4HATB

Crystal structure of crm1 inhibitor leptomycin b in complex with crm1-ran-ranbp1
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
121
structure length
121
Chain Sequence
EEDEEVLYKVRAKLFRFDKDAKEWKERGTGDCKFLKNKKTNKVRILMRRDKTLKICANHIIAPEYTLKPNVGSDRSWVYACTADIAEGEAEAFTFAIRFGSKENADKFKEEFEKAQEINKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein transport/antibiotic
molecule keywords GTP-binding nuclear protein Ran
publication title Nuclear export inhibition through covalent conjugation and hydrolysis of Leptomycin B by CRM1.
pubmed doi rcsb
source organism Homo sapiens
total genus 35
structure length 121
sequence length 121
ec nomenclature
pdb deposition date 2012-09-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00638 Ran_BP1 RanBP1 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 4hatB00
1PFJA 3OANA 4ZRJA 2OTXA 1U5DA 5C6RA 3SUZA 1ZVRA 1X11A 4Z2NA 2DFKA 1XX0A 2P0FA 1NTVA 3QBVB 2NZ8B 4MK0A 2Z0QA 1SGHA 1DDWA 1KZ7A 4EMOA 3D8FA 3BJIA 2CY4A 1XODA 1E5WA 4GMVA 2Z0PA 2DLWA 1P5TA 2H7DA 4HAUB 2YS1A 3PSCA 4KVGB 4HAVB 1FHXA 3KSYA 1PMSA 4GXBA 1KI1B 1UPRA 4HB3B 3P6AA 4MY6A 2V76A 3MPXA 2D9VA 2AEHA 4A6FB 5JHGA 1MKEA 4HAXB 2YT0A 4Y94A 2G35A 2EMSA 1WGUA 1EF1A 5D3WA 3DXCA 4K17A 4HAWB 1QC6A 5JP4A 4TKNA 3G9WA 1EVHA 2D4QA 4XWXA 1P6SA 2DX5A 2LOZA 2RSGA 2P8VA 3SO6A 1Q67A 1NU2A 2ELAA 4B6HA 4GZUA 1FGYA 2DA0A 4YL8A 1V5MA 5J3QA 2N23A 2EC1A 1M7EA 4K81A 2P0DA 2Y8GA 3CXBB 2D10A 2P0HA 2GCLA 1FHWA 2D11A 3PVUA 4K2PA 2ELBA 2I1KA 5KQ4A 1U29A 1AWEA 3SNHA 2D9WA 2QKMA 1XCGA 2HTHB 4KHBB 3PG7A 1Y19B 2W2XD 1TXDA 3ODXA 2W2WA 4WJ7A 1BWNA 2DKQA 1MIZB 5CLLB 4L6EA 4IAPA 3D8DA 1LW3A 2GCJA 2LG1A 5D3VA 1QQGA 2QKLA 2J0MA 1RJ2A 2JP2A 2OQBA 4HAYB 4DX90 2CY5A 3QIJA 3RCPA 1B55A 3A98B 2D9XA 1PLSA 1OQNA 3MDBC 3DXDA 5D27A 1XKEA 1MK7B 1X1GA 1I2HA 3ZVRA 2R0DA 1BAKA 2L2IA 2ADZA 4HB2B 2RNRB 4PQ0A 2I5FA 2ZPYA 4HDQA 5C79A 2J59M 1V88A 2N0YA 3X23A 2IYBA 4MT7A 5FI1A 2DX1A 4YONA 3FM8C 2DHKA 2FJLA 3TO1A 2ROZB 1K5GB 1Z87A 2DYQA 1SHCA 1ZC3B 3D8EA 4HB4B 2HE7A 1N3HA 4GN1A 1UNRA 2E2XA 2DN6A 1ZM0A 4F7HA 3VIAA 2YS3A 3TFMA 1P3RA 5C5BA 3KZ1A 2YRYA 2K2JA 1XR0B 1UEFA 1WVHA 4CHJA 1TQZA 4CHMA 2R09A 1H4RA 3UZTA 2VKIA 1X05A 3DXEA 2MKRA 2EMTA 2H7EA 2X18A 2K2UA 1K5DB 1WI1A 1U5EA 1Y5OA 4HB0B 2DHIA 5DHAB 2KCJA 5HE2A 3T06A 2LKOA 1X1FA 4H8SA 3KY9A 3WYFB 1U5GA 2Y7BA 3PEGA 4A5KA 4CYEA 1W1HA 4NY0A 4ZRKA 4KHAA 3PP2A 5J3YA 5DIFB 5HE0A 2DKPA 4P7IA 2CAYA 2I5CA 1V89A 2COCA 2YS5A 2RUKB 2MFQA 2COFA 5JHHA 1MPHA 5EFXA 3AJ4A 3LJUX 1EGXA 1MIXA 3ODWA 3PZDA 2GJYA 3HW2B 3KRWA 2VSZA 3TVVA 1AQCA 1WGQA 5LOPB 1FB8A 1M7RA 3VOQA 4HATB 2YT1A 4K2OA 1NI2A 2K00A 5L81A 3SV1A 3BINA 1U27A 1LB1A 2D9ZA 4GMXB 5DI9B 3N7CA 3FEHA 5KQ1A 2RGNB 1UNQA 1BTKA 1GC6A 4ZRIA 1DDMA 1OY2A 1FGZA 3CIKA 3GYPA 1W1GA 5D3XA 3U7DA 4BBKA 2NMBA 1FOEA 1ZC4B 4IOYX 5J3TA 5C16A 5FI0A 3ULCA 2LOXA 5CLQB 4D0NB 4IFSA 1ISNA 1J19A 1IRSA 1GC7A 2VRWB 5DH9B 4WVFB 4NSWA 2BCJA 2KGXB 2IFSA 4KAXB 3ZDTA 2LYDA 3PVWA 2UVMA 3F5RA 2LULA 2J0KA 4A6FA 2COAA 1DROA 4TYZA 3GYOA 2L1CA 3QWMA 4GPTB 5D3YA 2YVCA 2AL6A 3AU4A 2RLOA 3KRXA 1W1DA 3A8PA 2DHJA 4Z2MB 5GOWB 4C0AA 4DX8A 3ML4A 2UZSA 2W2XC 1X86A 1V5UA 4F7GA 4WSFA 3V5WA 3M1IB 1U5FA 2PZ1A 3F0WA 1UPQA 1DYNA 4PNKA 3AU5A 4KHOA 3U8ZA 5JLJB 1RRPB 1KZGA 1GG3A 1U2BA 2CODA 2EJ8A 1WG7A 2DYNA 3IVFA 4A6HA 2DTCA 3ODOA 5C5BB 4DBBA 3TW1A 2J0JA 1MK9B 2RVBB 1FHOA 1UNPA 4F7UP 2KUPA 3HQCA 3FSSA 1FAOA 1ZSQA 2M38A 2I1JA 1NTYA 1WJMA 2XQNM 1I7AA 4EKUA 3ULBA 1DDVA 5HE1A 2MDXA 3P7ZA 3PVLA 2CRFA 1WJ1A 4HHVA 1H10A 3O96A 3NSUA 4DXAB 2Y8FA 1XD4A 4EJNA 2Z0OA 1DBHA 4HAZB 4HDOA 3A8QA 5KCVA 5LONB 2M14A 4A6KA 1V5PA 1OMWA 3WA0A 3SYXA 2Q13A 2YSZA 1MAIA 2UZRA 1V61A 2ROVA 3TCAA 2MWNB 1EAZA 2GS0A 5HE3A 2D9YA 5DHFB 1J0WA 3HK0A 2YF0A 2D2QA 1BTNA 1TJ6A
chains in the Genus database with same CATH superfamily
1PFJA 3OANA 1MI1A 4ZRJA 2OTXA 1U5DA 5I2MA 5C6RA 3SUZA 1ZVRA 1X11A 4Z2NA 2DFKA 1XX0A 2P0FA 1NTVA 3QBVB 2NZ8B 4MK0A 2Z0QA 1SGHA 1DDWA 1KZ7A 4EMOA 3D8FA 3BJIA 2CY4A 1XODA 1E5WA 4GMVA 2Z0PA 2DLWA 1P5TA 2H7DA 4HAUB 2K49A 2YS1A 5I2SA 3PSCA 4KVGB 4HAVB 1FHXA 3KSYA 1PMSA 4GXBA 1KI1B 1UPRA 4HB3B 3P6AA 4MY6A 2V76A 3MPXA 4D6WA 2D9VA 2AEHA 4HSIA 3HSAA 4A6FB 5JHGA 1T77A 1MKEA 4HAXB 2YT0A 4Y94A 2G35A 2EMSA 4OSNA 1WGUA 1EF1A 5D3WA 3DXCA 4K17A 4HAWB 1QC6A 5JP4A 4TKNA 3G9WA 1EVHA 2D4QA 4XWXA 1P6SA 2DX5A 2LOZA 2RSGA 2P8VA 3SO6A 1Q67A 1NU2A 2ELAA 4B6HA 4GZUA 1FGYA 2DA0A 4YL8A 1V5MA 5J3QA 2N23A 4CSQA 2EC1A 1M7EA 4K81A 2P0DA 2Y8GA 3CXBB 2D10A 2P0HA 2GCLA 1FHWA 2D11A 3PVUA 4K2PA 2ELBA 2I1KA 5KQ4A 4QJ4B 1U29A 1AWEA 3SNHA 2D9WA 2QKMA 2Z14A 1XCGA 2YT2A 2HTHB 4KHBB 3PG7A 1Y19B 2W2XD 1TXDA 3ODXA 2W2WA 4WJ7A 1BWNA 2DKQA 2R2YA 1MIZB 5CLLB 4L6EA 4IAPA 3D8DA 1LW3A 2GCJA 2LG1A 5D3VA 1QQGA 4L1RA 2QKLA 2J0MA 1RJ2A 3NWAA 4OT1A 2JP2A 2OQBA 4HAYB 4DX90 2CY5A 3QIJA 3RCPA 3NWDA 1B55A 3A98B 2D9XA 1PLSA 1OQNA 3MDBC 3B77A 3DXDA 5D27A 1XKEA 1MK7B 1X1GA 1I2HA 3ZVRA 2R0DA 1BAKA 2L2IA 2ADZA 4HB2B 2RNRB 4PQ0A 4DIXA 2I5FA 2ZPYA 4HDQA 5C79A 2J59M 1ZYIA 1V88A 2N0YA 4GOUA 2IYBA 3X23A 4MT7A 5FI1A 2DX1A 4YONA 3FM8C 2DHKA 2FJLA 3TO1A 2ROZB 1K5GB 5M4YB 1Z87A 4GNKB 3U12A 2DYQA 1SHCA 1ZC3B 3D8EA 4HB4B 2HE7A 1N3HA 4GN1A 1UNRA 2E2XA 2DN6A 2K8EA 1ZM0A 4F7HA 3VIAA 2YS3A 3TFMA 1P3RA 3A58A 5C5BA 2KIEA 3KZ1A 2YRYA 2K2JA 1XR0B 1UEFA 1WVHA 4CHJA 1TQZA 4CHMA 2R09A 1H4RA 3UZTA 2VKIA 1X05A 3DXEA 2KUQA 2MKRA 2EMTA 2H7EA 2X18A 2K2UA 1K5DB 1WI1A 1U5EA 1Y5OA 4HB0B 2DHIA 5DHAB 2KR0A 2KCJA 5HE2A 3T06A 2LKOA 1X1FA 5LG4B 4H8SA 3KY9A 3WYFB 1U5GA 2Y7BA 2Z59A 3PEGA 4A5KA 4CYEA 1W1HA 4NY0A 4ZRKA 4KHAA 3NW8A 3PP2A 5J3YA 5DIFB 5HE0A 2DKPA 4P7IA 2CAYA 2GUMA 2I5CA 1V89A 2COCA 2YS5A 2RUKB 2MFQA 2COFA 5JHHA 1MPHA 5EFXA 3AJ4A 3LJUX 1EGXA 1MIXA 3ODWA 3PZDA 3HIEA 2GJYA 3HW2B 3KRWA 2VSZA 3TVVA 1AQCA 1WGQA 5LOPB 1FB8A 1M7RA 3VOQA 4HATB 2YT1A 4K2OA 1NI2A 3OHMB 2K00A 5L81A 3SV1A 3BINA 1U27A 1LB1A 2D9ZA 2RRFA 4GMXB 5DI9B 3N7CA 3FEHA 5KQ1A 2RGNB 1UNQA 1BTKA 1GC6A 4ZRIA 2ZKMX 1DDMA 1OY2A 1FGZA 3CIKA 3GYPA 1W1GA 5D3XA 3U7DA 4BBKA 2NMBA 1FOEA 1ZC4B 4IOYX 5J3TA 5C16A 5FI0A 3ULCA 2LOXA 5CLQB 4D0NB 4IFSA 1ISNA 1J19A 1IRSA 1GC7A 2VRWB 5DH9B 5IRSA 4WVFB 4NSWA 2BCJA 2KGXB 3DCXA 2IFSA 2KIGA 4KAXB 3ZDTA 2LYDA 3PVWA 2UVMA 3F5RA 2LULA 2J0KA 4A6FA 2COAA 1DROA 4TYZA 3GYOA 2L1CA 3QWMA 4GPTB 2FJUB 5D3YA 2YVCA 2AL6A 3AU4A 2RLOA 3KRXA 1W1DA 3A8PA 2DHJA 4Z2MB 5GOWB 4C0AA 4DX8A 3ML4A 2UZSA 2W2XC 2NBVA 1X86A 1V5UA 4F7GA 4WSFA 3FVCA 3V5WA 3M1IB 1U5FA 2PZ1A 3F0WA 1UPQA 1DYNA 4PNKA 3AU5A 4KHOA 3U8ZA 5JLJB 1RRPB 1KZGA 1GG3A 1U2BA 2CODA 2EJ8A 1WG7A 2DYNA 3IVFA 2Z4DA 4A6HA 2DTCA 3ODOA 5C5BB 4DBBA 3TW1A 2J0JA 1MK9B 2RVBB 1FHOA 1UNPA 4F7UP 2KUPA 3HQCA 3FSSA 1FAOA 1ZSQA 2M38A 2I1JA 1NTYA 1WJMA 4QJ5B 4KHBA 2XQNM 1I7AA 4EKUA 3ULBA 1DDVA 5HE1A 2MDXA 3P7ZA 3PVLA 2CRFA 1WJ1A 4HHVA 1H10A 3O96A 3NSUA 4QJ3B 4DXAB 2Y8FA 1XD4A 4EJNA 2Z0OA 1DBHA 4HAZB 4HDOA 3A8QA 4QXAB 2Z13A 5KCVA 5LONB 2M14A 4A6KA 1V5PA 1OMWA 3WA0A 3SYXA 2Q13A 2YSZA 1MAIA 2UZRA 1V61A 2ROVA 3TCAA 2MWNB 1EAZA 2GS0A 5HE3A 2D9YA 5DHFB 1J0WA 3HK0A 3NWFA 2YF0A 2D2QA 1BTNA 1TJ6A
chains in the Genus database with same CATH topology
1PFJA 3OANA 4ZRJA 2OTXA 1U5DA 5C6RA 3SUZA 1ZVRA 1X11A 4Z2NA 2DFKA 1XX0A 2P0FA 1NTVA 3QBVB 2NZ8B 4MK0A 2Z0QA 1SGHA 1DDWA 1KZ7A 4EMOA 3D8FA 3BJIA 2CY4A 1XODA 1E5WA 4GMVA 2Z0PA 2DLWA 1P5TA 2H7DA 4HAUB 2YS1A 3PSCA 4KVGB 4HAVB 1FHXA 3KSYA 1PMSA 4GXBA 1KI1B 1UPRA 4HB3B 3P6AA 4MY6A 2V76A 3MPXA 2D9VA 2AEHA 4A6FB 5JHGA 1MKEA 4HAXB 2YT0A 4Y94A 2G35A 2EMSA 1WGUA 1EF1A 5D3WA 3DXCA 4K17A 4HAWB 1QC6A 5JP4A 4TKNA 3G9WA 1EVHA 2D4QA 4XWXA 1P6SA 2DX5A 2LOZA 2RSGA 2P8VA 3SO6A 1Q67A 1NU2A 2ELAA 4B6HA 4GZUA 1FGYA 2DA0A 4YL8A 1V5MA 5J3QA 2N23A 2EC1A 1M7EA 4K81A 2P0DA 2Y8GA 3CXBB 2D10A 2P0HA 2GCLA 1FHWA 2D11A 3PVUA 4K2PA 2ELBA 2I1KA 5KQ4A 1U29A 1AWEA 3SNHA 2D9WA 2QKMA 1XCGA 2HTHB 4KHBB 3PG7A 1Y19B 2W2XD 1TXDA 3ODXA 2W2WA 4WJ7A 1BWNA 2DKQA 1MIZB 5CLLB 4L6EA 4IAPA 3D8DA 1LW3A 2GCJA 2LG1A 5D3VA 1QQGA 2QKLA 2J0MA 1RJ2A 2JP2A 2OQBA 4HAYB 4DX90 2CY5A 3QIJA 3RCPA 1B55A 3A98B 2D9XA 1PLSA 1OQNA 3MDBC 3DXDA 5D27A 1XKEA 1MK7B 1X1GA 1I2HA 3ZVRA 2R0DA 1BAKA 2L2IA 2ADZA 4HB2B 2RNRB 4PQ0A 2I5FA 2ZPYA 4HDQA 5C79A 2J59M 1V88A 2N0YA 3X23A 2IYBA 4MT7A 5FI1A 2DX1A 4YONA 3FM8C 2DHKA 2FJLA 3TO1A 2ROZB 1K5GB 1Z87A 2DYQA 1SHCA 1ZC3B 3D8EA 4HB4B 2HE7A 1N3HA 4GN1A 1UNRA 2E2XA 2DN6A 1ZM0A 4F7HA 3VIAA 2YS3A 3TFMA 1P3RA 5C5BA 3KZ1A 2YRYA 2K2JA 1XR0B 1UEFA 1WVHA 4CHJA 1TQZA 4CHMA 2R09A 1H4RA 3UZTA 2VKIA 1X05A 3DXEA 2MKRA 2EMTA 2H7EA 2X18A 2K2UA 1K5DB 1WI1A 1U5EA 1Y5OA 4HB0B 2DHIA 5DHAB 2KCJA 5HE2A 3T06A 2LKOA 1X1FA 4H8SA 3KY9A 3WYFB 1U5GA 2Y7BA 3PEGA 4A5KA 4CYEA 1W1HA 4NY0A 4ZRKA 4KHAA 3PP2A 5J3YA 5DIFB 5HE0A 2DKPA 4P7IA 2CAYA 2I5CA 1V89A 2COCA 2YS5A 2RUKB 2MFQA 2COFA 5JHHA 1MPHA 5EFXA 3AJ4A 3LJUX 1EGXA 1MIXA 3ODWA 3PZDA 2GJYA 3HW2B 3KRWA 2VSZA 3TVVA 1AQCA 1WGQA 5LOPB 1FB8A 1M7RA 3VOQA 4HATB 2YT1A 4K2OA 1NI2A 2K00A 5L81A 3SV1A 3BINA 1U27A 1LB1A 2D9ZA 4GMXB 5DI9B 3N7CA 3FEHA 5KQ1A 2RGNB 1UNQA 1BTKA 1GC6A 4ZRIA 1DDMA 1OY2A 1FGZA 3CIKA 3GYPA 1W1GA 5D3XA 3U7DA 4BBKA 2NMBA 1FOEA 1ZC4B 4IOYX 5J3TA 5C16A 5FI0A 3ULCA 2LOXA 5CLQB 4D0NB 4IFSA 1ISNA 1J19A 1IRSA 1GC7A 2VRWB 5DH9B 4WVFB 4NSWA 2BCJA 2KGXB 2IFSA 4KAXB 3ZDTA 2LYDA 3PVWA 2UVMA 3F5RA 2LULA 2J0KA 4A6FA 2COAA 1DROA 4TYZA 3GYOA 2L1CA 3QWMA 4GPTB 5D3YA 2YVCA 2AL6A 3AU4A 2RLOA 3KRXA 1W1DA 3A8PA 2DHJA 4Z2MB 5GOWB 4C0AA 4DX8A 3ML4A 2UZSA 2W2XC 1X86A 1V5UA 4F7GA 4WSFA 3V5WA 3M1IB 1U5FA 2PZ1A 3F0WA 1UPQA 1DYNA 4PNKA 3AU5A 4KHOA 3U8ZA 5JLJB 1RRPB 1KZGA 1GG3A 1U2BA 2CODA 2EJ8A 1WG7A 2DYNA 3IVFA 4A6HA 2DTCA 3ODOA 5C5BB 4DBBA 3TW1A 2J0JA 1MK9B 2RVBB 1FHOA 1UNPA 4F7UP 2KUPA 3HQCA 3FSSA 1FAOA 1ZSQA 2M38A 2I1JA 1NTYA 1WJMA 2XQNM 1I7AA 4EKUA 3ULBA 1DDVA 5HE1A 2MDXA 3P7ZA 3PVLA 2CRFA 1WJ1A 4HHVA 1H10A 3O96A 3NSUA 4DXAB 2Y8FA 1XD4A 4EJNA 2Z0OA 1DBHA 4HAZB 4HDOA 3A8QA 5KCVA 5LONB 2M14A 4A6KA 1V5PA 1OMWA 3WA0A 3SYXA 2Q13A 2YSZA 1MAIA 2UZRA 1V61A 2ROVA 3TCAA 2MWNB 1EAZA 2GS0A 5HE3A 2D9YA 5DHFB 1J0WA 3HK0A 2YF0A 2D2QA 1BTNA 1TJ6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PFJ A;  3OAN A;  4ZRJ A;  2OTX A;  1U5D A;  5C6R A;  3SUZ A;  1ZVR A;  1X11 A;  4Z2N A;  2DFK A;  1XX0 A;  2P0F A;  1NTV A;  3QBV B;  2NZ8 B;  4MK0 A;  2Z0Q A;  1SGH A;  1DDW A;  1KZ7 A;  4EMO A;  3D8F A;  3BJI A;  2CY4 A;  1XOD A;  1E5W A;  4GMV A;  2Z0P A;  2DLW A;  1P5T A;  2H7D A;  4HAU B;  2YS1 A;  3PSC A;  4KVG B;  4HAV B;  1FHX A;  3KSY A;  1PMS A;  4GXB A;  1KI1 B;  1UPR A;  4HB3 B;  3P6A A;  4MY6 A;  2V76 A;  3MPX A;  2D9V A;  2AEH A;  4A6F B;  5JHG A;  1MKE A;  4HAX B;  2YT0 A;  4Y94 A;  2G35 A;  2EMS A;  1WGU A;  1EF1 A;  5D3W A;  3DXC A;  4K17 A;  4HAW B;  1QC6 A;  5JP4 A;  4TKN A;  3G9W A;  1EVH A;  2D4Q A;  4XWX A;  1P6S A;  2DX5 A;  2LOZ A;  2RSG A;  2P8V A;  3SO6 A;  1Q67 A;  1NU2 A;  2ELA A;  4B6H A;  4GZU A;  1FGY A;  2DA0 A;  4YL8 A;  1V5M A;  5J3Q A;  2N23 A;  2EC1 A;  1M7E A;  4K81 A;  2P0D A;  2Y8G A;  3CXB B;  2D10 A;  2P0H A;  2GCL A;  1FHW A;  2D11 A;  3PVU A;  4K2P A;  2ELB A;  2I1K A;  5KQ4 A;  1U29 A;  1AWE A;  3SNH A;  2D9W A;  2QKM A;  1XCG A;  2HTH B;  4KHB B;  3PG7 A;  1Y19 B;  2W2X D;  1TXD A;  3ODX A;  2W2W A;  4WJ7 A;  1BWN A;  2DKQ A;  1MIZ B;  5CLL B;  4L6E A;  4IAP A;  3D8D A;  1LW3 A;  2GCJ A;  2LG1 A;  5D3V A;  1QQG A;  2QKL A;  2J0M A;  1RJ2 A;  2JP2 A;  2OQB A;  4HAY B;  4DX9 0;  2CY5 A;  3QIJ A;  3RCP A;  1B55 A;  3A98 B;  2D9X A;  1PLS A;  1OQN A;  3MDB C;  3DXD A;  5D27 A;  1XKE A;  1MK7 B;  1X1G A;  1I2H A;  3ZVR A;  2R0D A;  1BAK A;  2L2I A;  2ADZ A;  4HB2 B;  2RNR B;  4PQ0 A;  2I5F A;  2ZPY A;  4HDQ A;  5C79 A;  2J59 M;  1V88 A;  2N0Y A;  3X23 A;  2IYB A;  4MT7 A;  5FI1 A;  2DX1 A;  4YON A;  3FM8 C;  2DHK A;  2FJL A;  3TO1 A;  2ROZ B;  1K5G B;  1Z87 A;  2DYQ A;  1SHC A;  1ZC3 B;  3D8E A;  4HB4 B;  2HE7 A;  1N3H A;  4GN1 A;  1UNR A;  2E2X A;  2DN6 A;  1ZM0 A;  4F7H A;  3VIA A;  2YS3 A;  3TFM A;  1P3R A;  5C5B A;  3KZ1 A;  2YRY A;  2K2J A;  1XR0 B;  1UEF A;  1WVH A;  4CHJ A;  1TQZ A;  4CHM A;  2R09 A;  1H4R A;  3UZT A;  2VKI A;  1X05 A;  3DXE A;  2MKR A;  2EMT A;  2H7E A;  2X18 A;  2K2U A;  1K5D B;  1WI1 A;  1U5E A;  1Y5O A;  4HB0 B;  2DHI A;  5DHA B;  2KCJ A;  5HE2 A;  3T06 A;  2LKO A;  1X1F A;  4H8S A;  3KY9 A;  3WYF B;  1U5G A;  2Y7B A;  3PEG A;  4A5K A;  4CYE A;  1W1H A;  4NY0 A;  4ZRK A;  4KHA A;  3PP2 A;  5J3Y A;  5DIF B;  5HE0 A;  2DKP A;  4P7I A;  2CAY A;  2I5C A;  1V89 A;  2COC A;  2YS5 A;  2RUK B;  2MFQ A;  2COF A;  5JHH A;  1MPH A;  5EFX A;  3AJ4 A;  3LJU X;  1EGX A;  1MIX A;  3ODW A;  3PZD A;  2GJY A;  3HW2 B;  3KRW A;  2VSZ A;  3TVV A;  1AQC A;  1WGQ A;  5LOP B;  1FB8 A;  1M7R A;  3VOQ A;  4HAT B;  2YT1 A;  4K2O A;  1NI2 A;  2K00 A;  5L81 A;  3SV1 A;  3BIN A;  1U27 A;  1LB1 A;  2D9Z A;  4GMX B;  5DI9 B;  3N7C A;  3FEH A;  5KQ1 A;  2RGN B;  1UNQ A;  1BTK A;  1GC6 A;  4ZRI A;  1DDM A;  1OY2 A;  1FGZ A;  3CIK A;  3GYP A;  1W1G A;  5D3X A;  3U7D A;  4BBK A;  2NMB A;  1FOE A;  1ZC4 B;  4IOY X;  5J3T A;  5C16 A;  5FI0 A;  3ULC A;  2LOX A;  5CLQ B;  4D0N B;  4IFS A;  1ISN A;  1J19 A;  1IRS A;  1GC7 A;  2VRW B;  5DH9 B;  4WVF B;  4NSW A;  2BCJ A;  2KGX B;  2IFS A;  4KAX B;  3ZDT A;  2LYD A;  3PVW A;  2UVM A;  3F5R A;  2LUL A;  2J0K A;  4A6F A;  2COA A;  1DRO A;  4TYZ A;  3GYO A;  2L1C A;  3QWM A;  4GPT B;  5D3Y A;  2YVC A;  2AL6 A;  3AU4 A;  2RLO A;  3KRX A;  1W1D A;  3A8P A;  2DHJ A;  4Z2M B;  5GOW B;  4C0A A;  4DX8 A;  3ML4 A;  2UZS A;  2W2X C;  1X86 A;  1V5U A;  4F7G A;  4WSF A;  3V5W A;  3M1I B;  1U5F A;  2PZ1 A;  3F0W A;  1UPQ A;  1DYN A;  4PNK A;  3AU5 A;  4KHO A;  3U8Z A;  5JLJ B;  1RRP B;  1KZG A;  1GG3 A;  1U2B A;  2COD A;  2EJ8 A;  1WG7 A;  2DYN A;  3IVF A;  4A6H A;  2DTC A;  3ODO A;  5C5B B;  4DBB A;  3TW1 A;  2J0J A;  1MK9 B;  2RVB B;  1FHO A;  1UNP A;  4F7U P;  2KUP A;  3HQC A;  3FSS A;  1FAO A;  1ZSQ A;  2M38 A;  2I1J A;  1NTY A;  1WJM A;  2XQN M;  1I7A A;  4EKU A;  3ULB A;  1DDV A;  5HE1 A;  2MDX A;  3P7Z A;  3PVL A;  2CRF A;  1WJ1 A;  4HHV A;  1H10 A;  3O96 A;  3NSU A;  4DXA B;  2Y8F A;  1XD4 A;  4EJN A;  2Z0O A;  1DBH A;  4HAZ B;  4HDO A;  3A8Q A;  5KCV A;  5LON B;  2M14 A;  4A6K A;  1V5P A;  1OMW A;  3WA0 A;  3SYX A;  2Q13 A;  2YSZ A;  1MAI A;  2UZR A;  1V61 A;  2ROV A;  3TCA A;  2MWN B;  1EAZ A;  2GS0 A;  5HE3 A;  2D9Y A;  5DHF B;  1J0W A;  3HK0 A;  2YF0 A;  2D2Q A;  1BTN A;  1TJ6 A; 
#chains in the Genus database with same CATH topology
 1PFJ A;  3OAN A;  1MI1 A;  4ZRJ A;  2OTX A;  1U5D A;  5I2M A;  5C6R A;  3SUZ A;  1ZVR A;  1X11 A;  4Z2N A;  2DFK A;  1XX0 A;  2P0F A;  1NTV A;  3QBV B;  2NZ8 B;  4MK0 A;  2Z0Q A;  1SGH A;  1DDW A;  1KZ7 A;  4EMO A;  3D8F A;  3BJI A;  2CY4 A;  1XOD A;  1E5W A;  4GMV A;  2Z0P A;  2DLW A;  1P5T A;  2H7D A;  4HAU B;  2K49 A;  2YS1 A;  5I2S A;  3PSC A;  4KVG B;  4HAV B;  1FHX A;  3KSY A;  1PMS A;  4GXB A;  1KI1 B;  1UPR A;  4HB3 B;  3P6A A;  4MY6 A;  2V76 A;  3MPX A;  4D6W A;  2D9V A;  2AEH A;  4HSI A;  3HSA A;  4A6F B;  5JHG A;  1T77 A;  1MKE A;  4HAX B;  2YT0 A;  4Y94 A;  2G35 A;  2EMS A;  4OSN A;  1WGU A;  1EF1 A;  5D3W A;  3DXC A;  4K17 A;  4HAW B;  1QC6 A;  5JP4 A;  4TKN A;  3G9W A;  1EVH A;  2D4Q A;  4XWX A;  1P6S A;  2DX5 A;  2LOZ A;  2RSG A;  2P8V A;  3SO6 A;  1Q67 A;  1NU2 A;  2ELA A;  4B6H A;  4GZU A;  1FGY A;  2DA0 A;  4YL8 A;  1V5M A;  5J3Q A;  2N23 A;  4CSQ A;  2EC1 A;  1M7E A;  4K81 A;  2P0D A;  2Y8G A;  3CXB B;  2D10 A;  2P0H A;  2GCL A;  1FHW A;  2D11 A;  3PVU A;  4K2P A;  2ELB A;  2I1K A;  5KQ4 A;  4QJ4 B;  1U29 A;  1AWE A;  3SNH A;  2D9W A;  2QKM A;  2Z14 A;  1XCG A;  2YT2 A;  2HTH B;  4KHB B;  3PG7 A;  1Y19 B;  2W2X D;  1TXD A;  3ODX A;  2W2W A;  4WJ7 A;  1BWN A;  2DKQ A;  2R2Y A;  1MIZ B;  5CLL B;  4L6E A;  4IAP A;  3D8D A;  1LW3 A;  2GCJ A;  2LG1 A;  5D3V A;  1QQG A;  4L1R A;  2QKL A;  2J0M A;  1RJ2 A;  3NWA A;  4OT1 A;  2JP2 A;  2OQB A;  4HAY B;  4DX9 0;  2CY5 A;  3QIJ A;  3RCP A;  3NWD A;  1B55 A;  3A98 B;  2D9X A;  1PLS A;  1OQN A;  3MDB C;  3B77 A;  3DXD A;  5D27 A;  1XKE A;  1MK7 B;  1X1G A;  1I2H A;  3ZVR A;  2R0D A;  1BAK A;  2L2I A;  2ADZ A;  4HB2 B;  2RNR B;  4PQ0 A;  4DIX A;  2I5F A;  2ZPY A;  4HDQ A;  5C79 A;  2J59 M;  1ZYI A;  1V88 A;  2N0Y A;  4GOU A;  2IYB A;  3X23 A;  4MT7 A;  5FI1 A;  2DX1 A;  4YON A;  3FM8 C;  2DHK A;  2FJL A;  3TO1 A;  2ROZ B;  1K5G B;  5M4Y B;  1Z87 A;  4GNK B;  3U12 A;  2DYQ A;  1SHC A;  1ZC3 B;  3D8E A;  4HB4 B;  2HE7 A;  1N3H A;  4GN1 A;  1UNR A;  2E2X A;  2DN6 A;  2K8E A;  1ZM0 A;  4F7H A;  3VIA A;  2YS3 A;  3TFM A;  1P3R A;  3A58 A;  5C5B A;  2KIE A;  3KZ1 A;  2YRY A;  2K2J A;  1XR0 B;  1UEF A;  1WVH A;  4CHJ A;  1TQZ A;  4CHM A;  2R09 A;  1H4R A;  3UZT A;  2VKI A;  1X05 A;  3DXE A;  2KUQ A;  2MKR A;  2EMT A;  2H7E A;  2X18 A;  2K2U A;  1K5D B;  1WI1 A;  1U5E A;  1Y5O A;  4HB0 B;  2DHI A;  5DHA B;  2KR0 A;  2KCJ A;  5HE2 A;  3T06 A;  2LKO A;  1X1F A;  5LG4 B;  4H8S A;  3KY9 A;  3WYF B;  1U5G A;  2Y7B A;  2Z59 A;  3PEG A;  4A5K A;  4CYE A;  1W1H A;  4NY0 A;  4ZRK A;  4KHA A;  3NW8 A;  3PP2 A;  5J3Y A;  5DIF B;  5HE0 A;  2DKP A;  4P7I A;  2CAY A;  2GUM A;  2I5C A;  1V89 A;  2COC A;  2YS5 A;  2RUK B;  2MFQ A;  2COF A;  5JHH A;  1MPH A;  5EFX A;  3AJ4 A;  3LJU X;  1EGX A;  1MIX A;  3ODW A;  3PZD A;  3HIE A;  2GJY A;  3HW2 B;  3KRW A;  2VSZ A;  3TVV A;  1AQC A;  1WGQ A;  5LOP B;  1FB8 A;  1M7R A;  3VOQ A;  4HAT B;  2YT1 A;  4K2O A;  1NI2 A;  3OHM B;  2K00 A;  5L81 A;  3SV1 A;  3BIN A;  1U27 A;  1LB1 A;  2D9Z A;  2RRF A;  4GMX B;  5DI9 B;  3N7C A;  3FEH A;  5KQ1 A;  2RGN B;  1UNQ A;  1BTK A;  1GC6 A;  4ZRI A;  2ZKM X;  1DDM A;  1OY2 A;  1FGZ A;  3CIK A;  3GYP A;  1W1G A;  5D3X A;  3U7D A;  4BBK A;  2NMB A;  1FOE A;  1ZC4 B;  4IOY X;  5J3T A;  5C16 A;  5FI0 A;  3ULC A;  2LOX A;  5CLQ B;  4D0N B;  4IFS A;  1ISN A;  1J19 A;  1IRS A;  1GC7 A;  2VRW B;  5DH9 B;  5IRS A;  4WVF B;  4NSW A;  2BCJ A;  2KGX B;  3DCX A;  2IFS A;  2KIG A;  4KAX B;  3ZDT A;  2LYD A;  3PVW A;  2UVM A;  3F5R A;  2LUL A;  2J0K A;  4A6F A;  2COA A;  1DRO A;  4TYZ A;  3GYO A;  2L1C A;  3QWM A;  4GPT B;  2FJU B;  5D3Y A;  2YVC A;  2AL6 A;  3AU4 A;  2RLO A;  3KRX A;  1W1D A;  3A8P A;  2DHJ A;  4Z2M B;  5GOW B;  4C0A A;  4DX8 A;  3ML4 A;  2UZS A;  2W2X C;  2NBV A;  1X86 A;  1V5U A;  4F7G A;  4WSF A;  3FVC A;  3V5W A;  3M1I B;  1U5F A;  2PZ1 A;  3F0W A;  1UPQ A;  1DYN A;  4PNK A;  3AU5 A;  4KHO A;  3U8Z A;  5JLJ B;  1RRP B;  1KZG A;  1GG3 A;  1U2B A;  2COD A;  2EJ8 A;  1WG7 A;  2DYN A;  3IVF A;  2Z4D A;  4A6H A;  2DTC A;  3ODO A;  5C5B B;  4DBB A;  3TW1 A;  2J0J A;  1MK9 B;  2RVB B;  1FHO A;  1UNP A;  4F7U P;  2KUP A;  3HQC A;  3FSS A;  1FAO A;  1ZSQ A;  2M38 A;  2I1J A;  1NTY A;  1WJM A;  4QJ5 B;  4KHB A;  2XQN M;  1I7A A;  4EKU A;  3ULB A;  1DDV A;  5HE1 A;  2MDX A;  3P7Z A;  3PVL A;  2CRF A;  1WJ1 A;  4HHV A;  1H10 A;  3O96 A;  3NSU A;  4QJ3 B;  4DXA B;  2Y8F A;  1XD4 A;  4EJN A;  2Z0O A;  1DBH A;  4HAZ B;  4HDO A;  3A8Q A;  4QXA B;  2Z13 A;  5KCV A;  5LON B;  2M14 A;  4A6K A;  1V5P A;  1OMW A;  3WA0 A;  3SYX A;  2Q13 A;  2YSZ A;  1MAI A;  2UZR A;  1V61 A;  2ROV A;  3TCA A;  2MWN B;  1EAZ A;  2GS0 A;  5HE3 A;  2D9Y A;  5DHF B;  1J0W A;  3HK0 A;  3NWF A;  2YF0 A;  2D2Q A;  1BTN A;  1TJ6 A; 
#chains in the Genus database with same CATH homology
 1PFJ A;  3OAN A;  4ZRJ A;  2OTX A;  1U5D A;  5C6R A;  3SUZ A;  1ZVR A;  1X11 A;  4Z2N A;  2DFK A;  1XX0 A;  2P0F A;  1NTV A;  3QBV B;  2NZ8 B;  4MK0 A;  2Z0Q A;  1SGH A;  1DDW A;  1KZ7 A;  4EMO A;  3D8F A;  3BJI A;  2CY4 A;  1XOD A;  1E5W A;  4GMV A;  2Z0P A;  2DLW A;  1P5T A;  2H7D A;  4HAU B;  2YS1 A;  3PSC A;  4KVG B;  4HAV B;  1FHX A;  3KSY A;  1PMS A;  4GXB A;  1KI1 B;  1UPR A;  4HB3 B;  3P6A A;  4MY6 A;  2V76 A;  3MPX A;  2D9V A;  2AEH A;  4A6F B;  5JHG A;  1MKE A;  4HAX B;  2YT0 A;  4Y94 A;  2G35 A;  2EMS A;  1WGU A;  1EF1 A;  5D3W A;  3DXC A;  4K17 A;  4HAW B;  1QC6 A;  5JP4 A;  4TKN A;  3G9W A;  1EVH A;  2D4Q A;  4XWX A;  1P6S A;  2DX5 A;  2LOZ A;  2RSG A;  2P8V A;  3SO6 A;  1Q67 A;  1NU2 A;  2ELA A;  4B6H A;  4GZU A;  1FGY A;  2DA0 A;  4YL8 A;  1V5M A;  5J3Q A;  2N23 A;  2EC1 A;  1M7E A;  4K81 A;  2P0D A;  2Y8G A;  3CXB B;  2D10 A;  2P0H A;  2GCL A;  1FHW A;  2D11 A;  3PVU A;  4K2P A;  2ELB A;  2I1K A;  5KQ4 A;  1U29 A;  1AWE A;  3SNH A;  2D9W A;  2QKM A;  1XCG A;  2HTH B;  4KHB B;  3PG7 A;  1Y19 B;  2W2X D;  1TXD A;  3ODX A;  2W2W A;  4WJ7 A;  1BWN A;  2DKQ A;  1MIZ B;  5CLL B;  4L6E A;  4IAP A;  3D8D A;  1LW3 A;  2GCJ A;  2LG1 A;  5D3V A;  1QQG A;  2QKL A;  2J0M A;  1RJ2 A;  2JP2 A;  2OQB A;  4HAY B;  4DX9 0;  2CY5 A;  3QIJ A;  3RCP A;  1B55 A;  3A98 B;  2D9X A;  1PLS A;  1OQN A;  3MDB C;  3DXD A;  5D27 A;  1XKE A;  1MK7 B;  1X1G A;  1I2H A;  3ZVR A;  2R0D A;  1BAK A;  2L2I A;  2ADZ A;  4HB2 B;  2RNR B;  4PQ0 A;  2I5F A;  2ZPY A;  4HDQ A;  5C79 A;  2J59 M;  1V88 A;  2N0Y A;  3X23 A;  2IYB A;  4MT7 A;  5FI1 A;  2DX1 A;  4YON A;  3FM8 C;  2DHK A;  2FJL A;  3TO1 A;  2ROZ B;  1K5G B;  1Z87 A;  2DYQ A;  1SHC A;  1ZC3 B;  3D8E A;  4HB4 B;  2HE7 A;  1N3H A;  4GN1 A;  1UNR A;  2E2X A;  2DN6 A;  1ZM0 A;  4F7H A;  3VIA A;  2YS3 A;  3TFM A;  1P3R A;  5C5B A;  3KZ1 A;  2YRY A;  2K2J A;  1XR0 B;  1UEF A;  1WVH A;  4CHJ A;  1TQZ A;  4CHM A;  2R09 A;  1H4R A;  3UZT A;  2VKI A;  1X05 A;  3DXE A;  2MKR A;  2EMT A;  2H7E A;  2X18 A;  2K2U A;  1K5D B;  1WI1 A;  1U5E A;  1Y5O A;  4HB0 B;  2DHI A;  5DHA B;  2KCJ A;  5HE2 A;  3T06 A;  2LKO A;  1X1F A;  4H8S A;  3KY9 A;  3WYF B;  1U5G A;  2Y7B A;  3PEG A;  4A5K A;  4CYE A;  1W1H A;  4NY0 A;  4ZRK A;  4KHA A;  3PP2 A;  5J3Y A;  5DIF B;  5HE0 A;  2DKP A;  4P7I A;  2CAY A;  2I5C A;  1V89 A;  2COC A;  2YS5 A;  2RUK B;  2MFQ A;  2COF A;  5JHH A;  1MPH A;  5EFX A;  3AJ4 A;  3LJU X;  1EGX A;  1MIX A;  3ODW A;  3PZD A;  2GJY A;  3HW2 B;  3KRW A;  2VSZ A;  3TVV A;  1AQC A;  1WGQ A;  5LOP B;  1FB8 A;  1M7R A;  3VOQ A;  4HAT B;  2YT1 A;  4K2O A;  1NI2 A;  2K00 A;  5L81 A;  3SV1 A;  3BIN A;  1U27 A;  1LB1 A;  2D9Z A;  4GMX B;  5DI9 B;  3N7C A;  3FEH A;  5KQ1 A;  2RGN B;  1UNQ A;  1BTK A;  1GC6 A;  4ZRI A;  1DDM A;  1OY2 A;  1FGZ A;  3CIK A;  3GYP A;  1W1G A;  5D3X A;  3U7D A;  4BBK A;  2NMB A;  1FOE A;  1ZC4 B;  4IOY X;  5J3T A;  5C16 A;  5FI0 A;  3ULC A;  2LOX A;  5CLQ B;  4D0N B;  4IFS A;  1ISN A;  1J19 A;  1IRS A;  1GC7 A;  2VRW B;  5DH9 B;  4WVF B;  4NSW A;  2BCJ A;  2KGX B;  2IFS A;  4KAX B;  3ZDT A;  2LYD A;  3PVW A;  2UVM A;  3F5R A;  2LUL A;  2J0K A;  4A6F A;  2COA A;  1DRO A;  4TYZ A;  3GYO A;  2L1C A;  3QWM A;  4GPT B;  5D3Y A;  2YVC A;  2AL6 A;  3AU4 A;  2RLO A;  3KRX A;  1W1D A;  3A8P A;  2DHJ A;  4Z2M B;  5GOW B;  4C0A A;  4DX8 A;  3ML4 A;  2UZS A;  2W2X C;  1X86 A;  1V5U A;  4F7G A;  4WSF A;  3V5W A;  3M1I B;  1U5F A;  2PZ1 A;  3F0W A;  1UPQ A;  1DYN A;  4PNK A;  3AU5 A;  4KHO A;  3U8Z A;  5JLJ B;  1RRP B;  1KZG A;  1GG3 A;  1U2B A;  2COD A;  2EJ8 A;  1WG7 A;  2DYN A;  3IVF A;  4A6H A;  2DTC A;  3ODO A;  5C5B B;  4DBB A;  3TW1 A;  2J0J A;  1MK9 B;  2RVB B;  1FHO A;  1UNP A;  4F7U P;  2KUP A;  3HQC A;  3FSS A;  1FAO A;  1ZSQ A;  2M38 A;  2I1J A;  1NTY A;  1WJM A;  2XQN M;  1I7A A;  4EKU A;  3ULB A;  1DDV A;  5HE1 A;  2MDX A;  3P7Z A;  3PVL A;  2CRF A;  1WJ1 A;  4HHV A;  1H10 A;  3O96 A;  3NSU A;  4DXA B;  2Y8F A;  1XD4 A;  4EJN A;  2Z0O A;  1DBH A;  4HAZ B;  4HDO A;  3A8Q A;  5KCV A;  5LON B;  2M14 A;  4A6K A;  1V5P A;  1OMW A;  3WA0 A;  3SYX A;  2Q13 A;  2YSZ A;  1MAI A;  2UZR A;  1V61 A;  2ROV A;  3TCA A;  2MWN B;  1EAZ A;  2GS0 A;  5HE3 A;  2D9Y A;  5DHF B;  1J0W A;  3HK0 A;  2YF0 A;  2D2Q A;  1BTN A;  1TJ6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...