5C79A

Ph domain of asap1 in complex with dic4-ptdins(4,5)p2
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
104
structure length
104
Chain Sequence
GNKEYGSEKKGFLLKKSDGIRKVWQRRKCAVKNGILTISHATSNRQPAKLNLLTCQVKPNAEDKKSFDLISHNRTYHFQAEDEQDYIAWISVLTNSKEEALTMA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Signaling protein
molecule keywords Arf-GAP
publication title Molecular Basis for Cooperative Binding of Anionic Phospholipids to the PH Domain of the Arf GAP ASAP1.
pubmed doi rcsb
source organism Mus musculus
total genus 22
structure length 104
sequence length 104
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-06-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00169 PH PH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 5c79A00
1UPRA 4MY6A 2P0FA 1NI2A 4HAVB 3IVFA 5HE0A 3A8QA 1X11A 1MAIA 2CAYA 2P0HA 1V5UA 3GYPA 4WSFA 1XCGA 3N7CA 3AU5A 3KY9A 1FB8A 5CLLB 1WG7A 4B6HA 5DH9B 2P0DA 2GCLA 2MKRA 3PZDA 1PMSA 2DHJA 1P3RA 1TJ6A 2Y8FA 2NZ8B 2FJLA 2VSZA 1EVHA 2OQBA 4K17A 1WVHA 5LONB 4DX90 2DHKA 3ODOA 2DA0A 4GMVA 3M1IB 1PFJA 1MK7B 2YRYA 4HB4B 4C0AA 1DDVA 2RLOA 1U29A 3FSSA 3X23A 4HATB 2CODA 2I1KA 1H10A 3F5RA 1U27A 4YL8A 5J3TA 3T06A 1MKEA 3KRWA 1UEFA 4K2OA 5HE3A 1U5FA 4ZRKA 1KZ7A 4L6EA 2COAA 1UPQA 2EJ8A 2CY4A 4IAPA 2YF0A 1H4RA 2ELAA 1XODA 2MDXA 2GJYA 3ULCA 4HAYB 1WJ1A 5JHGA 2LG1A 1MIZB 3A98B 2V76A 4HAXB 2Z0OA 2N0YA 3HK0A 5DHFB 2UVMA 4NY0A 1OY2A 4HAZB 1OMWA 2G35A 5J3QA 2J59M 4HDQA 2J0JA 3P7ZA 1WGQA 3HQCA 1W1HA 4KAXB 4PNKA 2KGXB 2LOZA 2UZSA 1LW3A 4GXBA 2K2JA 1BTNA 3D8FA 2YSZA 5FI0A 2YS3A 5C5BA 1DDMA 3KRXA 2Z0QA 2RSGA 1SGHA 2COFA 5D27A 1EGXA 2D9ZA 2IFSA 1UNQA 3PVWA 3ODWA 4IFSA 1U5EA 1BTKA 1W1DA 5FI1A 3P6AA 1J19A 2ROZB 1GC6A 2CRFA 3QWMA 3ODXA 2EMTA 3OANA 1B55A 2DKQA 2M38A 4EJNA 2YT1A 2Y8GA 1K5DB 2DX5A 3PVUA 2Z0PA 2RVBB 4A6KA 5KQ1A 1FHOA 2RNRB 2YT0A 1MPHA 2PZ1A 3DXEA 2RGNB 1K5GB 3SV1A 3VOQA 4DX8A 1V61A 4MK0A 1J0WA 3TCAA 1XX0A 2MWNB 3BINA 1X1GA 3TFMA 3PVLA 4A6FB 1V5MA 3D8DA 3ML4A 2LOXA 1W1GA 2YS5A 3SNHA 1LB1A 2COCA 3FEHA 2DYNA 1EAZA 2DHIA 3WYFB 3LJUX 4Z2MB 4F7GA 1X05A 1XD4A 5DIFB 5D3XA 2D9YA 3G9WA 3MDBC 2M14A 4WJ7A 1DROA 3TVVA 1OQNA 4F7UP 2R09A 2NMBA 1U5DA 3PEGA 3WA0A 2LULA 1XR0B 3HW2B 1N3HA 2W2WA 3QIJA 3ZVRA 2Y7BA 2MFQA 2I5CA 4CHJA 3O96A 4A5KA 2DTCA 1KI1B 2I5FA 5D3YA 1WI1A 4HB3B 3PSCA 1V88A 4K2PA 1NTVA 1Y5OA 2H7EA 1FGYA 2KUPA 5EFXA 1ZC3B 2DKPA 5C16A 3CIKA 3NSUA 2IYBA 5C6RA 5JLJB 4Z2NA 2J0KA 2ELBA 1M7RA 2BCJA 2E2XA 4GZUA 1IRSA 4CYEA 1AWEA 2D9VA 4DBBA 1TQZA 3DXDA 3CXBB 3BJIA 1BWNA 1SHCA 1RJ2A 4HDOA 2DLWA 2DX1A 4XWXA 2ROVA 3ULBA 4HHVA 3MPXA 1MK9B 5C79A 4H8SA 5HE1A 4MT7A 4KHBB 4KVGB 2EC1A 2I1JA 1ZVRA 4P7IA 1MIXA 2LKOA 4YONA 2RUKB 1WGUA 1FHWA 1I2HA 4PQ0A 1UNRA 1UNPA 1X1FA 3V5WA 2ADZA 3D8EA 4KHOA 1M7EA 2W2XD 1NU2A 3ZDTA 2VRWB 4DXAB 2OTXA 1GC7A 2XQNM 5KQ4A 2EMSA 1Y19B 4GPTB 3UZTA 2Q13A 4F7HA 1BAKA 3AJ4A 1FHXA 1FAOA 1E5WA 1KZGA 3GYOA 4WVFB 3SO6A 3U7DA 4EMOA 1NTYA 1P5TA 2H7DA 4IOYX 2D10A 1DDWA 2YVCA 4TYZA 5CLQB 4HB2B 4A6HA 3SUZA 5DHAB 1ZSQA 1QQGA 2D2QA 1Z87A 3PG7A 2X18A 1EF1A 1DYNA 1ZC4B 1ZM0A 4ZRJA 2N23A 2L1CA 2D9XA 1ISNA 2L2IA 3RCPA 1RRPB 4KHAA 2LYDA 1U2BA 4BBKA 3TW1A 2HE7A 1TXDA 1FGZA 1XKEA 4TKNA 4GN1A 2GS0A 3F0WA 2D4QA 2AEHA 2CY5A 5J3YA 2W2XC 2JP2A 1AQCA 1V89A 4A6FA 2YS1A 4Y94A 3PP2A 4D0NB 5C5BB 1GG3A 1I7AA 5D3VA 2QKLA 3TO1A 2DN6A 1P6SA 2J0MA 2D9WA 4K81A 5HE2A 5KCVA 3U8ZA 1FOEA 3AU4A 3SYXA 3QBVB 1DBHA 2AL6A 2HTHB 5DI9B 5LOPB 1PLSA 3FM8C 2GCJA 2DYQA 2KCJA 4HAWB 5D3WA 2ZPYA 4EKUA 4HB0B 3KZ1A 2D11A 4NSWA 5GOWB 2QKMA 1X86A 4GMXB 5JHHA 3A8PA 2UZRA 5L81A 4CHMA 2K00A 4HAUB 1WJMA 2P8VA 1Q67A 5JP4A 2R0DA 3KSYA 1V5PA 2VKIA 1QC6A 2K2UA 3VIAA 2DFKA 1U5GA 3DXCA 4ZRIA
chains in the Genus database with same CATH superfamily
1UPRA 2K49A 4MY6A 2P0FA 1NI2A 4HAVB 5LG4B 2YT2A 3IVFA 5HE0A 3A8QA 3U12A 1X11A 1MAIA 2CAYA 2P0HA 4KHBA 1V5UA 3GYPA 4WSFA 1XCGA 3N7CA 3AU5A 3FVCA 3KY9A 1FB8A 5CLLB 1WG7A 4B6HA 5DH9B 2P0DA 2GCLA 2MKRA 3PZDA 1PMSA 2DHJA 1P3RA 1TJ6A 2Y8FA 2NZ8B 2FJLA 2VSZA 1EVHA 2OQBA 4K17A 1WVHA 5LONB 4DX90 2DHKA 3ODOA 2DA0A 4GMVA 2RRFA 1PFJA 1MK7B 3M1IB 4QJ4B 2YRYA 2KUQA 4HB4B 4C0AA 1DDVA 2RLOA 1MI1A 1U29A 3FSSA 3X23A 4HATB 2CODA 2I1KA 1H10A 3F5RA 1U27A 4YL8A 5J3TA 3T06A 1MKEA 3KRWA 1UEFA 4K2OA 5HE3A 1U5FA 4ZRKA 1KZ7A 4L6EA 2COAA 1UPQA 2EJ8A 2CY4A 4IAPA 2YF0A 1H4RA 2ELAA 1XODA 2MDXA 2GJYA 3ULCA 4HAYB 1WJ1A 4OSNA 5JHGA 2LG1A 1MIZB 3A98B 2V76A 4HAXB 4OT1A 2Z0OA 2N0YA 3HK0A 5DHFB 2UVMA 3NW8A 4NY0A 1OY2A 4HAZB 1OMWA 4GOUA 2G35A 5J3QA 2J59M 4HDQA 2J0JA 3P7ZA 1WGQA 3HQCA 1W1HA 4KAXB 4PNKA 2KIGA 2KGXB 2LOZA 2UZSA 1LW3A 4GXBA 2K2JA 1BTNA 3D8FA 2YSZA 5FI0A 2YS3A 5C5BA 1DDMA 3KRXA 2Z0QA 2RSGA 1SGHA 2COFA 5I2SA 5D27A 1EGXA 2D9ZA 2IFSA 1UNQA 3PVWA 3ODWA 4IFSA 1U5EA 1BTKA 5IRSA 1W1DA 5FI1A 3P6AA 1J19A 2ROZB 1GC6A 2CRFA 3QWMA 3HSAA 3ODXA 2EMTA 3OANA 1B55A 2DKQA 2M38A 4EJNA 2YT1A 2Y8GA 1K5DB 2DX5A 3PVUA 5I2MA 2Z0PA 2RVBB 4A6KA 5KQ1A 1FHOA 2RNRB 2YT0A 1MPHA 2PZ1A 3DXEA 2RGNB 1K5GB 3SV1A 3VOQA 4DX8A 1V61A 4MK0A 1J0WA 3TCAA 1XX0A 2MWNB 3BINA 1X1GA 3TFMA 3PVLA 4A6FB 2KIEA 1V5MA 3D8DA 3ML4A 2FJUB 2LOXA 1W1GA 2YS5A 3SNHA 1LB1A 2K8EA 2COCA 3FEHA 2DYNA 1EAZA 2DHIA 3WYFB 3LJUX 4Z2MB 4F7GA 1X05A 1XD4A 5DIFB 5D3XA 2D9YA 3G9WA 3MDBC 2M14A 4WJ7A 1DROA 3TVVA 1OQNA 4F7UP 2R09A 2NMBA 1T77A 1U5DA 3PEGA 3WA0A 4D6WA 2LULA 1XR0B 3HW2B 1N3HA 2W2WA 3QIJA 3ZVRA 2Y7BA 2MFQA 2I5CA 4CHJA 3O96A 4A5KA 2DTCA 1KI1B 2I5FA 5D3YA 1WI1A 4HB3B 3PSCA 1V88A 4K2PA 1NTVA 1Y5OA 2H7EA 1FGYA 2KUPA 5EFXA 1ZC3B 2ZKMX 2DKPA 5C16A 3CIKA 1ZYIA 3NSUA 2IYBA 5C6RA 5JLJB 4Z2NA 2J0KA 2ELBA 1M7RA 2BCJA 2E2XA 4QJ3B 4GZUA 1IRSA 4CYEA 1AWEA 2D9VA 4DBBA 1TQZA 3DXDA 3CXBB 3BJIA 1BWNA 4CSQA 1SHCA 1RJ2A 4HDOA 2DLWA 2DX1A 4XWXA 2ROVA 4QXAB 3ULBA 3DCXA 3NWFA 4HHVA 3HIEA 3MPXA 1MK9B 5C79A 4H8SA 5HE1A 4MT7A 4KHBB 4KVGB 2EC1A 2I1JA 1ZVRA 2GUMA 4P7IA 1MIXA 2LKOA 4YONA 2RUKB 1WGUA 1FHWA 1I2HA 4PQ0A 1UNRA 3OHMB 1UNPA 1X1FA 3V5WA 2ADZA 3D8EA 4KHOA 1M7EA 2W2XD 1NU2A 3ZDTA 2VRWB 4DXAB 2OTXA 1GC7A 2XQNM 5KQ4A 2EMSA 1Y19B 4GPTB 3UZTA 2Q13A 4F7HA 1BAKA 3AJ4A 1FHXA 2Z59A 1FAOA 1E5WA 1KZGA 3GYOA 4WVFB 3SO6A 3U7DA 4EMOA 1NTYA 1P5TA 2H7DA 4IOYX 2D10A 1DDWA 2YVCA 4TYZA 5CLQB 2KR0A 4HB2B 3B77A 4A6HA 3SUZA 5DHAB 1ZSQA 1QQGA 2D2QA 3A58A 1Z87A 3PG7A 4L1RA 2X18A 1EF1A 1DYNA 1ZC4B 1ZM0A 4ZRJA 2N23A 2L1CA 2D9XA 1ISNA 2L2IA 3RCPA 1RRPB 4KHAA 2LYDA 2R2YA 1U2BA 4BBKA 3TW1A 2HE7A 1TXDA 1FGZA 1XKEA 4TKNA 2Z13A 4GN1A 2GS0A 3F0WA 4DIXA 2D4QA 2AEHA 2CY5A 5J3YA 2W2XC 2JP2A 1AQCA 1V89A 4A6FA 2YS1A 4Y94A 3PP2A 2NBVA 4D0NB 5C5BB 1GG3A 1I7AA 5D3VA 2QKLA 3TO1A 2DN6A 1P6SA 2J0MA 2D9WA 4K81A 5HE2A 5KCVA 3U8ZA 1FOEA 3AU4A 3SYXA 3QBVB 2Z4DA 1DBHA 2AL6A 2HTHB 5DI9B 5LOPB 5M4YB 1PLSA 3NWDA 3FM8C 2GCJA 2DYQA 2KCJA 2Z14A 4HAWB 5D3WA 2ZPYA 4EKUA 4HB0B 3KZ1A 2D11A 4NSWA 5GOWB 2QKMA 1X86A 4GMXB 5JHHA 3A8PA 2UZRA 5L81A 4CHMA 2K00A 4HAUB 1WJMA 2P8VA 1Q67A 5JP4A 2R0DA 4QJ5B 3KSYA 1V5PA 2VKIA 1QC6A 2K2UA 3NWAA 4HSIA 4GNKB 3VIAA 2DFKA 1U5GA 3DXCA 4ZRIA
chains in the Genus database with same CATH topology
1UPRA 4MY6A 2P0FA 1NI2A 4HAVB 3IVFA 5HE0A 3A8QA 1X11A 1MAIA 2CAYA 2P0HA 1V5UA 3GYPA 4WSFA 1XCGA 3N7CA 3AU5A 3KY9A 1FB8A 5CLLB 1WG7A 4B6HA 5DH9B 2P0DA 2GCLA 2MKRA 3PZDA 1PMSA 2DHJA 1P3RA 1TJ6A 2Y8FA 2NZ8B 2FJLA 2VSZA 1EVHA 2OQBA 4K17A 1WVHA 5LONB 4DX90 2DHKA 3ODOA 2DA0A 4GMVA 3M1IB 1PFJA 1MK7B 2YRYA 4HB4B 4C0AA 1DDVA 2RLOA 1U29A 3FSSA 3X23A 4HATB 2CODA 2I1KA 1H10A 3F5RA 1U27A 4YL8A 5J3TA 3T06A 1MKEA 3KRWA 1UEFA 4K2OA 5HE3A 1U5FA 4ZRKA 1KZ7A 4L6EA 2COAA 1UPQA 2EJ8A 2CY4A 4IAPA 2YF0A 1H4RA 2ELAA 1XODA 2MDXA 2GJYA 3ULCA 4HAYB 1WJ1A 5JHGA 2LG1A 1MIZB 3A98B 2V76A 4HAXB 2Z0OA 2N0YA 3HK0A 5DHFB 2UVMA 4NY0A 1OY2A 4HAZB 1OMWA 2G35A 5J3QA 2J59M 4HDQA 2J0JA 3P7ZA 1WGQA 3HQCA 1W1HA 4KAXB 4PNKA 2KGXB 2LOZA 2UZSA 1LW3A 4GXBA 2K2JA 1BTNA 3D8FA 2YSZA 5FI0A 2YS3A 5C5BA 1DDMA 3KRXA 2Z0QA 2RSGA 1SGHA 2COFA 5D27A 1EGXA 2D9ZA 2IFSA 1UNQA 3PVWA 3ODWA 4IFSA 1U5EA 1BTKA 1W1DA 5FI1A 3P6AA 1J19A 2ROZB 1GC6A 2CRFA 3QWMA 3ODXA 2EMTA 3OANA 1B55A 2DKQA 2M38A 4EJNA 2YT1A 2Y8GA 1K5DB 2DX5A 3PVUA 2Z0PA 2RVBB 4A6KA 5KQ1A 1FHOA 2RNRB 2YT0A 1MPHA 2PZ1A 3DXEA 2RGNB 1K5GB 3SV1A 3VOQA 4DX8A 1V61A 4MK0A 1J0WA 3TCAA 1XX0A 2MWNB 3BINA 1X1GA 3TFMA 3PVLA 4A6FB 1V5MA 3D8DA 3ML4A 2LOXA 1W1GA 2YS5A 3SNHA 1LB1A 2COCA 3FEHA 2DYNA 1EAZA 2DHIA 3WYFB 3LJUX 4Z2MB 4F7GA 1X05A 1XD4A 5DIFB 5D3XA 2D9YA 3G9WA 3MDBC 2M14A 4WJ7A 1DROA 3TVVA 1OQNA 4F7UP 2R09A 2NMBA 1U5DA 3PEGA 3WA0A 2LULA 1XR0B 3HW2B 1N3HA 2W2WA 3QIJA 3ZVRA 2Y7BA 2MFQA 2I5CA 4CHJA 3O96A 4A5KA 2DTCA 1KI1B 2I5FA 5D3YA 1WI1A 4HB3B 3PSCA 1V88A 4K2PA 1NTVA 1Y5OA 2H7EA 1FGYA 2KUPA 5EFXA 1ZC3B 2DKPA 5C16A 3CIKA 3NSUA 2IYBA 5C6RA 5JLJB 4Z2NA 2J0KA 2ELBA 1M7RA 2BCJA 2E2XA 4GZUA 1IRSA 4CYEA 1AWEA 2D9VA 4DBBA 1TQZA 3DXDA 3CXBB 3BJIA 1BWNA 1SHCA 1RJ2A 4HDOA 2DLWA 2DX1A 4XWXA 2ROVA 3ULBA 4HHVA 3MPXA 1MK9B 5C79A 4H8SA 5HE1A 4MT7A 4KHBB 4KVGB 2EC1A 2I1JA 1ZVRA 4P7IA 1MIXA 2LKOA 4YONA 2RUKB 1WGUA 1FHWA 1I2HA 4PQ0A 1UNRA 1UNPA 1X1FA 3V5WA 2ADZA 3D8EA 4KHOA 1M7EA 2W2XD 1NU2A 3ZDTA 2VRWB 4DXAB 2OTXA 1GC7A 2XQNM 5KQ4A 2EMSA 1Y19B 4GPTB 3UZTA 2Q13A 4F7HA 1BAKA 3AJ4A 1FHXA 1FAOA 1E5WA 1KZGA 3GYOA 4WVFB 3SO6A 3U7DA 4EMOA 1NTYA 1P5TA 2H7DA 4IOYX 2D10A 1DDWA 2YVCA 4TYZA 5CLQB 4HB2B 4A6HA 3SUZA 5DHAB 1ZSQA 1QQGA 2D2QA 1Z87A 3PG7A 2X18A 1EF1A 1DYNA 1ZC4B 1ZM0A 4ZRJA 2N23A 2L1CA 2D9XA 1ISNA 2L2IA 3RCPA 1RRPB 4KHAA 2LYDA 1U2BA 4BBKA 3TW1A 2HE7A 1TXDA 1FGZA 1XKEA 4TKNA 4GN1A 2GS0A 3F0WA 2D4QA 2AEHA 2CY5A 5J3YA 2W2XC 2JP2A 1AQCA 1V89A 4A6FA 2YS1A 4Y94A 3PP2A 4D0NB 5C5BB 1GG3A 1I7AA 5D3VA 2QKLA 3TO1A 2DN6A 1P6SA 2J0MA 2D9WA 4K81A 5HE2A 5KCVA 3U8ZA 1FOEA 3AU4A 3SYXA 3QBVB 1DBHA 2AL6A 2HTHB 5DI9B 5LOPB 1PLSA 3FM8C 2GCJA 2DYQA 2KCJA 4HAWB 5D3WA 2ZPYA 4EKUA 4HB0B 3KZ1A 2D11A 4NSWA 5GOWB 2QKMA 1X86A 4GMXB 5JHHA 3A8PA 2UZRA 5L81A 4CHMA 2K00A 4HAUB 1WJMA 2P8VA 1Q67A 5JP4A 2R0DA 3KSYA 1V5PA 2VKIA 1QC6A 2K2UA 3VIAA 2DFKA 1U5GA 3DXCA 4ZRIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UPR A;  4MY6 A;  2P0F A;  1NI2 A;  4HAV B;  3IVF A;  5HE0 A;  3A8Q A;  1X11 A;  1MAI A;  2CAY A;  2P0H A;  1V5U A;  3GYP A;  4WSF A;  1XCG A;  3N7C A;  3AU5 A;  3KY9 A;  1FB8 A;  5CLL B;  1WG7 A;  4B6H A;  5DH9 B;  2P0D A;  2GCL A;  2MKR A;  3PZD A;  1PMS A;  2DHJ A;  1P3R A;  1TJ6 A;  2Y8F A;  2NZ8 B;  2FJL A;  2VSZ A;  1EVH A;  2OQB A;  4K17 A;  1WVH A;  5LON B;  4DX9 0;  2DHK A;  3ODO A;  2DA0 A;  4GMV A;  3M1I B;  1PFJ A;  1MK7 B;  2YRY A;  4HB4 B;  4C0A A;  1DDV A;  2RLO A;  1U29 A;  3FSS A;  3X23 A;  4HAT B;  2COD A;  2I1K A;  1H10 A;  3F5R A;  1U27 A;  4YL8 A;  5J3T A;  3T06 A;  1MKE A;  3KRW A;  1UEF A;  4K2O A;  5HE3 A;  1U5F A;  4ZRK A;  1KZ7 A;  4L6E A;  2COA A;  1UPQ A;  2EJ8 A;  2CY4 A;  4IAP A;  2YF0 A;  1H4R A;  2ELA A;  1XOD A;  2MDX A;  2GJY A;  3ULC A;  4HAY B;  1WJ1 A;  5JHG A;  2LG1 A;  1MIZ B;  3A98 B;  2V76 A;  4HAX B;  2Z0O A;  2N0Y A;  3HK0 A;  5DHF B;  2UVM A;  4NY0 A;  1OY2 A;  4HAZ B;  1OMW A;  2G35 A;  5J3Q A;  2J59 M;  4HDQ A;  2J0J A;  3P7Z A;  1WGQ A;  3HQC A;  1W1H A;  4KAX B;  4PNK A;  2KGX B;  2LOZ A;  2UZS A;  1LW3 A;  4GXB A;  2K2J A;  1BTN A;  3D8F A;  2YSZ A;  5FI0 A;  2YS3 A;  5C5B A;  1DDM A;  3KRX A;  2Z0Q A;  2RSG A;  1SGH A;  2COF A;  5D27 A;  1EGX A;  2D9Z A;  2IFS A;  1UNQ A;  3PVW A;  3ODW A;  4IFS A;  1U5E A;  1BTK A;  1W1D A;  5FI1 A;  3P6A A;  1J19 A;  2ROZ B;  1GC6 A;  2CRF A;  3QWM A;  3ODX A;  2EMT A;  3OAN A;  1B55 A;  2DKQ A;  2M38 A;  4EJN A;  2YT1 A;  2Y8G A;  1K5D B;  2DX5 A;  3PVU A;  2Z0P A;  2RVB B;  4A6K A;  5KQ1 A;  1FHO A;  2RNR B;  2YT0 A;  1MPH A;  2PZ1 A;  3DXE A;  2RGN B;  1K5G B;  3SV1 A;  3VOQ A;  4DX8 A;  1V61 A;  4MK0 A;  1J0W A;  3TCA A;  1XX0 A;  2MWN B;  3BIN A;  1X1G A;  3TFM A;  3PVL A;  4A6F B;  1V5M A;  3D8D A;  3ML4 A;  2LOX A;  1W1G A;  2YS5 A;  3SNH A;  1LB1 A;  2COC A;  3FEH A;  2DYN A;  1EAZ A;  2DHI A;  3WYF B;  3LJU X;  4Z2M B;  4F7G A;  1X05 A;  1XD4 A;  5DIF B;  5D3X A;  2D9Y A;  3G9W A;  3MDB C;  2M14 A;  4WJ7 A;  1DRO A;  3TVV A;  1OQN A;  4F7U P;  2R09 A;  2NMB A;  1U5D A;  3PEG A;  3WA0 A;  2LUL A;  1XR0 B;  3HW2 B;  1N3H A;  2W2W A;  3QIJ A;  3ZVR A;  2Y7B A;  2MFQ A;  2I5C A;  4CHJ A;  3O96 A;  4A5K A;  2DTC A;  1KI1 B;  2I5F A;  5D3Y A;  1WI1 A;  4HB3 B;  3PSC A;  1V88 A;  4K2P A;  1NTV A;  1Y5O A;  2H7E A;  1FGY A;  2KUP A;  5EFX A;  1ZC3 B;  2DKP A;  5C16 A;  3CIK A;  3NSU A;  2IYB A;  5C6R A;  5JLJ B;  4Z2N A;  2J0K A;  2ELB A;  1M7R A;  2BCJ A;  2E2X A;  4GZU A;  1IRS A;  4CYE A;  1AWE A;  2D9V A;  4DBB A;  1TQZ A;  3DXD A;  3CXB B;  3BJI A;  1BWN A;  1SHC A;  1RJ2 A;  4HDO A;  2DLW A;  2DX1 A;  4XWX A;  2ROV A;  3ULB A;  4HHV A;  3MPX A;  1MK9 B;  5C79 A;  4H8S A;  5HE1 A;  4MT7 A;  4KHB B;  4KVG B;  2EC1 A;  2I1J A;  1ZVR A;  4P7I A;  1MIX A;  2LKO A;  4YON A;  2RUK B;  1WGU A;  1FHW A;  1I2H A;  4PQ0 A;  1UNR A;  1UNP A;  1X1F A;  3V5W A;  2ADZ A;  3D8E A;  4KHO A;  1M7E A;  2W2X D;  1NU2 A;  3ZDT A;  2VRW B;  4DXA B;  2OTX A;  1GC7 A;  2XQN M;  5KQ4 A;  2EMS A;  1Y19 B;  4GPT B;  3UZT A;  2Q13 A;  4F7H A;  1BAK A;  3AJ4 A;  1FHX A;  1FAO A;  1E5W A;  1KZG A;  3GYO A;  4WVF B;  3SO6 A;  3U7D A;  4EMO A;  1NTY A;  1P5T A;  2H7D A;  4IOY X;  2D10 A;  1DDW A;  2YVC A;  4TYZ A;  5CLQ B;  4HB2 B;  4A6H A;  3SUZ A;  5DHA B;  1ZSQ A;  1QQG A;  2D2Q A;  1Z87 A;  3PG7 A;  2X18 A;  1EF1 A;  1DYN A;  1ZC4 B;  1ZM0 A;  4ZRJ A;  2N23 A;  2L1C A;  2D9X A;  1ISN A;  2L2I A;  3RCP A;  1RRP B;  4KHA A;  2LYD A;  1U2B A;  4BBK A;  3TW1 A;  2HE7 A;  1TXD A;  1FGZ A;  1XKE A;  4TKN A;  4GN1 A;  2GS0 A;  3F0W A;  2D4Q A;  2AEH A;  2CY5 A;  5J3Y A;  2W2X C;  2JP2 A;  1AQC A;  1V89 A;  4A6F A;  2YS1 A;  4Y94 A;  3PP2 A;  4D0N B;  5C5B B;  1GG3 A;  1I7A A;  5D3V A;  2QKL A;  3TO1 A;  2DN6 A;  1P6S A;  2J0M A;  2D9W A;  4K81 A;  5HE2 A;  5KCV A;  3U8Z A;  1FOE A;  3AU4 A;  3SYX A;  3QBV B;  1DBH A;  2AL6 A;  2HTH B;  5DI9 B;  5LOP B;  1PLS A;  3FM8 C;  2GCJ A;  2DYQ A;  2KCJ A;  4HAW B;  5D3W A;  2ZPY A;  4EKU A;  4HB0 B;  3KZ1 A;  2D11 A;  4NSW A;  5GOW B;  2QKM A;  1X86 A;  4GMX B;  5JHH A;  3A8P A;  2UZR A;  5L81 A;  4CHM A;  2K00 A;  4HAU B;  1WJM A;  2P8V A;  1Q67 A;  5JP4 A;  2R0D A;  3KSY A;  1V5P A;  2VKI A;  1QC6 A;  2K2U A;  3VIA A;  2DFK A;  1U5G A;  3DXC A;  4ZRI A; 
#chains in the Genus database with same CATH topology
 1UPR A;  2K49 A;  4MY6 A;  2P0F A;  1NI2 A;  4HAV B;  5LG4 B;  2YT2 A;  3IVF A;  5HE0 A;  3A8Q A;  3U12 A;  1X11 A;  1MAI A;  2CAY A;  2P0H A;  4KHB A;  1V5U A;  3GYP A;  4WSF A;  1XCG A;  3N7C A;  3AU5 A;  3FVC A;  3KY9 A;  1FB8 A;  5CLL B;  1WG7 A;  4B6H A;  5DH9 B;  2P0D A;  2GCL A;  2MKR A;  3PZD A;  1PMS A;  2DHJ A;  1P3R A;  1TJ6 A;  2Y8F A;  2NZ8 B;  2FJL A;  2VSZ A;  1EVH A;  2OQB A;  4K17 A;  1WVH A;  5LON B;  4DX9 0;  2DHK A;  3ODO A;  2DA0 A;  4GMV A;  2RRF A;  1PFJ A;  1MK7 B;  3M1I B;  4QJ4 B;  2YRY A;  2KUQ A;  4HB4 B;  4C0A A;  1DDV A;  2RLO A;  1MI1 A;  1U29 A;  3FSS A;  3X23 A;  4HAT B;  2COD A;  2I1K A;  1H10 A;  3F5R A;  1U27 A;  4YL8 A;  5J3T A;  3T06 A;  1MKE A;  3KRW A;  1UEF A;  4K2O A;  5HE3 A;  1U5F A;  4ZRK A;  1KZ7 A;  4L6E A;  2COA A;  1UPQ A;  2EJ8 A;  2CY4 A;  4IAP A;  2YF0 A;  1H4R A;  2ELA A;  1XOD A;  2MDX A;  2GJY A;  3ULC A;  4HAY B;  1WJ1 A;  4OSN A;  5JHG A;  2LG1 A;  1MIZ B;  3A98 B;  2V76 A;  4HAX B;  4OT1 A;  2Z0O A;  2N0Y A;  3HK0 A;  5DHF B;  2UVM A;  3NW8 A;  4NY0 A;  1OY2 A;  4HAZ B;  1OMW A;  4GOU A;  2G35 A;  5J3Q A;  2J59 M;  4HDQ A;  2J0J A;  3P7Z A;  1WGQ A;  3HQC A;  1W1H A;  4KAX B;  4PNK A;  2KIG A;  2KGX B;  2LOZ A;  2UZS A;  1LW3 A;  4GXB A;  2K2J A;  1BTN A;  3D8F A;  2YSZ A;  5FI0 A;  2YS3 A;  5C5B A;  1DDM A;  3KRX A;  2Z0Q A;  2RSG A;  1SGH A;  2COF A;  5I2S A;  5D27 A;  1EGX A;  2D9Z A;  2IFS A;  1UNQ A;  3PVW A;  3ODW A;  4IFS A;  1U5E A;  1BTK A;  5IRS A;  1W1D A;  5FI1 A;  3P6A A;  1J19 A;  2ROZ B;  1GC6 A;  2CRF A;  3QWM A;  3HSA A;  3ODX A;  2EMT A;  3OAN A;  1B55 A;  2DKQ A;  2M38 A;  4EJN A;  2YT1 A;  2Y8G A;  1K5D B;  2DX5 A;  3PVU A;  5I2M A;  2Z0P A;  2RVB B;  4A6K A;  5KQ1 A;  1FHO A;  2RNR B;  2YT0 A;  1MPH A;  2PZ1 A;  3DXE A;  2RGN B;  1K5G B;  3SV1 A;  3VOQ A;  4DX8 A;  1V61 A;  4MK0 A;  1J0W A;  3TCA A;  1XX0 A;  2MWN B;  3BIN A;  1X1G A;  3TFM A;  3PVL A;  4A6F B;  2KIE A;  1V5M A;  3D8D A;  3ML4 A;  2FJU B;  2LOX A;  1W1G A;  2YS5 A;  3SNH A;  1LB1 A;  2K8E A;  2COC A;  3FEH A;  2DYN A;  1EAZ A;  2DHI A;  3WYF B;  3LJU X;  4Z2M B;  4F7G A;  1X05 A;  1XD4 A;  5DIF B;  5D3X A;  2D9Y A;  3G9W A;  3MDB C;  2M14 A;  4WJ7 A;  1DRO A;  3TVV A;  1OQN A;  4F7U P;  2R09 A;  2NMB A;  1T77 A;  1U5D A;  3PEG A;  3WA0 A;  4D6W A;  2LUL A;  1XR0 B;  3HW2 B;  1N3H A;  2W2W A;  3QIJ A;  3ZVR A;  2Y7B A;  2MFQ A;  2I5C A;  4CHJ A;  3O96 A;  4A5K A;  2DTC A;  1KI1 B;  2I5F A;  5D3Y A;  1WI1 A;  4HB3 B;  3PSC A;  1V88 A;  4K2P A;  1NTV A;  1Y5O A;  2H7E A;  1FGY A;  2KUP A;  5EFX A;  1ZC3 B;  2ZKM X;  2DKP A;  5C16 A;  3CIK A;  1ZYI A;  3NSU A;  2IYB A;  5C6R A;  5JLJ B;  4Z2N A;  2J0K A;  2ELB A;  1M7R A;  2BCJ A;  2E2X A;  4QJ3 B;  4GZU A;  1IRS A;  4CYE A;  1AWE A;  2D9V A;  4DBB A;  1TQZ A;  3DXD A;  3CXB B;  3BJI A;  1BWN A;  4CSQ A;  1SHC A;  1RJ2 A;  4HDO A;  2DLW A;  2DX1 A;  4XWX A;  2ROV A;  4QXA B;  3ULB A;  3DCX A;  3NWF A;  4HHV A;  3HIE A;  3MPX A;  1MK9 B;  5C79 A;  4H8S A;  5HE1 A;  4MT7 A;  4KHB B;  4KVG B;  2EC1 A;  2I1J A;  1ZVR A;  2GUM A;  4P7I A;  1MIX A;  2LKO A;  4YON A;  2RUK B;  1WGU A;  1FHW A;  1I2H A;  4PQ0 A;  1UNR A;  3OHM B;  1UNP A;  1X1F A;  3V5W A;  2ADZ A;  3D8E A;  4KHO A;  1M7E A;  2W2X D;  1NU2 A;  3ZDT A;  2VRW B;  4DXA B;  2OTX A;  1GC7 A;  2XQN M;  5KQ4 A;  2EMS A;  1Y19 B;  4GPT B;  3UZT A;  2Q13 A;  4F7H A;  1BAK A;  3AJ4 A;  1FHX A;  2Z59 A;  1FAO A;  1E5W A;  1KZG A;  3GYO A;  4WVF B;  3SO6 A;  3U7D A;  4EMO A;  1NTY A;  1P5T A;  2H7D A;  4IOY X;  2D10 A;  1DDW A;  2YVC A;  4TYZ A;  5CLQ B;  2KR0 A;  4HB2 B;  3B77 A;  4A6H A;  3SUZ A;  5DHA B;  1ZSQ A;  1QQG A;  2D2Q A;  3A58 A;  1Z87 A;  3PG7 A;  4L1R A;  2X18 A;  1EF1 A;  1DYN A;  1ZC4 B;  1ZM0 A;  4ZRJ A;  2N23 A;  2L1C A;  2D9X A;  1ISN A;  2L2I A;  3RCP A;  1RRP B;  4KHA A;  2LYD A;  2R2Y A;  1U2B A;  4BBK A;  3TW1 A;  2HE7 A;  1TXD A;  1FGZ A;  1XKE A;  4TKN A;  2Z13 A;  4GN1 A;  2GS0 A;  3F0W A;  4DIX A;  2D4Q A;  2AEH A;  2CY5 A;  5J3Y A;  2W2X C;  2JP2 A;  1AQC A;  1V89 A;  4A6F A;  2YS1 A;  4Y94 A;  3PP2 A;  2NBV A;  4D0N B;  5C5B B;  1GG3 A;  1I7A A;  5D3V A;  2QKL A;  3TO1 A;  2DN6 A;  1P6S A;  2J0M A;  2D9W A;  4K81 A;  5HE2 A;  5KCV A;  3U8Z A;  1FOE A;  3AU4 A;  3SYX A;  3QBV B;  2Z4D A;  1DBH A;  2AL6 A;  2HTH B;  5DI9 B;  5LOP B;  5M4Y B;  1PLS A;  3NWD A;  3FM8 C;  2GCJ A;  2DYQ A;  2KCJ A;  2Z14 A;  4HAW B;  5D3W A;  2ZPY A;  4EKU A;  4HB0 B;  3KZ1 A;  2D11 A;  4NSW A;  5GOW B;  2QKM A;  1X86 A;  4GMX B;  5JHH A;  3A8P A;  2UZR A;  5L81 A;  4CHM A;  2K00 A;  4HAU B;  1WJM A;  2P8V A;  1Q67 A;  5JP4 A;  2R0D A;  4QJ5 B;  3KSY A;  1V5P A;  2VKI A;  1QC6 A;  2K2U A;  3NWA A;  4HSI A;  4GNK B;  3VIA A;  2DFK A;  1U5G A;  3DXC A;  4ZRI A; 
#chains in the Genus database with same CATH homology
 1UPR A;  4MY6 A;  2P0F A;  1NI2 A;  4HAV B;  3IVF A;  5HE0 A;  3A8Q A;  1X11 A;  1MAI A;  2CAY A;  2P0H A;  1V5U A;  3GYP A;  4WSF A;  1XCG A;  3N7C A;  3AU5 A;  3KY9 A;  1FB8 A;  5CLL B;  1WG7 A;  4B6H A;  5DH9 B;  2P0D A;  2GCL A;  2MKR A;  3PZD A;  1PMS A;  2DHJ A;  1P3R A;  1TJ6 A;  2Y8F A;  2NZ8 B;  2FJL A;  2VSZ A;  1EVH A;  2OQB A;  4K17 A;  1WVH A;  5LON B;  4DX9 0;  2DHK A;  3ODO A;  2DA0 A;  4GMV A;  3M1I B;  1PFJ A;  1MK7 B;  2YRY A;  4HB4 B;  4C0A A;  1DDV A;  2RLO A;  1U29 A;  3FSS A;  3X23 A;  4HAT B;  2COD A;  2I1K A;  1H10 A;  3F5R A;  1U27 A;  4YL8 A;  5J3T A;  3T06 A;  1MKE A;  3KRW A;  1UEF A;  4K2O A;  5HE3 A;  1U5F A;  4ZRK A;  1KZ7 A;  4L6E A;  2COA A;  1UPQ A;  2EJ8 A;  2CY4 A;  4IAP A;  2YF0 A;  1H4R A;  2ELA A;  1XOD A;  2MDX A;  2GJY A;  3ULC A;  4HAY B;  1WJ1 A;  5JHG A;  2LG1 A;  1MIZ B;  3A98 B;  2V76 A;  4HAX B;  2Z0O A;  2N0Y A;  3HK0 A;  5DHF B;  2UVM A;  4NY0 A;  1OY2 A;  4HAZ B;  1OMW A;  2G35 A;  5J3Q A;  2J59 M;  4HDQ A;  2J0J A;  3P7Z A;  1WGQ A;  3HQC A;  1W1H A;  4KAX B;  4PNK A;  2KGX B;  2LOZ A;  2UZS A;  1LW3 A;  4GXB A;  2K2J A;  1BTN A;  3D8F A;  2YSZ A;  5FI0 A;  2YS3 A;  5C5B A;  1DDM A;  3KRX A;  2Z0Q A;  2RSG A;  1SGH A;  2COF A;  5D27 A;  1EGX A;  2D9Z A;  2IFS A;  1UNQ A;  3PVW A;  3ODW A;  4IFS A;  1U5E A;  1BTK A;  1W1D A;  5FI1 A;  3P6A A;  1J19 A;  2ROZ B;  1GC6 A;  2CRF A;  3QWM A;  3ODX A;  2EMT A;  3OAN A;  1B55 A;  2DKQ A;  2M38 A;  4EJN A;  2YT1 A;  2Y8G A;  1K5D B;  2DX5 A;  3PVU A;  2Z0P A;  2RVB B;  4A6K A;  5KQ1 A;  1FHO A;  2RNR B;  2YT0 A;  1MPH A;  2PZ1 A;  3DXE A;  2RGN B;  1K5G B;  3SV1 A;  3VOQ A;  4DX8 A;  1V61 A;  4MK0 A;  1J0W A;  3TCA A;  1XX0 A;  2MWN B;  3BIN A;  1X1G A;  3TFM A;  3PVL A;  4A6F B;  1V5M A;  3D8D A;  3ML4 A;  2LOX A;  1W1G A;  2YS5 A;  3SNH A;  1LB1 A;  2COC A;  3FEH A;  2DYN A;  1EAZ A;  2DHI A;  3WYF B;  3LJU X;  4Z2M B;  4F7G A;  1X05 A;  1XD4 A;  5DIF B;  5D3X A;  2D9Y A;  3G9W A;  3MDB C;  2M14 A;  4WJ7 A;  1DRO A;  3TVV A;  1OQN A;  4F7U P;  2R09 A;  2NMB A;  1U5D A;  3PEG A;  3WA0 A;  2LUL A;  1XR0 B;  3HW2 B;  1N3H A;  2W2W A;  3QIJ A;  3ZVR A;  2Y7B A;  2MFQ A;  2I5C A;  4CHJ A;  3O96 A;  4A5K A;  2DTC A;  1KI1 B;  2I5F A;  5D3Y A;  1WI1 A;  4HB3 B;  3PSC A;  1V88 A;  4K2P A;  1NTV A;  1Y5O A;  2H7E A;  1FGY A;  2KUP A;  5EFX A;  1ZC3 B;  2DKP A;  5C16 A;  3CIK A;  3NSU A;  2IYB A;  5C6R A;  5JLJ B;  4Z2N A;  2J0K A;  2ELB A;  1M7R A;  2BCJ A;  2E2X A;  4GZU A;  1IRS A;  4CYE A;  1AWE A;  2D9V A;  4DBB A;  1TQZ A;  3DXD A;  3CXB B;  3BJI A;  1BWN A;  1SHC A;  1RJ2 A;  4HDO A;  2DLW A;  2DX1 A;  4XWX A;  2ROV A;  3ULB A;  4HHV A;  3MPX A;  1MK9 B;  5C79 A;  4H8S A;  5HE1 A;  4MT7 A;  4KHB B;  4KVG B;  2EC1 A;  2I1J A;  1ZVR A;  4P7I A;  1MIX A;  2LKO A;  4YON A;  2RUK B;  1WGU A;  1FHW A;  1I2H A;  4PQ0 A;  1UNR A;  1UNP A;  1X1F A;  3V5W A;  2ADZ A;  3D8E A;  4KHO A;  1M7E A;  2W2X D;  1NU2 A;  3ZDT A;  2VRW B;  4DXA B;  2OTX A;  1GC7 A;  2XQN M;  5KQ4 A;  2EMS A;  1Y19 B;  4GPT B;  3UZT A;  2Q13 A;  4F7H A;  1BAK A;  3AJ4 A;  1FHX A;  1FAO A;  1E5W A;  1KZG A;  3GYO A;  4WVF B;  3SO6 A;  3U7D A;  4EMO A;  1NTY A;  1P5T A;  2H7D A;  4IOY X;  2D10 A;  1DDW A;  2YVC A;  4TYZ A;  5CLQ B;  4HB2 B;  4A6H A;  3SUZ A;  5DHA B;  1ZSQ A;  1QQG A;  2D2Q A;  1Z87 A;  3PG7 A;  2X18 A;  1EF1 A;  1DYN A;  1ZC4 B;  1ZM0 A;  4ZRJ A;  2N23 A;  2L1C A;  2D9X A;  1ISN A;  2L2I A;  3RCP A;  1RRP B;  4KHA A;  2LYD A;  1U2B A;  4BBK A;  3TW1 A;  2HE7 A;  1TXD A;  1FGZ A;  1XKE A;  4TKN A;  4GN1 A;  2GS0 A;  3F0W A;  2D4Q A;  2AEH A;  2CY5 A;  5J3Y A;  2W2X C;  2JP2 A;  1AQC A;  1V89 A;  4A6F A;  2YS1 A;  4Y94 A;  3PP2 A;  4D0N B;  5C5B B;  1GG3 A;  1I7A A;  5D3V A;  2QKL A;  3TO1 A;  2DN6 A;  1P6S A;  2J0M A;  2D9W A;  4K81 A;  5HE2 A;  5KCV A;  3U8Z A;  1FOE A;  3AU4 A;  3SYX A;  3QBV B;  1DBH A;  2AL6 A;  2HTH B;  5DI9 B;  5LOP B;  1PLS A;  3FM8 C;  2GCJ A;  2DYQ A;  2KCJ A;  4HAW B;  5D3W A;  2ZPY A;  4EKU A;  4HB0 B;  3KZ1 A;  2D11 A;  4NSW A;  5GOW B;  2QKM A;  1X86 A;  4GMX B;  5JHH A;  3A8P A;  2UZR A;  5L81 A;  4CHM A;  2K00 A;  4HAU B;  1WJM A;  2P8V A;  1Q67 A;  5JP4 A;  2R0D A;  3KSY A;  1V5P A;  2VKI A;  1QC6 A;  2K2U A;  3VIA A;  2DFK A;  1U5G A;  3DXC A;  4ZRI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...