH A;  3PVL A;  1OMW A;  4CHM A;  3NWD A;  1DDM A;  3ULC A;  4GNK B;  1WGU A;  1WGQ A;  3A58 A;  1M7R A;  2K2J A;  1QC6 A;  4K2P A;  2P0H A;  1U5D A;  1FHO A;  5J3Y A;  1U5F A;  2NZ8 B;  1ZSQ A;  2J0K A;  2I1K A;  2EJ8 A;  1EGX A;  5CLL B;  4F7H A;  2COD A;  4OT1 A;  1X1F A;  2K00 A;  4GZU A;  3ZVR A;  1M7E A;  1ZC4 B;  4PQ0 A;  4A6F B;  2R09 A;  4GMV A;  1GC7 A;  3U12 A;  1AQC A;  2Z59 A;  4ZRI A;  4HDO A;  1SGH A;  2ELA A;  3SYX A;  2COF A;  3NW8 A;  2YVC A;  2DHJ A;  2DKP A;  3F5R A;  1U29 A;  2Z0P A;  5IRS A;  1ZYI A;  2I5F A;  1FAO A;  2DN6 A;  3MDB C;  4HSI A;  3LJU X;  1UPR A;  3ODW A;  4GOU A;  2Z0O A;  4TKN A;  2D9V A;  1SHC A;  1P5T A;  2RSG A;  1EVH A;  4C0A A;  2COA A;  2J59 M;  2YT0 A;  5I2S A;  5J3Q A;  1I2H A;  3AU4 A;  1U5G A;  3TO1 A;  3KSY A;  5DI9 B;  2KR0 A;  3GYO A;  1V5M A;  5LON B;  3V5W A;  3MPX A;  3KZ1 A;  1QQG A;  5D3X A;  2NMB A;  5HE3 A;  4HAZ B;  2YS1 A;  1U5E A;  2D4Q A;  1K5G B;  1XX0 A;  2LKO A;  2R2Y A;  4GXB A;  1AWE A;  2AEH A;  2DFK A;  3PEG A;  1ZC3 B;  2KCJ A;  3O96 A;  4HAU B;  2QKL A;  5JHG A;  1PMS A;  2D9X A;  3NWF A;  4EMO A;  2Z0Q A;  4HAV B;  1ZVR A;  3A8P A;  5LOP B;  3F0W A;  1X1G A;  4QXA B;  2N0Y A;  4HAW B;  2GCJ A;  5DHA B;  2D11 A;  3GYP A;  3KRX A;  2YT2 A;  2KGX B;  4YON A;  4WVF B;  2YS5 A;  3BIN A;  2L2I A;  3QWM A;  2Q13 A;  2K49 A;  5DHF B;  3PVW A;  1Y5O A;  3A8Q A;  2VKI A;  3SNH A;  5KQ4 A;  1MK7 B;  3WA0 A;  3HK0 A;  2DTC A;  1X05 A;  3PG7 A;  2G35 A;  2HTH B;  1BTN A;  3HQC A;  4D0N B;  2MFQ A;  5KQ1 A;  2W2W A;  2NBV A;  4A5K A;  5D3W A;  2VSZ A;  5D3V A;  2KIE A;  1ISN A;  1MI1 A;  1BWN A;  4Y94 A;  1KZG A;  3OHM B;  1PLS A;  3TFM A;  4QJ3 B;  1Z87 A;  5C16 A;  1OQN A;  2MKR A;  2D2Q A;  2JP2 A;  5JHH A;  1DDV A;  1LB1 A;  3PP2 A;  2UVM A;  1WJM A;  3UZT A;  2EC1 A;  2IFS A;  3ZDT A;  1RRP B;  3CXB B;  2P0D A;  3VIA A;  4HHV A;  3AU5 A;  4HAT B;  2PZ1 A;  3DXE A;  1FGZ A;  4YL8 A;  3FSS A;  5I2M A;  5FI0 A;  1FGY A;  2YS3 A;  3OAN A;  4TYZ A;  3U7D A;  1OY2 A;  2RRF A;  1WG7 A;  3U8Z A;  3SV1 A;  2LOX A;  2J0J A;  4CHJ A;  4BBK A;  1RJ2 A;  3DXD A;  3M1I B;  2DX5 A;  1V5U A;  2HE7 A;  2Y8G A;  1KI1 B;  2I5C A;  3TCA A;  2ROZ B;  5C5B B;  3ODX A;  1MIZ B;  4PNK A;  2LOZ A;  4HAY B;  1N3H A;  1WVH A;  2AL6 A;  3ODO A;  5HE0 A;  2Z14 A;  3FVC A;  2N23 A;  1FOE A;  5D27 A;  1DYN A;  2CAY A;  2MDX A;  4GN1 A;  1PFJ A;  3PSC A;  1T77 A;  3CIK A;  1LW3 A;  3PZD A;  2RNR B;  3A98 B;  2CY5 A;  2EMT A;  1DRO A;  4IOY X;  4KHA A;  5DIF B;  4HB4 B;  2ROV A;  2YSZ A;  1H10 A;  4KHB A;  4MT7 A;  2KIG A;  3SUZ A;  4K81 A;  2R0D A;  4GPT B;  1Y19 B;  4IAP A;  3DXC A;  2COC A;  4IFS A;  2UZS A;  1NTV A;  2KUP A;  2H7D A;  5J3T A;  4OSN A;  1Q67 A;  3VOQ A;  1NU2 A; 
#chains in the Genus database with same CATH homology
 1UNR A;  1X11 A;  4EKU A;  2DA0 A;  1MAI A;  1MPH A;  3D8D A;  3G9W A;  2P8V A;  5D3Y A;  1XKE A;  3HW2 B;  3N7C A;  2IYB A;  4KHB B;  4KHO A;  1U27 A;  2K2U A;  5JLJ B;  3IVF A;  4DBB A;  1MIX A;  3FEH A;  2LG1 A;  4A6H A;  2DHI A;  4K2O A;  1WI1 A;  1V88 A;  2P0F A;  2FJL A;  2DX1 A;  1I7A A;  3P7Z A;  3KRW A;  2OQB A;  1V89 A;  1XR0 B;  3PVU A;  4KAX B;  4MY6 A;  2E2X A;  4HB3 B;  2YF0 A;  5C5B A;  4K17 A;  1W1H A;  2ADZ A;  1H4R A;  2OTX A;  1ZM0 A;  5C6R A;  5CLQ B;  4HB0 B;  1W1D A;  2UZR A;  2DLW A;  3P6A A;  2QKM A;  1GC6 A;  5FI1 A;  4B6H A;  4Z2M B;  1BTK A;  3BJI A;  1XOD A;  1V5P A;  4KVG B;  1XCG A;  4A6K A;  2MWN B;  1V61 A;  1IRS A;  3TW1 A;  3TVV A;  4HAX B;  4NSW A;  4F7U P;  2GCL A;  3RCP A;  4NY0 A;  2RLO A;  2RVB B;  4HB2 B;  2YRY A;  3D8F A;  2W2X C;  5HE1 A;  4MK0 A;  2CY4 A;  2GS0 A;  2J0M A;  1KZ7 A;  4P7I A;  3WYF B;  1GG3 A;  2CRF A;  5JP4 A;  1P3R A;  3FM8 C;  2Y8F A;  2ELB A;  4EJN A;  5KCV A;  2H7E A;  2M38 A;  4H8S A;  2D9Y A;  1NI2 A;  1UPQ A;  4HDQ A;  3QBV B;  2XQN M;  2D9Z A;  4L6E A;  3ML4 A;  5GOW B;  2LUL A;  1TQZ A;  2LYD A;  1XD4 A;  4F7G A;  1MK9 B;  1TXD A;  1B55 A;  2YT1 A;  2Y7B A;  4WSF A;  1J0W A;  2GJY A;  2VRW B;  4DX9 0;  1X86 A;  1FB8 A;  3KY9 A;  3NSU A;  3D8E A;  1MKE A;  1J19 A;  4Z2N A;  3T06 A;  4A6F A;  4DX8 A;  1EAZ A;  1UNQ A;  2DYN A;  4WJ7 A;  1UNP A;  1W1G A;  3AJ4 A;  5L81 A;  2EMS A;  1E5W A;  4ZRK A;  2D9W A;  2ZPY A;  2DKQ A;  1UEF A;  2M14 A;  1P6S A;  2W2X D;  1U2B A;  5EFX A;  1FHX A;  1FHW A;  2RUK B;  3QIJ A;  4GMX B;  5DH9 B;  2D10 A;  1DDW A;  1EF1 A;  5HE2 A;  1K5D B;  4XWX A;  4CYE A;  1WJ1 A;  5C79 A;  1TJ6 A;  2L1C A;  3ULB A;  1BAK A;  1NTY A;  2BCJ A;  2V76 A;  4DXA B;  2RGN B;  3SO6 A;  4ZRJ A;  2X18 A;  2DHK A;  3X23 A;  2DYQ A;  2I1J A;  1DBH A;  3PVL A;  1OMW A;  4CHM A;  1DDM A;  3ULC A;  1WGU A;  1WGQ A;  1M7R A;  2K2J A;  1QC6 A;  4K2P A;  2P0H A;  1U5D A;  1FHO A;  5J3Y A;  1U5F A;  2NZ8 B;  1ZSQ A;  2J0K A;  2I1K A;  2EJ8 A;  1EGX A;  5CLL B;  4F7H A;  2COD A;  1X1F A;  2K00 A;  4GZU A;  3ZVR A;  1M7E A;  1ZC4 B;  4PQ0 A;  4A6F B;  2R09 A;  4GMV A;  1GC7 A;  1AQC A;  4ZRI A;  4HDO A;  1SGH A;  2ELA A;  3SYX A;  2COF A;  2YVC A;  2DHJ A;  2DKP A;  3F5R A;  1U29 A;  2Z0P A;  2I5F A;  1FAO A;  2DN6 A;  3MDB C;  3LJU X;  1UPR A;  3ODW A;  2Z0O A;  4TKN A;  2D9V A;  1SHC A;  1P5T A;  2RSG A;  1EVH A;  4C0A A;  2COA A;  2J59 M;  2YT0 A;  5J3Q A;  1I2H A;  3AU4 A;  1U5G A;  3TO1 A;  3KSY A;  5DI9 B;  5LON B;  3GYO A;  1V5M A;  3V5W A;  3MPX A;  3KZ1 A;  1QQG A;  5D3X A;  2NMB A;  5HE3 A;  4HAZ B;  2YS1 A;  1U5E A;  2D4Q A;  1K5G B;  1XX0 A;  2LKO A;  4GXB A;  1AWE A;  2AEH A;  2DFK A;  3PEG A;  1ZC3 B;  2KCJ A;  3O96 A;  4HAU B;  2QKL A;  5JHG A;  1PMS A;  2D9X A;  4EMO A;  2Z0Q A;  4HAV B;  1ZVR A;  3A8P A;  5LOP B;  3F0W A;  1X1G A;  2N0Y A;  4HAW B;  2GCJ A;  5DHA B;  2D11 A;  3GYP A;  3KRX A;  2KGX B;  4YON A;  4WVF B;  2YS5 A;  3BIN A;  2L2I A;  3QWM A;  2Q13 A;  5DHF B;  3PVW A;  1Y5O A;  3A8Q A;  2VKI A;  3SNH A;  5KQ4 A;  1MK7 B;  3WA0 A;  3HK0 A;  2DTC A;  1X05 A;  3PG7 A;  2G35 A;  2HTH B;  1BTN A;  3HQC A;  4D0N B;  2MFQ A;  5KQ1 A;  2W2W A;  4A5K A;  5D3W A;  2VSZ A;  5D3V A;  1ISN A;  1BWN A;  4Y94 A;  1KZG A;  1PLS A;  3TFM A;  1Z87 A;  5C16 A;  1OQN A;  2MKR A;  2D2Q A;  2JP2 A;  5JHH A;  1DDV A;  1LB1 A;  3PP2 A;  2UVM A;  1WJM A;  3UZT A;  2EC1 A;  2IFS A;  3ZDT A;  1RRP B;  3CXB B;  2P0D A;  3VIA A;  4HHV A;  3AU5 A;  4HAT B;  2PZ1 A;  3DXE A;  1FGZ A;  4YL8 A;  3FSS A;  5FI0 A;  1FGY A;  2YS3 A;  3OAN A;  4TYZ A;  3U7D A;  1OY2 A;  1WG7 A;  3U8Z A;  3SV1 A;  2LOX A;  2J0J A;  4CHJ A;  4BBK A;  1RJ2 A;  3DXD A;  3M1I B;  2DX5 A;  1V5U A;  2HE7 A;  2Y8G A;  1KI1 B;  2I5C A;  3TCA A;  2ROZ B;  5C5B B;  3ODX A;  1MIZ B;  4PNK A;  2LOZ A;  4HAY B;  1N3H A;  1WVH A;  2AL6 A;  3ODO A;  5HE0 A;  2N23 A;  1FOE A;  5D27 A;  1DYN A;  2CAY A;  2MDX A;  4GN1 A;  1PFJ A;  3PSC A;  3CIK A;  1LW3 A;  3PZD A;  2RNR B;  3A98 B;  2CY5 A;  2EMT A;  1DRO A;  4IOY X;  4KHA A;  5DIF B;  4HB4 B;  2ROV A;  2YSZ A;  1H10 A;  4MT7 A;  3SUZ A;  4K81 A;  2R0D A;  4GPT B;  1Y19 B;  4IAP A;  3DXC A;  2COC A;  4IFS A;  2UZS A;  1NTV A;  2KUP A;  2H7D A;  5J3T A;  1Q67 A;  3VOQ A;  1NU2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...