2YT2A

Solution structure of the chimera of the ptb domain of snt-2 and 19-residue peptide (aa 1571-1589) of halk
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
153
structure length
153
Chain Sequence
GSSGSSGLNRDSVPDNHPTKFKVTNVDDEGVELGSGVMELTQSELVLHLHRREAVRWPYLCLRRYGYDSNLFSFESGRRCQTGQGIFAFKCSRAEEIFNLLQDLMQCNSINVMEEPVIITSGSSGSSGSSGSSGLFRLRHFPCGNVNYGYQQQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords Fibroblast growth factor receptor substrate 3 and ALK tyrosi
publication title Structural basis for the recognition of nucleophosmin-anaplastic lymphoma kinase oncoprotein by the phosphotyrosine binding domain of Suc1-associated neurotrophic factor-induced tyrosine-phosphorylated target-2
pubmed doi rcsb
source organism Homo sapiens
total genus 16
structure length 153
sequence length 153
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2007-04-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02174 IRS PTB domain (IRS-1 type)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.250 Mainly Beta Roll PH-domain like PH-domain like 2yt2A00
2KUQA 2YT2A
chains in the Genus database with same CATH superfamily
5CLLB 1EAZA 1M7RA 2J59M 2J0MA 2Z59A 1DDWA 4B6HA 2MDXA 3IVFA 2LULA 2DHKA 2DFKA 1XD4A 3D8EA 4Z2NA 4DIXA 4HAYB 2EJ8A 4HAVB 5DH9B 3G9WA 1MK7B 1V89A 3DCXA 1RRPB 4KHBA 2RVBB 4HB0B 4L6EA 3KZ1A 1ZC3B 4K17A 2DLWA 2UZSA 2IYBA 4OSNA 1ISNA 1XX0A 5J3QA 4K81A 1XODA 2CODA 2ELAA 4HDQA 4F7HA 3D8FA 3GYOA 5D3XA 3A8QA 3V5WA 3BJIA 5KQ1A 3DXEA 3TCAA 1U29A 1QQGA 1EF1A 2K00A 1WJ1A 3QIJA 2J0JA 2BCJA 2KR0A 5J3TA 1BWNA 2I5CA 1FGZA 4L1RA 2RRFA 3TO1A 5HE3A 1FAOA 2GJYA 1PMSA 5CLQB 1SHCA 1TJ6A 1XCGA 1X05A 1E5WA 4DBBA 3NSUA 2D9YA 4HDOA 1TQZA 2R2YA 1EGXA 2Z0PA 2ADZA 5JP4A 5C6RA 3PG7A 1PLSA 2ZPYA 1WGQA 3PSCA 3UZTA 2D9XA 4HB2B 2I1JA 2GCJA 3HK0A 1XR0B 3AU5A 2VKIA 2EMSA 4EMOA 2RNRB 4IOYX 3A98B 4KHBB 3PVWA 2LYDA 3SNHA 4CHJA 5DHFB 5KCVA 5D3YA 1P3RA 2NZ8B 2YT0A 2DA0A 2YS5A 2CY5A 4C0AA 2K2UA 4KHAA 1RJ2A 1LB1A 2GS0A 2W2WA 1U5DA 1MIZB 4EJNA 4GXBA 2DKQA 5KQ4A 3P6AA 2GCLA 1I7AA 3DXDA 5LONB 2Y8GA 5JHHA 4ZRIA 4CYEA 2I1KA 1WI1A 3HQCA 3PVUA 1W1DA 3NW8A 2I5FA 2VRWB 3QWMA 1K5DB 5D3WA 1V61A 1DDVA 5D27A 2R0DA 2KUQA 1ZC4B 1FHWA 5C79A 2RUKB 1FHOA 4K2PA 2EC1A 3PEGA 3A8PA 1GC7A 4P7IA 2IFSA 2COAA 3T06A 5DIFB 4DXAB 4D0NB 2YSZA 4YONA 3CIKA 5DHAB 2PZ1A 4WSFA 1MK9B 4F7UP 4XWXA 2OQBA 3M1IB 5M4YB 1BAKA 3WA0A 4NY0A 2XQNM 1UEFA 3CXBB 2RLOA 3OANA 4YL8A 4HSIA 4KHOA 3U12A 2RSGA 4KVGB 1AQCA 2L1CA 3QBVB 1AWEA 2KIGA 2M14A 4QJ5B 1KZGA 3KRWA 2N0YA 1Z87A 1BTKA 1NTYA 2YVCA 3NWFA 2GUMA 1PFJA 3F5RA 2X18A 3FSSA 2QKMA 2HTHB 5I2MA 1OY2A 2NMBA 2D11A 1UNRA 5LOPB 2P0FA 3X23A 2CY4A 3KY9A 5C5BA 1U5EA 1W1HA 3FVCA 2MFQA 3U8ZA 1MIXA 1ZSQA 1P6SA 2YT1A 2ROVA 2YF0A 1WJMA 2H7DA 3GYPA 3ODOA 4Z2MB 4HAZB 5D3VA 4A6HA 1GC6A 2D10A 3MDBC 4ZRKA 2D9WA 1M7EA 3ODWA 2NBVA 2Z0QA 4HHVA 1FGYA 3LJUX 3SO6A 1T77A 1OQNA 5JHGA 1UPRA 4WJ7A 1NU2A 3A58A 1IRSA 1Y5OA 2ZKMX 2COCA 2J0KA 3HW2B 1UPQA 4HB4B 1WG7A 3HIEA 4A6FA 4GPTB 1X11A 3KSYA 4GOUA 2H7EA 2UZRA 3OHMB 5HE1A 3FM8C 1H4RA 4OT1A 1J19A 1BTNA 1V5MA 5I2SA 5LG4B 2YS1A 2LG1A 2D4QA 3AU4A 1Y19B 2KGXB 3RCPA 2KIEA 2LOZA 1QC6A 2DHIA 1ZVRA 2Z4DA 3B77A 1W1GA 3O96A 1TXDA 2M38A 1U5FA 2DYQA 3P7ZA 5L81A 1DROA 2DN6A 1X1GA 2EMTA 4IAPA 2Y7BA 2Z0OA 3BINA 1DDMA 3PVLA 4GMXB 1WGUA 1MI1A 2RGNB 4D6WA 1V88A 3TW1A 2D9VA 4PNKA 1ZM0A 3HSAA 4CHMA 3NWDA 5HE0A 2YT2A 1MAIA 4EKUA 5C5BB 4QJ4B 5FI1A 4IFSA 5HE2A 1N3HA 2K2JA 5JLJB 2Y8FA 3VOQA 2YRYA 1KI1B 2E2XA 2L2IA 1XKEA 2K8EA 3F0WA 5J3YA 3ZDTA 4GNKB 2YS3A 4ZRJA 4GZUA 5GOWB 1J0WA 2JP2A 1K5GB 3SYXA 2ROZB 3D8DA 1DBHA 4DX90 4GN1A 1EVHA 2R09A 5FI0A 3KRXA 3NWAA 3DXCA 3ODXA 1U5GA 4HAXB 1I2HA 4PQ0A 3TVVA 2V76A 3MPXA 1FOEA 4A6FB 2ELBA 2DTCA 3ULBA 1X1FA 4WVFB 5DI9B 2DX1A 4K2OA 2W2XD 2Q13A 4CSQA 1P5TA 2MKRA 1H10A 5EFXA 3PZDA 1UNQA 1FHXA 4DX8A 3SV1A 4MT7A 2LKOA 3FEHA 2DX5A 5C16A 3WYFB 2FJLA 2G35A 2AL6A 1Q67A 1NTVA 4MK0A 1DYNA 4TKNA 5IRSA 2W2XC 1KZ7A 3AJ4A 3PP2A 3VIAA 2P8VA 4HAWB 2QKLA 1FB8A 3SUZA 1WVHA 1X86A 1SGHA 2VSZA 2N23A 1V5UA 2D9ZA 4H8SA 1ZYIA 4QJ3B 4F7GA 4QXAB 4A6KA 2UVMA 1OMWA 2MWNB 3ZVRA 4Y94A 3TFMA 2COFA 1LW3A 1V5PA 3ML4A 2Z13A 4HATB 2KUPA 2KCJA 2Z14A 3N7CA 1NI2A 4MY6A 4NSWA 1MKEA 2CAYA 2AEHA 1B55A 4HAUB 2HE7A 2P0DA 1MPHA 2CRFA 2P0HA 3ULCA 2FJUB 2K49A 2D2QA 4KAXB 2LOXA 2DKPA 1U2BA 4TYZA 2DYNA 3U7DA 4A5KA 1U27A 2OTXA 4HB3B 4BBKA 4GMVA 1GG3A 2DHJA 1UNPA
chains in the Genus database with same CATH topology
2NBVA 4D6WA 2GCLA 4KHBA 4KHBB 3TW1A 2KIEA 3NWDA 1ZYIA 2YT2A 4QJ3B 4QXAB 4QJ4B 2KR0A 3NWAA 2Z4DA 4IFSA 2ZKMX 3A58A 2GCJA 2KIGA 4PQ0A 3NW8A 3TVVA 4QJ5B 2Z59A 3FVCA 2FJUB 2K49A 4KHAA 4L1RA 4OSNA 2RRFA 3HIEA 3TO1A 5M4YB 5IRSA 3U12A 4GOUA 3OHMB 2Z13A 3GYPA 4Z2MB 3NWFA 4OT1A 2GUMA 2KUQA 3FSSA 4Z2NA 4DIXA 2K8EA 2Z14A 5I2MA 5I2SA 5LG4B 4GNKB 2R2YA 4IOYX 3GYOA 4HSIA 4CSQA 4KHOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KUQ A;  2YT2 A; 
#chains in the Genus database with same CATH topology
 5CLL B;  1EAZ A;  1M7R A;  2J59 M;  2J0M A;  2Z59 A;  1DDW A;  4B6H A;  2MDX A;  3IVF A;  2LUL A;  2DHK A;  2DFK A;  1XD4 A;  3D8E A;  4Z2N A;  4DIX A;  4HAY B;  2EJ8 A;  4HAV B;  5DH9 B;  3G9W A;  1MK7 B;  1V89 A;  3DCX A;  1RRP B;  4KHB A;  2RVB B;  4HB0 B;  4L6E A;  3KZ1 A;  1ZC3 B;  4K17 A;  2DLW A;  2UZS A;  2IYB A;  4OSN A;  1ISN A;  1XX0 A;  5J3Q A;  4K81 A;  1XOD A;  2COD A;  2ELA A;  4HDQ A;  4F7H A;  3D8F A;  3GYO A;  5D3X A;  3A8Q A;  3V5W A;  3BJI A;  5KQ1 A;  3DXE A;  3TCA A;  1U29 A;  1QQG A;  1EF1 A;  2K00 A;  1WJ1 A;  3QIJ A;  2J0J A;  2BCJ A;  2KR0 A;  5J3T A;  1BWN A;  2I5C A;  1FGZ A;  4L1R A;  2RRF A;  3TO1 A;  5HE3 A;  1FAO A;  2GJY A;  1PMS A;  5CLQ B;  1SHC A;  1TJ6 A;  1XCG A;  1X05 A;  1E5W A;  4DBB A;  3NSU A;  2D9Y A;  4HDO A;  1TQZ A;  2R2Y A;  1EGX A;  2Z0P A;  2ADZ A;  5JP4 A;  5C6R A;  3PG7 A;  1PLS A;  2ZPY A;  1WGQ A;  3PSC A;  3UZT A;  2D9X A;  4HB2 B;  2I1J A;  2GCJ A;  3HK0 A;  1XR0 B;  3AU5 A;  2VKI A;  2EMS A;  4EMO A;  2RNR B;  4IOY X;  3A98 B;  4KHB B;  3PVW A;  2LYD A;  3SNH A;  4CHJ A;  5DHF B;  5KCV A;  5D3Y A;  1P3R A;  2NZ8 B;  2YT0 A;  2DA0 A;  2YS5 A;  2CY5 A;  4C0A A;  2K2U A;  4KHA A;  1RJ2 A;  1LB1 A;  2GS0 A;  2W2W A;  1U5D A;  1MIZ B;  4EJN A;  4GXB A;  2DKQ A;  5KQ4 A;  3P6A A;  2GCL A;  1I7A A;  3DXD A;  5LON B;  2Y8G A;  5JHH A;  4ZRI A;  4CYE A;  2I1K A;  1WI1 A;  3HQC A;  3PVU A;  1W1D A;  3NW8 A;  2I5F A;  2VRW B;  3QWM A;  1K5D B;  5D3W A;  1V61 A;  1DDV A;  5D27 A;  2R0D A;  2KUQ A;  1ZC4 B;  1FHW A;  5C79 A;  2RUK B;  1FHO A;  4K2P A;  2EC1 A;  3PEG A;  3A8P A;  1GC7 A;  4P7I A;  2IFS A;  2COA A;  3T06 A;  5DIF B;  4DXA B;  4D0N B;  2YSZ A;  4YON A;  3CIK A;  5DHA B;  2PZ1 A;  4WSF A;  1MK9 B;  4F7U P;  4XWX A;  2OQB A;  3M1I B;  5M4Y B;  1BAK A;  3WA0 A;  4NY0 A;  2XQN M;  1UEF A;  3CXB B;  2RLO A;  3OAN A;  4YL8 A;  4HSI A;  4KHO A;  3U12 A;  2RSG A;  4KVG B;  1AQC A;  2L1C A;  3QBV B;  1AWE A;  2KIG A;  2M14 A;  4QJ5 B;  1KZG A;  3KRW A;  2N0Y A;  1Z87 A;  1BTK A;  1NTY A;  2YVC A;  3NWF A;  2GUM A;  1PFJ A;  3F5R A;  2X18 A;  3FSS A;  2QKM A;  2HTH B;  5I2M A;  1OY2 A;  2NMB A;  2D11 A;  1UNR A;  5LOP B;  2P0F A;  3X23 A;  2CY4 A;  3KY9 A;  5C5B A;  1U5E A;  1W1H A;  3FVC A;  2MFQ A;  3U8Z A;  1MIX A;  1ZSQ A;  1P6S A;  2YT1 A;  2ROV A;  2YF0 A;  1WJM A;  2H7D A;  3GYP A;  3ODO A;  4Z2M B;  4HAZ B;  5D3V A;  4A6H A;  1GC6 A;  2D10 A;  3MDB C;  4ZRK A;  2D9W A;  1M7E A;  3ODW A;  2NBV A;  2Z0Q A;  4HHV A;  1FGY A;  3LJU X;  3SO6 A;  1T77 A;  1OQN A;  5JHG A;  1UPR A;  4WJ7 A;  1NU2 A;  3A58 A;  1IRS A;  1Y5O A;  2ZKM X;  2COC A;  2J0K A;  3HW2 B;  1UPQ A;  4HB4 B;  1WG7 A;  3HIE A;  4A6F A;  4GPT B;  1X11 A;  3KSY A;  4GOU A;  2H7E A;  2UZR A;  3OHM B;  5HE1 A;  3FM8 C;  1H4R A;  4OT1 A;  1J19 A;  1BTN A;  1V5M A;  5I2S A;  5LG4 B;  2YS1 A;  2LG1 A;  2D4Q A;  3AU4 A;  1Y19 B;  2KGX B;  3RCP A;  2KIE A;  2LOZ A;  1QC6 A;  2DHI A;  1ZVR A;  2Z4D A;  3B77 A;  1W1G A;  3O96 A;  1TXD A;  2M38 A;  1U5F A;  2DYQ A;  3P7Z A;  5L81 A;  1DRO A;  2DN6 A;  1X1G A;  2EMT A;  4IAP A;  2Y7B A;  2Z0O A;  3BIN A;  1DDM A;  3PVL A;  4GMX B;  1WGU A;  1MI1 A;  2RGN B;  4D6W A;  1V88 A;  3TW1 A;  2D9V A;  4PNK A;  1ZM0 A;  3HSA A;  4CHM A;  3NWD A;  5HE0 A;  2YT2 A;  1MAI A;  4EKU A;  5C5B B;  4QJ4 B;  5FI1 A;  4IFS A;  5HE2 A;  1N3H A;  2K2J A;  5JLJ B;  2Y8F A;  3VOQ A;  2YRY A;  1KI1 B;  2E2X A;  2L2I A;  1XKE A;  2K8E A;  3F0W A;  5J3Y A;  3ZDT A;  4GNK B;  2YS3 A;  4ZRJ A;  4GZU A;  5GOW B;  1J0W A;  2JP2 A;  1K5G B;  3SYX A;  2ROZ B;  3D8D A;  1DBH A;  4DX9 0;  4GN1 A;  1EVH A;  2R09 A;  5FI0 A;  3KRX A;  3NWA A;  3DXC A;  3ODX A;  1U5G A;  4HAX B;  1I2H A;  4PQ0 A;  3TVV A;  2V76 A;  3MPX A;  1FOE A;  4A6F B;  2ELB A;  2DTC A;  3ULB A;  1X1F A;  4WVF B;  5DI9 B;  2DX1 A;  4K2O A;  2W2X D;  2Q13 A;  4CSQ A;  1P5T A;  2MKR A;  1H10 A;  5EFX A;  3PZD A;  1UNQ A;  1FHX A;  4DX8 A;  3SV1 A;  4MT7 A;  2LKO A;  3FEH A;  2DX5 A;  5C16 A;  3WYF B;  2FJL A;  2G35 A;  2AL6 A;  1Q67 A;  1NTV A;  4MK0 A;  1DYN A;  4TKN A;  5IRS A;  2W2X C;  1KZ7 A;  3AJ4 A;  3PP2 A;  3VIA A;  2P8V A;  4HAW B;  2QKL A;  1FB8 A;  3SUZ A;  1WVH A;  1X86 A;  1SGH A;  2VSZ A;  2N23 A;  1V5U A;  2D9Z A;  4H8S A;  1ZYI A;  4QJ3 B;  4F7G A;  4QXA B;  4A6K A;  2UVM A;  1OMW A;  2MWN B;  3ZVR A;  4Y94 A;  3TFM A;  2COF A;  1LW3 A;  1V5P A;  3ML4 A;  2Z13 A;  4HAT B;  2KUP A;  2KCJ A;  2Z14 A;  3N7C A;  1NI2 A;  4MY6 A;  4NSW A;  1MKE A;  2CAY A;  2AEH A;  1B55 A;  4HAU B;  2HE7 A;  2P0D A;  1MPH A;  2CRF A;  2P0H A;  3ULC A;  2FJU B;  2K49 A;  2D2Q A;  4KAX B;  2LOX A;  2DKP A;  1U2B A;  4TYZ A;  2DYN A;  3U7D A;  4A5K A;  1U27 A;  2OTX A;  4HB3 B;  4BBK A;  4GMV A;  1GG3 A;  2DHJ A;  1UNP A; 
#chains in the Genus database with same CATH homology
 2NBV A;  4D6W A;  2GCL A;  4KHB A;  4KHB B;  3TW1 A;  2KIE A;  3NWD A;  1ZYI A;  2YT2 A;  4QJ3 B;  4QXA B;  4QJ4 B;  2KR0 A;  3NWA A;  2Z4D A;  4IFS A;  2ZKM X;  3A58 A;  2GCJ A;  2KIG A;  4PQ0 A;  3NW8 A;  3TVV A;  4QJ5 B;  2Z59 A;  3FVC A;  2FJU B;  2K49 A;  4KHA A;  4L1R A;  4OSN A;  2RRF A;  3HIE A;  3TO1 A;  5M4Y B;  5IRS A;  3U12 A;  4GOU A;  3OHM B;  2Z13 A;  3GYP A;  4Z2M B;  3NWF A;  4OT1 A;  2GUM A;  2KUQ A;  3FSS A;  4Z2N A;  4DIX A;  2K8E A;  2Z14 A;  5I2M A;  5I2S A;  5LG4 B;  4GNK B;  2R2Y A;  4IOY X;  3GYO A;  4HSI A;  4CSQ A;  4KHO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...