4HATB

Crystal structure of crm1 inhibitor leptomycin b in complex with crm1-ran-ranbp1
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
121
structure length
121
Chain Sequence
EEDEEVLYKVRAKLFRFDKDAKEWKERGTGDCKFLKNKKTNKVRILMRRDKTLKICANHIIAPEYTLKPNVGSDRSWVYACTADIAEGEAEAFTFAIRFGSKENADKFKEEFEKAQEINKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Nuclear export inhibition through covalent conjugation and hydrolysis of Leptomycin B by CRM1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport/antibiotic
molecule keywords GTP-binding nuclear protein Ran
total genus 35
structure length 121
sequence length 121
ec nomenclature
pdb deposition date 2012-09-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00638 Ran_BP1 RanBP1 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 4hatB00
1UNPA 2Y8FA 1EGXA 1ZVRA 5JLJB 4WSFA 4F7GA 1DDWA 2DFKA 3TCAA 1EAZA 3PSCA 2DHKA 2Z0PA 1DROA 3KRXA 5J3TA 2BCJA 4Z2NA 2LOXA 3FM8C 2W2XC 4HAUB 1XKEA 2R09A 3IVFA 1ISNA 2LULA 1QC6A 2N23A 4HDOA 2RGNB 2LOZA 1RJ2A 1U5DA 3O96A 5JHHA 1NU2A 3TVVA 3NSUA 3OANA 3PEGA 2W2XD 1DYNA 5DIFB 2QKLA 1UNQA 2K2JA 1UNRA 5HE0A 1GC7A 5DI9B 3A98B 2DX5A 1Z87A 4HB0B 3A8PA 3TW1A 2EJ8A 2MKRA 1P3RA 2D9XA 3PZDA 5C6RA 2JP2A 4HAVB 2UZRA 3QIJA 1TQZA 1RRPB 4YL8A 3KRWA 2R0DA 5GOWB 3G9WA 4F7HA 2QKMA 3AJ4A 1BWNA 4PQ0A 1XX0A 5CLQB 1EVHA 3M1IB 4C0AA 1PMSA 1Q67A 5FI0A 5JP4A 2D9WA 5CLLB 2HE7A 1U5EA 2LYDA 2EMSA 2M14A 4NY0A 5EFXA 2DHIA 2H7DA 3D8FA 1X1FA 4K81A 1V61A 2ROZB 1M7EA 2DN6A 2LG1A 2NMBA 3T06A 2D2QA 1LB1A 4P7IA 4GMVA 3F5RA 1DDMA 4GPTB 4ZRKA 2EC1A 2I5CA 3FEHA 3WA0A 4WVFB 2DX1A 5LOPB 2DTCA 2I5FA 1MAIA 3ML4A 3RCPA 5J3YA 1X86A 5JHGA 4IOYX 4A5KA 2CY4A 4IAPA 2P0HA 4MK0A 3PP2A 2MFQA 3P7ZA 4HDQA 4HHVA 2DA0A 1B55A 1H4RA 1NTVA 1BTNA 4HAZB 2Q13A 4ZRJA 3SO6A 1PLSA 1AQCA 2DYQA 4DX90 3WYFB 1BTKA 4GZUA 3ODXA 4IFSA 4A6HA 3P6AA 5D3XA 1K5GB 1X11A 1I7AA 2DHJA 5C16A 3TFMA 1WJ1A 3DXDA 3KY9A 4EMOA 1TXDA 1FOEA 2K2UA 4H8SA 1NI2A 1H10A 1MIXA 1WJMA 4HAXB 3TO1A 4MT7A 4A6KA 3GYPA 1FHWA 1Y19B 2Z0QA 4ZRIA 2LKOA 1M7RA 2H7EA 5DH9B 1WVHA 4YONA 2Y7BA 2I1JA 2KUPA 2N0YA 2VRWB 1KZ7A 2ADZA 3ODWA 4K17A 2COCA 1FGYA 5D3VA 4HB3B 4DBBA 3KZ1A 1BAKA 1V89A 2L1CA 2OTXA 2YF0A 3D8DA 2DKPA 1V5PA 4DXAB 1XCGA 4KHBB 3VIAA 3F0WA 3UZTA 2KCJA 3HW2B 3KSYA 4L6EA 1QQGA 2IYBA 3X23A 4PNKA 1OMWA 5D27A 4CHJA 3SV1A 2E2XA 4A6FA 2VSZA 2L2IA 5D3YA 3D8EA 3ODOA 2RLOA 5KQ4A 2NZ8B 2RNRB 2KGXB 3MPXA 1XR0B 1UPQA 1ZSQA 5C79A 2VKIA 4B6HA 4HB4B 1V5MA 2I1KA 1UPRA 2COAA 3A8QA 4TKNA 1DDVA 1U5GA 2D9VA 1UEFA 2AEHA 2D4QA 4K2PA 2X18A 1ZC4B 5C5BB 2FJLA 3U7DA 3FSSA 4Z2MB 1I2HA 2OQBA 2ELBA 5J3QA 3CXBB 2PZ1A 5FI1A 3AU5A 3GYOA 2GS0A 1PFJA 1U29A 2UZSA 1IRSA 1DBHA 1WG7A 2DKQA 3CIKA 5DHFB 1E5WA 1SGHA 2AL6A 2GCLA 2ROVA 1OY2A 3LJUX 3V5WA 4BBKA 2MWNB 1XODA 1U5FA 2YT0A 1W1GA 4GN1A 1WGUA 4TYZA 3SNHA 3BINA 3N7CA 2D9YA 3U8ZA 1W1DA 2D11A 2ELAA 2HTHB 2Z0OA 4GMXB 4XWXA 5DHAB 1MIZB 1AWEA 3HK0A 2V76A 3PVWA 1X05A 1J19A 4HAWB 1FHOA 1MK9B 2YS1A 4HATB 2DYNA 4F7UP 2J0JA 1U27A 1KI1B 2RVBB 4NSWA 1MK7B 4EJNA 2EMTA 1XD4A 2P8VA 1W1HA 4KAXB 5L81A 3VOQA 4MY6A 4A6FB 3ULCA 2GJYA 3SUZA 2J0KA 1FB8A 1FHXA 4CHMA 5LONB 1GC6A 3DXCA 4HB2B 2CRFA 1GG3A 2UVMA 3DXEA 1FAOA 2D10A 1TJ6A 4WJ7A 2J0MA 4CYEA 2D9ZA 3QBVB 1ZC3B 3BJIA 2RUKB 4DX8A 2YT1A 2K00A 2W2WA 5HE2A 2COFA 2P0DA 2YSZA 2GCJA 2RSGA 2CY5A 1OQNA 3ZDTA 3ZVRA 4K2OA 2YRYA 2ZPYA 1Y5OA 2Y8GA 1J0WA 1FGZA 1MKEA 2J59M 1SHCA 3ULBA 1V5UA 1WGQA 1U2BA 3HQCA 5KQ1A 1X1GA 4D0NB 1WI1A 3PG7A 2DLWA 5HE1A 1MPHA 4HAYB 2YS3A 2YVCA 4GXBA 1LW3A 2IFSA 2P0FA 5C5BA 4KVGB 4Y94A 5HE3A 2XQNM 4EKUA 4KHAA 1V88A 2YS5A 2CAYA 3QWMA 3MDBC 3AU4A 3PVUA 5D3WA 1KZGA 5KCVA 2M38A 1N3HA 3SYXA 1P6SA 2G35A 4KHOA 2MDXA 1NTYA 3PVLA 1EF1A 1K5DB 2CODA 1P5TA 1ZM0A
chains in the Genus database with same CATH superfamily
1UNPA 2Y8FA 1EGXA 1ZVRA 5JLJB 4WSFA 4F7GA 1DDWA 2DFKA 3TCAA 1EAZA 3PSCA 2DHKA 2Z0PA 1DROA 3KRXA 5J3TA 2BCJA 2Z13A 4Z2NA 2LOXA 3FM8C 2W2XC 4HAUB 1XKEA 2R09A 3IVFA 1ISNA 2LULA 1QC6A 2N23A 4HDOA 4L1RA 2RGNB 2LOZA 1RJ2A 1U5DA 3O96A 5JHHA 1NU2A 3TVVA 3NSUA 3OANA 3PEGA 3FVCA 2W2XD 4CSQA 1DYNA 5DIFB 2QKLA 1UNQA 2K2JA 1UNRA 5HE0A 1GC7A 5DI9B 3A98B 2DX5A 1Z87A 4HB0B 3A8PA 3TW1A 2EJ8A 2KUQA 1P3RA 2MKRA 2D9XA 3PZDA 5C6RA 2JP2A 4HAVB 2UZRA 3QIJA 1TQZA 1RRPB 4YL8A 3KRWA 2R0DA 5GOWB 3G9WA 4F7HA 2QKMA 3AJ4A 1BWNA 4PQ0A 1XX0A 5CLQB 2K49A 1EVHA 3M1IB 2KIEA 4C0AA 1PMSA 1Q67A 5FI0A 5JP4A 2D9WA 5CLLB 2HE7A 1U5EA 2LYDA 2EMSA 2M14A 4NY0A 5EFXA 2DHIA 2H7DA 3D8FA 1X1FA 1T77A 3OHMB 4K81A 1V61A 3HSAA 2ROZB 1M7EA 2DN6A 2LG1A 2NMBA 1ZYIA 3T06A 2D2QA 1LB1A 4P7IA 3NWFA 4GMVA 3F5RA 1DDMA 4GPTB 4ZRKA 2EC1A 2I5CA 3FEHA 3WA0A 4WVFB 2DX1A 2GUMA 5LOPB 2DTCA 2I5FA 1MAIA 3ML4A 3RCPA 5J3YA 1X86A 5JHGA 4IOYX 4A5KA 2CY4A 4IAPA 2P0HA 4MK0A 5LG4B 3PP2A 2MFQA 3P7ZA 4HDQA 4HHVA 2DA0A 1B55A 1H4RA 1NTVA 1BTNA 4HAZB 2Z4DA 2Q13A 4ZRJA 3SO6A 1PLSA 1AQCA 2DYQA 4DX90 3WYFB 1BTKA 4GZUA 3ODXA 4IFSA 4A6HA 3P6AA 5D3XA 1K5GB 1X11A 1I7AA 2DHJA 5C16A 3TFMA 1WJ1A 3DXDA 3KY9A 4EMOA 1TXDA 1FOEA 2NBVA 2K2UA 4H8SA 1NI2A 1H10A 1MIXA 1WJMA 3U12A 4HAXB 3TO1A 4MT7A 4A6KA 3GYPA 1FHWA 1Y19B 2Z0QA 4ZRIA 2LKOA 1M7RA 2H7EA 5DH9B 1WVHA 4YONA 2Y7BA 2I1JA 2KUPA 2N0YA 2VRWB 1KZ7A 2ADZA 3ODWA 4K17A 4KHBA 2COCA 1FGYA 5D3VA 4D6WA 4HB3B 4DBBA 4QJ4B 3NWDA 3KZ1A 1BAKA 1V89A 2L1CA 2OTXA 2YF0A 3D8DA 2DKPA 1V5PA 4DXAB 1XCGA 4KHBB 3VIAA 3F0WA 3UZTA 2KCJA 3HW2B 3KSYA 4L6EA 3HIEA 1QQGA 2IYBA 3DCXA 3X23A 2FJUB 4PNKA 1OMWA 5D27A 2RRFA 4CHJA 3SV1A 2E2XA 4A6FA 2VSZA 2L2IA 5D3YA 3D8EA 2Z14A 3ODOA 2RLOA 5KQ4A 2NZ8B 2RNRB 2KGXB 2R2YA 3MPXA 1XR0B 1UPQA 1ZSQA 5C79A 2VKIA 4QJ5B 4B6HA 4HB4B 1V5MA 2I1KA 1UPRA 2COAA 3A8QA 4TKNA 2KR0A 1DDVA 1U5GA 2D9VA 1UEFA 2AEHA 4HSIA 2D4QA 4K2PA 2X18A 1ZC4B 5C5BB 2FJLA 3U7DA 3FSSA 4Z2MB 1I2HA 2OQBA 2ELBA 5I2MA 5J3QA 3CXBB 2PZ1A 5FI1A 3AU5A 3GYOA 2GS0A 1PFJA 1U29A 2UZSA 1IRSA 1DBHA 1WG7A 2DKQA 3CIKA 5DHFB 1E5WA 4GOUA 1SGHA 2AL6A 2GCLA 2ROVA 1OY2A 3LJUX 3V5WA 4BBKA 2MWNB 1XODA 1U5FA 2YT0A 1W1GA 4GN1A 1WGUA 4TYZA 3SNHA 3BINA 3N7CA 2D9YA 3U8ZA 1W1DA 2KIGA 2D11A 2ELAA 2HTHB 5I2SA 2Z0OA 4GMXB 4XWXA 5DHAB 1MIZB 1AWEA 3HK0A 2V76A 4GNKB 3PVWA 1X05A 1J19A 4HAWB 1FHOA 1MI1A 1MK9B 2YS1A 4HATB 2DYNA 4F7UP 3B77A 2ZKMX 2J0JA 1U27A 1KI1B 2RVBB 4NSWA 1MK7B 4EJNA 2EMTA 1XD4A 2P8VA 5M4YB 1W1HA 4KAXB 5L81A 3VOQA 4MY6A 4A6FB 3ULCA 2GJYA 3SUZA 2J0KA 1FB8A 1FHXA 4CHMA 5LONB 1GC6A 3DXCA 4HB2B 2CRFA 1GG3A 2UVMA 3NW8A 3DXEA 1FAOA 2D10A 1TJ6A 4WJ7A 2J0MA 4CYEA 2D9ZA 2YT2A 3QBVB 1ZC3B 3BJIA 2RUKB 4DX8A 2YT1A 4OSNA 2K00A 2W2WA 5HE2A 4QXAB 2COFA 2P0DA 2YSZA 2GCJA 2RSGA 2CY5A 1OQNA 3ZDTA 3ZVRA 5IRSA 4K2OA 2YRYA 2ZPYA 4DIXA 1Y5OA 3NWAA 2Y8GA 1J0WA 4QJ3B 1FGZA 2Z59A 1MKEA 2J59M 1SHCA 3ULBA 1V5UA 4OT1A 1WGQA 1U2BA 3HQCA 5KQ1A 1X1GA 4D0NB 1WI1A 3PG7A 2DLWA 5HE1A 1MPHA 4HAYB 2YS3A 2YVCA 4GXBA 2K8EA 1LW3A 2IFSA 2P0FA 5C5BA 4KVGB 4Y94A 5HE3A 2XQNM 4EKUA 4KHAA 1V88A 2YS5A 2CAYA 3QWMA 3MDBC 3AU4A 3PVUA 5D3WA 1KZGA 5KCVA 2M38A 1N3HA 3SYXA 1P6SA 2G35A 4KHOA 2MDXA 1NTYA 3PVLA 1EF1A 3A58A 1K5DB 2CODA 1P5TA 1ZM0A
chains in the Genus database with same CATH topology
1UNPA 2Y8FA 1EGXA 1ZVRA 5JLJB 4WSFA 4F7GA 1DDWA 2DFKA 3TCAA 1EAZA 3PSCA 2DHKA 2Z0PA 1DROA 3KRXA 5J3TA 2BCJA 4Z2NA 2LOXA 3FM8C 2W2XC 4HAUB 1XKEA 2R09A 3IVFA 1ISNA 2LULA 1QC6A 2N23A 4HDOA 2RGNB 2LOZA 1RJ2A 1U5DA 3O96A 5JHHA 1NU2A 3TVVA 3NSUA 3OANA 3PEGA 2W2XD 1DYNA 5DIFB 2QKLA 1UNQA 2K2JA 1UNRA 5HE0A 1GC7A 5DI9B 3A98B 2DX5A 1Z87A 4HB0B 3A8PA 3TW1A 2EJ8A 2MKRA 1P3RA 2D9XA 3PZDA 5C6RA 2JP2A 4HAVB 2UZRA 3QIJA 1TQZA 1RRPB 4YL8A 3KRWA 2R0DA 5GOWB 3G9WA 4F7HA 2QKMA 3AJ4A 1BWNA 4PQ0A 1XX0A 5CLQB 1EVHA 3M1IB 4C0AA 1PMSA 1Q67A 5FI0A 5JP4A 2D9WA 5CLLB 2HE7A 1U5EA 2LYDA 2EMSA 2M14A 4NY0A 5EFXA 2DHIA 2H7DA 3D8FA 1X1FA 4K81A 1V61A 2ROZB 1M7EA 2DN6A 2LG1A 2NMBA 3T06A 2D2QA 1LB1A 4P7IA 4GMVA 3F5RA 1DDMA 4GPTB 4ZRKA 2EC1A 2I5CA 3FEHA 3WA0A 4WVFB 2DX1A 5LOPB 2DTCA 2I5FA 1MAIA 3ML4A 3RCPA 5J3YA 1X86A 5JHGA 4IOYX 4A5KA 2CY4A 4IAPA 2P0HA 4MK0A 3PP2A 2MFQA 3P7ZA 4HDQA 4HHVA 2DA0A 1B55A 1H4RA 1NTVA 1BTNA 4HAZB 2Q13A 4ZRJA 3SO6A 1PLSA 1AQCA 2DYQA 4DX90 3WYFB 1BTKA 4GZUA 3ODXA 4IFSA 4A6HA 3P6AA 5D3XA 1K5GB 1X11A 1I7AA 2DHJA 5C16A 3TFMA 1WJ1A 3DXDA 3KY9A 4EMOA 1TXDA 1FOEA 2K2UA 4H8SA 1NI2A 1H10A 1MIXA 1WJMA 4HAXB 3TO1A 4MT7A 4A6KA 3GYPA 1FHWA 1Y19B 2Z0QA 4ZRIA 2LKOA 1M7RA 2H7EA 5DH9B 1WVHA 4YONA 2Y7BA 2I1JA 2KUPA 2N0YA 2VRWB 1KZ7A 2ADZA 3ODWA 4K17A 2COCA 1FGYA 5D3VA 4HB3B 4DBBA 3KZ1A 1BAKA 1V89A 2L1CA 2OTXA 2YF0A 3D8DA 2DKPA 1V5PA 4DXAB 1XCGA 4KHBB 3VIAA 3F0WA 3UZTA 2KCJA 3HW2B 3KSYA 4L6EA 1QQGA 2IYBA 3X23A 4PNKA 1OMWA 5D27A 4CHJA 3SV1A 2E2XA 4A6FA 2VSZA 2L2IA 5D3YA 3D8EA 3ODOA 2RLOA 5KQ4A 2NZ8B 2RNRB 2KGXB 3MPXA 1XR0B 1UPQA 1ZSQA 5C79A 2VKIA 4B6HA 4HB4B 1V5MA 2I1KA 1UPRA 2COAA 3A8QA 4TKNA 1DDVA 1U5GA 2D9VA 1UEFA 2AEHA 2D4QA 4K2PA 2X18A 1ZC4B 5C5BB 2FJLA 3U7DA 3FSSA 4Z2MB 1I2HA 2OQBA 2ELBA 5J3QA 3CXBB 2PZ1A 5FI1A 3AU5A 3GYOA 2GS0A 1PFJA 1U29A 2UZSA 1IRSA 1DBHA 1WG7A 2DKQA 3CIKA 5DHFB 1E5WA 1SGHA 2AL6A 2GCLA 2ROVA 1OY2A 3LJUX 3V5WA 4BBKA 2MWNB 1XODA 1U5FA 2YT0A 1W1GA 4GN1A 1WGUA 4TYZA 3SNHA 3BINA 3N7CA 2D9YA 3U8ZA 1W1DA 2D11A 2ELAA 2HTHB 2Z0OA 4GMXB 4XWXA 5DHAB 1MIZB 1AWEA 3HK0A 2V76A 3PVWA 1X05A 1J19A 4HAWB 1FHOA 1MK9B 2YS1A 4HATB 2DYNA 4F7UP 2J0JA 1U27A 1KI1B 2RVBB 4NSWA 1MK7B 4EJNA 2EMTA 1XD4A 2P8VA 1W1HA 4KAXB 5L81A 3VOQA 4MY6A 4A6FB 3ULCA 2GJYA 3SUZA 2J0KA 1FB8A 1FHXA 4CHMA 5LONB 1GC6A 3DXCA 4HB2B 2CRFA 1GG3A 2UVMA 3DXEA 1FAOA 2D10A 1TJ6A 4WJ7A 2J0MA 4CYEA 2D9ZA 3QBVB 1ZC3B 3BJIA 2RUKB 4DX8A 2YT1A 2K00A 2W2WA 5HE2A 2COFA 2P0DA 2YSZA 2GCJA 2RSGA 2CY5A 1OQNA 3ZDTA 3ZVRA 4K2OA 2YRYA 2ZPYA 1Y5OA 2Y8GA 1J0WA 1FGZA 1MKEA 2J59M 1SHCA 3ULBA 1V5UA 1WGQA 1U2BA 3HQCA 5KQ1A 1X1GA 4D0NB 1WI1A 3PG7A 2DLWA 5HE1A 1MPHA 4HAYB 2YS3A 2YVCA 4GXBA 1LW3A 2IFSA 2P0FA 5C5BA 4KVGB 4Y94A 5HE3A 2XQNM 4EKUA 4KHAA 1V88A 2YS5A 2CAYA 3QWMA 3MDBC 3AU4A 3PVUA 5D3WA 1KZGA 5KCVA 2M38A 1N3HA 3SYXA 1P6SA 2G35A 4KHOA 2MDXA 1NTYA 3PVLA 1EF1A 1K5DB 2CODA 1P5TA 1ZM0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UNP A;  2Y8F A;  1EGX A;  1ZVR A;  5JLJ B;  4WSF A;  4F7G A;  1DDW A;  2DFK A;  3TCA A;  1EAZ A;  3PSC A;  2DHK A;  2Z0P A;  1DRO A;  3KRX A;  5J3T A;  2BCJ A;  4Z2N A;  2LOX A;  3FM8 C;  2W2X C;  4HAU B;  1XKE A;  2R09 A;  3IVF A;  1ISN A;  2LUL A;  1QC6 A;  2N23 A;  4HDO A;  2RGN B;  2LOZ A;  1RJ2 A;  1U5D A;  3O96 A;  5JHH A;  1NU2 A;  3TVV A;  3NSU A;  3OAN A;  3PEG A;  2W2X D;  1DYN A;  5DIF B;  2QKL A;  1UNQ A;  2K2J A;  1UNR A;  5HE0 A;  1GC7 A;  5DI9 B;  3A98 B;  2DX5 A;  1Z87 A;  4HB0 B;  3A8P A;  3TW1 A;  2EJ8 A;  2MKR A;  1P3R A;  2D9X A;  3PZD A;  5C6R A;  2JP2 A;  4HAV B;  2UZR A;  3QIJ A;  1TQZ A;  1RRP B;  4YL8 A;  3KRW A;  2R0D A;  5GOW B;  3G9W A;  4F7H A;  2QKM A;  3AJ4 A;  1BWN A;  4PQ0 A;  1XX0 A;  5CLQ B;  1EVH A;  3M1I B;  4C0A A;  1PMS A;  1Q67 A;  5FI0 A;  5JP4 A;  2D9W A;  5CLL B;  2HE7 A;  1U5E A;  2LYD A;  2EMS A;  2M14 A;  4NY0 A;  5EFX A;  2DHI A;  2H7D A;  3D8F A;  1X1F A;  4K81 A;  1V61 A;  2ROZ B;  1M7E A;  2DN6 A;  2LG1 A;  2NMB A;  3T06 A;  2D2Q A;  1LB1 A;  4P7I A;  4GMV A;  3F5R A;  1DDM A;  4GPT B;  4ZRK A;  2EC1 A;  2I5C A;  3FEH A;  3WA0 A;  4WVF B;  2DX1 A;  5LOP B;  2DTC A;  2I5F A;  1MAI A;  3ML4 A;  3RCP A;  5J3Y A;  1X86 A;  5JHG A;  4IOY X;  4A5K A;  2CY4 A;  4IAP A;  2P0H A;  4MK0 A;  3PP2 A;  2MFQ A;  3P7Z A;  4HDQ A;  4HHV A;  2DA0 A;  1B55 A;  1H4R A;  1NTV A;  1BTN A;  4HAZ B;  2Q13 A;  4ZRJ A;  3SO6 A;  1PLS A;  1AQC A;  2DYQ A;  4DX9 0;  3WYF B;  1BTK A;  4GZU A;  3ODX A;  4IFS A;  4A6H A;  3P6A A;  5D3X A;  1K5G B;  1X11 A;  1I7A A;  2DHJ A;  5C16 A;  3TFM A;  1WJ1 A;  3DXD A;  3KY9 A;  4EMO A;  1TXD A;  1FOE A;  2K2U A;  4H8S A;  1NI2 A;  1H10 A;  1MIX A;  1WJM A;  4HAX B;  3TO1 A;  4MT7 A;  4A6K A;  3GYP A;  1FHW A;  1Y19 B;  2Z0Q A;  4ZRI A;  2LKO A;  1M7R A;  2H7E A;  5DH9 B;  1WVH A;  4YON A;  2Y7B A;  2I1J A;  2KUP A;  2N0Y A;  2VRW B;  1KZ7 A;  2ADZ A;  3ODW A;  4K17 A;  2COC A;  1FGY A;  5D3V A;  4HB3 B;  4DBB A;  3KZ1 A;  1BAK A;  1V89 A;  2L1C A;  2OTX A;  2YF0 A;  3D8D A;  2DKP A;  1V5P A;  4DXA B;  1XCG A;  4KHB B;  3VIA A;  3F0W A;  3UZT A;  2KCJ A;  3HW2 B;  3KSY A;  4L6E A;  1QQG A;  2IYB A;  3X23 A;  4PNK A;  1OMW A;  5D27 A;  4CHJ A;  3SV1 A;  2E2X A;  4A6F A;  2VSZ A;  2L2I A;  5D3Y A;  3D8E A;  3ODO A;  2RLO A;  5KQ4 A;  2NZ8 B;  2RNR B;  2KGX B;  3MPX A;  1XR0 B;  1UPQ A;  1ZSQ A;  5C79 A;  2VKI A;  4B6H A;  4HB4 B;  1V5M A;  2I1K A;  1UPR A;  2COA A;  3A8Q A;  4TKN A;  1DDV A;  1U5G A;  2D9V A;  1UEF A;  2AEH A;  2D4Q A;  4K2P A;  2X18 A;  1ZC4 B;  5C5B B;  2FJL A;  3U7D A;  3FSS A;  4Z2M B;  1I2H A;  2OQB A;  2ELB A;  5J3Q A;  3CXB B;  2PZ1 A;  5FI1 A;  3AU5 A;  3GYO A;  2GS0 A;  1PFJ A;  1U29 A;  2UZS A;  1IRS A;  1DBH A;  1WG7 A;  2DKQ A;  3CIK A;  5DHF B;  1E5W A;  1SGH A;  2AL6 A;  2GCL A;  2ROV A;  1OY2 A;  3LJU X;  3V5W A;  4BBK A;  2MWN B;  1XOD A;  1U5F A;  2YT0 A;  1W1G A;  4GN1 A;  1WGU A;  4TYZ A;  3SNH A;  3BIN A;  3N7C A;  2D9Y A;  3U8Z A;  1W1D A;  2D11 A;  2ELA A;  2HTH B;  2Z0O A;  4GMX B;  4XWX A;  5DHA B;  1MIZ B;  1AWE A;  3HK0 A;  2V76 A;  3PVW A;  1X05 A;  1J19 A;  4HAW B;  1FHO A;  1MK9 B;  2YS1 A;  4HAT B;  2DYN A;  4F7U P;  2J0J A;  1U27 A;  1KI1 B;  2RVB B;  4NSW A;  1MK7 B;  4EJN A;  2EMT A;  1XD4 A;  2P8V A;  1W1H A;  4KAX B;  5L81 A;  3VOQ A;  4MY6 A;  4A6F B;  3ULC A;  2GJY A;  3SUZ A;  2J0K A;  1FB8 A;  1FHX A;  4CHM A;  5LON B;  1GC6 A;  3DXC A;  4HB2 B;  2CRF A;  1GG3 A;  2UVM A;  3DXE A;  1FAO A;  2D10 A;  1TJ6 A;  4WJ7 A;  2J0M A;  4CYE A;  2D9Z A;  3QBV B;  1ZC3 B;  3BJI A;  2RUK B;  4DX8 A;  2YT1 A;  2K00 A;  2W2W A;  5HE2 A;  2COF A;  2P0D A;  2YSZ A;  2GCJ A;  2RSG A;  2CY5 A;  1OQN A;  3ZDT A;  3ZVR A;  4K2O A;  2YRY A;  2ZPY A;  1Y5O A;  2Y8G A;  1J0W A;  1FGZ A;  1MKE A;  2J59 M;  1SHC A;  3ULB A;  1V5U A;  1WGQ A;  1U2B A;  3HQC A;  5KQ1 A;  1X1G A;  4D0N B;  1WI1 A;  3PG7 A;  2DLW A;  5HE1 A;  1MPH A;  4HAY B;  2YS3 A;  2YVC A;  4GXB A;  1LW3 A;  2IFS A;  2P0F A;  5C5B A;  4KVG B;  4Y94 A;  5HE3 A;  2XQN M;  4EKU A;  4KHA A;  1V88 A;  2YS5 A;  2CAY A;  3QWM A;  3MDB C;  3AU4 A;  3PVU A;  5D3W A;  1KZG A;  5KCV A;  2M38 A;  1N3H A;  3SYX A;  1P6S A;  2G35 A;  4KHO A;  2MDX A;  1NTY A;  3PVL A;  1EF1 A;  1K5D B;  2COD A;  1P5T A;  1ZM0 A; 
#chains in the Genus database with same CATH topology
 1UNP A;  2Y8F A;  1EGX A;  1ZVR A;  5JLJ B;  4WSF A;  4F7G A;  1DDW A;  2DFK A;  3TCA A;  1EAZ A;  3PSC A;  2DHK A;  2Z0P A;  1DRO A;  3KRX A;  5J3T A;  2BCJ A;  2Z13 A;  4Z2N A;  2LOX A;  3FM8 C;  2W2X C;  4HAU B;  1XKE A;  2R09 A;  3IVF A;  1ISN A;  2LUL A;  1QC6 A;  2N23 A;  4HDO A;  4L1R A;  2RGN B;  2LOZ A;  1RJ2 A;  1U5D A;  3O96 A;  5JHH A;  1NU2 A;  3TVV A;  3NSU A;  3OAN A;  3PEG A;  3FVC A;  2W2X D;  4CSQ A;  1DYN A;  5DIF B;  2QKL A;  1UNQ A;  2K2J A;  1UNR A;  5HE0 A;  1GC7 A;  5DI9 B;  3A98 B;  2DX5 A;  1Z87 A;  4HB0 B;  3A8P A;  3TW1 A;  2EJ8 A;  2KUQ A;  1P3R A;  2MKR A;  2D9X A;  3PZD A;  5C6R A;  2JP2 A;  4HAV B;  2UZR A;  3QIJ A;  1TQZ A;  1RRP B;  4YL8 A;  3KRW A;  2R0D A;  5GOW B;  3G9W A;  4F7H A;  2QKM A;  3AJ4 A;  1BWN A;  4PQ0 A;  1XX0 A;  5CLQ B;  2K49 A;  1EVH A;  3M1I B;  2KIE A;  4C0A A;  1PMS A;  1Q67 A;  5FI0 A;  5JP4 A;  2D9W A;  5CLL B;  2HE7 A;  1U5E A;  2LYD A;  2EMS A;  2M14 A;  4NY0 A;  5EFX A;  2DHI A;  2H7D A;  3D8F A;  1X1F A;  1T77 A;  3OHM B;  4K81 A;  1V61 A;  3HSA A;  2ROZ B;  1M7E A;  2DN6 A;  2LG1 A;  2NMB A;  1ZYI A;  3T06 A;  2D2Q A;  1LB1 A;  4P7I A;  3NWF A;  4GMV A;  3F5R A;  1DDM A;  4GPT B;  4ZRK A;  2EC1 A;  2I5C A;  3FEH A;  3WA0 A;  4WVF B;  2DX1 A;  2GUM A;  5LOP B;  2DTC A;  2I5F A;  1MAI A;  3ML4 A;  3RCP A;  5J3Y A;  1X86 A;  5JHG A;  4IOY X;  4A5K A;  2CY4 A;  4IAP A;  2P0H A;  4MK0 A;  5LG4 B;  3PP2 A;  2MFQ A;  3P7Z A;  4HDQ A;  4HHV A;  2DA0 A;  1B55 A;  1H4R A;  1NTV A;  1BTN A;  4HAZ B;  2Z4D A;  2Q13 A;  4ZRJ A;  3SO6 A;  1PLS A;  1AQC A;  2DYQ A;  4DX9 0;  3WYF B;  1BTK A;  4GZU A;  3ODX A;  4IFS A;  4A6H A;  3P6A A;  5D3X A;  1K5G B;  1X11 A;  1I7A A;  2DHJ A;  5C16 A;  3TFM A;  1WJ1 A;  3DXD A;  3KY9 A;  4EMO A;  1TXD A;  1FOE A;  2NBV A;  2K2U A;  4H8S A;  1NI2 A;  1H10 A;  1MIX A;  1WJM A;  3U12 A;  4HAX B;  3TO1 A;  4MT7 A;  4A6K A;  3GYP A;  1FHW A;  1Y19 B;  2Z0Q A;  4ZRI A;  2LKO A;  1M7R A;  2H7E A;  5DH9 B;  1WVH A;  4YON A;  2Y7B A;  2I1J A;  2KUP A;  2N0Y A;  2VRW B;  1KZ7 A;  2ADZ A;  3ODW A;  4K17 A;  4KHB A;  2COC A;  1FGY A;  5D3V A;  4D6W A;  4HB3 B;  4DBB A;  4QJ4 B;  3NWD A;  3KZ1 A;  1BAK A;  1V89 A;  2L1C A;  2OTX A;  2YF0 A;  3D8D A;  2DKP A;  1V5P A;  4DXA B;  1XCG A;  4KHB B;  3VIA A;  3F0W A;  3UZT A;  2KCJ A;  3HW2 B;  3KSY A;  4L6E A;  3HIE A;  1QQG A;  2IYB A;  3DCX A;  3X23 A;  2FJU B;  4PNK A;  1OMW A;  5D27 A;  2RRF A;  4CHJ A;  3SV1 A;  2E2X A;  4A6F A;  2VSZ A;  2L2I A;  5D3Y A;  3D8E A;  2Z14 A;  3ODO A;  2RLO A;  5KQ4 A;  2NZ8 B;  2RNR B;  2KGX B;  2R2Y A;  3MPX A;  1XR0 B;  1UPQ A;  1ZSQ A;  5C79 A;  2VKI A;  4QJ5 B;  4B6H A;  4HB4 B;  1V5M A;  2I1K A;  1UPR A;  2COA A;  3A8Q A;  4TKN A;  2KR0 A;  1DDV A;  1U5G A;  2D9V A;  1UEF A;  2AEH A;  4HSI A;  2D4Q A;  4K2P A;  2X18 A;  1ZC4 B;  5C5B B;  2FJL A;  3U7D A;  3FSS A;  4Z2M B;  1I2H A;  2OQB A;  2ELB A;  5I2M A;  5J3Q A;  3CXB B;  2PZ1 A;  5FI1 A;  3AU5 A;  3GYO A;  2GS0 A;  1PFJ A;  1U29 A;  2UZS A;  1IRS A;  1DBH A;  1WG7 A;  2DKQ A;  3CIK A;  5DHF B;  1E5W A;  4GOU A;  1SGH A;  2AL6 A;  2GCL A;  2ROV A;  1OY2 A;  3LJU X;  3V5W A;  4BBK A;  2MWN B;  1XOD A;  1U5F A;  2YT0 A;  1W1G A;  4GN1 A;  1WGU A;  4TYZ A;  3SNH A;  3BIN A;  3N7C A;  2D9Y A;  3U8Z A;  1W1D A;  2KIG A;  2D11 A;  2ELA A;  2HTH B;  5I2S A;  2Z0O A;  4GMX B;  4XWX A;  5DHA B;  1MIZ B;  1AWE A;  3HK0 A;  2V76 A;  4GNK B;  3PVW A;  1X05 A;  1J19 A;  4HAW B;  1FHO A;  1MI1 A;  1MK9 B;  2YS1 A;  4HAT B;  2DYN A;  4F7U P;  3B77 A;  2ZKM X;  2J0J A;  1U27 A;  1KI1 B;  2RVB B;  4NSW A;  1MK7 B;  4EJN A;  2EMT A;  1XD4 A;  2P8V A;  5M4Y B;  1W1H A;  4KAX B;  5L81 A;  3VOQ A;  4MY6 A;  4A6F B;  3ULC A;  2GJY A;  3SUZ A;  2J0K A;  1FB8 A;  1FHX A;  4CHM A;  5LON B;  1GC6 A;  3DXC A;  4HB2 B;  2CRF A;  1GG3 A;  2UVM A;  3NW8 A;  3DXE A;  1FAO A;  2D10 A;  1TJ6 A;  4WJ7 A;  2J0M A;  4CYE A;  2D9Z A;  2YT2 A;  3QBV B;  1ZC3 B;  3BJI A;  2RUK B;  4DX8 A;  2YT1 A;  4OSN A;  2K00 A;  2W2W A;  5HE2 A;  4QXA B;  2COF A;  2P0D A;  2YSZ A;  2GCJ A;  2RSG A;  2CY5 A;  1OQN A;  3ZDT A;  3ZVR A;  5IRS A;  4K2O A;  2YRY A;  2ZPY A;  4DIX A;  1Y5O A;  3NWA A;  2Y8G A;  1J0W A;  4QJ3 B;  1FGZ A;  2Z59 A;  1MKE A;  2J59 M;  1SHC A;  3ULB A;  1V5U A;  4OT1 A;  1WGQ A;  1U2B A;  3HQC A;  5KQ1 A;  1X1G A;  4D0N B;  1WI1 A;  3PG7 A;  2DLW A;  5HE1 A;  1MPH A;  4HAY B;  2YS3 A;  2YVC A;  4GXB A;  2K8E A;  1LW3 A;  2IFS A;  2P0F A;  5C5B A;  4KVG B;  4Y94 A;  5HE3 A;  2XQN M;  4EKU A;  4KHA A;  1V88 A;  2YS5 A;  2CAY A;  3QWM A;  3MDB C;  3AU4 A;  3PVU A;  5D3W A;  1KZG A;  5KCV A;  2M38 A;  1N3H A;  3SYX A;  1P6S A;  2G35 A;  4KHO A;  2MDX A;  1NTY A;  3PVL A;  1EF1 A;  3A58 A;  1K5D B;  2COD A;  1P5T A;  1ZM0 A; 
#chains in the Genus database with same CATH homology
 1UNP A;  2Y8F A;  1EGX A;  1ZVR A;  5JLJ B;  4WSF A;  4F7G A;  1DDW A;  2DFK A;  3TCA A;  1EAZ A;  3PSC A;  2DHK A;  2Z0P A;  1DRO A;  3KRX A;  5J3T A;  2BCJ A;  4Z2N A;  2LOX A;  3FM8 C;  2W2X C;  4HAU B;  1XKE A;  2R09 A;  3IVF A;  1ISN A;  2LUL A;  1QC6 A;  2N23 A;  4HDO A;  2RGN B;  2LOZ A;  1RJ2 A;  1U5D A;  3O96 A;  5JHH A;  1NU2 A;  3TVV A;  3NSU A;  3OAN A;  3PEG A;  2W2X D;  1DYN A;  5DIF B;  2QKL A;  1UNQ A;  2K2J A;  1UNR A;  5HE0 A;  1GC7 A;  5DI9 B;  3A98 B;  2DX5 A;  1Z87 A;  4HB0 B;  3A8P A;  3TW1 A;  2EJ8 A;  2MKR A;  1P3R A;  2D9X A;  3PZD A;  5C6R A;  2JP2 A;  4HAV B;  2UZR A;  3QIJ A;  1TQZ A;  1RRP B;  4YL8 A;  3KRW A;  2R0D A;  5GOW B;  3G9W A;  4F7H A;  2QKM A;  3AJ4 A;  1BWN A;  4PQ0 A;  1XX0 A;  5CLQ B;  1EVH A;  3M1I B;  4C0A A;  1PMS A;  1Q67 A;  5FI0 A;  5JP4 A;  2D9W A;  5CLL B;  2HE7 A;  1U5E A;  2LYD A;  2EMS A;  2M14 A;  4NY0 A;  5EFX A;  2DHI A;  2H7D A;  3D8F A;  1X1F A;  4K81 A;  1V61 A;  2ROZ B;  1M7E A;  2DN6 A;  2LG1 A;  2NMB A;  3T06 A;  2D2Q A;  1LB1 A;  4P7I A;  4GMV A;  3F5R A;  1DDM A;  4GPT B;  4ZRK A;  2EC1 A;  2I5C A;  3FEH A;  3WA0 A;  4WVF B;  2DX1 A;  5LOP B;  2DTC A;  2I5F A;  1MAI A;  3ML4 A;  3RCP A;  5J3Y A;  1X86 A;  5JHG A;  4IOY X;  4A5K A;  2CY4 A;  4IAP A;  2P0H A;  4MK0 A;  3PP2 A;  2MFQ A;  3P7Z A;  4HDQ A;  4HHV A;  2DA0 A;  1B55 A;  1H4R A;  1NTV A;  1BTN A;  4HAZ B;  2Q13 A;  4ZRJ A;  3SO6 A;  1PLS A;  1AQC A;  2DYQ A;  4DX9 0;  3WYF B;  1BTK A;  4GZU A;  3ODX A;  4IFS A;  4A6H A;  3P6A A;  5D3X A;  1K5G B;  1X11 A;  1I7A A;  2DHJ A;  5C16 A;  3TFM A;  1WJ1 A;  3DXD A;  3KY9 A;  4EMO A;  1TXD A;  1FOE A;  2K2U A;  4H8S A;  1NI2 A;  1H10 A;  1MIX A;  1WJM A;  4HAX B;  3TO1 A;  4MT7 A;  4A6K A;  3GYP A;  1FHW A;  1Y19 B;  2Z0Q A;  4ZRI A;  2LKO A;  1M7R A;  2H7E A;  5DH9 B;  1WVH A;  4YON A;  2Y7B A;  2I1J A;  2KUP A;  2N0Y A;  2VRW B;  1KZ7 A;  2ADZ A;  3ODW A;  4K17 A;  2COC A;  1FGY A;  5D3V A;  4HB3 B;  4DBB A;  3KZ1 A;  1BAK A;  1V89 A;  2L1C A;  2OTX A;  2YF0 A;  3D8D A;  2DKP A;  1V5P A;  4DXA B;  1XCG A;  4KHB B;  3VIA A;  3F0W A;  3UZT A;  2KCJ A;  3HW2 B;  3KSY A;  4L6E A;  1QQG A;  2IYB A;  3X23 A;  4PNK A;  1OMW A;  5D27 A;  4CHJ A;  3SV1 A;  2E2X A;  4A6F A;  2VSZ A;  2L2I A;  5D3Y A;  3D8E A;  3ODO A;  2RLO A;  5KQ4 A;  2NZ8 B;  2RNR B;  2KGX B;  3MPX A;  1XR0 B;  1UPQ A;  1ZSQ A;  5C79 A;  2VKI A;  4B6H A;  4HB4 B;  1V5M A;  2I1K A;  1UPR A;  2COA A;  3A8Q A;  4TKN A;  1DDV A;  1U5G A;  2D9V A;  1UEF A;  2AEH A;  2D4Q A;  4K2P A;  2X18 A;  1ZC4 B;  5C5B B;  2FJL A;  3U7D A;  3FSS A;  4Z2M B;  1I2H A;  2OQB A;  2ELB A;  5J3Q A;  3CXB B;  2PZ1 A;  5FI1 A;  3AU5 A;  3GYO A;  2GS0 A;  1PFJ A;  1U29 A;  2UZS A;  1IRS A;  1DBH A;  1WG7 A;  2DKQ A;  3CIK A;  5DHF B;  1E5W A;  1SGH A;  2AL6 A;  2GCL A;  2ROV A;  1OY2 A;  3LJU X;  3V5W A;  4BBK A;  2MWN B;  1XOD A;  1U5F A;  2YT0 A;  1W1G A;  4GN1 A;  1WGU A;  4TYZ A;  3SNH A;  3BIN A;  3N7C A;  2D9Y A;  3U8Z A;  1W1D A;  2D11 A;  2ELA A;  2HTH B;  2Z0O A;  4GMX B;  4XWX A;  5DHA B;  1MIZ B;  1AWE A;  3HK0 A;  2V76 A;  3PVW A;  1X05 A;  1J19 A;  4HAW B;  1FHO A;  1MK9 B;  2YS1 A;  4HAT B;  2DYN A;  4F7U P;  2J0J A;  1U27 A;  1KI1 B;  2RVB B;  4NSW A;  1MK7 B;  4EJN A;  2EMT A;  1XD4 A;  2P8V A;  1W1H A;  4KAX B;  5L81 A;  3VOQ A;  4MY6 A;  4A6F B;  3ULC A;  2GJY A;  3SUZ A;  2J0K A;  1FB8 A;  1FHX A;  4CHM A;  5LON B;  1GC6 A;  3DXC A;  4HB2 B;  2CRF A;  1GG3 A;  2UVM A;  3DXE A;  1FAO A;  2D10 A;  1TJ6 A;  4WJ7 A;  2J0M A;  4CYE A;  2D9Z A;  3QBV B;  1ZC3 B;  3BJI A;  2RUK B;  4DX8 A;  2YT1 A;  2K00 A;  2W2W A;  5HE2 A;  2COF A;  2P0D A;  2YSZ A;  2GCJ A;  2RSG A;  2CY5 A;  1OQN A;  3ZDT A;  3ZVR A;  4K2O A;  2YRY A;  2ZPY A;  1Y5O A;  2Y8G A;  1J0W A;  1FGZ A;  1MKE A;  2J59 M;  1SHC A;  3ULB A;  1V5U A;  1WGQ A;  1U2B A;  3HQC A;  5KQ1 A;  1X1G A;  4D0N B;  1WI1 A;  3PG7 A;  2DLW A;  5HE1 A;  1MPH A;  4HAY B;  2YS3 A;  2YVC A;  4GXB A;  1LW3 A;  2IFS A;  2P0F A;  5C5B A;  4KVG B;  4Y94 A;  5HE3 A;  2XQN M;  4EKU A;  4KHA A;  1V88 A;  2YS5 A;  2CAY A;  3QWM A;  3MDB C;  3AU4 A;  3PVU A;  5D3W A;  1KZG A;  5KCV A;  2M38 A;  1N3H A;  3SYX A;  1P6S A;  2G35 A;  4KHO A;  2MDX A;  1NTY A;  3PVL A;  1EF1 A;  1K5D B;  2COD A;  1P5T A;  1ZM0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...