4HATB

Crystal structure of crm1 inhibitor leptomycin b in complex with crm1-ran-ranbp1
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
121
structure length
121
Chain Sequence
EEDEEVLYKVRAKLFRFDKDAKEWKERGTGDCKFLKNKKTNKVRILMRRDKTLKICANHIIAPEYTLKPNVGSDRSWVYACTADIAEGEAEAFTFAIRFGSKENADKFKEEFEKAQEINKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GTP-binding nuclear protein Ran
publication title Nuclear export inhibition through covalent conjugation and hydrolysis of Leptomycin B by CRM1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport/antibiotic
total genus 35
structure length 121
sequence length 121
ec nomenclature
pdb deposition date 2012-09-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00638 Ran_BP1 RanBP1 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 4hatB00
4HAYB 1MIZB 2VSZA 2N0YA 1U5EA 1NTYA 1FGYA 3HK0A 2Z0QA 5GOWB 2IFSA 2ELBA 2L1CA 2P0FA 2MKRA 2NMBA 3F5RA 1DDMA 4YONA 5D3WA 4GMXB 3DXEA 4C0AA 4DX90 2DKQA 2LG1A 2MWNB 1QQGA 2RVBB 2XQNM 3V5WA 2COFA 3U7DA 4HAUB 5EFXA 5L81A 1FAOA 2P0HA 1OY2A 2YRYA 1X86A 2N23A 4IFSA 2D9XA 4HB2B 5LONB 1K5DB 2R09A 1SGHA 2EC1A 2Y8FA 3PSCA 2ELAA 3X23A 2J0MA 4IOYX 1V5PA 2GCLA 2RUKB 1M7EA 1WJ1A 1TQZA 3G9WA 1WI1A 3KZ1A 5D3XA 3ODOA 2Y8GA 3TW1A 4KHBB 2DKPA 2D4QA 2RLOA 2DA0A 1GG3A 4Z2MB 3TO1A 5C16A 2HTHB 1MK9B 1ZVRA 2DHJA 1KZ7A 1U5DA 2M14A 2ZPYA 2YS1A 3BJIA 4CYEA 2COAA 1WGQA 2HE7A 5DHAB 1WJMA 1Y5OA 4F7HA 1PLSA 3PG7A 2DHIA 4HB0B 2I5FA 1MKEA 1W1DA 3SYXA 5D27A 4NY0A 4BBKA 3HQCA 1LB1A 2M38A 2RGNB 3ODXA 2Q13A 1ZSQA 4A6FA 1FHOA 1XR0B 4DBBA 1V5MA 1DDWA 2GS0A 2PZ1A 1UPRA 2CODA 2Z0OA 2W2WA 1UEFA 5CLQB 1RJ2A 3FSSA 1N3HA 3IVFA 5HE2A 2KUPA 2YVCA 3ODWA 1IRSA 2LOXA 1UNRA 2Y7BA 2J0JA 3QBVB 4IAPA 5D3YA 1UNQA 4ZRIA 5C5BB 5JLJB 4HDQA 1B55A 2MFQA 1FB8A 1NU2A 4GZUA 4KAXB 1DDVA 3VOQA 1V5UA 5KQ1A 2I5CA 1LW3A 3ZVRA 1MIXA 1PFJA 3F0WA 4WVFB 4GN1A 1TXDA 4A6KA 2X18A 5J3YA 2R0DA 1NI2A 2YT1A 1RRPB 2V76A 5HE0A 2H7EA 3BINA 3KSYA 2KCJA 3M1IB 3WYFB 5J3TA 3KRXA 2LYDA 2I1JA 3FEHA 5J3QA 1H10A 4K17A 1OMWA 3GYPA 2CRFA 1SHCA 1H4RA 2UZSA 2DYQA 2DFKA 2I1KA 2W2XD 1BAKA 1X11A 1BWNA 1XKEA 1V88A 1P5TA 2NZ8B 4KVGB 4MY6A 3ULCA 1DROA 2UVMA 1U27A 1ISNA 4WSFA 2AL6A 4CHMA 4K2OA 4DXAB 4A6FB 2VRWB 1KI1B 2CY4A 1ZC3B 2DX5A 2KGXB 4Z2NA 3A8QA 3T06A 2YT0A 5D3VA 4D0NB 3SV1A 1ZM0A 3FM8C 1EF1A 3ZDTA 4EJNA 4PNKA 2D10A 3D8DA 2EJ8A 4H8SA 4HAXB 1X05A 1DBHA 2OQBA 3RCPA 4PQ0A 1FGZA 3AU5A 3OANA 2FJLA 1EVHA 2DX1A 3NSUA 1XCGA 1XD4A 1TJ6A 3N7CA 1Q67A 3KRWA 1WVHA 2DN6A 2LKOA 4K2PA 4GMVA 3PVLA 3GYOA 4HB4B 3AJ4A 4ZRKA 3PZDA 3QWMA 3QIJA 1BTNA 4EKUA 2L2IA 2LULA 3ULBA 2K2JA 1EAZA 1U5GA 2P8VA 3D8FA 2ADZA 3SNHA 2YS3A 1GC6A 3PP2A 1I2HA 5C79A 3LJUX 2DTCA 4Y94A 2OTXA 5KQ4A 4A5KA 4XWXA 1U2BA 4HDOA 2VKIA 3KY9A 2DYNA 5C6RA 3UZTA 2D11A 2DHKA 4F7UP 1X1FA 4F7GA 3SO6A 5HE3A 1U5FA 2H7DA 3TVVA 2YSZA 1I7AA 4P7IA 4HATB 2CAYA 2D9YA 1AWEA 4DX8A 5JHGA 1PMSA 3MDBC 1XX0A 3ML4A 2J0KA 4HHVA 5C5BA 5FI0A 1M7RA 4ZRJA 3CXBB 1V61A 4HAWB 4HB3B 1ZC4B 2D9VA 3DXCA 1V89A 4GXBA 1Y19B 4B6HA 2D9WA 5CLLB 1MK7B 5DIFB 5HE1A 2G35A 2RNRB 2GCJA 1J19A 2RSGA 5JHHA 2JP2A 1MAIA 3AU4A 2K00A 2W2XC 3TFMA 3A8PA 3O96A 2YF0A 5LOPB 1J0WA 2D9ZA 4TKNA 3MPXA 1BTKA 4MT7A 1KZGA 2GJYA 3PVWA 2QKLA 2Z0PA 5FI1A 4WJ7A 1XODA 3P7ZA 1OQNA 1P3RA 2EMSA 2MDXA 2K2UA 4NSWA 1W1HA 4EMOA 2QKMA 1EGXA 2AEHA 4TYZA 2YS5A 5JP4A 1E5WA 5KCVA 2COCA 4A6HA 2J59M 5DH9B 3SUZA 4YL8A 2LOZA 3TCAA 1UPQA 2E2XA 1P6SA 5DI9B 1U29A 2IYBA 1W1GA 3PVUA 1MPHA 1NTVA 1Z87A 4MK0A 1WGUA 4HAZB 3A98B 4KHOA 3DXDA 3WA0A 1FHXA 1AQCA 2ROVA 4K81A 3VIAA 2UZRA 4CHJA 1K5GB 1FOEA 3HW2B 2EMTA 3P6AA 5DHFB 4GPTB 2D2QA 4HAVB 1X1GA 1WG7A 2P0DA 3CIKA 3U8ZA 1QC6A 2DLWA 2ROZB 4KHAA 1UNPA 1DYNA 4L6EA 1FHWA 2BCJA 3D8EA 1GC7A 2CY5A 3PEGA
chains in the Genus database with same CATH superfamily
4HAYB 1MIZB 2VSZA 2N0YA 1U5EA 1NTYA 1FGYA 3HK0A 2R2YA 2Z0QA 5GOWB 2IFSA 2ELBA 2L1CA 2P0FA 2MKRA 2NMBA 3F5RA 1DDMA 3NWDA 4YONA 5D3WA 4GMXB 3DXEA 4C0AA 4DX90 2DKQA 2LG1A 2MWNB 1QQGA 2RVBB 5M4YB 2XQNM 3V5WA 2COFA 3U7DA 4OSNA 4HAUB 5EFXA 5L81A 1FAOA 2P0HA 1OY2A 2YRYA 1X86A 2N23A 4IFSA 2D9XA 4HB2B 5LONB 1K5DB 2FJUB 2R09A 1SGHA 2EC1A 2Y8FA 3PSCA 2ELAA 3X23A 2J0MA 4IOYX 1V5PA 2GCLA 2RUKB 1M7EA 1WJ1A 1TQZA 2Z59A 3G9WA 1WI1A 3KZ1A 5D3XA 3ODOA 2Y8GA 3TW1A 4KHBB 2DKPA 2D4QA 2RLOA 2DA0A 1GG3A 4Z2MB 3TO1A 5C16A 2HTHB 1MK9B 1ZVRA 2DHJA 1KZ7A 1U5DA 2M14A 2Z14A 2ZPYA 3OHMB 2YS1A 3BJIA 4CYEA 2COAA 1WGQA 2HE7A 5DHAB 1WJMA 4DIXA 1Y5OA 3NWFA 4F7HA 3HIEA 1PLSA 3PG7A 2DHIA 4HB0B 2I5FA 1MKEA 1W1DA 3SYXA 5D27A 4NY0A 4BBKA 3HQCA 1LB1A 2M38A 2RGNB 3ODXA 2Q13A 1ZSQA 4A6FA 1FHOA 1XR0B 4DBBA 1V5MA 1DDWA 2GS0A 2PZ1A 1UPRA 2CODA 2Z0OA 2W2WA 1UEFA 5CLQB 1RJ2A 3FSSA 1N3HA 3IVFA 5HE2A 2KUPA 2YVCA 3NWAA 3ODWA 1IRSA 1T77A 2LOXA 1UNRA 2Y7BA 2J0JA 4QJ5B 3QBVB 2Z4DA 4IAPA 5D3YA 1UNQA 4ZRIA 5C5BB 5JLJB 4HDQA 1B55A 2MFQA 1FB8A 1NU2A 4GZUA 4KAXB 1DDVA 3VOQA 1V5UA 5KQ1A 2I5CA 1LW3A 3ZVRA 1MIXA 4CSQA 1PFJA 3F0WA 4WVFB 4GN1A 1TXDA 4A6KA 2X18A 5J3YA 2R0DA 1NI2A 2YT1A 1RRPB 4OT1A 2V76A 5HE0A 2H7EA 2NBVA 2GUMA 3BINA 4QXAB 4L1RA 3KSYA 2KCJA 3M1IB 3WYFB 5J3TA 3KRXA 2LYDA 2I1JA 3FEHA 5J3QA 1H10A 4K17A 1OMWA 3GYPA 2CRFA 2ZKMX 1SHCA 1H4RA 2UZSA 2DYQA 2DFKA 2I1KA 4GOUA 2W2XD 1BAKA 1X11A 1BWNA 1XKEA 1V88A 1P5TA 2NZ8B 2K8EA 4KVGB 4MY6A 3ULCA 1DROA 2UVMA 1U27A 1ISNA 4WSFA 2AL6A 4CHMA 4K2OA 4DXAB 4A6FB 2VRWB 1KI1B 2CY4A 1ZC3B 2DX5A 2KGXB 4Z2NA 3A8QA 3T06A 2YT0A 5D3VA 3U12A 4D0NB 3SV1A 1ZM0A 3FM8C 1EF1A 3ZDTA 4EJNA 4PNKA 2D10A 3D8DA 2EJ8A 4H8SA 4QJ4B 2KIEA 4HAXB 1X05A 1DBHA 2OQBA 3RCPA 4PQ0A 1FGZA 3AU5A 3OANA 2FJLA 1EVHA 2DX1A 3NSUA 1XCGA 4HSIA 1XD4A 1TJ6A 3N7CA 1Q67A 3KRWA 1WVHA 2DN6A 2LKOA 3NW8A 4GMVA 4K2PA 3PVLA 2RRFA 3GYOA 4HB4B 3AJ4A 4ZRKA 3PZDA 3QWMA 3QIJA 1BTNA 4EKUA 2Z13A 2L2IA 2LULA 3ULBA 2K2JA 4D6WA 2K49A 1EAZA 1U5GA 2P8VA 3D8FA 2ADZA 3SNHA 2YS3A 1GC6A 3PP2A 1I2HA 5C79A 3LJUX 2DTCA 4Y94A 2OTXA 5KQ4A 4A5KA 4XWXA 1U2BA 5I2SA 3DCXA 4HDOA 2VKIA 3KY9A 2DYNA 5C6RA 3UZTA 2D11A 2DHKA 3B77A 4F7UP 1MI1A 5IRSA 1X1FA 4F7GA 3SO6A 5HE3A 1U5FA 2H7DA 3TVVA 2YSZA 1I7AA 4P7IA 4HATB 2CAYA 2D9YA 1AWEA 4DX8A 5JHGA 3HSAA 1PMSA 3MDBC 1XX0A 3ML4A 2J0KA 4HHVA 5C5BA 5FI0A 1M7RA 4QJ3B 4ZRJA 3CXBB 1V61A 4HAWB 4HB3B 1ZC4B 2D9VA 3DXCA 1V89A 4GXBA 1Y19B 4B6HA 2D9WA 5CLLB 1MK7B 2KUQA 5DIFB 5HE1A 2G35A 2RNRB 2GCJA 1J19A 2RSGA 5JHHA 2JP2A 1MAIA 3AU4A 2K00A 2W2XC 3TFMA 3A8PA 3O96A 2YF0A 5LOPB 1J0WA 2D9ZA 4TKNA 3MPXA 1BTKA 4MT7A 1KZGA 2GJYA 3PVWA 2QKLA 2Z0PA 5FI1A 4WJ7A 3FVCA 1XODA 3P7ZA 1OQNA 5I2MA 1P3RA 2EMSA 2MDXA 2K2UA 3A58A 4NSWA 1W1HA 4EMOA 2QKMA 1EGXA 2AEHA 5LG4B 4TYZA 2YS5A 5JP4A 1E5WA 5KCVA 2COCA 2YT2A 4A6HA 2J59M 5DH9B 3SUZA 4YL8A 2LOZA 3TCAA 1UPQA 2E2XA 1P6SA 5DI9B 1U29A 2IYBA 1W1GA 3PVUA 1MPHA 1NTVA 1Z87A 4MK0A 1WGUA 4HAZB 3A98B 4KHBA 4KHOA 3DXDA 3WA0A 1FHXA 2KIGA 1AQCA 2KR0A 2ROVA 4GNKB 4K81A 3VIAA 2UZRA 4CHJA 1K5GB 1FOEA 3HW2B 2EMTA 3P6AA 5DHFB 4GPTB 2D2QA 4HAVB 1X1GA 1WG7A 2P0DA 3CIKA 3U8ZA 1QC6A 2DLWA 2ROZB 4KHAA 1UNPA 1DYNA 4L6EA 1FHWA 2BCJA 1ZYIA 3D8EA 1GC7A 2CY5A 3PEGA
chains in the Genus database with same CATH topology
4HAYB 1MIZB 2VSZA 2N0YA 1U5EA 1NTYA 1FGYA 3HK0A 2Z0QA 5GOWB 2IFSA 2ELBA 2L1CA 2P0FA 2MKRA 2NMBA 3F5RA 1DDMA 4YONA 5D3WA 4GMXB 3DXEA 4C0AA 4DX90 2DKQA 2LG1A 2MWNB 1QQGA 2RVBB 2XQNM 3V5WA 2COFA 3U7DA 4HAUB 5EFXA 5L81A 1FAOA 2P0HA 1OY2A 2YRYA 1X86A 2N23A 4IFSA 2D9XA 4HB2B 5LONB 1K5DB 2R09A 1SGHA 2EC1A 2Y8FA 3PSCA 2ELAA 3X23A 2J0MA 4IOYX 1V5PA 2GCLA 2RUKB 1M7EA 1WJ1A 1TQZA 3G9WA 1WI1A 3KZ1A 5D3XA 3ODOA 2Y8GA 3TW1A 4KHBB 2DKPA 2D4QA 2RLOA 2DA0A 1GG3A 4Z2MB 3TO1A 5C16A 2HTHB 1MK9B 1ZVRA 2DHJA 1KZ7A 1U5DA 2M14A 2ZPYA 2YS1A 3BJIA 4CYEA 2COAA 1WGQA 2HE7A 5DHAB 1WJMA 1Y5OA 4F7HA 1PLSA 3PG7A 2DHIA 4HB0B 2I5FA 1MKEA 1W1DA 3SYXA 5D27A 4NY0A 4BBKA 3HQCA 1LB1A 2M38A 2RGNB 3ODXA 2Q13A 1ZSQA 4A6FA 1FHOA 1XR0B 4DBBA 1V5MA 1DDWA 2GS0A 2PZ1A 1UPRA 2CODA 2Z0OA 2W2WA 1UEFA 5CLQB 1RJ2A 3FSSA 1N3HA 3IVFA 5HE2A 2KUPA 2YVCA 3ODWA 1IRSA 2LOXA 1UNRA 2Y7BA 2J0JA 3QBVB 4IAPA 5D3YA 1UNQA 4ZRIA 5C5BB 5JLJB 4HDQA 1B55A 2MFQA 1FB8A 1NU2A 4GZUA 4KAXB 1DDVA 3VOQA 1V5UA 5KQ1A 2I5CA 1LW3A 3ZVRA 1MIXA 1PFJA 3F0WA 4WVFB 4GN1A 1TXDA 4A6KA 2X18A 5J3YA 2R0DA 1NI2A 2YT1A 1RRPB 2V76A 5HE0A 2H7EA 3BINA 3KSYA 2KCJA 3M1IB 3WYFB 5J3TA 3KRXA 2LYDA 2I1JA 3FEHA 5J3QA 1H10A 4K17A 1OMWA 3GYPA 2CRFA 1SHCA 1H4RA 2UZSA 2DYQA 2DFKA 2I1KA 2W2XD 1BAKA 1X11A 1BWNA 1XKEA 1V88A 1P5TA 2NZ8B 4KVGB 4MY6A 3ULCA 1DROA 2UVMA 1U27A 1ISNA 4WSFA 2AL6A 4CHMA 4K2OA 4DXAB 4A6FB 2VRWB 1KI1B 2CY4A 1ZC3B 2DX5A 2KGXB 4Z2NA 3A8QA 3T06A 2YT0A 5D3VA 4D0NB 3SV1A 1ZM0A 3FM8C 1EF1A 3ZDTA 4EJNA 4PNKA 2D10A 3D8DA 2EJ8A 4H8SA 4HAXB 1X05A 1DBHA 2OQBA 3RCPA 4PQ0A 1FGZA 3AU5A 3OANA 2FJLA 1EVHA 2DX1A 3NSUA 1XCGA 1XD4A 1TJ6A 3N7CA 1Q67A 3KRWA 1WVHA 2DN6A 2LKOA 4K2PA 4GMVA 3PVLA 3GYOA 4HB4B 3AJ4A 4ZRKA 3PZDA 3QWMA 3QIJA 1BTNA 4EKUA 2L2IA 2LULA 3ULBA 2K2JA 1EAZA 1U5GA 2P8VA 3D8FA 2ADZA 3SNHA 2YS3A 1GC6A 3PP2A 1I2HA 5C79A 3LJUX 2DTCA 4Y94A 2OTXA 5KQ4A 4A5KA 4XWXA 1U2BA 4HDOA 2VKIA 3KY9A 2DYNA 5C6RA 3UZTA 2D11A 2DHKA 4F7UP 1X1FA 4F7GA 3SO6A 5HE3A 1U5FA 2H7DA 3TVVA 2YSZA 1I7AA 4P7IA 4HATB 2CAYA 2D9YA 1AWEA 4DX8A 5JHGA 1PMSA 3MDBC 1XX0A 3ML4A 2J0KA 4HHVA 5C5BA 5FI0A 1M7RA 4ZRJA 3CXBB 1V61A 4HAWB 4HB3B 1ZC4B 2D9VA 3DXCA 1V89A 4GXBA 1Y19B 4B6HA 2D9WA 5CLLB 1MK7B 5DIFB 5HE1A 2G35A 2RNRB 2GCJA 1J19A 2RSGA 5JHHA 2JP2A 1MAIA 3AU4A 2K00A 2W2XC 3TFMA 3A8PA 3O96A 2YF0A 5LOPB 1J0WA 2D9ZA 4TKNA 3MPXA 1BTKA 4MT7A 1KZGA 2GJYA 3PVWA 2QKLA 2Z0PA 5FI1A 4WJ7A 1XODA 3P7ZA 1OQNA 1P3RA 2EMSA 2MDXA 2K2UA 4NSWA 1W1HA 4EMOA 2QKMA 1EGXA 2AEHA 4TYZA 2YS5A 5JP4A 1E5WA 5KCVA 2COCA 4A6HA 2J59M 5DH9B 3SUZA 4YL8A 2LOZA 3TCAA 1UPQA 2E2XA 1P6SA 5DI9B 1U29A 2IYBA 1W1GA 3PVUA 1MPHA 1NTVA 1Z87A 4MK0A 1WGUA 4HAZB 3A98B 4KHOA 3DXDA 3WA0A 1FHXA 1AQCA 2ROVA 4K81A 3VIAA 2UZRA 4CHJA 1K5GB 1FOEA 3HW2B 2EMTA 3P6AA 5DHFB 4GPTB 2D2QA 4HAVB 1X1GA 1WG7A 2P0DA 3CIKA 3U8ZA 1QC6A 2DLWA 2ROZB 4KHAA 1UNPA 1DYNA 4L6EA 1FHWA 2BCJA 3D8EA 1GC7A 2CY5A 3PEGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HAY B;  1MIZ B;  2VSZ A;  2N0Y A;  1U5E A;  1NTY A;  1FGY A;  3HK0 A;  2Z0Q A;  5GOW B;  2IFS A;  2ELB A;  2L1C A;  2P0F A;  2MKR A;  2NMB A;  3F5R A;  1DDM A;  4YON A;  5D3W A;  4GMX B;  3DXE A;  4C0A A;  4DX9 0;  2DKQ A;  2LG1 A;  2MWN B;  1QQG A;  2RVB B;  2XQN M;  3V5W A;  2COF A;  3U7D A;  4HAU B;  5EFX A;  5L81 A;  1FAO A;  2P0H A;  1OY2 A;  2YRY A;  1X86 A;  2N23 A;  4IFS A;  2D9X A;  4HB2 B;  5LON B;  1K5D B;  2R09 A;  1SGH A;  2EC1 A;  2Y8F A;  3PSC A;  2ELA A;  3X23 A;  2J0M A;  4IOY X;  1V5P A;  2GCL A;  2RUK B;  1M7E A;  1WJ1 A;  1TQZ A;  3G9W A;  1WI1 A;  3KZ1 A;  5D3X A;  3ODO A;  2Y8G A;  3TW1 A;  4KHB B;  2DKP A;  2D4Q A;  2RLO A;  2DA0 A;  1GG3 A;  4Z2M B;  3TO1 A;  5C16 A;  2HTH B;  1MK9 B;  1ZVR A;  2DHJ A;  1KZ7 A;  1U5D A;  2M14 A;  2ZPY A;  2YS1 A;  3BJI A;  4CYE A;  2COA A;  1WGQ A;  2HE7 A;  5DHA B;  1WJM A;  1Y5O A;  4F7H A;  1PLS A;  3PG7 A;  2DHI A;  4HB0 B;  2I5F A;  1MKE A;  1W1D A;  3SYX A;  5D27 A;  4NY0 A;  4BBK A;  3HQC A;  1LB1 A;  2M38 A;  2RGN B;  3ODX A;  2Q13 A;  1ZSQ A;  4A6F A;  1FHO A;  1XR0 B;  4DBB A;  1V5M A;  1DDW A;  2GS0 A;  2PZ1 A;  1UPR A;  2COD A;  2Z0O A;  2W2W A;  1UEF A;  5CLQ B;  1RJ2 A;  3FSS A;  1N3H A;  3IVF A;  5HE2 A;  2KUP A;  2YVC A;  3ODW A;  1IRS A;  2LOX A;  1UNR A;  2Y7B A;  2J0J A;  3QBV B;  4IAP A;  5D3Y A;  1UNQ A;  4ZRI A;  5C5B B;  5JLJ B;  4HDQ A;  1B55 A;  2MFQ A;  1FB8 A;  1NU2 A;  4GZU A;  4KAX B;  1DDV A;  3VOQ A;  1V5U A;  5KQ1 A;  2I5C A;  1LW3 A;  3ZVR A;  1MIX A;  1PFJ A;  3F0W A;  4WVF B;  4GN1 A;  1TXD A;  4A6K A;  2X18 A;  5J3Y A;  2R0D A;  1NI2 A;  2YT1 A;  1RRP B;  2V76 A;  5HE0 A;  2H7E A;  3BIN A;  3KSY A;  2KCJ A;  3M1I B;  3WYF B;  5J3T A;  3KRX A;  2LYD A;  2I1J A;  3FEH A;  5J3Q A;  1H10 A;  4K17 A;  1OMW A;  3GYP A;  2CRF A;  1SHC A;  1H4R A;  2UZS A;  2DYQ A;  2DFK A;  2I1K A;  2W2X D;  1BAK A;  1X11 A;  1BWN A;  1XKE A;  1V88 A;  1P5T A;  2NZ8 B;  4KVG B;  4MY6 A;  3ULC A;  1DRO A;  2UVM A;  1U27 A;  1ISN A;  4WSF A;  2AL6 A;  4CHM A;  4K2O A;  4DXA B;  4A6F B;  2VRW B;  1KI1 B;  2CY4 A;  1ZC3 B;  2DX5 A;  2KGX B;  4Z2N A;  3A8Q A;  3T06 A;  2YT0 A;  5D3V A;  4D0N B;  3SV1 A;  1ZM0 A;  3FM8 C;  1EF1 A;  3ZDT A;  4EJN A;  4PNK A;  2D10 A;  3D8D A;  2EJ8 A;  4H8S A;  4HAX B;  1X05 A;  1DBH A;  2OQB A;  3RCP A;  4PQ0 A;  1FGZ A;  3AU5 A;  3OAN A;  2FJL A;  1EVH A;  2DX1 A;  3NSU A;  1XCG A;  1XD4 A;  1TJ6 A;  3N7C A;  1Q67 A;  3KRW A;  1WVH A;  2DN6 A;  2LKO A;  4K2P A;  4GMV A;  3PVL A;  3GYO A;  4HB4 B;  3AJ4 A;  4ZRK A;  3PZD A;  3QWM A;  3QIJ A;  1BTN A;  4EKU A;  2L2I A;  2LUL A;  3ULB A;  2K2J A;  1EAZ A;  1U5G A;  2P8V A;  3D8F A;  2ADZ A;  3SNH A;  2YS3 A;  1GC6 A;  3PP2 A;  1I2H A;  5C79 A;  3LJU X;  2DTC A;  4Y94 A;  2OTX A;  5KQ4 A;  4A5K A;  4XWX A;  1U2B A;  4HDO A;  2VKI A;  3KY9 A;  2DYN A;  5C6R A;  3UZT A;  2D11 A;  2DHK A;  4F7U P;  1X1F A;  4F7G A;  3SO6 A;  5HE3 A;  1U5F A;  2H7D A;  3TVV A;  2YSZ A;  1I7A A;  4P7I A;  4HAT B;  2CAY A;  2D9Y A;  1AWE A;  4DX8 A;  5JHG A;  1PMS A;  3MDB C;  1XX0 A;  3ML4 A;  2J0K A;  4HHV A;  5C5B A;  5FI0 A;  1M7R A;  4ZRJ A;  3CXB B;  1V61 A;  4HAW B;  4HB3 B;  1ZC4 B;  2D9V A;  3DXC A;  1V89 A;  4GXB A;  1Y19 B;  4B6H A;  2D9W A;  5CLL B;  1MK7 B;  5DIF B;  5HE1 A;  2G35 A;  2RNR B;  2GCJ A;  1J19 A;  2RSG A;  5JHH A;  2JP2 A;  1MAI A;  3AU4 A;  2K00 A;  2W2X C;  3TFM A;  3A8P A;  3O96 A;  2YF0 A;  5LOP B;  1J0W A;  2D9Z A;  4TKN A;  3MPX A;  1BTK A;  4MT7 A;  1KZG A;  2GJY A;  3PVW A;  2QKL A;  2Z0P A;  5FI1 A;  4WJ7 A;  1XOD A;  3P7Z A;  1OQN A;  1P3R A;  2EMS A;  2MDX A;  2K2U A;  4NSW A;  1W1H A;  4EMO A;  2QKM A;  1EGX A;  2AEH A;  4TYZ A;  2YS5 A;  5JP4 A;  1E5W A;  5KCV A;  2COC A;  4A6H A;  2J59 M;  5DH9 B;  3SUZ A;  4YL8 A;  2LOZ A;  3TCA A;  1UPQ A;  2E2X A;  1P6S A;  5DI9 B;  1U29 A;  2IYB A;  1W1G A;  3PVU A;  1MPH A;  1NTV A;  1Z87 A;  4MK0 A;  1WGU A;  4HAZ B;  3A98 B;  4KHO A;  3DXD A;  3WA0 A;  1FHX A;  1AQC A;  2ROV A;  4K81 A;  3VIA A;  2UZR A;  4CHJ A;  1K5G B;  1FOE A;  3HW2 B;  2EMT A;  3P6A A;  5DHF B;  4GPT B;  2D2Q A;  4HAV B;  1X1G A;  1WG7 A;  2P0D A;  3CIK A;  3U8Z A;  1QC6 A;  2DLW A;  2ROZ B;  4KHA A;  1UNP A;  1DYN A;  4L6E A;  1FHW A;  2BCJ A;  3D8E A;  1GC7 A;  2CY5 A;  3PEG A; 
#chains in the Genus database with same CATH topology
 4HAY B;  1MIZ B;  2VSZ A;  2N0Y A;  1U5E A;  1NTY A;  1FGY A;  3HK0 A;  2R2Y A;  2Z0Q A;  5GOW B;  2IFS A;  2ELB A;  2L1C A;  2P0F A;  2MKR A;  2NMB A;  3F5R A;  1DDM A;  3NWD A;  4YON A;  5D3W A;  4GMX B;  3DXE A;  4C0A A;  4DX9 0;  2DKQ A;  2LG1 A;  2MWN B;  1QQG A;  2RVB B;  5M4Y B;  2XQN M;  3V5W A;  2COF A;  3U7D A;  4OSN A;  4HAU B;  5EFX A;  5L81 A;  1FAO A;  2P0H A;  1OY2 A;  2YRY A;  1X86 A;  2N23 A;  4IFS A;  2D9X A;  4HB2 B;  5LON B;  1K5D B;  2FJU B;  2R09 A;  1SGH A;  2EC1 A;  2Y8F A;  3PSC A;  2ELA A;  3X23 A;  2J0M A;  4IOY X;  1V5P A;  2GCL A;  2RUK B;  1M7E A;  1WJ1 A;  1TQZ A;  2Z59 A;  3G9W A;  1WI1 A;  3KZ1 A;  5D3X A;  3ODO A;  2Y8G A;  3TW1 A;  4KHB B;  2DKP A;  2D4Q A;  2RLO A;  2DA0 A;  1GG3 A;  4Z2M B;  3TO1 A;  5C16 A;  2HTH B;  1MK9 B;  1ZVR A;  2DHJ A;  1KZ7 A;  1U5D A;  2M14 A;  2Z14 A;  2ZPY A;  3OHM B;  2YS1 A;  3BJI A;  4CYE A;  2COA A;  1WGQ A;  2HE7 A;  5DHA B;  1WJM A;  4DIX A;  1Y5O A;  3NWF A;  4F7H A;  3HIE A;  1PLS A;  3PG7 A;  2DHI A;  4HB0 B;  2I5F A;  1MKE A;  1W1D A;  3SYX A;  5D27 A;  4NY0 A;  4BBK A;  3HQC A;  1LB1 A;  2M38 A;  2RGN B;  3ODX A;  2Q13 A;  1ZSQ A;  4A6F A;  1FHO A;  1XR0 B;  4DBB A;  1V5M A;  1DDW A;  2GS0 A;  2PZ1 A;  1UPR A;  2COD A;  2Z0O A;  2W2W A;  1UEF A;  5CLQ B;  1RJ2 A;  3FSS A;  1N3H A;  3IVF A;  5HE2 A;  2KUP A;  2YVC A;  3NWA A;  3ODW A;  1IRS A;  1T77 A;  2LOX A;  1UNR A;  2Y7B A;  2J0J A;  4QJ5 B;  3QBV B;  2Z4D A;  4IAP A;  5D3Y A;  1UNQ A;  4ZRI A;  5C5B B;  5JLJ B;  4HDQ A;  1B55 A;  2MFQ A;  1FB8 A;  1NU2 A;  4GZU A;  4KAX B;  1DDV A;  3VOQ A;  1V5U A;  5KQ1 A;  2I5C A;  1LW3 A;  3ZVR A;  1MIX A;  4CSQ A;  1PFJ A;  3F0W A;  4WVF B;  4GN1 A;  1TXD A;  4A6K A;  2X18 A;  5J3Y A;  2R0D A;  1NI2 A;  2YT1 A;  1RRP B;  4OT1 A;  2V76 A;  5HE0 A;  2H7E A;  2NBV A;  2GUM A;  3BIN A;  4QXA B;  4L1R A;  3KSY A;  2KCJ A;  3M1I B;  3WYF B;  5J3T A;  3KRX A;  2LYD A;  2I1J A;  3FEH A;  5J3Q A;  1H10 A;  4K17 A;  1OMW A;  3GYP A;  2CRF A;  2ZKM X;  1SHC A;  1H4R A;  2UZS A;  2DYQ A;  2DFK A;  2I1K A;  4GOU A;  2W2X D;  1BAK A;  1X11 A;  1BWN A;  1XKE A;  1V88 A;  1P5T A;  2NZ8 B;  2K8E A;  4KVG B;  4MY6 A;  3ULC A;  1DRO A;  2UVM A;  1U27 A;  1ISN A;  4WSF A;  2AL6 A;  4CHM A;  4K2O A;  4DXA B;  4A6F B;  2VRW B;  1KI1 B;  2CY4 A;  1ZC3 B;  2DX5 A;  2KGX B;  4Z2N A;  3A8Q A;  3T06 A;  2YT0 A;  5D3V A;  3U12 A;  4D0N B;  3SV1 A;  1ZM0 A;  3FM8 C;  1EF1 A;  3ZDT A;  4EJN A;  4PNK A;  2D10 A;  3D8D A;  2EJ8 A;  4H8S A;  4QJ4 B;  2KIE A;  4HAX B;  1X05 A;  1DBH A;  2OQB A;  3RCP A;  4PQ0 A;  1FGZ A;  3AU5 A;  3OAN A;  2FJL A;  1EVH A;  2DX1 A;  3NSU A;  1XCG A;  4HSI A;  1XD4 A;  1TJ6 A;  3N7C A;  1Q67 A;  3KRW A;  1WVH A;  2DN6 A;  2LKO A;  3NW8 A;  4GMV A;  4K2P A;  3PVL A;  2RRF A;  3GYO A;  4HB4 B;  3AJ4 A;  4ZRK A;  3PZD A;  3QWM A;  3QIJ A;  1BTN A;  4EKU A;  2Z13 A;  2L2I A;  2LUL A;  3ULB A;  2K2J A;  4D6W A;  2K49 A;  1EAZ A;  1U5G A;  2P8V A;  3D8F A;  2ADZ A;  3SNH A;  2YS3 A;  1GC6 A;  3PP2 A;  1I2H A;  5C79 A;  3LJU X;  2DTC A;  4Y94 A;  2OTX A;  5KQ4 A;  4A5K A;  4XWX A;  1U2B A;  5I2S A;  3DCX A;  4HDO A;  2VKI A;  3KY9 A;  2DYN A;  5C6R A;  3UZT A;  2D11 A;  2DHK A;  3B77 A;  4F7U P;  1MI1 A;  5IRS A;  1X1F A;  4F7G A;  3SO6 A;  5HE3 A;  1U5F A;  2H7D A;  3TVV A;  2YSZ A;  1I7A A;  4P7I A;  4HAT B;  2CAY A;  2D9Y A;  1AWE A;  4DX8 A;  5JHG A;  3HSA A;  1PMS A;  3MDB C;  1XX0 A;  3ML4 A;  2J0K A;  4HHV A;  5C5B A;  5FI0 A;  1M7R A;  4QJ3 B;  4ZRJ A;  3CXB B;  1V61 A;  4HAW B;  4HB3 B;  1ZC4 B;  2D9V A;  3DXC A;  1V89 A;  4GXB A;  1Y19 B;  4B6H A;  2D9W A;  5CLL B;  1MK7 B;  2KUQ A;  5DIF B;  5HE1 A;  2G35 A;  2RNR B;  2GCJ A;  1J19 A;  2RSG A;  5JHH A;  2JP2 A;  1MAI A;  3AU4 A;  2K00 A;  2W2X C;  3TFM A;  3A8P A;  3O96 A;  2YF0 A;  5LOP B;  1J0W A;  2D9Z A;  4TKN A;  3MPX A;  1BTK A;  4MT7 A;  1KZG A;  2GJY A;  3PVW A;  2QKL A;  2Z0P A;  5FI1 A;  4WJ7 A;  3FVC A;  1XOD A;  3P7Z A;  1OQN A;  5I2M A;  1P3R A;  2EMS A;  2MDX A;  2K2U A;  3A58 A;  4NSW A;  1W1H A;  4EMO A;  2QKM A;  1EGX A;  2AEH A;  5LG4 B;  4TYZ A;  2YS5 A;  5JP4 A;  1E5W A;  5KCV A;  2COC A;  2YT2 A;  4A6H A;  2J59 M;  5DH9 B;  3SUZ A;  4YL8 A;  2LOZ A;  3TCA A;  1UPQ A;  2E2X A;  1P6S A;  5DI9 B;  1U29 A;  2IYB A;  1W1G A;  3PVU A;  1MPH A;  1NTV A;  1Z87 A;  4MK0 A;  1WGU A;  4HAZ B;  3A98 B;  4KHB A;  4KHO A;  3DXD A;  3WA0 A;  1FHX A;  2KIG A;  1AQC A;  2KR0 A;  2ROV A;  4GNK B;  4K81 A;  3VIA A;  2UZR A;  4CHJ A;  1K5G B;  1FOE A;  3HW2 B;  2EMT A;  3P6A A;  5DHF B;  4GPT B;  2D2Q A;  4HAV B;  1X1G A;  1WG7 A;  2P0D A;  3CIK A;  3U8Z A;  1QC6 A;  2DLW A;  2ROZ B;  4KHA A;  1UNP A;  1DYN A;  4L6E A;  1FHW A;  2BCJ A;  1ZYI A;  3D8E A;  1GC7 A;  2CY5 A;  3PEG A; 
#chains in the Genus database with same CATH homology
 4HAY B;  1MIZ B;  2VSZ A;  2N0Y A;  1U5E A;  1NTY A;  1FGY A;  3HK0 A;  2Z0Q A;  5GOW B;  2IFS A;  2ELB A;  2L1C A;  2P0F A;  2MKR A;  2NMB A;  3F5R A;  1DDM A;  4YON A;  5D3W A;  4GMX B;  3DXE A;  4C0A A;  4DX9 0;  2DKQ A;  2LG1 A;  2MWN B;  1QQG A;  2RVB B;  2XQN M;  3V5W A;  2COF A;  3U7D A;  4HAU B;  5EFX A;  5L81 A;  1FAO A;  2P0H A;  1OY2 A;  2YRY A;  1X86 A;  2N23 A;  4IFS A;  2D9X A;  4HB2 B;  5LON B;  1K5D B;  2R09 A;  1SGH A;  2EC1 A;  2Y8F A;  3PSC A;  2ELA A;  3X23 A;  2J0M A;  4IOY X;  1V5P A;  2GCL A;  2RUK B;  1M7E A;  1WJ1 A;  1TQZ A;  3G9W A;  1WI1 A;  3KZ1 A;  5D3X A;  3ODO A;  2Y8G A;  3TW1 A;  4KHB B;  2DKP A;  2D4Q A;  2RLO A;  2DA0 A;  1GG3 A;  4Z2M B;  3TO1 A;  5C16 A;  2HTH B;  1MK9 B;  1ZVR A;  2DHJ A;  1KZ7 A;  1U5D A;  2M14 A;  2ZPY A;  2YS1 A;  3BJI A;  4CYE A;  2COA A;  1WGQ A;  2HE7 A;  5DHA B;  1WJM A;  1Y5O A;  4F7H A;  1PLS A;  3PG7 A;  2DHI A;  4HB0 B;  2I5F A;  1MKE A;  1W1D A;  3SYX A;  5D27 A;  4NY0 A;  4BBK A;  3HQC A;  1LB1 A;  2M38 A;  2RGN B;  3ODX A;  2Q13 A;  1ZSQ A;  4A6F A;  1FHO A;  1XR0 B;  4DBB A;  1V5M A;  1DDW A;  2GS0 A;  2PZ1 A;  1UPR A;  2COD A;  2Z0O A;  2W2W A;  1UEF A;  5CLQ B;  1RJ2 A;  3FSS A;  1N3H A;  3IVF A;  5HE2 A;  2KUP A;  2YVC A;  3ODW A;  1IRS A;  2LOX A;  1UNR A;  2Y7B A;  2J0J A;  3QBV B;  4IAP A;  5D3Y A;  1UNQ A;  4ZRI A;  5C5B B;  5JLJ B;  4HDQ A;  1B55 A;  2MFQ A;  1FB8 A;  1NU2 A;  4GZU A;  4KAX B;  1DDV A;  3VOQ A;  1V5U A;  5KQ1 A;  2I5C A;  1LW3 A;  3ZVR A;  1MIX A;  1PFJ A;  3F0W A;  4WVF B;  4GN1 A;  1TXD A;  4A6K A;  2X18 A;  5J3Y A;  2R0D A;  1NI2 A;  2YT1 A;  1RRP B;  2V76 A;  5HE0 A;  2H7E A;  3BIN A;  3KSY A;  2KCJ A;  3M1I B;  3WYF B;  5J3T A;  3KRX A;  2LYD A;  2I1J A;  3FEH A;  5J3Q A;  1H10 A;  4K17 A;  1OMW A;  3GYP A;  2CRF A;  1SHC A;  1H4R A;  2UZS A;  2DYQ A;  2DFK A;  2I1K A;  2W2X D;  1BAK A;  1X11 A;  1BWN A;  1XKE A;  1V88 A;  1P5T A;  2NZ8 B;  4KVG B;  4MY6 A;  3ULC A;  1DRO A;  2UVM A;  1U27 A;  1ISN A;  4WSF A;  2AL6 A;  4CHM A;  4K2O A;  4DXA B;  4A6F B;  2VRW B;  1KI1 B;  2CY4 A;  1ZC3 B;  2DX5 A;  2KGX B;  4Z2N A;  3A8Q A;  3T06 A;  2YT0 A;  5D3V A;  4D0N B;  3SV1 A;  1ZM0 A;  3FM8 C;  1EF1 A;  3ZDT A;  4EJN A;  4PNK A;  2D10 A;  3D8D A;  2EJ8 A;  4H8S A;  4HAX B;  1X05 A;  1DBH A;  2OQB A;  3RCP A;  4PQ0 A;  1FGZ A;  3AU5 A;  3OAN A;  2FJL A;  1EVH A;  2DX1 A;  3NSU A;  1XCG A;  1XD4 A;  1TJ6 A;  3N7C A;  1Q67 A;  3KRW A;  1WVH A;  2DN6 A;  2LKO A;  4K2P A;  4GMV A;  3PVL A;  3GYO A;  4HB4 B;  3AJ4 A;  4ZRK A;  3PZD A;  3QWM A;  3QIJ A;  1BTN A;  4EKU A;  2L2I A;  2LUL A;  3ULB A;  2K2J A;  1EAZ A;  1U5G A;  2P8V A;  3D8F A;  2ADZ A;  3SNH A;  2YS3 A;  1GC6 A;  3PP2 A;  1I2H A;  5C79 A;  3LJU X;  2DTC A;  4Y94 A;  2OTX A;  5KQ4 A;  4A5K A;  4XWX A;  1U2B A;  4HDO A;  2VKI A;  3KY9 A;  2DYN A;  5C6R A;  3UZT A;  2D11 A;  2DHK A;  4F7U P;  1X1F A;  4F7G A;  3SO6 A;  5HE3 A;  1U5F A;  2H7D A;  3TVV A;  2YSZ A;  1I7A A;  4P7I A;  4HAT B;  2CAY A;  2D9Y A;  1AWE A;  4DX8 A;  5JHG A;  1PMS A;  3MDB C;  1XX0 A;  3ML4 A;  2J0K A;  4HHV A;  5C5B A;  5FI0 A;  1M7R A;  4ZRJ A;  3CXB B;  1V61 A;  4HAW B;  4HB3 B;  1ZC4 B;  2D9V A;  3DXC A;  1V89 A;  4GXB A;  1Y19 B;  4B6H A;  2D9W A;  5CLL B;  1MK7 B;  5DIF B;  5HE1 A;  2G35 A;  2RNR B;  2GCJ A;  1J19 A;  2RSG A;  5JHH A;  2JP2 A;  1MAI A;  3AU4 A;  2K00 A;  2W2X C;  3TFM A;  3A8P A;  3O96 A;  2YF0 A;  5LOP B;  1J0W A;  2D9Z A;  4TKN A;  3MPX A;  1BTK A;  4MT7 A;  1KZG A;  2GJY A;  3PVW A;  2QKL A;  2Z0P A;  5FI1 A;  4WJ7 A;  1XOD A;  3P7Z A;  1OQN A;  1P3R A;  2EMS A;  2MDX A;  2K2U A;  4NSW A;  1W1H A;  4EMO A;  2QKM A;  1EGX A;  2AEH A;  4TYZ A;  2YS5 A;  5JP4 A;  1E5W A;  5KCV A;  2COC A;  4A6H A;  2J59 M;  5DH9 B;  3SUZ A;  4YL8 A;  2LOZ A;  3TCA A;  1UPQ A;  2E2X A;  1P6S A;  5DI9 B;  1U29 A;  2IYB A;  1W1G A;  3PVU A;  1MPH A;  1NTV A;  1Z87 A;  4MK0 A;  1WGU A;  4HAZ B;  3A98 B;  4KHO A;  3DXD A;  3WA0 A;  1FHX A;  1AQC A;  2ROV A;  4K81 A;  3VIA A;  2UZR A;  4CHJ A;  1K5G B;  1FOE A;  3HW2 B;  2EMT A;  3P6A A;  5DHF B;  4GPT B;  2D2Q A;  4HAV B;  1X1G A;  1WG7 A;  2P0D A;  3CIK A;  3U8Z A;  1QC6 A;  2DLW A;  2ROZ B;  4KHA A;  1UNP A;  1DYN A;  4L6E A;  1FHW A;  2BCJ A;  3D8E A;  1GC7 A;  2CY5 A;  3PEG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...