5C79A

Ph domain of asap1 in complex with dic4-ptdins(4,5)p2
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
104
structure length
104
Chain Sequence
GNKEYGSEKKGFLLKKSDGIRKVWQRRKCAVKNGILTISHATSNRQPAKLNLLTCQVKPNAEDKKSFDLISHNRTYHFQAEDEQDYIAWISVLTNSKEEALTMA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Arf-GAP
publication title Molecular Basis for Cooperative Binding of Anionic Phospholipids to the PH Domain of the Arf GAP ASAP1.
pubmed doi rcsb
source organism Mus musculus
molecule tags Signaling protein
total genus 22
structure length 104
sequence length 104
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-06-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00169 PH PH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 5c79A00
2EMSA 4GXBA 4XWXA 1XX0A 3LJUX 4PQ0A 5HE1A 4A6HA 4K17A 1XCGA 2RVBB 4HAZB 4F7HA 1MPHA 4NY0A 3D8DA 2XQNM 1V89A 3PSCA 1DROA 1ISNA 3QWMA 5DHAB 3WA0A 1U27A 4K2PA 4WJ7A 3X23A 5C79A 1TXDA 3DXEA 1P6SA 2D2QA 2LKOA 1Z87A 3TFMA 4ZRJA 2K00A 5HE2A 4A6KA 2YF0A 1MAIA 5EFXA 2DX5A 3DXCA 2V76A 2H7DA 3KRWA 2W2XD 4ZRKA 3CIKA 1BWNA 1GC6A 2W2XC 1U5GA 2NZ8B 4D0NB 5D3WA 2DFKA 2DKQA 2D9ZA 2DHJA 1P3RA 4IFSA 1U5DA 1AWEA 2D9WA 1GG3A 3NSUA 5DIFB 2D10A 3ZDTA 2LOZA 4F7UP 1M7EA 4MK0A 5D3XA 1K5GB 3PP2A 3FSSA 3G9WA 1Y5OA 3KY9A 2D9YA 2YT1A 1H10A 4HB4B 2I1KA 1V5MA 4DXAB 2UVMA 2Z0PA 1H4RA 3D8EA 5GOWB 4HDOA 3SO6A 2N23A 5JP4A 2UZRA 5LONB 1UNRA 4BBKA 4HB3B 2J59M 3ODOA 3ODXA 2NMBA 1FHOA 2MFQA 4A6FB 2Y8GA 5JLJB 1FHWA 4H8SA 1UNQA 4ZRIA 4CHMA 2Z0QA 1WVHA 1TJ6A 2YS3A 1NTYA 2J0KA 1V61A 4CYEA 5FI0A 2GCLA 1B55A 3O96A 1KZGA 4WSFA 2UZSA 2HTHB 5C16A 2D9XA 2MKRA 2Y7BA 4HAYB 2E2XA 3WYFB 1MK7B 2DLWA 1EAZA 3SUZA 5LOPB 5JHHA 4HAWB 1SHCA 2L1CA 1TQZA 2M38A 2MDXA 3A98B 3HW2B 3KSYA 2RLOA 2IFSA 5D3YA 1WI1A 3HK0A 5CLQB 5J3YA 3U7DA 2EMTA 2RUKB 3GYOA 5C5BA 3ULBA 1RRPB 2M14A 4Y94A 3RCPA 1ZSQA 4YL8A 3GYPA 2DN6A 4B6HA 2ADZA 3FEHA 1UPQA 4KHAA 2VRWB 2OTXA 2DX1A 2YRYA 2R09A 3TO1A 2RNRB 4IOYX 2P0DA 2RSGA 3AU4A 5DI9B 5CLLB 4KAXB 2K2JA 1PFJA 5C5BB 5D27A 1Q67A 2CRFA 2CODA 2R0DA 3PG7A 2GS0A 3PEGA 2GCJA 2DYQA 2AEHA 4TYZA 5J3QA 2DA0A 4PNKA 3T06A 1FB8A 3TCAA 2W2WA 1V5PA 2LULA 1WGQA 4GMVA 2JP2A 1OMWA 2L2IA 1U5EA 2ELAA 5HE0A 4GPTB 2GJYA 1U5FA 1OQNA 2CAYA 5JHGA 1RJ2A 2KGXB 2N0YA 4HAXB 1X05A 2ELBA 3TW1A 4HAUB 2VSZA 2ZPYA 2D9VA 2QKMA 1WGUA 4EMOA 2LG1A 2PZ1A 5C6RA 3ODWA 2COCA 3MPXA 3IVFA 3UZTA 2ROZB 4MT7A 1DDMA 4KVGB 3VOQA 2I1JA 1LB1A 2DTCA 3MDBC 1SGHA 1V5UA 1ZC3B 1I2HA 1W1HA 5KQ4A 4HDQA 1K5DB 2YS1A 2EJ8A 5J3TA 3ZVRA 4F7GA 3TVVA 5DH9B 1W1DA 2H7EA 3PVWA 3CXBB 1NU2A 1MIZB 2LOXA 2P8VA 2MWNB 2KCJA 3A8PA 2IYBA 3VIAA 1ZC4B 1J19A 3F5RA 3P6AA 4P7IA 1FOEA 1FAOA 1FGYA 2Z0OA 2COFA 4L6EA 1QC6A 3QBVB 1UPRA 2YS5A 2DHIA 3P7ZA 2RGNB 2G35A 5L81A 1WJ1A 4Z2MB 2D11A 1BAKA 1ZVRA 2YVCA 1MKEA 3ULCA 1AQCA 1P5TA 2ROVA 4HAVB 2HE7A 4EJNA 2I5CA 2CY4A 1XODA 4HHVA 1WJMA 1W1GA 1WG7A 2COAA 3FM8C 1XR0B 1EF1A 1DDVA 5KQ1A 1PLSA 2P0FA 5DHFB 4HB2B 1X1GA 4CHJA 3PVLA 1GC7A 3SNHA 4GMXB 3BINA 3QIJA 1I7AA 1KZ7A 3D8FA 4YONA 3AJ4A 5KCVA 1IRSA 2FJLA 3N7CA 4GN1A 4K2OA 3ML4A 3KZ1A 4EKUA 1QQGA 2DHKA 5HE3A 4GZUA 4DX8A 2YT0A 1N3HA 2QKLA 3KRXA 3DXDA 3U8ZA 1DYNA 2Y8FA 1FGZA 3AU5A 4KHOA 2J0MA 1EGXA 4A6FA 1KI1B 1LW3A 1NTVA 1X1FA 1DDWA 1XKEA 5FI1A 4DX90 2J0JA 3OANA 2YSZA 4MY6A 4WVFB 1M7RA 1EVHA 2CY5A 3V5WA 1MIXA 2D4QA 1UNPA 2X18A 4NSWA 4C0AA 4HB0B 2DKPA 3PZDA 1Y19B 4HATB 1V88A 4DBBA 1J0WA 4K81A 4IAPA 2KUPA 4KHBB 1E5WA 1DBHA 3BJIA 1U2BA 1PMSA 1U29A 1ZM0A 1BTKA 1NI2A 2EC1A 3M1IB 1FHXA 2K2UA 3HQCA 2Q13A 3PVUA 3F0WA 1XD4A 1X86A 1BTNA 3SV1A 4Z2NA 1X11A 4TKNA 2LYDA 2OQBA 2DYNA 2AL6A 5D3VA 4A5KA 1MK9B 1OY2A 2BCJA 2I5FA 1UEFA 3SYXA 2P0HA 3A8QA 2VKIA
chains in the Genus database with same CATH superfamily
2EMSA 4GXBA 4XWXA 1XX0A 2NBVA 3LJUX 4PQ0A 5HE1A 4A6HA 4K17A 1XCGA 2RVBB 4GOUA 4HAZB 4F7HA 1MPHA 5LG4B 4NY0A 3D8DA 1MI1A 2XQNM 5I2MA 1V89A 3PSCA 1DROA 1ISNA 3QWMA 5DHAB 3WA0A 1U27A 4K2PA 4WJ7A 3X23A 5C79A 1TXDA 3DXEA 1P6SA 2D2QA 2LKOA 1Z87A 3TFMA 4ZRJA 2K00A 5HE2A 3FVCA 4A6KA 2YF0A 1MAIA 5EFXA 5IRSA 2DX5A 3DXCA 2V76A 2H7DA 3KRWA 2W2XD 4ZRKA 3CIKA 1BWNA 1GC6A 2W2XC 1U5GA 2NZ8B 4D0NB 4QXAB 5D3WA 2DFKA 2DKQA 2D9ZA 2DHJA 3HSAA 1P3RA 4IFSA 1U5DA 1AWEA 2KIGA 2D9WA 1GG3A 3NSUA 5DIFB 2D10A 3ZDTA 2LOZA 4F7UP 1M7EA 4MK0A 5D3XA 1K5GB 3PP2A 3FSSA 3G9WA 1Y5OA 3KY9A 2D9YA 2YT1A 1H10A 4HB4B 2I1KA 1V5MA 3HIEA 4DXAB 2UVMA 2Z0PA 1H4RA 3D8EA 4GNKB 5GOWB 4HDOA 3SO6A 2N23A 5JP4A 2UZRA 5LONB 1UNRA 4BBKA 4HB3B 2J59M 3ODOA 3ODXA 3NWDA 2NMBA 1FHOA 2MFQA 4A6FB 3B77A 3NWAA 2Y8GA 5JLJB 1FHWA 4H8SA 1UNQA 4ZRIA 4CHMA 2Z0QA 2Z59A 1WVHA 2FJUB 1TJ6A 2YS3A 1NTYA 2J0KA 1V61A 4CYEA 5FI0A 2GCLA 4DIXA 1B55A 3O96A 1KZGA 4WSFA 2UZSA 2HTHB 5C16A 2D9XA 2MKRA 2Y7BA 4HAYB 2E2XA 3WYFB 1MK7B 2Z13A 1ZYIA 2DLWA 1EAZA 3SUZA 5LOPB 5JHHA 4HAWB 1SHCA 2L1CA 1TQZA 2M38A 2MDXA 3A98B 3HW2B 2YT2A 3KSYA 2RLOA 2IFSA 5D3YA 1WI1A 3HK0A 5CLQB 5J3YA 3OHMB 3U7DA 2EMTA 2RUKB 3GYOA 5C5BA 2K8EA 3ULBA 1RRPB 2M14A 4Y94A 3RCPA 1ZSQA 4YL8A 3GYPA 2DN6A 4B6HA 2ADZA 3FEHA 1UPQA 4KHAA 2VRWB 2OTXA 2Z4DA 2DX1A 2YRYA 2R09A 3TO1A 5I2SA 2RNRB 4IOYX 2P0DA 2RSGA 3AU4A 5DI9B 5CLLB 4KAXB 3DCXA 2K2JA 4D6WA 1PFJA 1T77A 5C5BB 5D27A 1Q67A 2CRFA 2CODA 2R0DA 3PG7A 2GS0A 3PEGA 2GCJA 2DYQA 2AEHA 4TYZA 5J3QA 2DA0A 2KUQA 4PNKA 3T06A 1FB8A 3TCAA 2W2WA 1V5PA 2LULA 1WGQA 4GMVA 2JP2A 1OMWA 2L2IA 1U5EA 2ELAA 5HE0A 4KHBA 4GPTB 2GJYA 1U5FA 3U12A 1OQNA 2CAYA 5JHGA 1RJ2A 2KGXB 2N0YA 4HAXB 1X05A 2ELBA 3TW1A 4HAUB 2VSZA 2ZPYA 2D9VA 2QKMA 1WGUA 4EMOA 2LG1A 2PZ1A 5C6RA 3ODWA 2COCA 3MPXA 3IVFA 3UZTA 2ROZB 4MT7A 1DDMA 4KVGB 4OSNA 3VOQA 2I1JA 1LB1A 2DTCA 3MDBC 1SGHA 1V5UA 1ZC3B 4QJ3B 2K49A 1I2HA 1W1HA 5KQ4A 4HDQA 1K5DB 2YS1A 2EJ8A 5J3TA 3ZVRA 4F7GA 3TVVA 5DH9B 1W1DA 2H7EA 3PVWA 3CXBB 1NU2A 1MIZB 2LOXA 2P8VA 2MWNB 2KCJA 3A8PA 2IYBA 3VIAA 1ZC4B 1J19A 3F5RA 3P6AA 4P7IA 1FOEA 1FAOA 1FGYA 2Z0OA 2COFA 4L6EA 1QC6A 3QBVB 1UPRA 2YS5A 3A58A 4CSQA 2R2YA 2DHIA 3P7ZA 2RGNB 2G35A 5L81A 1WJ1A 4Z2MB 2D11A 1BAKA 1ZVRA 2YVCA 1MKEA 3ULCA 1AQCA 1P5TA 2ROVA 2ZKMX 4HAVB 2HE7A 2KR0A 4EJNA 2I5CA 2CY4A 1XODA 4HHVA 1WJMA 1W1GA 1WG7A 2COAA 3FM8C 4HSIA 1XR0B 1EF1A 1DDVA 5KQ1A 1PLSA 2P0FA 5DHFB 4HB2B 1X1GA 4CHJA 3PVLA 1GC7A 3SNHA 4GMXB 3BINA 3QIJA 1I7AA 1KZ7A 3D8FA 4YONA 3AJ4A 5KCVA 1IRSA 2FJLA 3N7CA 4GN1A 4K2OA 3ML4A 3KZ1A 4EKUA 1QQGA 2DHKA 5HE3A 4GZUA 4DX8A 2YT0A 3NWFA 1N3HA 2QKLA 3KRXA 3DXDA 2KIEA 3U8ZA 1DYNA 2Y8FA 1FGZA 3AU5A 4KHOA 2J0MA 2Z14A 1EGXA 4A6FA 1KI1B 1LW3A 1NTVA 1X1FA 1DDWA 1XKEA 5FI1A 4DX90 2J0JA 3OANA 2YSZA 4MY6A 4WVFB 4QJ4B 1M7RA 1EVHA 2CY5A 3V5WA 1MIXA 2D4QA 1UNPA 2X18A 4NSWA 4C0AA 4HB0B 2DKPA 3PZDA 1Y19B 4HATB 1V88A 4DBBA 1J0WA 2RRFA 4IAPA 4K81A 4L1RA 2KUPA 4KHBB 1E5WA 1DBHA 3BJIA 1U2BA 1PMSA 4QJ5B 1U29A 1ZM0A 1BTKA 1NI2A 2EC1A 3M1IB 1FHXA 2K2UA 3HQCA 2Q13A 3PVUA 3F0WA 1XD4A 1X86A 1BTNA 2GUMA 3SV1A 3NW8A 4Z2NA 1X11A 4TKNA 2LYDA 2OQBA 2DYNA 2AL6A 5D3VA 4OT1A 4A5KA 1MK9B 1OY2A 2BCJA 2I5FA 5M4YB 1UEFA 3SYXA 2P0HA 3A8QA 2VKIA
chains in the Genus database with same CATH topology
2EMSA 4GXBA 4XWXA 1XX0A 3LJUX 4PQ0A 5HE1A 4A6HA 4K17A 1XCGA 2RVBB 4HAZB 4F7HA 1MPHA 4NY0A 3D8DA 2XQNM 1V89A 3PSCA 1DROA 1ISNA 3QWMA 5DHAB 3WA0A 1U27A 4K2PA 4WJ7A 3X23A 5C79A 1TXDA 3DXEA 1P6SA 2D2QA 2LKOA 1Z87A 3TFMA 4ZRJA 2K00A 5HE2A 4A6KA 2YF0A 1MAIA 5EFXA 2DX5A 3DXCA 2V76A 2H7DA 3KRWA 2W2XD 4ZRKA 3CIKA 1BWNA 1GC6A 2W2XC 1U5GA 2NZ8B 4D0NB 5D3WA 2DFKA 2DKQA 2D9ZA 2DHJA 1P3RA 4IFSA 1U5DA 1AWEA 2D9WA 1GG3A 3NSUA 5DIFB 2D10A 3ZDTA 2LOZA 4F7UP 1M7EA 4MK0A 5D3XA 1K5GB 3PP2A 3FSSA 3G9WA 1Y5OA 3KY9A 2D9YA 2YT1A 1H10A 4HB4B 2I1KA 1V5MA 4DXAB 2UVMA 2Z0PA 1H4RA 3D8EA 5GOWB 4HDOA 3SO6A 2N23A 5JP4A 2UZRA 5LONB 1UNRA 4BBKA 4HB3B 2J59M 3ODOA 3ODXA 2NMBA 1FHOA 2MFQA 4A6FB 2Y8GA 5JLJB 1FHWA 4H8SA 1UNQA 4ZRIA 4CHMA 2Z0QA 1WVHA 1TJ6A 2YS3A 1NTYA 2J0KA 1V61A 4CYEA 5FI0A 2GCLA 1B55A 3O96A 1KZGA 4WSFA 2UZSA 2HTHB 5C16A 2D9XA 2MKRA 2Y7BA 4HAYB 2E2XA 3WYFB 1MK7B 2DLWA 1EAZA 3SUZA 5LOPB 5JHHA 4HAWB 1SHCA 2L1CA 1TQZA 2M38A 2MDXA 3A98B 3HW2B 3KSYA 2RLOA 2IFSA 5D3YA 1WI1A 3HK0A 5CLQB 5J3YA 3U7DA 2EMTA 2RUKB 3GYOA 5C5BA 3ULBA 1RRPB 2M14A 4Y94A 3RCPA 1ZSQA 4YL8A 3GYPA 2DN6A 4B6HA 2ADZA 3FEHA 1UPQA 4KHAA 2VRWB 2OTXA 2DX1A 2YRYA 2R09A 3TO1A 2RNRB 4IOYX 2P0DA 2RSGA 3AU4A 5DI9B 5CLLB 4KAXB 2K2JA 1PFJA 5C5BB 5D27A 1Q67A 2CRFA 2CODA 2R0DA 3PG7A 2GS0A 3PEGA 2GCJA 2DYQA 2AEHA 4TYZA 5J3QA 2DA0A 4PNKA 3T06A 1FB8A 3TCAA 2W2WA 1V5PA 2LULA 1WGQA 4GMVA 2JP2A 1OMWA 2L2IA 1U5EA 2ELAA 5HE0A 4GPTB 2GJYA 1U5FA 1OQNA 2CAYA 5JHGA 1RJ2A 2KGXB 2N0YA 4HAXB 1X05A 2ELBA 3TW1A 4HAUB 2VSZA 2ZPYA 2D9VA 2QKMA 1WGUA 4EMOA 2LG1A 2PZ1A 5C6RA 3ODWA 2COCA 3MPXA 3IVFA 3UZTA 2ROZB 4MT7A 1DDMA 4KVGB 3VOQA 2I1JA 1LB1A 2DTCA 3MDBC 1SGHA 1V5UA 1ZC3B 1I2HA 1W1HA 5KQ4A 4HDQA 1K5DB 2YS1A 2EJ8A 5J3TA 3ZVRA 4F7GA 3TVVA 5DH9B 1W1DA 2H7EA 3PVWA 3CXBB 1NU2A 1MIZB 2LOXA 2P8VA 2MWNB 2KCJA 3A8PA 2IYBA 3VIAA 1ZC4B 1J19A 3F5RA 3P6AA 4P7IA 1FOEA 1FAOA 1FGYA 2Z0OA 2COFA 4L6EA 1QC6A 3QBVB 1UPRA 2YS5A 2DHIA 3P7ZA 2RGNB 2G35A 5L81A 1WJ1A 4Z2MB 2D11A 1BAKA 1ZVRA 2YVCA 1MKEA 3ULCA 1AQCA 1P5TA 2ROVA 4HAVB 2HE7A 4EJNA 2I5CA 2CY4A 1XODA 4HHVA 1WJMA 1W1GA 1WG7A 2COAA 3FM8C 1XR0B 1EF1A 1DDVA 5KQ1A 1PLSA 2P0FA 5DHFB 4HB2B 1X1GA 4CHJA 3PVLA 1GC7A 3SNHA 4GMXB 3BINA 3QIJA 1I7AA 1KZ7A 3D8FA 4YONA 3AJ4A 5KCVA 1IRSA 2FJLA 3N7CA 4GN1A 4K2OA 3ML4A 3KZ1A 4EKUA 1QQGA 2DHKA 5HE3A 4GZUA 4DX8A 2YT0A 1N3HA 2QKLA 3KRXA 3DXDA 3U8ZA 1DYNA 2Y8FA 1FGZA 3AU5A 4KHOA 2J0MA 1EGXA 4A6FA 1KI1B 1LW3A 1NTVA 1X1FA 1DDWA 1XKEA 5FI1A 4DX90 2J0JA 3OANA 2YSZA 4MY6A 4WVFB 1M7RA 1EVHA 2CY5A 3V5WA 1MIXA 2D4QA 1UNPA 2X18A 4NSWA 4C0AA 4HB0B 2DKPA 3PZDA 1Y19B 4HATB 1V88A 4DBBA 1J0WA 4K81A 4IAPA 2KUPA 4KHBB 1E5WA 1DBHA 3BJIA 1U2BA 1PMSA 1U29A 1ZM0A 1BTKA 1NI2A 2EC1A 3M1IB 1FHXA 2K2UA 3HQCA 2Q13A 3PVUA 3F0WA 1XD4A 1X86A 1BTNA 3SV1A 4Z2NA 1X11A 4TKNA 2LYDA 2OQBA 2DYNA 2AL6A 5D3VA 4A5KA 1MK9B 1OY2A 2BCJA 2I5FA 1UEFA 3SYXA 2P0HA 3A8QA 2VKIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EMS A;  4GXB A;  4XWX A;  1XX0 A;  3LJU X;  4PQ0 A;  5HE1 A;  4A6H A;  4K17 A;  1XCG A;  2RVB B;  4HAZ B;  4F7H A;  1MPH A;  4NY0 A;  3D8D A;  2XQN M;  1V89 A;  3PSC A;  1DRO A;  1ISN A;  3QWM A;  5DHA B;  3WA0 A;  1U27 A;  4K2P A;  4WJ7 A;  3X23 A;  5C79 A;  1TXD A;  3DXE A;  1P6S A;  2D2Q A;  2LKO A;  1Z87 A;  3TFM A;  4ZRJ A;  2K00 A;  5HE2 A;  4A6K A;  2YF0 A;  1MAI A;  5EFX A;  2DX5 A;  3DXC A;  2V76 A;  2H7D A;  3KRW A;  2W2X D;  4ZRK A;  3CIK A;  1BWN A;  1GC6 A;  2W2X C;  1U5G A;  2NZ8 B;  4D0N B;  5D3W A;  2DFK A;  2DKQ A;  2D9Z A;  2DHJ A;  1P3R A;  4IFS A;  1U5D A;  1AWE A;  2D9W A;  1GG3 A;  3NSU A;  5DIF B;  2D10 A;  3ZDT A;  2LOZ A;  4F7U P;  1M7E A;  4MK0 A;  5D3X A;  1K5G B;  3PP2 A;  3FSS A;  3G9W A;  1Y5O A;  3KY9 A;  2D9Y A;  2YT1 A;  1H10 A;  4HB4 B;  2I1K A;  1V5M A;  4DXA B;  2UVM A;  2Z0P A;  1H4R A;  3D8E A;  5GOW B;  4HDO A;  3SO6 A;  2N23 A;  5JP4 A;  2UZR A;  5LON B;  1UNR A;  4BBK A;  4HB3 B;  2J59 M;  3ODO A;  3ODX A;  2NMB A;  1FHO A;  2MFQ A;  4A6F B;  2Y8G A;  5JLJ B;  1FHW A;  4H8S A;  1UNQ A;  4ZRI A;  4CHM A;  2Z0Q A;  1WVH A;  1TJ6 A;  2YS3 A;  1NTY A;  2J0K A;  1V61 A;  4CYE A;  5FI0 A;  2GCL A;  1B55 A;  3O96 A;  1KZG A;  4WSF A;  2UZS A;  2HTH B;  5C16 A;  2D9X A;  2MKR A;  2Y7B A;  4HAY B;  2E2X A;  3WYF B;  1MK7 B;  2DLW A;  1EAZ A;  3SUZ A;  5LOP B;  5JHH A;  4HAW B;  1SHC A;  2L1C A;  1TQZ A;  2M38 A;  2MDX A;  3A98 B;  3HW2 B;  3KSY A;  2RLO A;  2IFS A;  5D3Y A;  1WI1 A;  3HK0 A;  5CLQ B;  5J3Y A;  3U7D A;  2EMT A;  2RUK B;  3GYO A;  5C5B A;  3ULB A;  1RRP B;  2M14 A;  4Y94 A;  3RCP A;  1ZSQ A;  4YL8 A;  3GYP A;  2DN6 A;  4B6H A;  2ADZ A;  3FEH A;  1UPQ A;  4KHA A;  2VRW B;  2OTX A;  2DX1 A;  2YRY A;  2R09 A;  3TO1 A;  2RNR B;  4IOY X;  2P0D A;  2RSG A;  3AU4 A;  5DI9 B;  5CLL B;  4KAX B;  2K2J A;  1PFJ A;  5C5B B;  5D27 A;  1Q67 A;  2CRF A;  2COD A;  2R0D A;  3PG7 A;  2GS0 A;  3PEG A;  2GCJ A;  2DYQ A;  2AEH A;  4TYZ A;  5J3Q A;  2DA0 A;  4PNK A;  3T06 A;  1FB8 A;  3TCA A;  2W2W A;  1V5P A;  2LUL A;  1WGQ A;  4GMV A;  2JP2 A;  1OMW A;  2L2I A;  1U5E A;  2ELA A;  5HE0 A;  4GPT B;  2GJY A;  1U5F A;  1OQN A;  2CAY A;  5JHG A;  1RJ2 A;  2KGX B;  2N0Y A;  4HAX B;  1X05 A;  2ELB A;  3TW1 A;  4HAU B;  2VSZ A;  2ZPY A;  2D9V A;  2QKM A;  1WGU A;  4EMO A;  2LG1 A;  2PZ1 A;  5C6R A;  3ODW A;  2COC A;  3MPX A;  3IVF A;  3UZT A;  2ROZ B;  4MT7 A;  1DDM A;  4KVG B;  3VOQ A;  2I1J A;  1LB1 A;  2DTC A;  3MDB C;  1SGH A;  1V5U A;  1ZC3 B;  1I2H A;  1W1H A;  5KQ4 A;  4HDQ A;  1K5D B;  2YS1 A;  2EJ8 A;  5J3T A;  3ZVR A;  4F7G A;  3TVV A;  5DH9 B;  1W1D A;  2H7E A;  3PVW A;  3CXB B;  1NU2 A;  1MIZ B;  2LOX A;  2P8V A;  2MWN B;  2KCJ A;  3A8P A;  2IYB A;  3VIA A;  1ZC4 B;  1J19 A;  3F5R A;  3P6A A;  4P7I A;  1FOE A;  1FAO A;  1FGY A;  2Z0O A;  2COF A;  4L6E A;  1QC6 A;  3QBV B;  1UPR A;  2YS5 A;  2DHI A;  3P7Z A;  2RGN B;  2G35 A;  5L81 A;  1WJ1 A;  4Z2M B;  2D11 A;  1BAK A;  1ZVR A;  2YVC A;  1MKE A;  3ULC A;  1AQC A;  1P5T A;  2ROV A;  4HAV B;  2HE7 A;  4EJN A;  2I5C A;  2CY4 A;  1XOD A;  4HHV A;  1WJM A;  1W1G A;  1WG7 A;  2COA A;  3FM8 C;  1XR0 B;  1EF1 A;  1DDV A;  5KQ1 A;  1PLS A;  2P0F A;  5DHF B;  4HB2 B;  1X1G A;  4CHJ A;  3PVL A;  1GC7 A;  3SNH A;  4GMX B;  3BIN A;  3QIJ A;  1I7A A;  1KZ7 A;  3D8F A;  4YON A;  3AJ4 A;  5KCV A;  1IRS A;  2FJL A;  3N7C A;  4GN1 A;  4K2O A;  3ML4 A;  3KZ1 A;  4EKU A;  1QQG A;  2DHK A;  5HE3 A;  4GZU A;  4DX8 A;  2YT0 A;  1N3H A;  2QKL A;  3KRX A;  3DXD A;  3U8Z A;  1DYN A;  2Y8F A;  1FGZ A;  3AU5 A;  4KHO A;  2J0M A;  1EGX A;  4A6F A;  1KI1 B;  1LW3 A;  1NTV A;  1X1F A;  1DDW A;  1XKE A;  5FI1 A;  4DX9 0;  2J0J A;  3OAN A;  2YSZ A;  4MY6 A;  4WVF B;  1M7R A;  1EVH A;  2CY5 A;  3V5W A;  1MIX A;  2D4Q A;  1UNP A;  2X18 A;  4NSW A;  4C0A A;  4HB0 B;  2DKP A;  3PZD A;  1Y19 B;  4HAT B;  1V88 A;  4DBB A;  1J0W A;  4K81 A;  4IAP A;  2KUP A;  4KHB B;  1E5W A;  1DBH A;  3BJI A;  1U2B A;  1PMS A;  1U29 A;  1ZM0 A;  1BTK A;  1NI2 A;  2EC1 A;  3M1I B;  1FHX A;  2K2U A;  3HQC A;  2Q13 A;  3PVU A;  3F0W A;  1XD4 A;  1X86 A;  1BTN A;  3SV1 A;  4Z2N A;  1X11 A;  4TKN A;  2LYD A;  2OQB A;  2DYN A;  2AL6 A;  5D3V A;  4A5K A;  1MK9 B;  1OY2 A;  2BCJ A;  2I5F A;  1UEF A;  3SYX A;  2P0H A;  3A8Q A;  2VKI A; 
#chains in the Genus database with same CATH topology
 2EMS A;  4GXB A;  4XWX A;  1XX0 A;  2NBV A;  3LJU X;  4PQ0 A;  5HE1 A;  4A6H A;  4K17 A;  1XCG A;  2RVB B;  4GOU A;  4HAZ B;  4F7H A;  1MPH A;  5LG4 B;  4NY0 A;  3D8D A;  1MI1 A;  2XQN M;  5I2M A;  1V89 A;  3PSC A;  1DRO A;  1ISN A;  3QWM A;  5DHA B;  3WA0 A;  1U27 A;  4K2P A;  4WJ7 A;  3X23 A;  5C79 A;  1TXD A;  3DXE A;  1P6S A;  2D2Q A;  2LKO A;  1Z87 A;  3TFM A;  4ZRJ A;  2K00 A;  5HE2 A;  3FVC A;  4A6K A;  2YF0 A;  1MAI A;  5EFX A;  5IRS A;  2DX5 A;  3DXC A;  2V76 A;  2H7D A;  3KRW A;  2W2X D;  4ZRK A;  3CIK A;  1BWN A;  1GC6 A;  2W2X C;  1U5G A;  2NZ8 B;  4D0N B;  4QXA B;  5D3W A;  2DFK A;  2DKQ A;  2D9Z A;  2DHJ A;  3HSA A;  1P3R A;  4IFS A;  1U5D A;  1AWE A;  2KIG A;  2D9W A;  1GG3 A;  3NSU A;  5DIF B;  2D10 A;  3ZDT A;  2LOZ A;  4F7U P;  1M7E A;  4MK0 A;  5D3X A;  1K5G B;  3PP2 A;  3FSS A;  3G9W A;  1Y5O A;  3KY9 A;  2D9Y A;  2YT1 A;  1H10 A;  4HB4 B;  2I1K A;  1V5M A;  3HIE A;  4DXA B;  2UVM A;  2Z0P A;  1H4R A;  3D8E A;  4GNK B;  5GOW B;  4HDO A;  3SO6 A;  2N23 A;  5JP4 A;  2UZR A;  5LON B;  1UNR A;  4BBK A;  4HB3 B;  2J59 M;  3ODO A;  3ODX A;  3NWD A;  2NMB A;  1FHO A;  2MFQ A;  4A6F B;  3B77 A;  3NWA A;  2Y8G A;  5JLJ B;  1FHW A;  4H8S A;  1UNQ A;  4ZRI A;  4CHM A;  2Z0Q A;  2Z59 A;  1WVH A;  2FJU B;  1TJ6 A;  2YS3 A;  1NTY A;  2J0K A;  1V61 A;  4CYE A;  5FI0 A;  2GCL A;  4DIX A;  1B55 A;  3O96 A;  1KZG A;  4WSF A;  2UZS A;  2HTH B;  5C16 A;  2D9X A;  2MKR A;  2Y7B A;  4HAY B;  2E2X A;  3WYF B;  1MK7 B;  2Z13 A;  1ZYI A;  2DLW A;  1EAZ A;  3SUZ A;  5LOP B;  5JHH A;  4HAW B;  1SHC A;  2L1C A;  1TQZ A;  2M38 A;  2MDX A;  3A98 B;  3HW2 B;  2YT2 A;  3KSY A;  2RLO A;  2IFS A;  5D3Y A;  1WI1 A;  3HK0 A;  5CLQ B;  5J3Y A;  3OHM B;  3U7D A;  2EMT A;  2RUK B;  3GYO A;  5C5B A;  2K8E A;  3ULB A;  1RRP B;  2M14 A;  4Y94 A;  3RCP A;  1ZSQ A;  4YL8 A;  3GYP A;  2DN6 A;  4B6H A;  2ADZ A;  3FEH A;  1UPQ A;  4KHA A;  2VRW B;  2OTX A;  2Z4D A;  2DX1 A;  2YRY A;  2R09 A;  3TO1 A;  5I2S A;  2RNR B;  4IOY X;  2P0D A;  2RSG A;  3AU4 A;  5DI9 B;  5CLL B;  4KAX B;  3DCX A;  2K2J A;  4D6W A;  1PFJ A;  1T77 A;  5C5B B;  5D27 A;  1Q67 A;  2CRF A;  2COD A;  2R0D A;  3PG7 A;  2GS0 A;  3PEG A;  2GCJ A;  2DYQ A;  2AEH A;  4TYZ A;  5J3Q A;  2DA0 A;  2KUQ A;  4PNK A;  3T06 A;  1FB8 A;  3TCA A;  2W2W A;  1V5P A;  2LUL A;  1WGQ A;  4GMV A;  2JP2 A;  1OMW A;  2L2I A;  1U5E A;  2ELA A;  5HE0 A;  4KHB A;  4GPT B;  2GJY A;  1U5F A;  3U12 A;  1OQN A;  2CAY A;  5JHG A;  1RJ2 A;  2KGX B;  2N0Y A;  4HAX B;  1X05 A;  2ELB A;  3TW1 A;  4HAU B;  2VSZ A;  2ZPY A;  2D9V A;  2QKM A;  1WGU A;  4EMO A;  2LG1 A;  2PZ1 A;  5C6R A;  3ODW A;  2COC A;  3MPX A;  3IVF A;  3UZT A;  2ROZ B;  4MT7 A;  1DDM A;  4KVG B;  4OSN A;  3VOQ A;  2I1J A;  1LB1 A;  2DTC A;  3MDB C;  1SGH A;  1V5U A;  1ZC3 B;  4QJ3 B;  2K49 A;  1I2H A;  1W1H A;  5KQ4 A;  4HDQ A;  1K5D B;  2YS1 A;  2EJ8 A;  5J3T A;  3ZVR A;  4F7G A;  3TVV A;  5DH9 B;  1W1D A;  2H7E A;  3PVW A;  3CXB B;  1NU2 A;  1MIZ B;  2LOX A;  2P8V A;  2MWN B;  2KCJ A;  3A8P A;  2IYB A;  3VIA A;  1ZC4 B;  1J19 A;  3F5R A;  3P6A A;  4P7I A;  1FOE A;  1FAO A;  1FGY A;  2Z0O A;  2COF A;  4L6E A;  1QC6 A;  3QBV B;  1UPR A;  2YS5 A;  3A58 A;  4CSQ A;  2R2Y A;  2DHI A;  3P7Z A;  2RGN B;  2G35 A;  5L81 A;  1WJ1 A;  4Z2M B;  2D11 A;  1BAK A;  1ZVR A;  2YVC A;  1MKE A;  3ULC A;  1AQC A;  1P5T A;  2ROV A;  2ZKM X;  4HAV B;  2HE7 A;  2KR0 A;  4EJN A;  2I5C A;  2CY4 A;  1XOD A;  4HHV A;  1WJM A;  1W1G A;  1WG7 A;  2COA A;  3FM8 C;  4HSI A;  1XR0 B;  1EF1 A;  1DDV A;  5KQ1 A;  1PLS A;  2P0F A;  5DHF B;  4HB2 B;  1X1G A;  4CHJ A;  3PVL A;  1GC7 A;  3SNH A;  4GMX B;  3BIN A;  3QIJ A;  1I7A A;  1KZ7 A;  3D8F A;  4YON A;  3AJ4 A;  5KCV A;  1IRS A;  2FJL A;  3N7C A;  4GN1 A;  4K2O A;  3ML4 A;  3KZ1 A;  4EKU A;  1QQG A;  2DHK A;  5HE3 A;  4GZU A;  4DX8 A;  2YT0 A;  3NWF A;  1N3H A;  2QKL A;  3KRX A;  3DXD A;  2KIE A;  3U8Z A;  1DYN A;  2Y8F A;  1FGZ A;  3AU5 A;  4KHO A;  2J0M A;  2Z14 A;  1EGX A;  4A6F A;  1KI1 B;  1LW3 A;  1NTV A;  1X1F A;  1DDW A;  1XKE A;  5FI1 A;  4DX9 0;  2J0J A;  3OAN A;  2YSZ A;  4MY6 A;  4WVF B;  4QJ4 B;  1M7R A;  1EVH A;  2CY5 A;  3V5W A;  1MIX A;  2D4Q A;  1UNP A;  2X18 A;  4NSW A;  4C0A A;  4HB0 B;  2DKP A;  3PZD A;  1Y19 B;  4HAT B;  1V88 A;  4DBB A;  1J0W A;  2RRF A;  4IAP A;  4K81 A;  4L1R A;  2KUP A;  4KHB B;  1E5W A;  1DBH A;  3BJI A;  1U2B A;  1PMS A;  4QJ5 B;  1U29 A;  1ZM0 A;  1BTK A;  1NI2 A;  2EC1 A;  3M1I B;  1FHX A;  2K2U A;  3HQC A;  2Q13 A;  3PVU A;  3F0W A;  1XD4 A;  1X86 A;  1BTN A;  2GUM A;  3SV1 A;  3NW8 A;  4Z2N A;  1X11 A;  4TKN A;  2LYD A;  2OQB A;  2DYN A;  2AL6 A;  5D3V A;  4OT1 A;  4A5K A;  1MK9 B;  1OY2 A;  2BCJ A;  2I5F A;  5M4Y B;  1UEF A;  3SYX A;  2P0H A;  3A8Q A;  2VKI A; 
#chains in the Genus database with same CATH homology
 2EMS A;  4GXB A;  4XWX A;  1XX0 A;  3LJU X;  4PQ0 A;  5HE1 A;  4A6H A;  4K17 A;  1XCG A;  2RVB B;  4HAZ B;  4F7H A;  1MPH A;  4NY0 A;  3D8D A;  2XQN M;  1V89 A;  3PSC A;  1DRO A;  1ISN A;  3QWM A;  5DHA B;  3WA0 A;  1U27 A;  4K2P A;  4WJ7 A;  3X23 A;  5C79 A;  1TXD A;  3DXE A;  1P6S A;  2D2Q A;  2LKO A;  1Z87 A;  3TFM A;  4ZRJ A;  2K00 A;  5HE2 A;  4A6K A;  2YF0 A;  1MAI A;  5EFX A;  2DX5 A;  3DXC A;  2V76 A;  2H7D A;  3KRW A;  2W2X D;  4ZRK A;  3CIK A;  1BWN A;  1GC6 A;  2W2X C;  1U5G A;  2NZ8 B;  4D0N B;  5D3W A;  2DFK A;  2DKQ A;  2D9Z A;  2DHJ A;  1P3R A;  4IFS A;  1U5D A;  1AWE A;  2D9W A;  1GG3 A;  3NSU A;  5DIF B;  2D10 A;  3ZDT A;  2LOZ A;  4F7U P;  1M7E A;  4MK0 A;  5D3X A;  1K5G B;  3PP2 A;  3FSS A;  3G9W A;  1Y5O A;  3KY9 A;  2D9Y A;  2YT1 A;  1H10 A;  4HB4 B;  2I1K A;  1V5M A;  4DXA B;  2UVM A;  2Z0P A;  1H4R A;  3D8E A;  5GOW B;  4HDO A;  3SO6 A;  2N23 A;  5JP4 A;  2UZR A;  5LON B;  1UNR A;  4BBK A;  4HB3 B;  2J59 M;  3ODO A;  3ODX A;  2NMB A;  1FHO A;  2MFQ A;  4A6F B;  2Y8G A;  5JLJ B;  1FHW A;  4H8S A;  1UNQ A;  4ZRI A;  4CHM A;  2Z0Q A;  1WVH A;  1TJ6 A;  2YS3 A;  1NTY A;  2J0K A;  1V61 A;  4CYE A;  5FI0 A;  2GCL A;  1B55 A;  3O96 A;  1KZG A;  4WSF A;  2UZS A;  2HTH B;  5C16 A;  2D9X A;  2MKR A;  2Y7B A;  4HAY B;  2E2X A;  3WYF B;  1MK7 B;  2DLW A;  1EAZ A;  3SUZ A;  5LOP B;  5JHH A;  4HAW B;  1SHC A;  2L1C A;  1TQZ A;  2M38 A;  2MDX A;  3A98 B;  3HW2 B;  3KSY A;  2RLO A;  2IFS A;  5D3Y A;  1WI1 A;  3HK0 A;  5CLQ B;  5J3Y A;  3U7D A;  2EMT A;  2RUK B;  3GYO A;  5C5B A;  3ULB A;  1RRP B;  2M14 A;  4Y94 A;  3RCP A;  1ZSQ A;  4YL8 A;  3GYP A;  2DN6 A;  4B6H A;  2ADZ A;  3FEH A;  1UPQ A;  4KHA A;  2VRW B;  2OTX A;  2DX1 A;  2YRY A;  2R09 A;  3TO1 A;  2RNR B;  4IOY X;  2P0D A;  2RSG A;  3AU4 A;  5DI9 B;  5CLL B;  4KAX B;  2K2J A;  1PFJ A;  5C5B B;  5D27 A;  1Q67 A;  2CRF A;  2COD A;  2R0D A;  3PG7 A;  2GS0 A;  3PEG A;  2GCJ A;  2DYQ A;  2AEH A;  4TYZ A;  5J3Q A;  2DA0 A;  4PNK A;  3T06 A;  1FB8 A;  3TCA A;  2W2W A;  1V5P A;  2LUL A;  1WGQ A;  4GMV A;  2JP2 A;  1OMW A;  2L2I A;  1U5E A;  2ELA A;  5HE0 A;  4GPT B;  2GJY A;  1U5F A;  1OQN A;  2CAY A;  5JHG A;  1RJ2 A;  2KGX B;  2N0Y A;  4HAX B;  1X05 A;  2ELB A;  3TW1 A;  4HAU B;  2VSZ A;  2ZPY A;  2D9V A;  2QKM A;  1WGU A;  4EMO A;  2LG1 A;  2PZ1 A;  5C6R A;  3ODW A;  2COC A;  3MPX A;  3IVF A;  3UZT A;  2ROZ B;  4MT7 A;  1DDM A;  4KVG B;  3VOQ A;  2I1J A;  1LB1 A;  2DTC A;  3MDB C;  1SGH A;  1V5U A;  1ZC3 B;  1I2H A;  1W1H A;  5KQ4 A;  4HDQ A;  1K5D B;  2YS1 A;  2EJ8 A;  5J3T A;  3ZVR A;  4F7G A;  3TVV A;  5DH9 B;  1W1D A;  2H7E A;  3PVW A;  3CXB B;  1NU2 A;  1MIZ B;  2LOX A;  2P8V A;  2MWN B;  2KCJ A;  3A8P A;  2IYB A;  3VIA A;  1ZC4 B;  1J19 A;  3F5R A;  3P6A A;  4P7I A;  1FOE A;  1FAO A;  1FGY A;  2Z0O A;  2COF A;  4L6E A;  1QC6 A;  3QBV B;  1UPR A;  2YS5 A;  2DHI A;  3P7Z A;  2RGN B;  2G35 A;  5L81 A;  1WJ1 A;  4Z2M B;  2D11 A;  1BAK A;  1ZVR A;  2YVC A;  1MKE A;  3ULC A;  1AQC A;  1P5T A;  2ROV A;  4HAV B;  2HE7 A;  4EJN A;  2I5C A;  2CY4 A;  1XOD A;  4HHV A;  1WJM A;  1W1G A;  1WG7 A;  2COA A;  3FM8 C;  1XR0 B;  1EF1 A;  1DDV A;  5KQ1 A;  1PLS A;  2P0F A;  5DHF B;  4HB2 B;  1X1G A;  4CHJ A;  3PVL A;  1GC7 A;  3SNH A;  4GMX B;  3BIN A;  3QIJ A;  1I7A A;  1KZ7 A;  3D8F A;  4YON A;  3AJ4 A;  5KCV A;  1IRS A;  2FJL A;  3N7C A;  4GN1 A;  4K2O A;  3ML4 A;  3KZ1 A;  4EKU A;  1QQG A;  2DHK A;  5HE3 A;  4GZU A;  4DX8 A;  2YT0 A;  1N3H A;  2QKL A;  3KRX A;  3DXD A;  3U8Z A;  1DYN A;  2Y8F A;  1FGZ A;  3AU5 A;  4KHO A;  2J0M A;  1EGX A;  4A6F A;  1KI1 B;  1LW3 A;  1NTV A;  1X1F A;  1DDW A;  1XKE A;  5FI1 A;  4DX9 0;  2J0J A;  3OAN A;  2YSZ A;  4MY6 A;  4WVF B;  1M7R A;  1EVH A;  2CY5 A;  3V5W A;  1MIX A;  2D4Q A;  1UNP A;  2X18 A;  4NSW A;  4C0A A;  4HB0 B;  2DKP A;  3PZD A;  1Y19 B;  4HAT B;  1V88 A;  4DBB A;  1J0W A;  4K81 A;  4IAP A;  2KUP A;  4KHB B;  1E5W A;  1DBH A;  3BJI A;  1U2B A;  1PMS A;  1U29 A;  1ZM0 A;  1BTK A;  1NI2 A;  2EC1 A;  3M1I B;  1FHX A;  2K2U A;  3HQC A;  2Q13 A;  3PVU A;  3F0W A;  1XD4 A;  1X86 A;  1BTN A;  3SV1 A;  4Z2N A;  1X11 A;  4TKN A;  2LYD A;  2OQB A;  2DYN A;  2AL6 A;  5D3V A;  4A5K A;  1MK9 B;  1OY2 A;  2BCJ A;  2I5F A;  1UEF A;  3SYX A;  2P0H A;  3A8Q A;  2VKI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...