2YT2A

Solution structure of the chimera of the ptb domain of snt-2 and 19-residue peptide (aa 1571-1589) of halk
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
153
structure length
153
Chain Sequence
b'GSSGSSGLNRDSVPDNHPTKFKVTNVDDEGVELGSGVMELTQSELVLHLHRREAVRWPYLCLRRYGYDSNLFSFESGRRCQTGQGIFAFKCSRAEEIFNLLQDLMQCNSINVMEEPVIITSGSSGSSGSSGSSGLFRLRHFPCGNVNYGYQQQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fibroblast growth factor receptor substrate 3 and ALK tyrosi
publication title Structural basis for the recognition of nucleophosmin-anaplastic lymphoma kinase oncoprotein by the phosphotyrosine binding domain of Suc1-associated neurotrophic factor-induced tyrosine-phosphorylated target-2
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 16
structure length 153
sequence length 153
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2007-04-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02174 IRS PTB domain (IRS-1 type)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.250 Mainly Beta Roll PH-domain like PH-domain like 2yt2A00
2KUQA 2YT2A
chains in the Genus database with same CATH superfamily
4H8SA 2J59M 4IFSA 4CHJA 2Y7BA 4KHBA 3TO1A 3GYPA 5D3YA 4ZRKA 1RRPB 1ZC3B 5I2MA 1OY2A 4TYZA 4L6EA 1SGHA 2EMTA 3CIKA 3QIJA 2K00A 3KRWA 4MK0A 5CLLB 4CYEA 2Q13A 1DYNA 1WGQA 4PQ0A 1MIZB 2D9VA 4K81A 2KIEA 2LOZA 3N7CA 2E2XA 2BCJA 3HK0A 1Q67A 4A6FA 4A6KA 3D8EA 3A8PA 4QJ5B 1B55A 4HAXB 1WJMA 1U5EA 4QXAB 3D8FA 1P5TA 2UZRA 1V61A 2P0DA 2KCJA 1MI1A 1H4RA 1UPQA 2EJ8A 2EMSA 4GOUA 1KZ7A 1H10A 2ROVA 1I7AA 1FHOA 4XWXA 1NU2A 2RRFA 1Y19B 2AEHA 2L2IA 4HAUB 1U5FA 5M4YB 2M14A 3ODXA 4D6WA 3OANA 1WG7A 2Z4DA 1SHCA 2DHIA 3BINA 4EMOA 4GZUA 2DX1A 2MDXA 1AQCA 2OTXA 3SO6A 4KHOA 1I2HA 3A8QA 1X05A 3A58A 3TFMA 1MAIA 2K49A 3KSYA 4BBKA 3CXBB 4K2PA 2IFSA 3PP2A 1Z87A 1TXDA 2LKOA 3ULBA 3AU4A 3DCXA 4HB0B 2MKRA 5KQ4A 2Z0QA 5KQ1A 4YL8A 5D3VA 1FOEA 3PVLA 3ULCA 5JP4A 2YT2A 3ZVRA 3U7DA 1DDMA 2CAYA 1WJ1A 1XD4A 2H7EA 2NZ8B 1QC6A 2P8VA 2DHKA 5KCVA 2ADZA 2W2WA 2LULA 2DLWA 1X11A 4DX8A 2COCA 3VOQA 3PZDA 2Y8GA 5GOWB 1PFJA 4C0AA 3P7ZA 4YONA 2D2QA 2GJYA 3NWAA 2J0KA 1U27A 5HE2A 3OHMB 4DIXA 1V5PA 4DX90 2DTCA 2R09A 1WI1A 1LB1A 1EAZA 3QWMA 2KR0A 2YS1A 1UNQA 3ODWA 4HATB 1XKEA 4DXAB 2KUQA 1PLSA 1XODA 1KZGA 3HQCA 1ZYIA 5LG4B 3DXDA 2N0YA 3SYXA 2K8EA 3FVCA 1WGUA 2LOXA 2D4QA 2J0MA 4K17A 3TW1A 2W2XD 2QKMA 1V89A 3TVVA 4MY6A 3B77A 3RCPA 2IYBA 1FHWA 1BWNA 2ELAA 4Z2MB 3TCAA 1WVHA 1KI1B 2YT0A 2EC1A 2UVMA 1U5DA 4IAPA 5J3TA 3PSCA 4HAVB 5C16A 2K2JA 2I1KA 3NWDA 2K2UA 5L81A 1MK7B 5LONB 4GPTB 2M38A 5HE1A 4B6HA 1FAOA 4WJ7A 2RSGA 1K5GB 2D9YA 3LJUX 2YT1A 3PEGA 4GMVA 2Z0OA 2ZPYA 4Y94A 1W1DA 2RUKB 2PZ1A 2V76A 4NSWA 4CHMA 5C79A 1DDWA 5DI9B 2AL6A 1PMSA 2UZSA 5DIFB 2H7DA 1GG3A 1X86A 2G35A 2I5CA 5DHFB 4ZRJA 3WYFB 3NSUA 3U12A 1AWEA 1GC6A 1ZVRA 2HTHB 2YS5A 1FGZA 2D9ZA 4HDQA 2OQBA 2YSZA 4GNKB 2D11A 3PVUA 4A6HA 4HAWB 4HHVA 2RNRB 5D3WA 1V5UA 2YRYA 3F5RA 2KIGA 4MT7A 4P7IA 1UPRA 5DHAB 4QJ4B 1P6SA 5JHHA 4A6FB 5C6RA 2CODA 2DA0A 2R2YA 4QJ3B 1MK9B 1X1FA 1E5WA 1TQZA 2J0JA 1OQNA 2GCJA 2DN6A 2QKLA 2FJUB 2P0FA 1FGYA 2VRWB 1UNPA 3O96A 1N3HA 2Z0PA 4NY0A 5CLQB 3AU5A 3FSSA 3IVFA 2RLOA 4HB3B 3NW8A 1ZC4B 4Z2NA 5IRSA 2DHJA 1IRSA 3KZ1A 1Y5OA 2DFKA 1W1HA 2I1JA 1V88A 3P6AA 3PG7A 3DXCA 3SUZA 4OSNA 5D27A 3V5WA 2W2XC 4OT1A 4PNKA 2GUMA 1EGXA 2NMBA 2DYQA 2LYDA 4HAZB 4WSFA 2DYNA 1LW3A 4A5KA 2COAA 5FI1A 1DROA 5LOPB 1DBHA 3A98B 2I5FA 4CSQA 2DKPA 1UNRA 3FEHA 5JHGA 1P3RA 2Z14A 4HDOA 5HE0A 5JLJB 2YS3A 3AJ4A 1NTVA 2MFQA 3M1IB 2RVBB 1NTYA 1K5DB 4HB2B 2VSZA 5C5BB 2Z13A 3T06A 3FM8C 4IOYX 5D3XA 4GN1A 3HIEA 3UZTA 1ZSQA 2JP2A 3U8ZA 1T77A 2XQNM 2YVCA 2D10A 4L1RA 1OMWA 4F7HA 4EKUA 2YF0A 3F0WA 1M7RA 1U29A 1BTNA 2DKQA 1ZM0A 1MIXA 2R0DA 2ROZB 1X1GA 2Z59A 4HB4B 3ODOA 3VIAA 1RJ2A 2FJLA 5HE3A 1UEFA 1ISNA 2NBVA 2CRFA 4F7UP 3SV1A 1J19A 3GYOA 2RGNB 2CY4A 1DDVA 1XR0B 1MPHA 3QBVB 5J3QA 4TKNA 4D0NB 4KHBB 2HE7A 2ELBA 5I2SA 3HW2B 1XCGA 3SNHA 1M7EA 1U5GA 2P0HA 4HSIA 3NWFA 3G9WA 3ZDTA 4KVGB 1BTKA 1U2BA 2N23A 3MDBC 4GMXB 3BJIA 1NI2A 5C5BA 4WVFB 2D9XA 2X18A 1V5MA 2COFA 3MPXA 1XX0A 1MKEA 1FHXA 2LG1A 3ML4A 2KUPA 2VKIA 4KAXB 2KGXB 1QQGA 4EJNA 1EVHA 3D8DA 5FI0A 2GS0A 5DH9B 1EF1A 3HSAA 1FB8A 5J3YA 2L1CA 1W1GA 2ZKMX 1TJ6A 3X23A 4KHAA 1J0WA 4F7GA 4K2OA 2MWNB 3KRXA 4DBBA 1BAKA 3DXEA 3PVWA 4ZRIA 3KY9A 4HAYB 3WA0A 2D9WA 2CY5A 2DX5A 5EFXA 2Y8FA 2GCLA 1GC7A 4GXBA
chains in the Genus database with same CATH topology
2RRFA 4QJ5B 4IFSA 3OHMB 2NBVA 4KHBA 3TO1A 4DIXA 3HIEA 4QXAB 3GYPA 5M4YB 2K8EA 3FVCA 3U12A 3GYOA 2KIGA 3NWDA 5I2MA 4OSNA 4D6WA 2Z14A 2ZKMX 4QJ4B 2Z4DA 4KHAA 4L1RA 2R2YA 4OT1A 4QJ3B 3TW1A 2GUMA 2KR0A 4KHBB 3TVVA 2GCJA 2YT2A 4GNKB 4PQ0A 2FJUB 4KHOA 5I2SA 5IRSA 4GOUA 3A58A 2Z59A 2KIEA 2KUQA 2K49A 4Z2MB 2Z13A 4HSIA 3FSSA 3NWFA 3NWAA 4IOYX 1ZYIA 2GCLA 5LG4B 3NW8A 4CSQA 4Z2NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KUQ A;  2YT2 A; 
#chains in the Genus database with same CATH topology
 4H8S A;  2J59 M;  4IFS A;  4CHJ A;  2Y7B A;  4KHB A;  3TO1 A;  3GYP A;  5D3Y A;  4ZRK A;  1RRP B;  1ZC3 B;  5I2M A;  1OY2 A;  4TYZ A;  4L6E A;  1SGH A;  2EMT A;  3CIK A;  3QIJ A;  2K00 A;  3KRW A;  4MK0 A;  5CLL B;  4CYE A;  2Q13 A;  1DYN A;  1WGQ A;  4PQ0 A;  1MIZ B;  2D9V A;  4K81 A;  2KIE A;  2LOZ A;  3N7C A;  2E2X A;  2BCJ A;  3HK0 A;  1Q67 A;  4A6F A;  4A6K A;  3D8E A;  3A8P A;  4QJ5 B;  1B55 A;  4HAX B;  1WJM A;  1U5E A;  4QXA B;  3D8F A;  1P5T A;  2UZR A;  1V61 A;  2P0D A;  2KCJ A;  1MI1 A;  1H4R A;  1UPQ A;  2EJ8 A;  2EMS A;  4GOU A;  1KZ7 A;  1H10 A;  2ROV A;  1I7A A;  1FHO A;  4XWX A;  1NU2 A;  2RRF A;  1Y19 B;  2AEH A;  2L2I A;  4HAU B;  1U5F A;  5M4Y B;  2M14 A;  3ODX A;  4D6W A;  3OAN A;  1WG7 A;  2Z4D A;  1SHC A;  2DHI A;  3BIN A;  4EMO A;  4GZU A;  2DX1 A;  2MDX A;  1AQC A;  2OTX A;  3SO6 A;  4KHO A;  1I2H A;  3A8Q A;  1X05 A;  3A58 A;  3TFM A;  1MAI A;  2K49 A;  3KSY A;  4BBK A;  3CXB B;  4K2P A;  2IFS A;  3PP2 A;  1Z87 A;  1TXD A;  2LKO A;  3ULB A;  3AU4 A;  3DCX A;  4HB0 B;  2MKR A;  5KQ4 A;  2Z0Q A;  5KQ1 A;  4YL8 A;  5D3V A;  1FOE A;  3PVL A;  3ULC A;  5JP4 A;  2YT2 A;  3ZVR A;  3U7D A;  1DDM A;  2CAY A;  1WJ1 A;  1XD4 A;  2H7E A;  2NZ8 B;  1QC6 A;  2P8V A;  2DHK A;  5KCV A;  2ADZ A;  2W2W A;  2LUL A;  2DLW A;  1X11 A;  4DX8 A;  2COC A;  3VOQ A;  3PZD A;  2Y8G A;  5GOW B;  1PFJ A;  4C0A A;  3P7Z A;  4YON A;  2D2Q A;  2GJY A;  3NWA A;  2J0K A;  1U27 A;  5HE2 A;  3OHM B;  4DIX A;  1V5P A;  4DX9 0;  2DTC A;  2R09 A;  1WI1 A;  1LB1 A;  1EAZ A;  3QWM A;  2KR0 A;  2YS1 A;  1UNQ A;  3ODW A;  4HAT B;  1XKE A;  4DXA B;  2KUQ A;  1PLS A;  1XOD A;  1KZG A;  3HQC A;  1ZYI A;  5LG4 B;  3DXD A;  2N0Y A;  3SYX A;  2K8E A;  3FVC A;  1WGU A;  2LOX A;  2D4Q A;  2J0M A;  4K17 A;  3TW1 A;  2W2X D;  2QKM A;  1V89 A;  3TVV A;  4MY6 A;  3B77 A;  3RCP A;  2IYB A;  1FHW A;  1BWN A;  2ELA A;  4Z2M B;  3TCA A;  1WVH A;  1KI1 B;  2YT0 A;  2EC1 A;  2UVM A;  1U5D A;  4IAP A;  5J3T A;  3PSC A;  4HAV B;  5C16 A;  2K2J A;  2I1K A;  3NWD A;  2K2U A;  5L81 A;  1MK7 B;  5LON B;  4GPT B;  2M38 A;  5HE1 A;  4B6H A;  1FAO A;  4WJ7 A;  2RSG A;  1K5G B;  2D9Y A;  3LJU X;  2YT1 A;  3PEG A;  4GMV A;  2Z0O A;  2ZPY A;  4Y94 A;  1W1D A;  2RUK B;  2PZ1 A;  2V76 A;  4NSW A;  4CHM A;  5C79 A;  1DDW A;  5DI9 B;  2AL6 A;  1PMS A;  2UZS A;  5DIF B;  2H7D A;  1GG3 A;  1X86 A;  2G35 A;  2I5C A;  5DHF B;  4ZRJ A;  3WYF B;  3NSU A;  3U12 A;  1AWE A;  1GC6 A;  1ZVR A;  2HTH B;  2YS5 A;  1FGZ A;  2D9Z A;  4HDQ A;  2OQB A;  2YSZ A;  4GNK B;  2D11 A;  3PVU A;  4A6H A;  4HAW B;  4HHV A;  2RNR B;  5D3W A;  1V5U A;  2YRY A;  3F5R A;  2KIG A;  4MT7 A;  4P7I A;  1UPR A;  5DHA B;  4QJ4 B;  1P6S A;  5JHH A;  4A6F B;  5C6R A;  2COD A;  2DA0 A;  2R2Y A;  4QJ3 B;  1MK9 B;  1X1F A;  1E5W A;  1TQZ A;  2J0J A;  1OQN A;  2GCJ A;  2DN6 A;  2QKL A;  2FJU B;  2P0F A;  1FGY A;  2VRW B;  1UNP A;  3O96 A;  1N3H A;  2Z0P A;  4NY0 A;  5CLQ B;  3AU5 A;  3FSS A;  3IVF A;  2RLO A;  4HB3 B;  3NW8 A;  1ZC4 B;  4Z2N A;  5IRS A;  2DHJ A;  1IRS A;  3KZ1 A;  1Y5O A;  2DFK A;  1W1H A;  2I1J A;  1V88 A;  3P6A A;  3PG7 A;  3DXC A;  3SUZ A;  4OSN A;  5D27 A;  3V5W A;  2W2X C;  4OT1 A;  4PNK A;  2GUM A;  1EGX A;  2NMB A;  2DYQ A;  2LYD A;  4HAZ B;  4WSF A;  2DYN A;  1LW3 A;  4A5K A;  2COA A;  5FI1 A;  1DRO A;  5LOP B;  1DBH A;  3A98 B;  2I5F A;  4CSQ A;  2DKP A;  1UNR A;  3FEH A;  5JHG A;  1P3R A;  2Z14 A;  4HDO A;  5HE0 A;  5JLJ B;  2YS3 A;  3AJ4 A;  1NTV A;  2MFQ A;  3M1I B;  2RVB B;  1NTY A;  1K5D B;  4HB2 B;  2VSZ A;  5C5B B;  2Z13 A;  3T06 A;  3FM8 C;  4IOY X;  5D3X A;  4GN1 A;  3HIE A;  3UZT A;  1ZSQ A;  2JP2 A;  3U8Z A;  1T77 A;  2XQN M;  2YVC A;  2D10 A;  4L1R A;  1OMW A;  4F7H A;  4EKU A;  2YF0 A;  3F0W A;  1M7R A;  1U29 A;  1BTN A;  2DKQ A;  1ZM0 A;  1MIX A;  2R0D A;  2ROZ B;  1X1G A;  2Z59 A;  4HB4 B;  3ODO A;  3VIA A;  1RJ2 A;  2FJL A;  5HE3 A;  1UEF A;  1ISN A;  2NBV A;  2CRF A;  4F7U P;  3SV1 A;  1J19 A;  3GYO A;  2RGN B;  2CY4 A;  1DDV A;  1XR0 B;  1MPH A;  3QBV B;  5J3Q A;  4TKN A;  4D0N B;  4KHB B;  2HE7 A;  2ELB A;  5I2S A;  3HW2 B;  1XCG A;  3SNH A;  1M7E A;  1U5G A;  2P0H A;  4HSI A;  3NWF A;  3G9W A;  3ZDT A;  4KVG B;  1BTK A;  1U2B A;  2N23 A;  3MDB C;  4GMX B;  3BJI A;  1NI2 A;  5C5B A;  4WVF B;  2D9X A;  2X18 A;  1V5M A;  2COF A;  3MPX A;  1XX0 A;  1MKE A;  1FHX A;  2LG1 A;  3ML4 A;  2KUP A;  2VKI A;  4KAX B;  2KGX B;  1QQG A;  4EJN A;  1EVH A;  3D8D A;  5FI0 A;  2GS0 A;  5DH9 B;  1EF1 A;  3HSA A;  1FB8 A;  5J3Y A;  2L1C A;  1W1G A;  2ZKM X;  1TJ6 A;  3X23 A;  4KHA A;  1J0W A;  4F7G A;  4K2O A;  2MWN B;  3KRX A;  4DBB A;  1BAK A;  3DXE A;  3PVW A;  4ZRI A;  3KY9 A;  4HAY B;  3WA0 A;  2D9W A;  2CY5 A;  2DX5 A;  5EFX A;  2Y8F A;  2GCL A;  1GC7 A;  4GXB A; 
#chains in the Genus database with same CATH homology
 2RRF A;  4QJ5 B;  4IFS A;  3OHM B;  2NBV A;  4KHB A;  3TO1 A;  4DIX A;  3HIE A;  4QXA B;  3GYP A;  5M4Y B;  2K8E A;  3FVC A;  3U12 A;  3GYO A;  2KIG A;  3NWD A;  5I2M A;  4OSN A;  4D6W A;  2Z14 A;  2ZKM X;  4QJ4 B;  2Z4D A;  4KHA A;  4L1R A;  2R2Y A;  4OT1 A;  4QJ3 B;  3TW1 A;  2GUM A;  2KR0 A;  4KHB B;  3TVV A;  2GCJ A;  2YT2 A;  4GNK B;  4PQ0 A;  2FJU B;  4KHO A;  5I2S A;  5IRS A;  4GOU A;  3A58 A;  2Z59 A;  2KIE A;  2KUQ A;  2K49 A;  4Z2M B;  2Z13 A;  4HSI A;  3FSS A;  3NWF A;  3NWA A;  4IOY X;  1ZYI A;  2GCL A;  5LG4 B;  3NW8 A;  4CSQ A;  4Z2N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...