4HATB

Crystal structure of crm1 inhibitor leptomycin b in complex with crm1-ran-ranbp1
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
121
structure length
121
Chain Sequence
b'EEDEEVLYKVRAKLFRFDKDAKEWKERGTGDCKFLKNKKTNKVRILMRRDKTLKICANHIIAPEYTLKPNVGSDRSWVYACTADIAEGEAEAFTFAIRFGSKENADKFKEEFEKAQEINKK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GTP-binding nuclear protein Ran
publication title Nuclear export inhibition through covalent conjugation and hydrolysis of Leptomycin B by CRM1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport/antibiotic
total genus 35
structure length 121
sequence length 121
ec nomenclature
pdb deposition date 2012-09-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00638 Ran_BP1 RanBP1 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 4hatB00
2FJLA 5JHHA 3KRWA 1XCGA 2VSZA 5C6RA 2D9VA 3D8DA 1MPHA 1P3RA 4MT7A 3TW1A 3VOQA 2GCJA 2CAYA 2XQNM 2R0DA 3ODWA 3D8FA 3X23A 1XX0A 2KUPA 1GG3A 1DDWA 2ZPYA 5HE1A 2COFA 4K17A 1GC6A 5CLQB 2J0JA 1DROA 4HATB 4DX90 2RGNB 4HAZB 5CLLB 1P5TA 1NTVA 1OMWA 4HAXB 2ELBA 4HB3B 4GZUA 4F7HA 2P0HA 5HE0A 2YRYA 2L2IA 2Y7BA 1XD4A 2LOZA 3M1IB 4MK0A 5DH9B 2ROVA 4HDQA 1FHXA 2K2JA 1FB8A 1I2HA 2DA0A 3DXCA 3ODXA 4EMOA 4HAVB 2M38A 2V76A 2KGXB 1X05A 4GXBA 1UPQA 1SGHA 2I1JA 3PVWA 4HAWB 4KVGB 1BTKA 1V61A 3NSUA 2CODA 1TJ6A 2D9ZA 2DHKA 2H7DA 3P6AA 2I5CA 5HE2A 4GN1A 1DBHA 3TO1A 1MKEA 1TQZA 3QIJA 2NMBA 4C0AA 2RUKB 1W1DA 1NI2A 5C16A 1GC7A 2YS3A 1MAIA 5DI9B 4BBKA 3ML4A 4NY0A 5JLJB 4CYEA 2CY4A 1OQNA 4ZRIA 3O96A 1TXDA 2K2UA 3P7ZA 1AWEA 4ZRKA 4Z2NA 1BWNA 4IOYX 4ZRJA 4HB4B 2X18A 3SV1A 3D8EA 1OY2A 4GMXB 2BCJA 5HE3A 1PMSA 1Z87A 4EKUA 1LW3A 1RRPB 4F7UP 2LYDA 1BAKA 2D9XA 4P7IA 2Y8FA 2EJ8A 3G9WA 3KZ1A 3PZDA 2P0FA 4XWXA 3MPXA 4A5KA 2D10A 4K2PA 1Y5OA 2Z0OA 2YF0A 1WJ1A 1RJ2A 1XKEA 4A6FA 1MIZB 2EMTA 2Z0QA 2GS0A 4WSFA 2Q13A 3RCPA 4EJNA 2AL6A 5J3YA 3TCAA 1H4RA 1J0WA 1U5GA 1MK9B 2I1KA 2YSZA 1EVHA 1U5FA 1WVHA 2LKOA 3BINA 2VKIA 4NSWA 1V5MA 1U5DA 1PLSA 2VRWB 2UZSA 3A98B 5D3YA 5D3VA 1P6SA 3A8QA 1KZGA 1AQCA 2N23A 3ZDTA 5DIFB 1ZSQA 1U5EA 4PNKA 3KRXA 4H8SA 1ZC3B 2W2XC 2HTHB 3PEGA 1KI1B 2DYNA 2GCLA 2RVBB 3U7DA 4HB2B 2G35A 3QWMA 2L1CA 3ZVRA 5C79A 1J19A 3TFMA 3WYFB 1FAOA 5GOWB 2E2XA 3WA0A 2AEHA 2COAA 5L81A 3FEHA 2J0MA 1M7EA 1MK7B 1WG7A 2MKRA 1UNRA 5DHFB 2RSGA 1LB1A 2DLWA 2J59M 1SHCA 1MIXA 5C5BB 2OTXA 2YT0A 3IVFA 2RLOA 1DDVA 3HQCA 4HHVA 2DTCA 5LOPB 2PZ1A 4CHMA 1X86A 2I5FA 4CHJA 1IRSA 4A6KA 2DHIA 1FHOA 2KCJA 2DX5A 1DDMA 1KZ7A 1M7RA 5KCVA 3A8PA 1Q67A 2DKPA 3PSCA 4DX8A 4F7GA 1FGZA 1NTYA 3PVLA 1E5WA 2D2QA 1B55A 4B6HA 5EFXA 1DYNA 1ZC4B 4IFSA 3SNHA 2W2WA 2K00A 3T06A 1H10A 2JP2A 1UNQA 3PG7A 3ULBA 4HAYB 4L6EA 3MDBC 2D11A 4GMVA 1UNPA 4TKNA 3FM8C 3F0WA 4K81A 5JHGA 2D4QA 1ISNA 4KHBB 2EMSA 1W1HA 1K5DB 3GYPA 3GYOA 4KHAA 4KHOA 2RNRB 2ELAA 2DN6A 1UPRA 1U2BA 4Y94A 1QC6A 3AU5A 1U29A 2YS5A 4DXAB 2DYQA 2P8VA 2CRFA 1I7AA 3HK0A 1FHWA 3F5RA 1X1FA 3LJUX 4Z2MB 2COCA 2DHJA 5D3WA 2UVMA 2QKLA 1N3HA 4YL8A 2YT1A 4IAPA 1NU2A 3TVVA 2Y8GA 1WGQA 2NZ8B 5DHAB 1Y19B 4WVFB 1FOEA 4HB0B 1WI1A 1V5UA 2DX1A 1K5GB 1V89A 3KY9A 4YONA 2QKMA 1EF1A 2EC1A 5KQ4A 3N7CA 2R09A 4MY6A 1QQGA 3U8ZA 2HE7A 4KAXB 1U27A 2DKQA 1EAZA 2ROZB 5KQ1A 3DXEA 1WGUA 1ZM0A 2ADZA 3SUZA 1BTNA 4D0NB 2J0KA 3PP2A 4HAUB 3UZTA 1V5PA 4WJ7A 2GJYA 5D27A 3OANA 5LONB 2W2XD 5D3XA 3PVUA 4TYZA 2CY5A 3KSYA 1X1GA 3SO6A 3VIAA 2M14A 3SYXA 4GPTB 3AJ4A 3HW2B 2MWNB 2MFQA 3V5WA 2YVCA 4HDOA 2Z0PA 5FI1A 3CIKA 1X11A 1W1GA 2MDXA 2D9WA 2IFSA 4A6FB 2UZRA 1EGXA 1UEFA 2OQBA 4A6HA 2LG1A 3QBVB 3DXDA 5JP4A 3BJIA 1ZVRA 2D9YA 3AU4A 3FSSA 2P0DA 1XODA 1PFJA 1XR0B 2DFKA 1V88A 2H7EA 4PQ0A 1WJMA 1FGYA 3ODOA 4DBBA 5J3QA 2N0YA 5FI0A 2IYBA 5J3TA 5C5BA 3CXBB 2YS1A 4K2OA 2LULA 3ULCA 2LOXA
chains in the Genus database with same CATH superfamily
2FJLA 5JHHA 3KRWA 1XCGA 2VSZA 5C6RA 3D8DA 2D9VA 3A58A 1MPHA 4L1RA 1P3RA 4MT7A 3TW1A 3VOQA 2GCJA 2CAYA 2XQNM 2R0DA 3ODWA 3D8FA 3NW8A 3X23A 1XX0A 2KUPA 1GG3A 1DDWA 2ZPYA 5HE1A 2COFA 4K17A 1GC6A 5CLQB 2J0JA 1DROA 4HATB 4DX90 2RGNB 4HAZB 5CLLB 1P5TA 1NTVA 1OMWA 5IRSA 4HAXB 2ELBA 4HB3B 4GZUA 4F7HA 2P0HA 5HE0A 2YRYA 2L2IA 2Y7BA 1XD4A 2LOZA 3M1IB 4KHBA 4MK0A 5DH9B 2ROVA 4HDQA 1FHXA 2K2JA 1FB8A 1I2HA 2DA0A 3DXCA 3ODXA 4EMOA 4HAVB 2M38A 4GNKB 2V76A 2KGXB 1X05A 4GXBA 1UPQA 1SGHA 2I1JA 3PVWA 4HAWB 4KVGB 1BTKA 1V61A 3NSUA 2CODA 1TJ6A 2D9ZA 2DHKA 2H7DA 3P6AA 2I5CA 5HE2A 4GN1A 2FJUB 1DBHA 3TO1A 1MKEA 1TQZA 3QIJA 2NMBA 4C0AA 2RUKB 1W1DA 1NI2A 5C16A 1GC7A 2YS3A 1MAIA 5DI9B 4BBKA 3ML4A 4NY0A 5JLJB 4CYEA 2CY4A 1OQNA 4ZRIA 4DIXA 3O96A 1TXDA 2K2UA 3P7ZA 4QXAB 4ZRKA 1AWEA 2Z4DA 2NBVA 4Z2NA 1BWNA 4IOYX 4ZRJA 4HB4B 2X18A 3SV1A 3D8EA 1OY2A 4GMXB 2BCJA 5HE3A 1PMSA 1Z87A 4EKUA 1LW3A 4HSIA 1RRPB 4F7UP 2LYDA 1BAKA 3FVCA 2Z14A 2D9XA 4P7IA 4GOUA 2Y8FA 2EJ8A 3G9WA 3KZ1A 3PZDA 2P0FA 4XWXA 3MPXA 4A5KA 2D10A 4K2PA 1Y5OA 2Z59A 2Z0OA 2YF0A 1WJ1A 1RJ2A 1XKEA 4A6FA 1MIZB 2EMTA 2Z0QA 2GS0A 4WSFA 3NWAA 3HIEA 2Q13A 3OHMB 3RCPA 4EJNA 2YT2A 2AL6A 5J3YA 3TCAA 3NWFA 1H4RA 1J0WA 1U5GA 1MK9B 2I1KA 2YSZA 1EVHA 1U5FA 1WVHA 2LKOA 3BINA 2VKIA 4NSWA 1V5MA 1U5DA 1PLSA 2VRWB 2UZSA 3A98B 5D3YA 5D3VA 1P6SA 3A8QA 1KZGA 1AQCA 2N23A 3ZDTA 5DIFB 1ZSQA 1U5EA 4PNKA 3KRXA 4H8SA 1ZC3B 2W2XC 2HTHB 3PEGA 1KI1B 2DYNA 2GCLA 2RVBB 3U7DA 4HB2B 1T77A 2G35A 3QWMA 2L1CA 3ZVRA 5C79A 1J19A 3TFMA 3WYFB 1FAOA 5GOWB 2E2XA 3WA0A 2AEHA 2COAA 5L81A 3FEHA 1MI1A 2Z13A 2J0MA 1M7EA 1MK7B 1WG7A 2MKRA 4CSQA 1UNRA 5DHFB 2RSGA 1LB1A 3DCXA 4QJ3B 2DLWA 2J59M 1SHCA 1MIXA 5C5BB 2OTXA 2YT0A 3IVFA 2RLOA 1DDVA 3HQCA 4HHVA 2DTCA 5LOPB 2PZ1A 4CHMA 1X86A 2I5FA 4CHJA 1IRSA 4A6KA 2DHIA 1FHOA 2KCJA 2DX5A 1DDMA 1KZ7A 3B77A 1M7RA 5KCVA 3A8PA 1Q67A 2DKPA 3PSCA 4DX8A 4F7GA 1FGZA 1NTYA 3PVLA 1E5WA 2D2QA 1B55A 4B6HA 5EFXA 1DYNA 1ZC4B 4IFSA 3SNHA 2W2WA 2K00A 3T06A 2GUMA 1H10A 2JP2A 1UNQA 3U12A 3PG7A 3ULBA 4HAYB 4L6EA 3MDBC 2D11A 4GMVA 1UNPA 4TKNA 3FM8C 3F0WA 4K81A 5JHGA 2D4QA 1ISNA 4KHBB 2EMSA 1W1HA 1K5DB 3GYPA 3GYOA 4KHAA 4KHOA 2RNRB 4QJ4B 2ELAA 2DN6A 1UPRA 1U2BA 4Y94A 4OSNA 2K8EA 1QC6A 3AU5A 1U29A 2YS5A 4DXAB 2DYQA 2P8VA 2CRFA 1I7AA 3HK0A 5I2MA 1FHWA 3F5RA 1X1FA 3LJUX 4Z2MB 2COCA 2DHJA 5D3WA 2UVMA 2QKLA 1N3HA 4YL8A 2YT1A 4IAPA 1NU2A 4OT1A 3TVVA 2Y8GA 1WGQA 2NZ8B 5DHAB 1Y19B 4WVFB 1FOEA 4HB0B 1WI1A 1V5UA 2DX1A 5I2SA 1K5GB 1V89A 3KY9A 4YONA 2KIGA 2QKMA 1EF1A 2EC1A 5KQ4A 2RRFA 3N7CA 2R09A 4MY6A 1QQGA 3U8ZA 2HE7A 4KAXB 1U27A 3HSAA 2DKQA 1EAZA 2ROZB 5KQ1A 3DXEA 1WGUA 1ZM0A 2ADZA 3SUZA 1BTNA 4D0NB 2J0KA 3PP2A 4HAUB 3UZTA 1V5PA 4WJ7A 2GJYA 5D27A 3OANA 5LONB 5LG4B 1ZYIA 2W2XD 5D3XA 3PVUA 4TYZA 2R2YA 2CY5A 3KSYA 1X1GA 3SO6A 3VIAA 4D6WA 2M14A 2KR0A 4GPTB 3SYXA 2KUQA 3AJ4A 3HW2B 2MWNB 2MFQA 3NWDA 3V5WA 2YVCA 2ZKMX 4HDOA 4QJ5B 2Z0PA 5FI1A 3CIKA 1X11A 1W1GA 2MDXA 2D9WA 2IFSA 4A6FB 2UZRA 1EGXA 1UEFA 2OQBA 4A6HA 2LG1A 3QBVB 3DXDA 2K49A 5JP4A 3BJIA 1ZVRA 2D9YA 3AU4A 3FSSA 2P0DA 2KIEA 1XODA 1PFJA 1XR0B 2DFKA 1V88A 2H7EA 4PQ0A 1WJMA 1FGYA 3ODOA 4DBBA 5J3QA 2N0YA 5FI0A 2IYBA 5M4YB 5J3TA 5C5BA 3CXBB 2YS1A 4K2OA 2LULA 3ULCA 2LOXA
chains in the Genus database with same CATH topology
2FJLA 5JHHA 3KRWA 1XCGA 2VSZA 5C6RA 2D9VA 3D8DA 1MPHA 1P3RA 4MT7A 3TW1A 3VOQA 2GCJA 2CAYA 2XQNM 2R0DA 3ODWA 3D8FA 3X23A 1XX0A 2KUPA 1GG3A 1DDWA 2ZPYA 5HE1A 2COFA 4K17A 1GC6A 5CLQB 2J0JA 1DROA 4HATB 4DX90 2RGNB 4HAZB 5CLLB 1P5TA 1NTVA 1OMWA 4HAXB 2ELBA 4HB3B 4GZUA 4F7HA 2P0HA 5HE0A 2YRYA 2L2IA 2Y7BA 1XD4A 2LOZA 3M1IB 4MK0A 5DH9B 2ROVA 4HDQA 1FHXA 2K2JA 1FB8A 1I2HA 2DA0A 3DXCA 3ODXA 4EMOA 4HAVB 2M38A 2V76A 2KGXB 1X05A 4GXBA 1UPQA 1SGHA 2I1JA 3PVWA 4HAWB 4KVGB 1BTKA 1V61A 3NSUA 2CODA 1TJ6A 2D9ZA 2DHKA 2H7DA 3P6AA 2I5CA 5HE2A 4GN1A 1DBHA 3TO1A 1MKEA 1TQZA 3QIJA 2NMBA 4C0AA 2RUKB 1W1DA 1NI2A 5C16A 1GC7A 2YS3A 1MAIA 5DI9B 4BBKA 3ML4A 4NY0A 5JLJB 4CYEA 2CY4A 1OQNA 4ZRIA 3O96A 1TXDA 2K2UA 3P7ZA 1AWEA 4ZRKA 4Z2NA 1BWNA 4IOYX 4ZRJA 4HB4B 2X18A 3SV1A 3D8EA 1OY2A 4GMXB 2BCJA 5HE3A 1PMSA 1Z87A 4EKUA 1LW3A 1RRPB 4F7UP 2LYDA 1BAKA 2D9XA 4P7IA 2Y8FA 2EJ8A 3G9WA 3KZ1A 3PZDA 2P0FA 4XWXA 3MPXA 4A5KA 2D10A 4K2PA 1Y5OA 2Z0OA 2YF0A 1WJ1A 1RJ2A 1XKEA 4A6FA 1MIZB 2EMTA 2Z0QA 2GS0A 4WSFA 2Q13A 3RCPA 4EJNA 2AL6A 5J3YA 3TCAA 1H4RA 1J0WA 1U5GA 1MK9B 2I1KA 2YSZA 1EVHA 1U5FA 1WVHA 2LKOA 3BINA 2VKIA 4NSWA 1V5MA 1U5DA 1PLSA 2VRWB 2UZSA 3A98B 5D3YA 5D3VA 1P6SA 3A8QA 1KZGA 1AQCA 2N23A 3ZDTA 5DIFB 1ZSQA 1U5EA 4PNKA 3KRXA 4H8SA 1ZC3B 2W2XC 2HTHB 3PEGA 1KI1B 2DYNA 2GCLA 2RVBB 3U7DA 4HB2B 2G35A 3QWMA 2L1CA 3ZVRA 5C79A 1J19A 3TFMA 3WYFB 1FAOA 5GOWB 2E2XA 3WA0A 2AEHA 2COAA 5L81A 3FEHA 2J0MA 1M7EA 1MK7B 1WG7A 2MKRA 1UNRA 5DHFB 2RSGA 1LB1A 2DLWA 2J59M 1SHCA 1MIXA 5C5BB 2OTXA 2YT0A 3IVFA 2RLOA 1DDVA 3HQCA 4HHVA 2DTCA 5LOPB 2PZ1A 4CHMA 1X86A 2I5FA 4CHJA 1IRSA 4A6KA 2DHIA 1FHOA 2KCJA 2DX5A 1DDMA 1KZ7A 1M7RA 5KCVA 3A8PA 1Q67A 2DKPA 3PSCA 4DX8A 4F7GA 1FGZA 1NTYA 3PVLA 1E5WA 2D2QA 1B55A 4B6HA 5EFXA 1DYNA 1ZC4B 4IFSA 3SNHA 2W2WA 2K00A 3T06A 1H10A 2JP2A 1UNQA 3PG7A 3ULBA 4HAYB 4L6EA 3MDBC 2D11A 4GMVA 1UNPA 4TKNA 3FM8C 3F0WA 4K81A 5JHGA 2D4QA 1ISNA 4KHBB 2EMSA 1W1HA 1K5DB 3GYPA 3GYOA 4KHAA 4KHOA 2RNRB 2ELAA 2DN6A 1UPRA 1U2BA 4Y94A 1QC6A 3AU5A 1U29A 2YS5A 4DXAB 2DYQA 2P8VA 2CRFA 1I7AA 3HK0A 1FHWA 3F5RA 1X1FA 3LJUX 4Z2MB 2COCA 2DHJA 5D3WA 2UVMA 2QKLA 1N3HA 4YL8A 2YT1A 4IAPA 1NU2A 3TVVA 2Y8GA 1WGQA 2NZ8B 5DHAB 1Y19B 4WVFB 1FOEA 4HB0B 1WI1A 1V5UA 2DX1A 1K5GB 1V89A 3KY9A 4YONA 2QKMA 1EF1A 2EC1A 5KQ4A 3N7CA 2R09A 4MY6A 1QQGA 3U8ZA 2HE7A 4KAXB 1U27A 2DKQA 1EAZA 2ROZB 5KQ1A 3DXEA 1WGUA 1ZM0A 2ADZA 3SUZA 1BTNA 4D0NB 2J0KA 3PP2A 4HAUB 3UZTA 1V5PA 4WJ7A 2GJYA 5D27A 3OANA 5LONB 2W2XD 5D3XA 3PVUA 4TYZA 2CY5A 3KSYA 1X1GA 3SO6A 3VIAA 2M14A 3SYXA 4GPTB 3AJ4A 3HW2B 2MWNB 2MFQA 3V5WA 2YVCA 4HDOA 2Z0PA 5FI1A 3CIKA 1X11A 1W1GA 2MDXA 2D9WA 2IFSA 4A6FB 2UZRA 1EGXA 1UEFA 2OQBA 4A6HA 2LG1A 3QBVB 3DXDA 5JP4A 3BJIA 1ZVRA 2D9YA 3AU4A 3FSSA 2P0DA 1XODA 1PFJA 1XR0B 2DFKA 1V88A 2H7EA 4PQ0A 1WJMA 1FGYA 3ODOA 4DBBA 5J3QA 2N0YA 5FI0A 2IYBA 5J3TA 5C5BA 3CXBB 2YS1A 4K2OA 2LULA 3ULCA 2LOXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FJL A;  5JHH A;  3KRW A;  1XCG A;  2VSZ A;  5C6R A;  2D9V A;  3D8D A;  1MPH A;  1P3R A;  4MT7 A;  3TW1 A;  3VOQ A;  2GCJ A;  2CAY A;  2XQN M;  2R0D A;  3ODW A;  3D8F A;  3X23 A;  1XX0 A;  2KUP A;  1GG3 A;  1DDW A;  2ZPY A;  5HE1 A;  2COF A;  4K17 A;  1GC6 A;  5CLQ B;  2J0J A;  1DRO A;  4HAT B;  4DX9 0;  2RGN B;  4HAZ B;  5CLL B;  1P5T A;  1NTV A;  1OMW A;  4HAX B;  2ELB A;  4HB3 B;  4GZU A;  4F7H A;  2P0H A;  5HE0 A;  2YRY A;  2L2I A;  2Y7B A;  1XD4 A;  2LOZ A;  3M1I B;  4MK0 A;  5DH9 B;  2ROV A;  4HDQ A;  1FHX A;  2K2J A;  1FB8 A;  1I2H A;  2DA0 A;  3DXC A;  3ODX A;  4EMO A;  4HAV B;  2M38 A;  2V76 A;  2KGX B;  1X05 A;  4GXB A;  1UPQ A;  1SGH A;  2I1J A;  3PVW A;  4HAW B;  4KVG B;  1BTK A;  1V61 A;  3NSU A;  2COD A;  1TJ6 A;  2D9Z A;  2DHK A;  2H7D A;  3P6A A;  2I5C A;  5HE2 A;  4GN1 A;  1DBH A;  3TO1 A;  1MKE A;  1TQZ A;  3QIJ A;  2NMB A;  4C0A A;  2RUK B;  1W1D A;  1NI2 A;  5C16 A;  1GC7 A;  2YS3 A;  1MAI A;  5DI9 B;  4BBK A;  3ML4 A;  4NY0 A;  5JLJ B;  4CYE A;  2CY4 A;  1OQN A;  4ZRI A;  3O96 A;  1TXD A;  2K2U A;  3P7Z A;  1AWE A;  4ZRK A;  4Z2N A;  1BWN A;  4IOY X;  4ZRJ A;  4HB4 B;  2X18 A;  3SV1 A;  3D8E A;  1OY2 A;  4GMX B;  2BCJ A;  5HE3 A;  1PMS A;  1Z87 A;  4EKU A;  1LW3 A;  1RRP B;  4F7U P;  2LYD A;  1BAK A;  2D9X A;  4P7I A;  2Y8F A;  2EJ8 A;  3G9W A;  3KZ1 A;  3PZD A;  2P0F A;  4XWX A;  3MPX A;  4A5K A;  2D10 A;  4K2P A;  1Y5O A;  2Z0O A;  2YF0 A;  1WJ1 A;  1RJ2 A;  1XKE A;  4A6F A;  1MIZ B;  2EMT A;  2Z0Q A;  2GS0 A;  4WSF A;  2Q13 A;  3RCP A;  4EJN A;  2AL6 A;  5J3Y A;  3TCA A;  1H4R A;  1J0W A;  1U5G A;  1MK9 B;  2I1K A;  2YSZ A;  1EVH A;  1U5F A;  1WVH A;  2LKO A;  3BIN A;  2VKI A;  4NSW A;  1V5M A;  1U5D A;  1PLS A;  2VRW B;  2UZS A;  3A98 B;  5D3Y A;  5D3V A;  1P6S A;  3A8Q A;  1KZG A;  1AQC A;  2N23 A;  3ZDT A;  5DIF B;  1ZSQ A;  1U5E A;  4PNK A;  3KRX A;  4H8S A;  1ZC3 B;  2W2X C;  2HTH B;  3PEG A;  1KI1 B;  2DYN A;  2GCL A;  2RVB B;  3U7D A;  4HB2 B;  2G35 A;  3QWM A;  2L1C A;  3ZVR A;  5C79 A;  1J19 A;  3TFM A;  3WYF B;  1FAO A;  5GOW B;  2E2X A;  3WA0 A;  2AEH A;  2COA A;  5L81 A;  3FEH A;  2J0M A;  1M7E A;  1MK7 B;  1WG7 A;  2MKR A;  1UNR A;  5DHF B;  2RSG A;  1LB1 A;  2DLW A;  2J59 M;  1SHC A;  1MIX A;  5C5B B;  2OTX A;  2YT0 A;  3IVF A;  2RLO A;  1DDV A;  3HQC A;  4HHV A;  2DTC A;  5LOP B;  2PZ1 A;  4CHM A;  1X86 A;  2I5F A;  4CHJ A;  1IRS A;  4A6K A;  2DHI A;  1FHO A;  2KCJ A;  2DX5 A;  1DDM A;  1KZ7 A;  1M7R A;  5KCV A;  3A8P A;  1Q67 A;  2DKP A;  3PSC A;  4DX8 A;  4F7G A;  1FGZ A;  1NTY A;  3PVL A;  1E5W A;  2D2Q A;  1B55 A;  4B6H A;  5EFX A;  1DYN A;  1ZC4 B;  4IFS A;  3SNH A;  2W2W A;  2K00 A;  3T06 A;  1H10 A;  2JP2 A;  1UNQ A;  3PG7 A;  3ULB A;  4HAY B;  4L6E A;  3MDB C;  2D11 A;  4GMV A;  1UNP A;  4TKN A;  3FM8 C;  3F0W A;  4K81 A;  5JHG A;  2D4Q A;  1ISN A;  4KHB B;  2EMS A;  1W1H A;  1K5D B;  3GYP A;  3GYO A;  4KHA A;  4KHO A;  2RNR B;  2ELA A;  2DN6 A;  1UPR A;  1U2B A;  4Y94 A;  1QC6 A;  3AU5 A;  1U29 A;  2YS5 A;  4DXA B;  2DYQ A;  2P8V A;  2CRF A;  1I7A A;  3HK0 A;  1FHW A;  3F5R A;  1X1F A;  3LJU X;  4Z2M B;  2COC A;  2DHJ A;  5D3W A;  2UVM A;  2QKL A;  1N3H A;  4YL8 A;  2YT1 A;  4IAP A;  1NU2 A;  3TVV A;  2Y8G A;  1WGQ A;  2NZ8 B;  5DHA B;  1Y19 B;  4WVF B;  1FOE A;  4HB0 B;  1WI1 A;  1V5U A;  2DX1 A;  1K5G B;  1V89 A;  3KY9 A;  4YON A;  2QKM A;  1EF1 A;  2EC1 A;  5KQ4 A;  3N7C A;  2R09 A;  4MY6 A;  1QQG A;  3U8Z A;  2HE7 A;  4KAX B;  1U27 A;  2DKQ A;  1EAZ A;  2ROZ B;  5KQ1 A;  3DXE A;  1WGU A;  1ZM0 A;  2ADZ A;  3SUZ A;  1BTN A;  4D0N B;  2J0K A;  3PP2 A;  4HAU B;  3UZT A;  1V5P A;  4WJ7 A;  2GJY A;  5D27 A;  3OAN A;  5LON B;  2W2X D;  5D3X A;  3PVU A;  4TYZ A;  2CY5 A;  3KSY A;  1X1G A;  3SO6 A;  3VIA A;  2M14 A;  3SYX A;  4GPT B;  3AJ4 A;  3HW2 B;  2MWN B;  2MFQ A;  3V5W A;  2YVC A;  4HDO A;  2Z0P A;  5FI1 A;  3CIK A;  1X11 A;  1W1G A;  2MDX A;  2D9W A;  2IFS A;  4A6F B;  2UZR A;  1EGX A;  1UEF A;  2OQB A;  4A6H A;  2LG1 A;  3QBV B;  3DXD A;  5JP4 A;  3BJI A;  1ZVR A;  2D9Y A;  3AU4 A;  3FSS A;  2P0D A;  1XOD A;  1PFJ A;  1XR0 B;  2DFK A;  1V88 A;  2H7E A;  4PQ0 A;  1WJM A;  1FGY A;  3ODO A;  4DBB A;  5J3Q A;  2N0Y A;  5FI0 A;  2IYB A;  5J3T A;  5C5B A;  3CXB B;  2YS1 A;  4K2O A;  2LUL A;  3ULC A;  2LOX A; 
#chains in the Genus database with same CATH topology
 2FJL A;  5JHH A;  3KRW A;  1XCG A;  2VSZ A;  5C6R A;  3D8D A;  2D9V A;  3A58 A;  1MPH A;  4L1R A;  1P3R A;  4MT7 A;  3TW1 A;  3VOQ A;  2GCJ A;  2CAY A;  2XQN M;  2R0D A;  3ODW A;  3D8F A;  3NW8 A;  3X23 A;  1XX0 A;  2KUP A;  1GG3 A;  1DDW A;  2ZPY A;  5HE1 A;  2COF A;  4K17 A;  1GC6 A;  5CLQ B;  2J0J A;  1DRO A;  4HAT B;  4DX9 0;  2RGN B;  4HAZ B;  5CLL B;  1P5T A;  1NTV A;  1OMW A;  5IRS A;  4HAX B;  2ELB A;  4HB3 B;  4GZU A;  4F7H A;  2P0H A;  5HE0 A;  2YRY A;  2L2I A;  2Y7B A;  1XD4 A;  2LOZ A;  3M1I B;  4KHB A;  4MK0 A;  5DH9 B;  2ROV A;  4HDQ A;  1FHX A;  2K2J A;  1FB8 A;  1I2H A;  2DA0 A;  3DXC A;  3ODX A;  4EMO A;  4HAV B;  2M38 A;  4GNK B;  2V76 A;  2KGX B;  1X05 A;  4GXB A;  1UPQ A;  1SGH A;  2I1J A;  3PVW A;  4HAW B;  4KVG B;  1BTK A;  1V61 A;  3NSU A;  2COD A;  1TJ6 A;  2D9Z A;  2DHK A;  2H7D A;  3P6A A;  2I5C A;  5HE2 A;  4GN1 A;  2FJU B;  1DBH A;  3TO1 A;  1MKE A;  1TQZ A;  3QIJ A;  2NMB A;  4C0A A;  2RUK B;  1W1D A;  1NI2 A;  5C16 A;  1GC7 A;  2YS3 A;  1MAI A;  5DI9 B;  4BBK A;  3ML4 A;  4NY0 A;  5JLJ B;  4CYE A;  2CY4 A;  1OQN A;  4ZRI A;  4DIX A;  3O96 A;  1TXD A;  2K2U A;  3P7Z A;  4QXA B;  4ZRK A;  1AWE A;  2Z4D A;  2NBV A;  4Z2N A;  1BWN A;  4IOY X;  4ZRJ A;  4HB4 B;  2X18 A;  3SV1 A;  3D8E A;  1OY2 A;  4GMX B;  2BCJ A;  5HE3 A;  1PMS A;  1Z87 A;  4EKU A;  1LW3 A;  4HSI A;  1RRP B;  4F7U P;  2LYD A;  1BAK A;  3FVC A;  2Z14 A;  2D9X A;  4P7I A;  4GOU A;  2Y8F A;  2EJ8 A;  3G9W A;  3KZ1 A;  3PZD A;  2P0F A;  4XWX A;  3MPX A;  4A5K A;  2D10 A;  4K2P A;  1Y5O A;  2Z59 A;  2Z0O A;  2YF0 A;  1WJ1 A;  1RJ2 A;  1XKE A;  4A6F A;  1MIZ B;  2EMT A;  2Z0Q A;  2GS0 A;  4WSF A;  3NWA A;  3HIE A;  2Q13 A;  3OHM B;  3RCP A;  4EJN A;  2YT2 A;  2AL6 A;  5J3Y A;  3TCA A;  3NWF A;  1H4R A;  1J0W A;  1U5G A;  1MK9 B;  2I1K A;  2YSZ A;  1EVH A;  1U5F A;  1WVH A;  2LKO A;  3BIN A;  2VKI A;  4NSW A;  1V5M A;  1U5D A;  1PLS A;  2VRW B;  2UZS A;  3A98 B;  5D3Y A;  5D3V A;  1P6S A;  3A8Q A;  1KZG A;  1AQC A;  2N23 A;  3ZDT A;  5DIF B;  1ZSQ A;  1U5E A;  4PNK A;  3KRX A;  4H8S A;  1ZC3 B;  2W2X C;  2HTH B;  3PEG A;  1KI1 B;  2DYN A;  2GCL A;  2RVB B;  3U7D A;  4HB2 B;  1T77 A;  2G35 A;  3QWM A;  2L1C A;  3ZVR A;  5C79 A;  1J19 A;  3TFM A;  3WYF B;  1FAO A;  5GOW B;  2E2X A;  3WA0 A;  2AEH A;  2COA A;  5L81 A;  3FEH A;  1MI1 A;  2Z13 A;  2J0M A;  1M7E A;  1MK7 B;  1WG7 A;  2MKR A;  4CSQ A;  1UNR A;  5DHF B;  2RSG A;  1LB1 A;  3DCX A;  4QJ3 B;  2DLW A;  2J59 M;  1SHC A;  1MIX A;  5C5B B;  2OTX A;  2YT0 A;  3IVF A;  2RLO A;  1DDV A;  3HQC A;  4HHV A;  2DTC A;  5LOP B;  2PZ1 A;  4CHM A;  1X86 A;  2I5F A;  4CHJ A;  1IRS A;  4A6K A;  2DHI A;  1FHO A;  2KCJ A;  2DX5 A;  1DDM A;  1KZ7 A;  3B77 A;  1M7R A;  5KCV A;  3A8P A;  1Q67 A;  2DKP A;  3PSC A;  4DX8 A;  4F7G A;  1FGZ A;  1NTY A;  3PVL A;  1E5W A;  2D2Q A;  1B55 A;  4B6H A;  5EFX A;  1DYN A;  1ZC4 B;  4IFS A;  3SNH A;  2W2W A;  2K00 A;  3T06 A;  2GUM A;  1H10 A;  2JP2 A;  1UNQ A;  3U12 A;  3PG7 A;  3ULB A;  4HAY B;  4L6E A;  3MDB C;  2D11 A;  4GMV A;  1UNP A;  4TKN A;  3FM8 C;  3F0W A;  4K81 A;  5JHG A;  2D4Q A;  1ISN A;  4KHB B;  2EMS A;  1W1H A;  1K5D B;  3GYP A;  3GYO A;  4KHA A;  4KHO A;  2RNR B;  4QJ4 B;  2ELA A;  2DN6 A;  1UPR A;  1U2B A;  4Y94 A;  4OSN A;  2K8E A;  1QC6 A;  3AU5 A;  1U29 A;  2YS5 A;  4DXA B;  2DYQ A;  2P8V A;  2CRF A;  1I7A A;  3HK0 A;  5I2M A;  1FHW A;  3F5R A;  1X1F A;  3LJU X;  4Z2M B;  2COC A;  2DHJ A;  5D3W A;  2UVM A;  2QKL A;  1N3H A;  4YL8 A;  2YT1 A;  4IAP A;  1NU2 A;  4OT1 A;  3TVV A;  2Y8G A;  1WGQ A;  2NZ8 B;  5DHA B;  1Y19 B;  4WVF B;  1FOE A;  4HB0 B;  1WI1 A;  1V5U A;  2DX1 A;  5I2S A;  1K5G B;  1V89 A;  3KY9 A;  4YON A;  2KIG A;  2QKM A;  1EF1 A;  2EC1 A;  5KQ4 A;  2RRF A;  3N7C A;  2R09 A;  4MY6 A;  1QQG A;  3U8Z A;  2HE7 A;  4KAX B;  1U27 A;  3HSA A;  2DKQ A;  1EAZ A;  2ROZ B;  5KQ1 A;  3DXE A;  1WGU A;  1ZM0 A;  2ADZ A;  3SUZ A;  1BTN A;  4D0N B;  2J0K A;  3PP2 A;  4HAU B;  3UZT A;  1V5P A;  4WJ7 A;  2GJY A;  5D27 A;  3OAN A;  5LON B;  5LG4 B;  1ZYI A;  2W2X D;  5D3X A;  3PVU A;  4TYZ A;  2R2Y A;  2CY5 A;  3KSY A;  1X1G A;  3SO6 A;  3VIA A;  4D6W A;  2M14 A;  2KR0 A;  4GPT B;  3SYX A;  2KUQ A;  3AJ4 A;  3HW2 B;  2MWN B;  2MFQ A;  3NWD A;  3V5W A;  2YVC A;  2ZKM X;  4HDO A;  4QJ5 B;  2Z0P A;  5FI1 A;  3CIK A;  1X11 A;  1W1G A;  2MDX A;  2D9W A;  2IFS A;  4A6F B;  2UZR A;  1EGX A;  1UEF A;  2OQB A;  4A6H A;  2LG1 A;  3QBV B;  3DXD A;  2K49 A;  5JP4 A;  3BJI A;  1ZVR A;  2D9Y A;  3AU4 A;  3FSS A;  2P0D A;  2KIE A;  1XOD A;  1PFJ A;  1XR0 B;  2DFK A;  1V88 A;  2H7E A;  4PQ0 A;  1WJM A;  1FGY A;  3ODO A;  4DBB A;  5J3Q A;  2N0Y A;  5FI0 A;  2IYB A;  5M4Y B;  5J3T A;  5C5B A;  3CXB B;  2YS1 A;  4K2O A;  2LUL A;  3ULC A;  2LOX A; 
#chains in the Genus database with same CATH homology
 2FJL A;  5JHH A;  3KRW A;  1XCG A;  2VSZ A;  5C6R A;  2D9V A;  3D8D A;  1MPH A;  1P3R A;  4MT7 A;  3TW1 A;  3VOQ A;  2GCJ A;  2CAY A;  2XQN M;  2R0D A;  3ODW A;  3D8F A;  3X23 A;  1XX0 A;  2KUP A;  1GG3 A;  1DDW A;  2ZPY A;  5HE1 A;  2COF A;  4K17 A;  1GC6 A;  5CLQ B;  2J0J A;  1DRO A;  4HAT B;  4DX9 0;  2RGN B;  4HAZ B;  5CLL B;  1P5T A;  1NTV A;  1OMW A;  4HAX B;  2ELB A;  4HB3 B;  4GZU A;  4F7H A;  2P0H A;  5HE0 A;  2YRY A;  2L2I A;  2Y7B A;  1XD4 A;  2LOZ A;  3M1I B;  4MK0 A;  5DH9 B;  2ROV A;  4HDQ A;  1FHX A;  2K2J A;  1FB8 A;  1I2H A;  2DA0 A;  3DXC A;  3ODX A;  4EMO A;  4HAV B;  2M38 A;  2V76 A;  2KGX B;  1X05 A;  4GXB A;  1UPQ A;  1SGH A;  2I1J A;  3PVW A;  4HAW B;  4KVG B;  1BTK A;  1V61 A;  3NSU A;  2COD A;  1TJ6 A;  2D9Z A;  2DHK A;  2H7D A;  3P6A A;  2I5C A;  5HE2 A;  4GN1 A;  1DBH A;  3TO1 A;  1MKE A;  1TQZ A;  3QIJ A;  2NMB A;  4C0A A;  2RUK B;  1W1D A;  1NI2 A;  5C16 A;  1GC7 A;  2YS3 A;  1MAI A;  5DI9 B;  4BBK A;  3ML4 A;  4NY0 A;  5JLJ B;  4CYE A;  2CY4 A;  1OQN A;  4ZRI A;  3O96 A;  1TXD A;  2K2U A;  3P7Z A;  1AWE A;  4ZRK A;  4Z2N A;  1BWN A;  4IOY X;  4ZRJ A;  4HB4 B;  2X18 A;  3SV1 A;  3D8E A;  1OY2 A;  4GMX B;  2BCJ A;  5HE3 A;  1PMS A;  1Z87 A;  4EKU A;  1LW3 A;  1RRP B;  4F7U P;  2LYD A;  1BAK A;  2D9X A;  4P7I A;  2Y8F A;  2EJ8 A;  3G9W A;  3KZ1 A;  3PZD A;  2P0F A;  4XWX A;  3MPX A;  4A5K A;  2D10 A;  4K2P A;  1Y5O A;  2Z0O A;  2YF0 A;  1WJ1 A;  1RJ2 A;  1XKE A;  4A6F A;  1MIZ B;  2EMT A;  2Z0Q A;  2GS0 A;  4WSF A;  2Q13 A;  3RCP A;  4EJN A;  2AL6 A;  5J3Y A;  3TCA A;  1H4R A;  1J0W A;  1U5G A;  1MK9 B;  2I1K A;  2YSZ A;  1EVH A;  1U5F A;  1WVH A;  2LKO A;  3BIN A;  2VKI A;  4NSW A;  1V5M A;  1U5D A;  1PLS A;  2VRW B;  2UZS A;  3A98 B;  5D3Y A;  5D3V A;  1P6S A;  3A8Q A;  1KZG A;  1AQC A;  2N23 A;  3ZDT A;  5DIF B;  1ZSQ A;  1U5E A;  4PNK A;  3KRX A;  4H8S A;  1ZC3 B;  2W2X C;  2HTH B;  3PEG A;  1KI1 B;  2DYN A;  2GCL A;  2RVB B;  3U7D A;  4HB2 B;  2G35 A;  3QWM A;  2L1C A;  3ZVR A;  5C79 A;  1J19 A;  3TFM A;  3WYF B;  1FAO A;  5GOW B;  2E2X A;  3WA0 A;  2AEH A;  2COA A;  5L81 A;  3FEH A;  2J0M A;  1M7E A;  1MK7 B;  1WG7 A;  2MKR A;  1UNR A;  5DHF B;  2RSG A;  1LB1 A;  2DLW A;  2J59 M;  1SHC A;  1MIX A;  5C5B B;  2OTX A;  2YT0 A;  3IVF A;  2RLO A;  1DDV A;  3HQC A;  4HHV A;  2DTC A;  5LOP B;  2PZ1 A;  4CHM A;  1X86 A;  2I5F A;  4CHJ A;  1IRS A;  4A6K A;  2DHI A;  1FHO A;  2KCJ A;  2DX5 A;  1DDM A;  1KZ7 A;  1M7R A;  5KCV A;  3A8P A;  1Q67 A;  2DKP A;  3PSC A;  4DX8 A;  4F7G A;  1FGZ A;  1NTY A;  3PVL A;  1E5W A;  2D2Q A;  1B55 A;  4B6H A;  5EFX A;  1DYN A;  1ZC4 B;  4IFS A;  3SNH A;  2W2W A;  2K00 A;  3T06 A;  1H10 A;  2JP2 A;  1UNQ A;  3PG7 A;  3ULB A;  4HAY B;  4L6E A;  3MDB C;  2D11 A;  4GMV A;  1UNP A;  4TKN A;  3FM8 C;  3F0W A;  4K81 A;  5JHG A;  2D4Q A;  1ISN A;  4KHB B;  2EMS A;  1W1H A;  1K5D B;  3GYP A;  3GYO A;  4KHA A;  4KHO A;  2RNR B;  2ELA A;  2DN6 A;  1UPR A;  1U2B A;  4Y94 A;  1QC6 A;  3AU5 A;  1U29 A;  2YS5 A;  4DXA B;  2DYQ A;  2P8V A;  2CRF A;  1I7A A;  3HK0 A;  1FHW A;  3F5R A;  1X1F A;  3LJU X;  4Z2M B;  2COC A;  2DHJ A;  5D3W A;  2UVM A;  2QKL A;  1N3H A;  4YL8 A;  2YT1 A;  4IAP A;  1NU2 A;  3TVV A;  2Y8G A;  1WGQ A;  2NZ8 B;  5DHA B;  1Y19 B;  4WVF B;  1FOE A;  4HB0 B;  1WI1 A;  1V5U A;  2DX1 A;  1K5G B;  1V89 A;  3KY9 A;  4YON A;  2QKM A;  1EF1 A;  2EC1 A;  5KQ4 A;  3N7C A;  2R09 A;  4MY6 A;  1QQG A;  3U8Z A;  2HE7 A;  4KAX B;  1U27 A;  2DKQ A;  1EAZ A;  2ROZ B;  5KQ1 A;  3DXE A;  1WGU A;  1ZM0 A;  2ADZ A;  3SUZ A;  1BTN A;  4D0N B;  2J0K A;  3PP2 A;  4HAU B;  3UZT A;  1V5P A;  4WJ7 A;  2GJY A;  5D27 A;  3OAN A;  5LON B;  2W2X D;  5D3X A;  3PVU A;  4TYZ A;  2CY5 A;  3KSY A;  1X1G A;  3SO6 A;  3VIA A;  2M14 A;  3SYX A;  4GPT B;  3AJ4 A;  3HW2 B;  2MWN B;  2MFQ A;  3V5W A;  2YVC A;  4HDO A;  2Z0P A;  5FI1 A;  3CIK A;  1X11 A;  1W1G A;  2MDX A;  2D9W A;  2IFS A;  4A6F B;  2UZR A;  1EGX A;  1UEF A;  2OQB A;  4A6H A;  2LG1 A;  3QBV B;  3DXD A;  5JP4 A;  3BJI A;  1ZVR A;  2D9Y A;  3AU4 A;  3FSS A;  2P0D A;  1XOD A;  1PFJ A;  1XR0 B;  2DFK A;  1V88 A;  2H7E A;  4PQ0 A;  1WJM A;  1FGY A;  3ODO A;  4DBB A;  5J3Q A;  2N0Y A;  5FI0 A;  2IYB A;  5J3T A;  5C5B A;  3CXB B;  2YS1 A;  4K2O A;  2LUL A;  3ULC A;  2LOX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...