2YT2A

Solution structure of the chimera of the ptb domain of snt-2 and 19-residue peptide (aa 1571-1589) of halk
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
153
structure length
153
Chain Sequence
GSSGSSGLNRDSVPDNHPTKFKVTNVDDEGVELGSGVMELTQSELVLHLHRREAVRWPYLCLRRYGYDSNLFSFESGRRCQTGQGIFAFKCSRAEEIFNLLQDLMQCNSINVMEEPVIITSGSSGSSGSSGSSGLFRLRHFPCGNVNYGYQQQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for the recognition of nucleophosmin-anaplastic lymphoma kinase oncoprotein by the phosphotyrosine binding domain of Suc1-associated neurotrophic factor-induced tyrosine-phosphorylated target-2
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords Fibroblast growth factor receptor substrate 3 and ALK tyrosi
total genus 16
structure length 153
sequence length 153
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2007-04-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02174 IRS PTB domain (IRS-1 type)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.250 Mainly Beta Roll PH-domain like PH-domain like 2yt2A00
2KUQA 2YT2A
chains in the Genus database with same CATH superfamily
5D3VA 4ZRIA 1MIXA 2LKOA 4A6KA 2D9YA 5C6RA 3VOQA 2K2UA 3DXCA 4IOYX 2R2YA 1ZSQA 1U5DA 1V61A 1GG3A 2YS1A 3LJUX 4GN1A 1N3HA 5FI1A 5LOPB 2RUKB 1EGXA 2NBVA 1X11A 3O96A 3KSYA 1NTVA 1DROA 4GNKB 3OHMB 3KRXA 1UEFA 1WJ1A 2D9XA 4DXAB 2G35A 5HE1A 3SNHA 1ZC3B 2R0DA 5LONB 2RLOA 5M4YB 3U12A 3HSAA 4H8SA 5C16A 2LOXA 4DX8A 2I1JA 3FM8C 2KIEA 5D27A 1MAIA 2J0KA 1TXDA 5C79A 2V76A 5J3YA 2JP2A 4F7GA 2YS5A 3DXEA 3CIKA 2EMSA 1J19A 4MT7A 2KUQA 3HQCA 1U5FA 2CAYA 5I2SA 2COCA 2KCJA 4HDOA 4OSNA 3DCXA 2DN6A 3SYXA 2W2XC 1QC6A 2OTXA 3PVUA 4MY6A 1ZYIA 4QJ3B 5HE3A 3PEGA 4L1RA 4Z2NA 2LULA 2J0MA 3HIEA 2DTCA 3V5WA 3KY9A 1WJMA 1TJ6A 2DKQA 2EJ8A 5CLLB 3FVCA 2L1CA 4XWXA 1Y19B 2E2XA 1ZC4B 2Y8FA 1EVHA 3P7ZA 3ODWA 2Z4DA 1W1DA 3TCAA 1W1GA 1FHOA 5KQ4A 1GC6A 4EJNA 3D8DA 4YONA 1M7EA 2BCJA 1KZGA 4DBBA 2CODA 5JHHA 1UNRA 2DHIA 2YSZA 3DXDA 4GMXB 3TVVA 1PMSA 3ZDTA 2K2JA 2NMBA 2DLWA 3F5RA 4EMOA 2GUMA 3ODOA 1X1GA 2IYBA 3BINA 3G9WA 5KQ1A 2W2WA 3NWDA 3RCPA 1SHCA 3NW8A 1KI1B 3ULCA 2LG1A 4HAWB 3QBVB 3U8ZA 3OANA 3TFMA 1EF1A 4HSIA 1MK9B 2DX5A 4HAYB 1U29A 2D2QA 5HE0A 1TQZA 4HAZB 4DX90 1UPQA 2Z0PA 1AQCA 1BTKA 3A8PA 4KVGB 1I2HA 2DKPA 4HB0B 2ZKMX 1J0WA 3U7DA 1Q67A 4ZRJA 1WVHA 1P6SA 5IRSA 1EAZA 2HE7A 2Z0OA 1XCGA 1P3RA 4Y94A 1W1HA 5DIFB 1XR0B 4IAPA 2DA0A 2DFKA 2I5FA 3SUZA 1BWNA 5J3TA 2M38A 3A98B 1AWEA 2J59M 3PP2A 2OQBA 2KGXB 3NSUA 5CLQB 1U27A 1V5PA 3D8EA 5D3YA 1NU2A 4IFSA 4ZRKA 5DHFB 4KHBA 4K2PA 1Y5OA 1FOEA 1U2BA 4K81A 4QXAB 4KAXB 4YL8A 2X18A 2Y8GA 1E5WA 5JP4A 2RNRB 2XQNM 3CXBB 5C5BB 4B6HA 4A6FB 1BTNA 2L2IA 1DDMA 5L81A 3ULBA 3PG7A 2MFQA 2AEHA 4CHJA 1XX0A 2KR0A 2GJYA 1K5DB 1MIZB 3AU5A 3KRWA 5I2MA 4P7IA 1NTYA 5DH9B 2ROVA 1WGUA 2GCJA 1Z87A 3UZTA 3NWFA 2ROZB 2Z14A 4PQ0A 5J3QA 2ELBA 2DHKA 3PSCA 1FHXA 2EC1A 1DBHA 2ELAA 4WVFB 3IVFA 5GOWB 1IRSA 3TW1A 1ISNA 3B77A 2P0DA 3P6AA 4F7HA 4A6HA 2D9WA 3AU4A 4HB3B 4GPTB 4GZUA 4NSWA 2DYNA 2QKLA 4DIXA 1H4RA 2K00A 2KIGA 4QJ5B 1GC7A 2RRFA 3SO6A 4WSFA 4GMVA 3MPXA 4WJ7A 1RRPB 2H7DA 2CRFA 2P0FA 3D8FA 2ADZA 1MI1A 3SV1A 1ZVRA 2W2XD 2GS0A 4HAXB 2D9ZA 1PLSA 4HHVA 5D3XA 3VIAA 1SGHA 5FI0A 3GYOA 3PVWA 4L6EA 3BJIA 3N7CA 2MKRA 1XD4A 5C5BA 1V88A 3NWAA 2K8EA 4A5KA 4HAUB 2RVBB 2VKIA 4CSQA 4QJ4B 1V89A 2Q13A 3WA0A 3PVLA 2FJLA 2YT1A 4TYZA 4D0NB 1FHWA 3HW2B 2D9VA 1RJ2A 2Z59A 4BBKA 2COFA 3FSSA 2HTHB 2Y7BA 2UVMA 2M14A 3KZ1A 2P0HA 1LB1A 2LOZA 5KCVA 2EMTA 4KHOA 4K17A 4Z2MB 1DDVA 4CYEA 2YT2A 2RSGA 4HATB 4PNKA 1LW3A 4K2OA 2ZPYA 2Z13A 1OMWA 3X23A 2H7EA 1PFJA 3FEHA 2AL6A 3T06A 1WGQA 4C0AA 4GOUA 4EKUA 3A8QA 1XODA 3TO1A 2I5CA 2UZRA 1FGYA 3HK0A 2K49A 2CY5A 5DHAB 2LYDA 2YVCA 2YF0A 1UPRA 2COAA 2D4QA 3AJ4A 4HAVB 2YRYA 2MWNB 1FAOA 1V5MA 2J0JA 4KHBB 4NY0A 4A6FA 1FGZA 4MK0A 2QKMA 3PZDA 1OQNA 1M7RA 2YT0A 2N23A 1MK7B 3ZVRA 2GCLA 2VSZA 2I1KA 2UZSA 2DYQA 2N0YA 1DYNA 3ML4A 3QWMA 1NI2A 2DHJA 5D3WA 1V5UA 1OY2A 2P8VA 2NZ8B 1T77A 2DX1A 1FB8A 4OT1A 1XKEA 2KUPA 2YS3A 1UNQA 1QQGA 5DI9B 3WYFB 1X1FA 4HDQA 2R09A 2Z0QA 1H10A 2MDXA 1X86A 3GYPA 3M1IB 5JLJB 2IFSA 2VRWB 1UNPA 1I7AA 1WG7A 2D10A 2RGNB 3MDBC 5JHGA 1U5GA 4KHAA 1MPHA 1MKEA 2FJUB 1BAKA 3F0WA 1P5TA 4HB4B 1DDWA 3ODXA 5EFXA 1X05A 3A58A 2PZ1A 4D6WA 4GXBA 4TKNA 1KZ7A 4CHMA 1WI1A 1ZM0A 5HE2A 1B55A 5LG4B 1U5EA 4F7UP 4HB2B 2D11A 3QIJA 2CY4A 1K5GB
chains in the Genus database with same CATH topology
4GNKB 3OHMB 4KHAA 3FVCA 2YT2A 5I2MA 2FJUB 4QXAB 2GCJA 2GUMA 3NWFA 3GYOA 5M4YB 3U12A 2Z14A 4IOYX 2Z13A 2R2YA 1ZYIA 2Z4DA 3NWDA 2ZKMX 4OT1A 4PQ0A 2KIEA 2Z59A 3FSSA 4KHBB 3A58A 4QJ3B 3NW8A 4D6WA 4L1RA 4DIXA 4Z2NA 5IRSA 2KIGA 4QJ5B 3NWAA 3HIEA 4GOUA 4CSQA 2RRFA 2K8EA 3GYPA 5LG4B 2GCLA 2KUQA 2NBVA 4IFSA 3TW1A 3TO1A 5I2SA 3TVVA 2KR0A 4HSIA 2K49A 4KHBA 4KHOA 4OSNA 4QJ4B 4Z2MB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KUQ A;  2YT2 A; 
#chains in the Genus database with same CATH topology
 5D3V A;  4ZRI A;  1MIX A;  2LKO A;  4A6K A;  2D9Y A;  5C6R A;  3VOQ A;  2K2U A;  3DXC A;  4IOY X;  2R2Y A;  1ZSQ A;  1U5D A;  1V61 A;  1GG3 A;  2YS1 A;  3LJU X;  4GN1 A;  1N3H A;  5FI1 A;  5LOP B;  2RUK B;  1EGX A;  2NBV A;  1X11 A;  3O96 A;  3KSY A;  1NTV A;  1DRO A;  4GNK B;  3OHM B;  3KRX A;  1UEF A;  1WJ1 A;  2D9X A;  4DXA B;  2G35 A;  5HE1 A;  3SNH A;  1ZC3 B;  2R0D A;  5LON B;  2RLO A;  5M4Y B;  3U12 A;  3HSA A;  4H8S A;  5C16 A;  2LOX A;  4DX8 A;  2I1J A;  3FM8 C;  2KIE A;  5D27 A;  1MAI A;  2J0K A;  1TXD A;  5C79 A;  2V76 A;  5J3Y A;  2JP2 A;  4F7G A;  2YS5 A;  3DXE A;  3CIK A;  2EMS A;  1J19 A;  4MT7 A;  2KUQ A;  3HQC A;  1U5F A;  2CAY A;  5I2S A;  2COC A;  2KCJ A;  4HDO A;  4OSN A;  3DCX A;  2DN6 A;  3SYX A;  2W2X C;  1QC6 A;  2OTX A;  3PVU A;  4MY6 A;  1ZYI A;  4QJ3 B;  5HE3 A;  3PEG A;  4L1R A;  4Z2N A;  2LUL A;  2J0M A;  3HIE A;  2DTC A;  3V5W A;  3KY9 A;  1WJM A;  1TJ6 A;  2DKQ A;  2EJ8 A;  5CLL B;  3FVC A;  2L1C A;  4XWX A;  1Y19 B;  2E2X A;  1ZC4 B;  2Y8F A;  1EVH A;  3P7Z A;  3ODW A;  2Z4D A;  1W1D A;  3TCA A;  1W1G A;  1FHO A;  5KQ4 A;  1GC6 A;  4EJN A;  3D8D A;  4YON A;  1M7E A;  2BCJ A;  1KZG A;  4DBB A;  2COD A;  5JHH A;  1UNR A;  2DHI A;  2YSZ A;  3DXD A;  4GMX B;  3TVV A;  1PMS A;  3ZDT A;  2K2J A;  2NMB A;  2DLW A;  3F5R A;  4EMO A;  2GUM A;  3ODO A;  1X1G A;  2IYB A;  3BIN A;  3G9W A;  5KQ1 A;  2W2W A;  3NWD A;  3RCP A;  1SHC A;  3NW8 A;  1KI1 B;  3ULC A;  2LG1 A;  4HAW B;  3QBV B;  3U8Z A;  3OAN A;  3TFM A;  1EF1 A;  4HSI A;  1MK9 B;  2DX5 A;  4HAY B;  1U29 A;  2D2Q A;  5HE0 A;  1TQZ A;  4HAZ B;  4DX9 0;  1UPQ A;  2Z0P A;  1AQC A;  1BTK A;  3A8P A;  4KVG B;  1I2H A;  2DKP A;  4HB0 B;  2ZKM X;  1J0W A;  3U7D A;  1Q67 A;  4ZRJ A;  1WVH A;  1P6S A;  5IRS A;  1EAZ A;  2HE7 A;  2Z0O A;  1XCG A;  1P3R A;  4Y94 A;  1W1H A;  5DIF B;  1XR0 B;  4IAP A;  2DA0 A;  2DFK A;  2I5F A;  3SUZ A;  1BWN A;  5J3T A;  2M38 A;  3A98 B;  1AWE A;  2J59 M;  3PP2 A;  2OQB A;  2KGX B;  3NSU A;  5CLQ B;  1U27 A;  1V5P A;  3D8E A;  5D3Y A;  1NU2 A;  4IFS A;  4ZRK A;  5DHF B;  4KHB A;  4K2P A;  1Y5O A;  1FOE A;  1U2B A;  4K81 A;  4QXA B;  4KAX B;  4YL8 A;  2X18 A;  2Y8G A;  1E5W A;  5JP4 A;  2RNR B;  2XQN M;  3CXB B;  5C5B B;  4B6H A;  4A6F B;  1BTN A;  2L2I A;  1DDM A;  5L81 A;  3ULB A;  3PG7 A;  2MFQ A;  2AEH A;  4CHJ A;  1XX0 A;  2KR0 A;  2GJY A;  1K5D B;  1MIZ B;  3AU5 A;  3KRW A;  5I2M A;  4P7I A;  1NTY A;  5DH9 B;  2ROV A;  1WGU A;  2GCJ A;  1Z87 A;  3UZT A;  3NWF A;  2ROZ B;  2Z14 A;  4PQ0 A;  5J3Q A;  2ELB A;  2DHK A;  3PSC A;  1FHX A;  2EC1 A;  1DBH A;  2ELA A;  4WVF B;  3IVF A;  5GOW B;  1IRS A;  3TW1 A;  1ISN A;  3B77 A;  2P0D A;  3P6A A;  4F7H A;  4A6H A;  2D9W A;  3AU4 A;  4HB3 B;  4GPT B;  4GZU A;  4NSW A;  2DYN A;  2QKL A;  4DIX A;  1H4R A;  2K00 A;  2KIG A;  4QJ5 B;  1GC7 A;  2RRF A;  3SO6 A;  4WSF A;  4GMV A;  3MPX A;  4WJ7 A;  1RRP B;  2H7D A;  2CRF A;  2P0F A;  3D8F A;  2ADZ A;  1MI1 A;  3SV1 A;  1ZVR A;  2W2X D;  2GS0 A;  4HAX B;  2D9Z A;  1PLS A;  4HHV A;  5D3X A;  3VIA A;  1SGH A;  5FI0 A;  3GYO A;  3PVW A;  4L6E A;  3BJI A;  3N7C A;  2MKR A;  1XD4 A;  5C5B A;  1V88 A;  3NWA A;  2K8E A;  4A5K A;  4HAU B;  2RVB B;  2VKI A;  4CSQ A;  4QJ4 B;  1V89 A;  2Q13 A;  3WA0 A;  3PVL A;  2FJL A;  2YT1 A;  4TYZ A;  4D0N B;  1FHW A;  3HW2 B;  2D9V A;  1RJ2 A;  2Z59 A;  4BBK A;  2COF A;  3FSS A;  2HTH B;  2Y7B A;  2UVM A;  2M14 A;  3KZ1 A;  2P0H A;  1LB1 A;  2LOZ A;  5KCV A;  2EMT A;  4KHO A;  4K17 A;  4Z2M B;  1DDV A;  4CYE A;  2YT2 A;  2RSG A;  4HAT B;  4PNK A;  1LW3 A;  4K2O A;  2ZPY A;  2Z13 A;  1OMW A;  3X23 A;  2H7E A;  1PFJ A;  3FEH A;  2AL6 A;  3T06 A;  1WGQ A;  4C0A A;  4GOU A;  4EKU A;  3A8Q A;  1XOD A;  3TO1 A;  2I5C A;  2UZR A;  1FGY A;  3HK0 A;  2K49 A;  2CY5 A;  5DHA B;  2LYD A;  2YVC A;  2YF0 A;  1UPR A;  2COA A;  2D4Q A;  3AJ4 A;  4HAV B;  2YRY A;  2MWN B;  1FAO A;  1V5M A;  2J0J A;  4KHB B;  4NY0 A;  4A6F A;  1FGZ A;  4MK0 A;  2QKM A;  3PZD A;  1OQN A;  1M7R A;  2YT0 A;  2N23 A;  1MK7 B;  3ZVR A;  2GCL A;  2VSZ A;  2I1K A;  2UZS A;  2DYQ A;  2N0Y A;  1DYN A;  3ML4 A;  3QWM A;  1NI2 A;  2DHJ A;  5D3W A;  1V5U A;  1OY2 A;  2P8V A;  2NZ8 B;  1T77 A;  2DX1 A;  1FB8 A;  4OT1 A;  1XKE A;  2KUP A;  2YS3 A;  1UNQ A;  1QQG A;  5DI9 B;  3WYF B;  1X1F A;  4HDQ A;  2R09 A;  2Z0Q A;  1H10 A;  2MDX A;  1X86 A;  3GYP A;  3M1I B;  5JLJ B;  2IFS A;  2VRW B;  1UNP A;  1I7A A;  1WG7 A;  2D10 A;  2RGN B;  3MDB C;  5JHG A;  1U5G A;  4KHA A;  1MPH A;  1MKE A;  2FJU B;  1BAK A;  3F0W A;  1P5T A;  4HB4 B;  1DDW A;  3ODX A;  5EFX A;  1X05 A;  3A58 A;  2PZ1 A;  4D6W A;  4GXB A;  4TKN A;  1KZ7 A;  4CHM A;  1WI1 A;  1ZM0 A;  5HE2 A;  1B55 A;  5LG4 B;  1U5E A;  4F7U P;  4HB2 B;  2D11 A;  3QIJ A;  2CY4 A;  1K5G B; 
#chains in the Genus database with same CATH homology
 4GNK B;  3OHM B;  4KHA A;  3FVC A;  2YT2 A;  5I2M A;  2FJU B;  4QXA B;  2GCJ A;  2GUM A;  3NWF A;  3GYO A;  5M4Y B;  3U12 A;  2Z14 A;  4IOY X;  2Z13 A;  2R2Y A;  1ZYI A;  2Z4D A;  3NWD A;  2ZKM X;  4OT1 A;  4PQ0 A;  2KIE A;  2Z59 A;  3FSS A;  4KHB B;  3A58 A;  4QJ3 B;  3NW8 A;  4D6W A;  4L1R A;  4DIX A;  4Z2N A;  5IRS A;  2KIG A;  4QJ5 B;  3NWA A;  3HIE A;  4GOU A;  4CSQ A;  2RRF A;  2K8E A;  3GYP A;  5LG4 B;  2GCL A;  2KUQ A;  2NBV A;  4IFS A;  3TW1 A;  3TO1 A;  5I2S A;  3TVV A;  2KR0 A;  4HSI A;  2K49 A;  4KHB A;  4KHO A;  4OSN A;  4QJ4 B;  4Z2M B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...