2YT2A

Solution structure of the chimera of the ptb domain of snt-2 and 19-residue peptide (aa 1571-1589) of halk
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
153
structure length
153
Chain Sequence
GSSGSSGLNRDSVPDNHPTKFKVTNVDDEGVELGSGVMELTQSELVLHLHRREAVRWPYLCLRRYGYDSNLFSFESGRRCQTGQGIFAFKCSRAEEIFNLLQDLMQCNSINVMEEPVIITSGSSGSSGSSGSSGLFRLRHFPCGNVNYGYQQQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fibroblast growth factor receptor substrate 3 and ALK tyrosi
publication title Structural basis for the recognition of nucleophosmin-anaplastic lymphoma kinase oncoprotein by the phosphotyrosine binding domain of Suc1-associated neurotrophic factor-induced tyrosine-phosphorylated target-2
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 16
structure length 153
sequence length 153
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2007-04-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02174 IRS PTB domain (IRS-1 type)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.250 Mainly Beta Roll PH-domain like PH-domain like 2yt2A00
2KUQA 2YT2A
chains in the Genus database with same CATH superfamily
1FHWA 3FM8C 3UZTA 1GG3A 4HDOA 2K49A 2J0KA 4HHVA 3ZVRA 4D6WA 1RJ2A 1DYNA 1DBHA 2DYQA 3D8DA 4CHMA 2P0FA 2KUPA 3CIKA 3G9WA 2IFSA 3DXEA 1LB1A 4HATB 3OHMB 4CHJA 2DA0A 5D3XA 5HE3A 1AWEA 2ELBA 2YRYA 1FB8A 5KCVA 3HIEA 2W2XD 5I2MA 5DIFB 2DHKA 4DX8A 1ZM0A 4QJ3B 1NTVA 3PSCA 3X23A 1KI1B 3HQCA 1DROA 2M14A 2I5CA 3B77A 3NWFA 5C16A 3BJIA 1EVHA 3PEGA 1PLSA 2I1JA 2RRFA 1FHXA 1X05A 3PG7A 4MY6A 5HE0A 1P3RA 2FJUB 4H8SA 5GOWB 2DTCA 3F5RA 2COFA 1BTKA 4PNKA 4HB4B 3WA0A 4F7GA 1U5DA 4C0AA 2H7DA 2I5FA 2RGNB 3ML4A 4A5KA 1IRSA 2J0MA 2NZ8B 2LG1A 4GPTB 4QXAB 4IOYX 3KZ1A 5J3QA 1TXDA 4P7IA 4K17A 3A58A 1U27A 2Y8FA 3QIJA 4IAPA 5EFXA 5J3YA 2MDXA 2Z4DA 5DI9B 3MDBC 2Y7BA 3FSSA 4CSQA 5CLLB 1X11A 3PZDA 4GZUA 4ZRIA 2DHIA 3A8QA 1FGYA 2GUMA 3CXBB 1FOEA 1V5UA 2KCJA 4WJ7A 4GMXB 1KZ7A 1U2BA 1UNPA 1FHOA 2COAA 3TO1A 3O96A 4KAXB 1ZC4B 5C5BB 1XD4A 2CAYA 4HAWB 4K2PA 1KZGA 2KR0A 4F7HA 1WGUA 4OSNA 5LONB 5M4YB 4ZRJA 1SGHA 4ZRKA 2DHJA 2EMSA 4DIXA 2D2QA 2X18A 2VSZA 2DFKA 2Z59A 1GC7A 1ZC3B 4HAUB 1T77A 2GCJA 1EAZA 2OTXA 1NTYA 2N0YA 4XWXA 1RRPB 2ELAA 4KHBA 3KRWA 1DDMA 5KQ1A 2L1CA 2D9YA 4QJ4B 1MK9B 2L2IA 2AL6A 3ODXA 2D11A 3ZDTA 5FI0A 3U12A 4PQ0A 1XODA 1V5MA 2I1KA 4WSFA 4D0NB 1ZSQA 2IYBA 1K5GB 2VRWB 4Z2MB 1WI1A 2UZSA 2KIGA 2P0HA 4A6KA 4HAXB 3D8FA 2Y8GA 4GMVA 3A8PA 3T06A 1ZVRA 3NWAA 3ULCA 3TCAA 2ZKMX 2OQBA 3M1IB 2V76A 4B6HA 2KIEA 2GJYA 1H4RA 3D8EA 1U5EA 3HK0A 1Q67A 3DCXA 2CRFA 3SYXA 2Z14A 2YF0A 1OQNA 3TFMA 5JP4A 3KY9A 4F7UP 4Y94A 1N3HA 1MI1A 3KSYA 5DH9B 2LOZA 1PMSA 3PVLA 4HAVB 2FJLA 4KHOA 2YSZA 3PP2A 2D10A 4HB2B 3TVVA 2KGXB 1M7RA 5JHGA 3DXDA 1GC6A 1OY2A 2BCJA 1TJ6A 3ULBA 3VOQA 3P7ZA 2JP2A 1V5PA 2RSGA 3IVFA 3WYFB 5JHHA 3OANA 2DN6A 5D3WA 2LOXA 2DLWA 2D9XA 3ODOA 2YS3A 1J0WA 2D9ZA 1J19A 2MFQA 2AEHA 2YT1A 1LW3A 3HSAA 1PFJA 2DX5A 2DKPA 5J3TA 1Z87A 2K8EA 2N23A 2CY5A 1X1FA 5CLQB 4TKNA 5D3VA 4MT7A 5JLJB 5L81A 2R09A 4EMOA 2RNRB 4K81A 1X86A 1TQZA 2D4QA 2RLOA 4A6FB 2ROVA 2QKLA 5C5BA 2HE7A 2ZPYA 3PVUA 3V5WA 2CY4A 3GYOA 2GCLA 2K2JA 2NBVA 1H10A 2DYNA 2LYDA 2YT2A 1P6SA 4NSWA 1U5GA 2KUQA 2YVCA 4HDQA 1EF1A 1W1GA 5KQ4A 3U7DA 2QKMA 3HW2B 1OMWA 1X1GA 1EGXA 2Z0QA 1U29A 5D3YA 2P0DA 4WVFB 3DXCA 4L1RA 1Y5OA 1FAOA 1V88A 2ADZA 2CODA 4MK0A 1QC6A 5FI1A 2J59M 5C79A 2DKQA 3VIAA 4HB0B 1UNQA 4TYZA 4OT1A 1WG7A 1XX0A 2MWNB 2K2UA 2YT0A 5DHFB 3RCPA 1FGZA 1BAKA 3TW1A 3SO6A 1WVHA 1M7EA 1ZYIA 5D27A 1DDVA 5LG4B 2R2YA 4BBKA 5I2SA 2W2WA 2Q13A 4KVGB 4GN1A 1I7AA 2UZRA 2YS5A 3BINA 2D9VA 4GOUA 2HTHB 5HE1A 4IFSA 3FEHA 4K2OA 1WGQA 1W1DA 1SHCA 3PVWA 3AU5A 2K00A 2Z13A 2ROZB 2Z0OA 1BWNA 1V89A 1WJ1A 2NMBA 1B55A 1MIZB 1P5TA 2UVMA 3ODWA 4HSIA 1DDWA 1XKEA 1U5FA 1MK7B 4KHAA 2PZ1A 2Z0PA 3LJUX 1V61A 4DX90 4YL8A 1NI2A 2LKOA 4DBBA 3U8ZA 5C6RA 3AU4A 4CYEA 4GNKB 4L6EA 3A98B 5HE2A 1UNRA 3MPXA 5IRSA 4EJNA 4HAZB 3GYPA 1W1HA 2EC1A 3FVCA 3KRXA 5LOPB 3NSUA 3SNHA 3NW8A 1Y19B 3SUZA 2J0JA 1BTNA 2EJ8A 4HAYB 4YONA 2GS0A 1UPQA 5DHAB 2LULA 1AQCA 2RUKB 1ISNA 1UPRA 2MKRA 4EKUA 1NU2A 3P6AA 2YS1A 1MAIA 4NY0A 2EMTA 3SV1A 4A6HA 4DXAB 1MPHA 4QJ5B 2XQNM 2VKIA 4Z2NA 1E5WA 2G35A 2DX1A 3QWMA 4GXBA 3AJ4A 2R0DA 2H7EA 2M38A 1WJMA 1QQGA 2P8VA 3N7CA 4KHBB 1MKEA 3NWDA 3F0WA 3QBVB 1XCGA 2D9WA 1I2HA 2RVBB 4HB3B 1MIXA 1XR0B 2W2XC 1K5DB 2COCA 2E2XA 4A6FA 1UEFA
chains in the Genus database with same CATH topology
4PQ0A 4QXAB 4IOYX 4HSIA 2RRFA 1ZYIA 2Z59A 3FVCA 3U12A 4Z2NA 5LG4B 4KHAA 4KHOA 2KIEA 3A58A 2GCJA 3NW8A 4Z2MB 2R2YA 3GYOA 2GCLA 5I2SA 2KR0A 2NBVA 2K49A 2FJUB 2KIGA 3TVVA 4D6WA 3HIEA 4OSNA 2YT2A 2Z4DA 5I2MA 4GOUA 4KHBA 4IFSA 2K8EA 3FSSA 4CSQA 2KUQA 5M4YB 4KHBB 4OT1A 4QJ3B 2Z14A 3NWDA 4QJ4B 4GNKB 2GUMA 4L1RA 3NWAA 5IRSA 2Z13A 4DIXA 3NWFA 3GYPA 2ZKMX 3TW1A 3OHMB 4QJ5B 3TO1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KUQ A;  2YT2 A; 
#chains in the Genus database with same CATH topology
 1FHW A;  3FM8 C;  3UZT A;  1GG3 A;  4HDO A;  2K49 A;  2J0K A;  4HHV A;  3ZVR A;  4D6W A;  1RJ2 A;  1DYN A;  1DBH A;  2DYQ A;  3D8D A;  4CHM A;  2P0F A;  2KUP A;  3CIK A;  3G9W A;  2IFS A;  3DXE A;  1LB1 A;  4HAT B;  3OHM B;  4CHJ A;  2DA0 A;  5D3X A;  5HE3 A;  1AWE A;  2ELB A;  2YRY A;  1FB8 A;  5KCV A;  3HIE A;  2W2X D;  5I2M A;  5DIF B;  2DHK A;  4DX8 A;  1ZM0 A;  4QJ3 B;  1NTV A;  3PSC A;  3X23 A;  1KI1 B;  3HQC A;  1DRO A;  2M14 A;  2I5C A;  3B77 A;  3NWF A;  5C16 A;  3BJI A;  1EVH A;  3PEG A;  1PLS A;  2I1J A;  2RRF A;  1FHX A;  1X05 A;  3PG7 A;  4MY6 A;  5HE0 A;  1P3R A;  2FJU B;  4H8S A;  5GOW B;  2DTC A;  3F5R A;  2COF A;  1BTK A;  4PNK A;  4HB4 B;  3WA0 A;  4F7G A;  1U5D A;  4C0A A;  2H7D A;  2I5F A;  2RGN B;  3ML4 A;  4A5K A;  1IRS A;  2J0M A;  2NZ8 B;  2LG1 A;  4GPT B;  4QXA B;  4IOY X;  3KZ1 A;  5J3Q A;  1TXD A;  4P7I A;  4K17 A;  3A58 A;  1U27 A;  2Y8F A;  3QIJ A;  4IAP A;  5EFX A;  5J3Y A;  2MDX A;  2Z4D A;  5DI9 B;  3MDB C;  2Y7B A;  3FSS A;  4CSQ A;  5CLL B;  1X11 A;  3PZD A;  4GZU A;  4ZRI A;  2DHI A;  3A8Q A;  1FGY A;  2GUM A;  3CXB B;  1FOE A;  1V5U A;  2KCJ A;  4WJ7 A;  4GMX B;  1KZ7 A;  1U2B A;  1UNP A;  1FHO A;  2COA A;  3TO1 A;  3O96 A;  4KAX B;  1ZC4 B;  5C5B B;  1XD4 A;  2CAY A;  4HAW B;  4K2P A;  1KZG A;  2KR0 A;  4F7H A;  1WGU A;  4OSN A;  5LON B;  5M4Y B;  4ZRJ A;  1SGH A;  4ZRK A;  2DHJ A;  2EMS A;  4DIX A;  2D2Q A;  2X18 A;  2VSZ A;  2DFK A;  2Z59 A;  1GC7 A;  1ZC3 B;  4HAU B;  1T77 A;  2GCJ A;  1EAZ A;  2OTX A;  1NTY A;  2N0Y A;  4XWX A;  1RRP B;  2ELA A;  4KHB A;  3KRW A;  1DDM A;  5KQ1 A;  2L1C A;  2D9Y A;  4QJ4 B;  1MK9 B;  2L2I A;  2AL6 A;  3ODX A;  2D11 A;  3ZDT A;  5FI0 A;  3U12 A;  4PQ0 A;  1XOD A;  1V5M A;  2I1K A;  4WSF A;  4D0N B;  1ZSQ A;  2IYB A;  1K5G B;  2VRW B;  4Z2M B;  1WI1 A;  2UZS A;  2KIG A;  2P0H A;  4A6K A;  4HAX B;  3D8F A;  2Y8G A;  4GMV A;  3A8P A;  3T06 A;  1ZVR A;  3NWA A;  3ULC A;  3TCA A;  2ZKM X;  2OQB A;  3M1I B;  2V76 A;  4B6H A;  2KIE A;  2GJY A;  1H4R A;  3D8E A;  1U5E A;  3HK0 A;  1Q67 A;  3DCX A;  2CRF A;  3SYX A;  2Z14 A;  2YF0 A;  1OQN A;  3TFM A;  5JP4 A;  3KY9 A;  4F7U P;  4Y94 A;  1N3H A;  1MI1 A;  3KSY A;  5DH9 B;  2LOZ A;  1PMS A;  3PVL A;  4HAV B;  2FJL A;  4KHO A;  2YSZ A;  3PP2 A;  2D10 A;  4HB2 B;  3TVV A;  2KGX B;  1M7R A;  5JHG A;  3DXD A;  1GC6 A;  1OY2 A;  2BCJ A;  1TJ6 A;  3ULB A;  3VOQ A;  3P7Z A;  2JP2 A;  1V5P A;  2RSG A;  3IVF A;  3WYF B;  5JHH A;  3OAN A;  2DN6 A;  5D3W A;  2LOX A;  2DLW A;  2D9X A;  3ODO A;  2YS3 A;  1J0W A;  2D9Z A;  1J19 A;  2MFQ A;  2AEH A;  2YT1 A;  1LW3 A;  3HSA A;  1PFJ A;  2DX5 A;  2DKP A;  5J3T A;  1Z87 A;  2K8E A;  2N23 A;  2CY5 A;  1X1F A;  5CLQ B;  4TKN A;  5D3V A;  4MT7 A;  5JLJ B;  5L81 A;  2R09 A;  4EMO A;  2RNR B;  4K81 A;  1X86 A;  1TQZ A;  2D4Q A;  2RLO A;  4A6F B;  2ROV A;  2QKL A;  5C5B A;  2HE7 A;  2ZPY A;  3PVU A;  3V5W A;  2CY4 A;  3GYO A;  2GCL A;  2K2J A;  2NBV A;  1H10 A;  2DYN A;  2LYD A;  2YT2 A;  1P6S A;  4NSW A;  1U5G A;  2KUQ A;  2YVC A;  4HDQ A;  1EF1 A;  1W1G A;  5KQ4 A;  3U7D A;  2QKM A;  3HW2 B;  1OMW A;  1X1G A;  1EGX A;  2Z0Q A;  1U29 A;  5D3Y A;  2P0D A;  4WVF B;  3DXC A;  4L1R A;  1Y5O A;  1FAO A;  1V88 A;  2ADZ A;  2COD A;  4MK0 A;  1QC6 A;  5FI1 A;  2J59 M;  5C79 A;  2DKQ A;  3VIA A;  4HB0 B;  1UNQ A;  4TYZ A;  4OT1 A;  1WG7 A;  1XX0 A;  2MWN B;  2K2U A;  2YT0 A;  5DHF B;  3RCP A;  1FGZ A;  1BAK A;  3TW1 A;  3SO6 A;  1WVH A;  1M7E A;  1ZYI A;  5D27 A;  1DDV A;  5LG4 B;  2R2Y A;  4BBK A;  5I2S A;  2W2W A;  2Q13 A;  4KVG B;  4GN1 A;  1I7A A;  2UZR A;  2YS5 A;  3BIN A;  2D9V A;  4GOU A;  2HTH B;  5HE1 A;  4IFS A;  3FEH A;  4K2O A;  1WGQ A;  1W1D A;  1SHC A;  3PVW A;  3AU5 A;  2K00 A;  2Z13 A;  2ROZ B;  2Z0O A;  1BWN A;  1V89 A;  1WJ1 A;  2NMB A;  1B55 A;  1MIZ B;  1P5T A;  2UVM A;  3ODW A;  4HSI A;  1DDW A;  1XKE A;  1U5F A;  1MK7 B;  4KHA A;  2PZ1 A;  2Z0P A;  3LJU X;  1V61 A;  4DX9 0;  4YL8 A;  1NI2 A;  2LKO A;  4DBB A;  3U8Z A;  5C6R A;  3AU4 A;  4CYE A;  4GNK B;  4L6E A;  3A98 B;  5HE2 A;  1UNR A;  3MPX A;  5IRS A;  4EJN A;  4HAZ B;  3GYP A;  1W1H A;  2EC1 A;  3FVC A;  3KRX A;  5LOP B;  3NSU A;  3SNH A;  3NW8 A;  1Y19 B;  3SUZ A;  2J0J A;  1BTN A;  2EJ8 A;  4HAY B;  4YON A;  2GS0 A;  1UPQ A;  5DHA B;  2LUL A;  1AQC A;  2RUK B;  1ISN A;  1UPR A;  2MKR A;  4EKU A;  1NU2 A;  3P6A A;  2YS1 A;  1MAI A;  4NY0 A;  2EMT A;  3SV1 A;  4A6H A;  4DXA B;  1MPH A;  4QJ5 B;  2XQN M;  2VKI A;  4Z2N A;  1E5W A;  2G35 A;  2DX1 A;  3QWM A;  4GXB A;  3AJ4 A;  2R0D A;  2H7E A;  2M38 A;  1WJM A;  1QQG A;  2P8V A;  3N7C A;  4KHB B;  1MKE A;  3NWD A;  3F0W A;  3QBV B;  1XCG A;  2D9W A;  1I2H A;  2RVB B;  4HB3 B;  1MIX A;  1XR0 B;  2W2X C;  1K5D B;  2COC A;  2E2X A;  4A6F A;  1UEF A; 
#chains in the Genus database with same CATH homology
 4PQ0 A;  4QXA B;  4IOY X;  4HSI A;  2RRF A;  1ZYI A;  2Z59 A;  3FVC A;  3U12 A;  4Z2N A;  5LG4 B;  4KHA A;  4KHO A;  2KIE A;  3A58 A;  2GCJ A;  3NW8 A;  4Z2M B;  2R2Y A;  3GYO A;  2GCL A;  5I2S A;  2KR0 A;  2NBV A;  2K49 A;  2FJU B;  2KIG A;  3TVV A;  4D6W A;  3HIE A;  4OSN A;  2YT2 A;  2Z4D A;  5I2M A;  4GOU A;  4KHB A;  4IFS A;  2K8E A;  3FSS A;  4CSQ A;  2KUQ A;  5M4Y B;  4KHB B;  4OT1 A;  4QJ3 B;  2Z14 A;  3NWD A;  4QJ4 B;  4GNK B;  2GUM A;  4L1R A;  3NWA A;  5IRS A;  2Z13 A;  4DIX A;  3NWF A;  3GYP A;  2ZKM X;  3TW1 A;  3OHM B;  4QJ5 B;  3TO1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...