2YT2A

Solution structure of the chimera of the ptb domain of snt-2 and 19-residue peptide (aa 1571-1589) of halk
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
153
structure length
153
Chain Sequence
GSSGSSGLNRDSVPDNHPTKFKVTNVDDEGVELGSGVMELTQSELVLHLHRREAVRWPYLCLRRYGYDSNLFSFESGRRCQTGQGIFAFKCSRAEEIFNLLQDLMQCNSINVMEEPVIITSGSSGSSGSSGSSGLFRLRHFPCGNVNYGYQQQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for the recognition of nucleophosmin-anaplastic lymphoma kinase oncoprotein by the phosphotyrosine binding domain of Suc1-associated neurotrophic factor-induced tyrosine-phosphorylated target-2
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords Fibroblast growth factor receptor substrate 3 and ALK tyrosi
total genus 16
structure length 153
sequence length 153
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2007-04-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02174 IRS PTB domain (IRS-1 type)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.250 Mainly Beta Roll PH-domain like PH-domain like 2yt2A00
2KUQA 2YT2A
chains in the Genus database with same CATH superfamily
2DTCA 2D4QA 1MAIA 5D3VA 2D9XA 1WGUA 1I2HA 1N3HA 3KSYA 4DXAB 1V88A 1K5GB 2DYNA 3D8FA 3TO1A 3PSCA 4QJ3B 5DHAB 1XODA 1AWEA 2D10A 1WJMA 3MDBC 1RRPB 5FI1A 2RGNB 4D0NB 2D9WA 1EF1A 2MKRA 4PQ0A 4K2PA 4GMXB 4CYEA 1P3RA 2ROVA 4IOYX 5CLQB 5C16A 2COFA 2RVBB 3D8DA 3U7DA 3FVCA 3SO6A 2N0YA 4KHAA 2IYBA 4Z2MB 5LOPB 1PLSA 2XQNM 1TQZA 2HTHB 2COCA 3B77A 2YT2A 1U5GA 4NSWA 1H10A 2Z13A 4WVFB 4PNKA 3ML4A 2P0HA 4K81A 4HAZB 2GS0A 2MWNB 3IVFA 5C6RA 5LG4B 2H7DA 1M7EA 4HDOA 2DKQA 4KHBB 3F0WA 3HK0A 3F5RA 4DX8A 2OTXA 3BJIA 1FGYA 1FHWA 4XWXA 1NI2A 1ZM0A 2LOXA 1FOEA 4F7GA 3BINA 1I7AA 1X1GA 2VKIA 5D27A 5D3YA 2DFKA 2YRYA 4ZRIA 4MY6A 2CY5A 2Z59A 4EJNA 4A5KA 2DX1A 2I5FA 3RCPA 2Y8GA 4HHVA 3KRWA 3DXDA 1MPHA 5J3TA 1E5WA 3HIEA 1SGHA 1OMWA 4GOUA 3CIKA 2QKLA 2KGXB 3TCAA 2CRFA 1K5DB 2K2JA 3NWAA 2M14A 1LW3A 5DH9B 4BBKA 2DHKA 3SV1A 4KAXB 2BCJA 2K2UA 1X11A 2GUMA 2PZ1A 5D3XA 2GJYA 2LYDA 1KZ7A 2V76A 2W2XD 5CLLB 1V5UA 3G9WA 2DLWA 3DXCA 1DDMA 1XKEA 4D6WA 3QWMA 3TVVA 1U5DA 1EAZA 2RLOA 2GCJA 1Z87A 2KIEA 3VOQA 5FI0A 1OY2A 2E2XA 3FSSA 3GYPA 4DBBA 4QXAB 5HE2A 5J3QA 5HE0A 1Q67A 2CAYA 3VIAA 1Y5OA 4B6HA 2D9YA 2W2XC 3A8PA 4ZRKA 5JLJB 1FAOA 2YVCA 1XD4A 4CHJA 3KRXA 1DROA 2L2IA 3HQCA 4NY0A 5JP4A 2ZPYA 5KCVA 5I2MA 4CHMA 3ULCA 1GC6A 1ZC4B 1BWNA 1TXDA 1OQNA 2IFSA 4TKNA 2NBVA 3PP2A 1DYNA 2UVMA 3T06A 2J0MA 2H7EA 1DDVA 2NZ8B 1WGQA 1BAKA 1U5EA 2R2YA 2K00A 2RSGA 5JHGA 2NMBA 5DIFB 1V5MA 1P5TA 2P0FA 3FM8C 1GG3A 2MFQA 3WA0A 2R09A 3OHMB 4F7HA 2DX5A 3DCXA 2X18A 2EMTA 2MDXA 4HB0B 5L81A 2HE7A 2Z0PA 4A6FA 3NWDA 4WSFA 1U29A 4L1RA 2D9ZA 3P6AA 2G35A 2D11A 1XR0B 4KVGB 1P6SA 2P8VA 1UPRA 4HB3B 4KHOA 1T77A 3PG7A 2KR0A 2ADZA 4EMOA 2GCLA 1GC7A 3A98B 3O96A 2ELAA 2YS3A 2Z0QA 4WJ7A 3MPXA 4MT7A 1NU2A 1WG7A 1DBHA 2YS1A 3UZTA 3ZDTA 2KCJA 5C79A 3GYOA 2CY4A 3HSAA 2L1CA 5LONB 3D8EA 3QIJA 2YT1A 4OSNA 4TYZA 2I1KA 1QQGA 3HW2B 2ROZB 2DN6A 3U12A 2P0DA 1W1HA 3TFMA 2K8EA 4EKUA 1U27A 1X86A 4MK0A 3U8ZA 4A6KA 4HB4B 1UNQA 2DHIA 3CXBB 3TW1A 2FJLA 4HATB 4ZRJA 4P7IA 2VSZA 3V5WA 2KUPA 4QJ5B 5M4YB 1H4RA 3FEHA 4HB2B 5D3WA 4IAPA 1ISNA 2J59M 2D9VA 3ZVRA 4C0AA 1TJ6A 2W2WA 1UPQA 4GN1A 4Z2NA 2Y8FA 4A6FB 1WVHA 4HAYB 1UEFA 3ULBA 3WYFB 5C5BA 2JP2A 1BTNA 3M1IB 4K17A 5HE1A 1J19A 1MIZB 1EVHA 2RRFA 2LKOA 1PFJA 3PVUA 1MI1A 4IFSA 4GPTB 2DKPA 1X1FA 5DHFB 3LJUX 2Z4DA 1MK9B 2KUQA 2UZRA 2EMSA 2D2QA 2VRWB 1UNPA 2UZSA 1KI1B 2YSZA 2COAA 3AU4A 1FHXA 2YS5A 2YT0A 2Z0OA 1ZYIA 4QJ4B 3PZDA 3SUZA 3SNHA 3X23A 1QC6A 2EJ8A 1SHCA 2R0DA 2LG1A 4HAUB 3DXEA 5EFXA 1FB8A 4GXBA 2K49A 2YF0A 1AQCA 4GMVA 1FHOA 4HDQA 1MKEA 4L6EA 1DDWA 2RNRB 2EC1A 1ZSQA 2DHJA 2QKMA 1EGXA 2I1JA 1Y19B 3AJ4A 2N23A 3NW8A 2Y7BA 3PEGA 5JHHA 4DX90 1PMSA 5IRSA 1W1GA 1ZVRA 3NSUA 3ODOA 3QBVB 4CSQA 5C5BB 4HSIA 2LOZA 1U5FA 2J0JA 3OANA 3ODXA 4HAVB 4GNKB 1J0WA 1MIXA 3KZ1A 1NTYA 1IRSA 1X05A 1RJ2A 4YL8A 2DYQA 3A58A 3A8QA 4HAWB 1V89A 3ODWA 1M7RA 5KQ4A 4A6HA 3PVWA 5DI9B 1UNRA 2OQBA 2I5CA 2RUKB 4GZUA 2AL6A 2ELBA 5HE3A 1W1DA 2Q13A 3SYXA 1WI1A 3P7ZA 4F7UP 3N7CA 5J3YA 3PVLA 1XX0A 3KY9A 4OT1A 5GOWB 1WJ1A 2FJUB 4YONA 2ZKMX 1NTVA 1KZGA 4K2OA 2DA0A 2KIGA 3AU5A 3NWFA 5KQ1A 2LULA 2M38A 1BTKA 1ZC3B 2AEHA 4DIXA 4KHBA 4H8SA 2CODA 1U2BA 1LB1A 4HAXB 1FGZA 2J0KA 1B55A 1XCGA 1V61A 2Z14A 5I2SA 4Y94A 1MK7B 1V5PA
chains in the Genus database with same CATH topology
2K8EA 2Z13A 2KIGA 4L1RA 5IRSA 2GUMA 4PQ0A 3NWFA 2NBVA 2Z4DA 4Z2NA 2Z59A 4CSQA 2KUQA 5LG4B 4KHOA 2K49A 3TW1A 3GYOA 4KHBB 4HSIA 4IOYX 2R2YA 4DIXA 4KHBA 2KR0A 3FVCA 4OT1A 3HIEA 4QJ5B 4GNKB 4D6WA 5M4YB 3TVVA 3TO1A 2GCLA 2GCJA 4OSNA 4GOUA 4KHAA 4QJ3B 2FJUB 1ZYIA 3OHMB 4Z2MB 2ZKMX 2KIEA 2Z14A 3A58A 3NW8A 4QJ4B 5I2MA 2RRFA 5I2SA 2YT2A 3FSSA 3GYPA 3NWAA 3U12A 4IFSA 3NWDA 4QXAB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KUQ A;  2YT2 A; 
#chains in the Genus database with same CATH topology
 2DTC A;  2D4Q A;  1MAI A;  5D3V A;  2D9X A;  1WGU A;  1I2H A;  1N3H A;  3KSY A;  4DXA B;  1V88 A;  1K5G B;  2DYN A;  3D8F A;  3TO1 A;  3PSC A;  4QJ3 B;  5DHA B;  1XOD A;  1AWE A;  2D10 A;  1WJM A;  3MDB C;  1RRP B;  5FI1 A;  2RGN B;  4D0N B;  2D9W A;  1EF1 A;  2MKR A;  4PQ0 A;  4K2P A;  4GMX B;  4CYE A;  1P3R A;  2ROV A;  4IOY X;  5CLQ B;  5C16 A;  2COF A;  2RVB B;  3D8D A;  3U7D A;  3FVC A;  3SO6 A;  2N0Y A;  4KHA A;  2IYB A;  4Z2M B;  5LOP B;  1PLS A;  2XQN M;  1TQZ A;  2HTH B;  2COC A;  3B77 A;  2YT2 A;  1U5G A;  4NSW A;  1H10 A;  2Z13 A;  4WVF B;  4PNK A;  3ML4 A;  2P0H A;  4K81 A;  4HAZ B;  2GS0 A;  2MWN B;  3IVF A;  5C6R A;  5LG4 B;  2H7D A;  1M7E A;  4HDO A;  2DKQ A;  4KHB B;  3F0W A;  3HK0 A;  3F5R A;  4DX8 A;  2OTX A;  3BJI A;  1FGY A;  1FHW A;  4XWX A;  1NI2 A;  1ZM0 A;  2LOX A;  1FOE A;  4F7G A;  3BIN A;  1I7A A;  1X1G A;  2VKI A;  5D27 A;  5D3Y A;  2DFK A;  2YRY A;  4ZRI A;  4MY6 A;  2CY5 A;  2Z59 A;  4EJN A;  4A5K A;  2DX1 A;  2I5F A;  3RCP A;  2Y8G A;  4HHV A;  3KRW A;  3DXD A;  1MPH A;  5J3T A;  1E5W A;  3HIE A;  1SGH A;  1OMW A;  4GOU A;  3CIK A;  2QKL A;  2KGX B;  3TCA A;  2CRF A;  1K5D B;  2K2J A;  3NWA A;  2M14 A;  1LW3 A;  5DH9 B;  4BBK A;  2DHK A;  3SV1 A;  4KAX B;  2BCJ A;  2K2U A;  1X11 A;  2GUM A;  2PZ1 A;  5D3X A;  2GJY A;  2LYD A;  1KZ7 A;  2V76 A;  2W2X D;  5CLL B;  1V5U A;  3G9W A;  2DLW A;  3DXC A;  1DDM A;  1XKE A;  4D6W A;  3QWM A;  3TVV A;  1U5D A;  1EAZ A;  2RLO A;  2GCJ A;  1Z87 A;  2KIE A;  3VOQ A;  5FI0 A;  1OY2 A;  2E2X A;  3FSS A;  3GYP A;  4DBB A;  4QXA B;  5HE2 A;  5J3Q A;  5HE0 A;  1Q67 A;  2CAY A;  3VIA A;  1Y5O A;  4B6H A;  2D9Y A;  2W2X C;  3A8P A;  4ZRK A;  5JLJ B;  1FAO A;  2YVC A;  1XD4 A;  4CHJ A;  3KRX A;  1DRO A;  2L2I A;  3HQC A;  4NY0 A;  5JP4 A;  2ZPY A;  5KCV A;  5I2M A;  4CHM A;  3ULC A;  1GC6 A;  1ZC4 B;  1BWN A;  1TXD A;  1OQN A;  2IFS A;  4TKN A;  2NBV A;  3PP2 A;  1DYN A;  2UVM A;  3T06 A;  2J0M A;  2H7E A;  1DDV A;  2NZ8 B;  1WGQ A;  1BAK A;  1U5E A;  2R2Y A;  2K00 A;  2RSG A;  5JHG A;  2NMB A;  5DIF B;  1V5M A;  1P5T A;  2P0F A;  3FM8 C;  1GG3 A;  2MFQ A;  3WA0 A;  2R09 A;  3OHM B;  4F7H A;  2DX5 A;  3DCX A;  2X18 A;  2EMT A;  2MDX A;  4HB0 B;  5L81 A;  2HE7 A;  2Z0P A;  4A6F A;  3NWD A;  4WSF A;  1U29 A;  4L1R A;  2D9Z A;  3P6A A;  2G35 A;  2D11 A;  1XR0 B;  4KVG B;  1P6S A;  2P8V A;  1UPR A;  4HB3 B;  4KHO A;  1T77 A;  3PG7 A;  2KR0 A;  2ADZ A;  4EMO A;  2GCL A;  1GC7 A;  3A98 B;  3O96 A;  2ELA A;  2YS3 A;  2Z0Q A;  4WJ7 A;  3MPX A;  4MT7 A;  1NU2 A;  1WG7 A;  1DBH A;  2YS1 A;  3UZT A;  3ZDT A;  2KCJ A;  5C79 A;  3GYO A;  2CY4 A;  3HSA A;  2L1C A;  5LON B;  3D8E A;  3QIJ A;  2YT1 A;  4OSN A;  4TYZ A;  2I1K A;  1QQG A;  3HW2 B;  2ROZ B;  2DN6 A;  3U12 A;  2P0D A;  1W1H A;  3TFM A;  2K8E A;  4EKU A;  1U27 A;  1X86 A;  4MK0 A;  3U8Z A;  4A6K A;  4HB4 B;  1UNQ A;  2DHI A;  3CXB B;  3TW1 A;  2FJL A;  4HAT B;  4ZRJ A;  4P7I A;  2VSZ A;  3V5W A;  2KUP A;  4QJ5 B;  5M4Y B;  1H4R A;  3FEH A;  4HB2 B;  5D3W A;  4IAP A;  1ISN A;  2J59 M;  2D9V A;  3ZVR A;  4C0A A;  1TJ6 A;  2W2W A;  1UPQ A;  4GN1 A;  4Z2N A;  2Y8F A;  4A6F B;  1WVH A;  4HAY B;  1UEF A;  3ULB A;  3WYF B;  5C5B A;  2JP2 A;  1BTN A;  3M1I B;  4K17 A;  5HE1 A;  1J19 A;  1MIZ B;  1EVH A;  2RRF A;  2LKO A;  1PFJ A;  3PVU A;  1MI1 A;  4IFS A;  4GPT B;  2DKP A;  1X1F A;  5DHF B;  3LJU X;  2Z4D A;  1MK9 B;  2KUQ A;  2UZR A;  2EMS A;  2D2Q A;  2VRW B;  1UNP A;  2UZS A;  1KI1 B;  2YSZ A;  2COA A;  3AU4 A;  1FHX A;  2YS5 A;  2YT0 A;  2Z0O A;  1ZYI A;  4QJ4 B;  3PZD A;  3SUZ A;  3SNH A;  3X23 A;  1QC6 A;  2EJ8 A;  1SHC A;  2R0D A;  2LG1 A;  4HAU B;  3DXE A;  5EFX A;  1FB8 A;  4GXB A;  2K49 A;  2YF0 A;  1AQC A;  4GMV A;  1FHO A;  4HDQ A;  1MKE A;  4L6E A;  1DDW A;  2RNR B;  2EC1 A;  1ZSQ A;  2DHJ A;  2QKM A;  1EGX A;  2I1J A;  1Y19 B;  3AJ4 A;  2N23 A;  3NW8 A;  2Y7B A;  3PEG A;  5JHH A;  4DX9 0;  1PMS A;  5IRS A;  1W1G A;  1ZVR A;  3NSU A;  3ODO A;  3QBV B;  4CSQ A;  5C5B B;  4HSI A;  2LOZ A;  1U5F A;  2J0J A;  3OAN A;  3ODX A;  4HAV B;  4GNK B;  1J0W A;  1MIX A;  3KZ1 A;  1NTY A;  1IRS A;  1X05 A;  1RJ2 A;  4YL8 A;  2DYQ A;  3A58 A;  3A8Q A;  4HAW B;  1V89 A;  3ODW A;  1M7R A;  5KQ4 A;  4A6H A;  3PVW A;  5DI9 B;  1UNR A;  2OQB A;  2I5C A;  2RUK B;  4GZU A;  2AL6 A;  2ELB A;  5HE3 A;  1W1D A;  2Q13 A;  3SYX A;  1WI1 A;  3P7Z A;  4F7U P;  3N7C A;  5J3Y A;  3PVL A;  1XX0 A;  3KY9 A;  4OT1 A;  5GOW B;  1WJ1 A;  2FJU B;  4YON A;  2ZKM X;  1NTV A;  1KZG A;  4K2O A;  2DA0 A;  2KIG A;  3AU5 A;  3NWF A;  5KQ1 A;  2LUL A;  2M38 A;  1BTK A;  1ZC3 B;  2AEH A;  4DIX A;  4KHB A;  4H8S A;  2COD A;  1U2B A;  1LB1 A;  4HAX B;  1FGZ A;  2J0K A;  1B55 A;  1XCG A;  1V61 A;  2Z14 A;  5I2S A;  4Y94 A;  1MK7 B;  1V5P A; 
#chains in the Genus database with same CATH homology
 2K8E A;  2Z13 A;  2KIG A;  4L1R A;  5IRS A;  2GUM A;  4PQ0 A;  3NWF A;  2NBV A;  2Z4D A;  4Z2N A;  2Z59 A;  4CSQ A;  2KUQ A;  5LG4 B;  4KHO A;  2K49 A;  3TW1 A;  3GYO A;  4KHB B;  4HSI A;  4IOY X;  2R2Y A;  4DIX A;  4KHB A;  2KR0 A;  3FVC A;  4OT1 A;  3HIE A;  4QJ5 B;  4GNK B;  4D6W A;  5M4Y B;  3TVV A;  3TO1 A;  2GCL A;  2GCJ A;  4OSN A;  4GOU A;  4KHA A;  4QJ3 B;  2FJU B;  1ZYI A;  3OHM B;  4Z2M B;  2ZKM X;  2KIE A;  2Z14 A;  3A58 A;  3NW8 A;  4QJ4 B;  5I2M A;  2RRF A;  5I2S A;  2YT2 A;  3FSS A;  3GYP A;  3NWA A;  3U12 A;  4IFS A;  3NWD A;  4QXA B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...