2YT2A

Solution structure of the chimera of the ptb domain of snt-2 and 19-residue peptide (aa 1571-1589) of halk
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
153
structure length
153
Chain Sequence
GSSGSSGLNRDSVPDNHPTKFKVTNVDDEGVELGSGVMELTQSELVLHLHRREAVRWPYLCLRRYGYDSNLFSFESGRRCQTGQGIFAFKCSRAEEIFNLLQDLMQCNSINVMEEPVIITSGSSGSSGSSGSSGLFRLRHFPCGNVNYGYQQQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fibroblast growth factor receptor substrate 3 and ALK tyrosi
publication title Structural basis for the recognition of nucleophosmin-anaplastic lymphoma kinase oncoprotein by the phosphotyrosine binding domain of Suc1-associated neurotrophic factor-induced tyrosine-phosphorylated target-2
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 16
structure length 153
sequence length 153
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2007-04-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02174 IRS PTB domain (IRS-1 type)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.250 Mainly Beta Roll PH-domain like PH-domain like 2yt2A00
2YT2A 2KUQA
chains in the Genus database with same CATH superfamily
4A6KA 2CODA 4EMOA 3IVFA 2AL6A 2D4QA 3V5WA 2KIGA 4HSIA 1BAKA 3FEHA 4GMVA 5CLQB 3TVVA 1U5EA 2D9ZA 1V88A 1XR0B 1NI2A 2KR0A 1EF1A 3SYXA 4GZUA 1MI1A 4DX8A 2DX5A 4B6HA 2GCJA 2MKRA 1ZM0A 1RJ2A 2W2XC 1BWNA 2ROVA 2D11A 1X05A 1OMWA 2I1KA 4WJ7A 2ZKMX 2P0FA 1UNPA 2I5FA 1MK7B 5D3VA 1MAIA 2IFSA 2RVBB 1B55A 2ROZB 1UEFA 4PQ0A 3FM8C 2K00A 3PVLA 3HSAA 4HHVA 2M14A 4HAVB 3MDBC 5C79A 3PSCA 3GYOA 1NTYA 2Z13A 4DBBA 2DX1A 2CY5A 4GPTB 2COCA 2DN6A 5J3QA 2Y7BA 1X1GA 4HATB 3KRWA 5M4YB 4XWXA 2DKPA 5LG4B 2R0DA 1ZYIA 1U5FA 3FSSA 5C5BA 1Q67A 3KY9A 1M7RA 1DDWA 2G35A 2J0JA 1W1DA 4PNKA 5IRSA 2DHKA 1X1FA 2NMBA 3D8FA 1J19A 2YS5A 1FOEA 3OANA 1V5UA 1SGHA 3QIJA 1KZ7A 2GS0A 3SUZA 3HW2B 4IAPA 3TCAA 2EMSA 4D0NB 2DLWA 3ODOA 5JP4A 2VRWB 3OHMB 1LB1A 1QQGA 3WYFB 2LOZA 4KHAA 2N23A 1ZVRA 1DDVA 2L2IA 4QJ3B 1K5GB 3NSUA 2COFA 1I2HA 2CRFA 4MT7A 4Z2NA 4F7HA 4F7GA 3D8EA 5FI0A 3ULBA 4A5KA 3O96A 1PFJA 1WJ1A 2UZRA 4ZRJA 1Y19B 1BTNA 3LJUX 4H8SA 3QWMA 1W1HA 1MKEA 2YSZA 1UNQA 4CSQA 2Z0PA 3PP2A 5KQ1A 2YT1A 2D2QA 2LYDA 3SV1A 4DX90 1EGXA 2D9XA 2GCLA 4OSNA 1XX0A 2K8EA 2UVMA 3ODWA 2D9WA 1WVHA 4A6HA 3FVCA 1WGUA 1Z87A 2ELBA 2UZSA 3P7ZA 1DROA 1EAZA 5CLLB 1FGZA 4HB2B 5LONB 3TO1A 2K49A 4K2OA 2QKLA 3DCXA 1U5DA 2Z0QA 3D8DA 2RGNB 4YONA 1T77A 2Q13A 2Z4DA 2MFQA 1TQZA 2KGXB 1M7EA 3F5RA 1AWEA 1GC7A 4D6WA 2D9VA 3HK0A 2DTCA 4HDOA 2YVCA 1AQCA 3KRXA 1FHOA 1DBHA 1FHXA 3ZVRA 3ML4A 4HAYB 4EKUA 2YT0A 2DKQA 1Y5OA 1QC6A 2XQNM 2YF0A 3NWDA 5L81A 2R09A 3HQCA 3U12A 3A58A 2D9YA 1SHCA 2ADZA 4IFSA 3TFMA 2W2XD 2KUPA 4IOYX 5GOWB 2K2UA 4KHBA 4GOUA 2VKIA 2Y8FA 5D3XA 3A8QA 2D10A 4OT1A 5KCVA 1DYNA 1J0WA 3TW1A 1GC6A 4ZRIA 4DXAB 5C6RA 2L1CA 2DHJA 3MPXA 4QJ4B 3A8PA 2DYQA 2YS3A 5C5BB 1U29A 3F0WA 3ODXA 4K17A 5DIFB 1N3HA 1WG7A 1XD4A 2LULA 2YT2A 3PVWA 4GN1A 3CXBB 2RRFA 4ZRKA 4F7UP 5I2SA 1NU2A 2Z0OA 4KAXB 2HTHB 2Z59A 1LW3A 4HAXB 1ISNA 5I2MA 2AEHA 1KZGA 1E5WA 2I5CA 2LG1A 2MWNB 4L1RA 4A6FA 1U27A 4CHJA 2CAYA 4C0AA 2COAA 3AU4A 4DIXA 1FAOA 2W2WA 1I7AA 1DDMA 2N0YA 2CY4A 5JHGA 2P0DA 1V89A 1XKEA 2LOXA 3VOQA 2RNRB 3N7CA 4QXAB 1RRPB 2KUQA 1XODA 3GYPA 3BINA 1U5GA 3KSYA 3PZDA 1MPHA 3B77A 1MIXA 1WI1A 1OY2A 3HIEA 1W1GA 2J0KA 2J59M 2IYBA 2KCJA 2RSGA 3AU5A 1V5PA 2V76A 1P5TA 4K2PA 3NWAA 3NW8A 3BJIA 5FI1A 1GG3A 3G9WA 3NWFA 3SO6A 1ZSQA 3U7DA 1ZC4B 4GXBA 3AJ4A 2J0MA 3M1IB 4CHMA 3ZDTA 5HE2A 1TJ6A 2P0HA 4EJNA 1OQNA 3PEGA 3CIKA 5JHHA 1ZC3B 1BTKA 2OTXA 1NTVA 3DXEA 1P3RA 1V61A 2Y8GA 2NZ8B 3A98B 4WSFA 2BCJA 2FJLA 4L6EA 4MY6A 5J3YA 4GNKB 5J3TA 5C16A 1WJMA 2OQBA 2EMTA 4HB0B 5LOPB 5EFXA 4Z2MB 1MK9B 3VIAA 2NBVA 1EVHA 2E2XA 4HAZB 1XCGA 1WGQA 4BBKA 3QBVB 2I1JA 2GUMA 4WVFB 1H10A 1MIZB 4Y94A 3UZTA 4P7IA 4KHBB 1KI1B 2DFKA 2VSZA 5DI9B 1FB8A 2Z14A 1TXDA 2JP2A 5KQ4A 2GJYA 5DHAB 1UPRA 2ELAA 2K2JA 2YS1A 4NY0A 1UPQA 2QKMA 5HE3A 2ZPYA 2RUKB 4KVGB 4HB3B 5DH9B 3SNHA 5D27A 2RLOA 3KZ1A 1U2BA 1H4RA 4CYEA 5D3WA 3WA0A 2HE7A 2MDXA 5JLJB 4HB4B 1P6SA 1FHWA 3P6AA 2R2YA 5DHFB 5HE0A 2DA0A 3DXDA 4TYZA 4A6FB 2P8VA 4HAUB 1FGYA 2EC1A 2YRYA 2EJ8A 4HDQA 2DHIA 1PLSA 2FJUB 1IRSA 3RCPA 3PVUA 4KHOA 2H7EA 4MK0A 1V5MA 1X11A 3ULCA 2X18A 4YL8A 3X23A 5D3YA 2PZ1A 1PMSA 1K5DB 2LKOA 4K81A 4NSWA 2KIEA 2H7DA 4GMXB 5HE1A 1X86A 4HAWB 2DYNA 3DXCA 3PG7A 3U8ZA 4TKNA 4QJ5B 1UNRA 2M38A 3T06A
chains in the Genus database with same CATH topology
4L1RA 4KHOA 3GYOA 4KHBB 2KIGA 4DIXA 4HSIA 2Z13A 4Z2NA 2ZKMX 3HIEA 3NWDA 4QJ4B 3TVVA 2Z4DA 2GCLA 4OSNA 2K8EA 2Z14A 3U12A 4GNKB 3A58A 4IFSA 3FVCA 2KR0A 2R2YA 5M4YB 2YT2A 4IOYX 2KIEA 4D6WA 4KHBA 2KUQA 4PQ0A 4GOUA 4QXAB 4Z2MB 5LG4B 2RRFA 3OHMB 1ZYIA 3FSSA 3GYPA 5I2SA 2NBVA 2GCJA 4OT1A 4KHAA 4QJ5B 3NWAA 3NW8A 3TO1A 3TW1A 2FJUB 2K49A 2GUMA 2Z59A 4QJ3B 5I2MA 3NWFA 4CSQA 5IRSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YT2 A;  2KUQ A; 
#chains in the Genus database with same CATH topology
 4A6K A;  2COD A;  4EMO A;  3IVF A;  2AL6 A;  2D4Q A;  3V5W A;  2KIG A;  4HSI A;  1BAK A;  3FEH A;  4GMV A;  5CLQ B;  3TVV A;  1U5E A;  2D9Z A;  1V88 A;  1XR0 B;  1NI2 A;  2KR0 A;  1EF1 A;  3SYX A;  4GZU A;  1MI1 A;  4DX8 A;  2DX5 A;  4B6H A;  2GCJ A;  2MKR A;  1ZM0 A;  1RJ2 A;  2W2X C;  1BWN A;  2ROV A;  2D11 A;  1X05 A;  1OMW A;  2I1K A;  4WJ7 A;  2ZKM X;  2P0F A;  1UNP A;  2I5F A;  1MK7 B;  5D3V A;  1MAI A;  2IFS A;  2RVB B;  1B55 A;  2ROZ B;  1UEF A;  4PQ0 A;  3FM8 C;  2K00 A;  3PVL A;  3HSA A;  4HHV A;  2M14 A;  4HAV B;  3MDB C;  5C79 A;  3PSC A;  3GYO A;  1NTY A;  2Z13 A;  4DBB A;  2DX1 A;  2CY5 A;  4GPT B;  2COC A;  2DN6 A;  5J3Q A;  2Y7B A;  1X1G A;  4HAT B;  3KRW A;  5M4Y B;  4XWX A;  2DKP A;  5LG4 B;  2R0D A;  1ZYI A;  1U5F A;  3FSS A;  5C5B A;  1Q67 A;  3KY9 A;  1M7R A;  1DDW A;  2G35 A;  2J0J A;  1W1D A;  4PNK A;  5IRS A;  2DHK A;  1X1F A;  2NMB A;  3D8F A;  1J19 A;  2YS5 A;  1FOE A;  3OAN A;  1V5U A;  1SGH A;  3QIJ A;  1KZ7 A;  2GS0 A;  3SUZ A;  3HW2 B;  4IAP A;  3TCA A;  2EMS A;  4D0N B;  2DLW A;  3ODO A;  5JP4 A;  2VRW B;  3OHM B;  1LB1 A;  1QQG A;  3WYF B;  2LOZ A;  4KHA A;  2N23 A;  1ZVR A;  1DDV A;  2L2I A;  4QJ3 B;  1K5G B;  3NSU A;  2COF A;  1I2H A;  2CRF A;  4MT7 A;  4Z2N A;  4F7H A;  4F7G A;  3D8E A;  5FI0 A;  3ULB A;  4A5K A;  3O96 A;  1PFJ A;  1WJ1 A;  2UZR A;  4ZRJ A;  1Y19 B;  1BTN A;  3LJU X;  4H8S A;  3QWM A;  1W1H A;  1MKE A;  2YSZ A;  1UNQ A;  4CSQ A;  2Z0P A;  3PP2 A;  5KQ1 A;  2YT1 A;  2D2Q A;  2LYD A;  3SV1 A;  4DX9 0;  1EGX A;  2D9X A;  2GCL A;  4OSN A;  1XX0 A;  2K8E A;  2UVM A;  3ODW A;  2D9W A;  1WVH A;  4A6H A;  3FVC A;  1WGU A;  1Z87 A;  2ELB A;  2UZS A;  3P7Z A;  1DRO A;  1EAZ A;  5CLL B;  1FGZ A;  4HB2 B;  5LON B;  3TO1 A;  2K49 A;  4K2O A;  2QKL A;  3DCX A;  1U5D A;  2Z0Q A;  3D8D A;  2RGN B;  4YON A;  1T77 A;  2Q13 A;  2Z4D A;  2MFQ A;  1TQZ A;  2KGX B;  1M7E A;  3F5R A;  1AWE A;  1GC7 A;  4D6W A;  2D9V A;  3HK0 A;  2DTC A;  4HDO A;  2YVC A;  1AQC A;  3KRX A;  1FHO A;  1DBH A;  1FHX A;  3ZVR A;  3ML4 A;  4HAY B;  4EKU A;  2YT0 A;  2DKQ A;  1Y5O A;  1QC6 A;  2XQN M;  2YF0 A;  3NWD A;  5L81 A;  2R09 A;  3HQC A;  3U12 A;  3A58 A;  2D9Y A;  1SHC A;  2ADZ A;  4IFS A;  3TFM A;  2W2X D;  2KUP A;  4IOY X;  5GOW B;  2K2U A;  4KHB A;  4GOU A;  2VKI A;  2Y8F A;  5D3X A;  3A8Q A;  2D10 A;  4OT1 A;  5KCV A;  1DYN A;  1J0W A;  3TW1 A;  1GC6 A;  4ZRI A;  4DXA B;  5C6R A;  2L1C A;  2DHJ A;  3MPX A;  4QJ4 B;  3A8P A;  2DYQ A;  2YS3 A;  5C5B B;  1U29 A;  3F0W A;  3ODX A;  4K17 A;  5DIF B;  1N3H A;  1WG7 A;  1XD4 A;  2LUL A;  2YT2 A;  3PVW A;  4GN1 A;  3CXB B;  2RRF A;  4ZRK A;  4F7U P;  5I2S A;  1NU2 A;  2Z0O A;  4KAX B;  2HTH B;  2Z59 A;  1LW3 A;  4HAX B;  1ISN A;  5I2M A;  2AEH A;  1KZG A;  1E5W A;  2I5C A;  2LG1 A;  2MWN B;  4L1R A;  4A6F A;  1U27 A;  4CHJ A;  2CAY A;  4C0A A;  2COA A;  3AU4 A;  4DIX A;  1FAO A;  2W2W A;  1I7A A;  1DDM A;  2N0Y A;  2CY4 A;  5JHG A;  2P0D A;  1V89 A;  1XKE A;  2LOX A;  3VOQ A;  2RNR B;  3N7C A;  4QXA B;  1RRP B;  2KUQ A;  1XOD A;  3GYP A;  3BIN A;  1U5G A;  3KSY A;  3PZD A;  1MPH A;  3B77 A;  1MIX A;  1WI1 A;  1OY2 A;  3HIE A;  1W1G A;  2J0K A;  2J59 M;  2IYB A;  2KCJ A;  2RSG A;  3AU5 A;  1V5P A;  2V76 A;  1P5T A;  4K2P A;  3NWA A;  3NW8 A;  3BJI A;  5FI1 A;  1GG3 A;  3G9W A;  3NWF A;  3SO6 A;  1ZSQ A;  3U7D A;  1ZC4 B;  4GXB A;  3AJ4 A;  2J0M A;  3M1I B;  4CHM A;  3ZDT A;  5HE2 A;  1TJ6 A;  2P0H A;  4EJN A;  1OQN A;  3PEG A;  3CIK A;  5JHH A;  1ZC3 B;  1BTK A;  2OTX A;  1NTV A;  3DXE A;  1P3R A;  1V61 A;  2Y8G A;  2NZ8 B;  3A98 B;  4WSF A;  2BCJ A;  2FJL A;  4L6E A;  4MY6 A;  5J3Y A;  4GNK B;  5J3T A;  5C16 A;  1WJM A;  2OQB A;  2EMT A;  4HB0 B;  5LOP B;  5EFX A;  4Z2M B;  1MK9 B;  3VIA A;  2NBV A;  1EVH A;  2E2X A;  4HAZ B;  1XCG A;  1WGQ A;  4BBK A;  3QBV B;  2I1J A;  2GUM A;  4WVF B;  1H10 A;  1MIZ B;  4Y94 A;  3UZT A;  4P7I A;  4KHB B;  1KI1 B;  2DFK A;  2VSZ A;  5DI9 B;  1FB8 A;  2Z14 A;  1TXD A;  2JP2 A;  5KQ4 A;  2GJY A;  5DHA B;  1UPR A;  2ELA A;  2K2J A;  2YS1 A;  4NY0 A;  1UPQ A;  2QKM A;  5HE3 A;  2ZPY A;  2RUK B;  4KVG B;  4HB3 B;  5DH9 B;  3SNH A;  5D27 A;  2RLO A;  3KZ1 A;  1U2B A;  1H4R A;  4CYE A;  5D3W A;  3WA0 A;  2HE7 A;  2MDX A;  5JLJ B;  4HB4 B;  1P6S A;  1FHW A;  3P6A A;  2R2Y A;  5DHF B;  5HE0 A;  2DA0 A;  3DXD A;  4TYZ A;  4A6F B;  2P8V A;  4HAU B;  1FGY A;  2EC1 A;  2YRY A;  2EJ8 A;  4HDQ A;  2DHI A;  1PLS A;  2FJU B;  1IRS A;  3RCP A;  3PVU A;  4KHO A;  2H7E A;  4MK0 A;  1V5M A;  1X11 A;  3ULC A;  2X18 A;  4YL8 A;  3X23 A;  5D3Y A;  2PZ1 A;  1PMS A;  1K5D B;  2LKO A;  4K81 A;  4NSW A;  2KIE A;  2H7D A;  4GMX B;  5HE1 A;  1X86 A;  4HAW B;  2DYN A;  3DXC A;  3PG7 A;  3U8Z A;  4TKN A;  4QJ5 B;  1UNR A;  2M38 A;  3T06 A; 
#chains in the Genus database with same CATH homology
 4L1R A;  4KHO A;  3GYO A;  4KHB B;  2KIG A;  4DIX A;  4HSI A;  2Z13 A;  4Z2N A;  2ZKM X;  3HIE A;  3NWD A;  4QJ4 B;  3TVV A;  2Z4D A;  2GCL A;  4OSN A;  2K8E A;  2Z14 A;  3U12 A;  4GNK B;  3A58 A;  4IFS A;  3FVC A;  2KR0 A;  2R2Y A;  5M4Y B;  2YT2 A;  4IOY X;  2KIE A;  4D6W A;  4KHB A;  2KUQ A;  4PQ0 A;  4GOU A;  4QXA B;  4Z2M B;  5LG4 B;  2RRF A;  3OHM B;  1ZYI A;  3FSS A;  3GYP A;  5I2S A;  2NBV A;  2GCJ A;  4OT1 A;  4KHA A;  4QJ5 B;  3NWA A;  3NW8 A;  3TO1 A;  3TW1 A;  2FJU B;  2K49 A;  2GUM A;  2Z59 A;  4QJ3 B;  5I2M A;  3NWF A;  4CSQ A;  5IRS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...