1V61A

Solution structure of the pleckstrin homology domain of alpha-pix
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
132
structure length
132
Chain Sequence
GSSGSSGQILSEPIQAWEGDDIKTLGNVIFMSQVVMQHGACEEKEERYFLLFSSVLIMLSASPRMSGFMYQGKIPIAGMVVNRLDEIEGSDCMFEITGSTVERIVVHCNNNQDFQEWMEQLNRLTKSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution Structure of the Pleckstrin Homology Domain of alpha-Pix
rcsb
source organism Mus musculus
molecule tags Signaling protein
molecule keywords Rac/Cdc42 guanine nucleotide exchange factor (GEF) 6
total genus 15
structure length 132
sequence length 132
ec nomenclature
pdb deposition date 2003-11-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00169 PH PH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 1v61A00
4BBKA 1K5DB 1V5PA 2J59M 5FI1A 3PVWA 5JHGA 2EC1A 2YT0A 4IOYX 2DKQA 2K2JA 2H7DA 2M38A 1MPHA 1DDMA 1FOEA 3TW1A 5FI0A 1P5TA 2ELBA 2ROVA 2LOXA 5C5BA 2W2XD 2H7EA 3AU5A 3ODOA 5C16A 1Q67A 1TXDA 3WA0A 3SV1A 2DHKA 2LYDA 1U5EA 1P3RA 3A8QA 4EMOA 1X1GA 1BTNA 1X86A 2V76A 3P7ZA 2DX1A 2LULA 5LOPB 1V5MA 2D9WA 2KUPA 4HATB 5GOWB 2YS1A 1EGXA 1XR0B 1DROA 1V61A 3D8EA 4IAPA 1QC6A 2I1JA 4A6HA 4Z2NA 5HE3A 1EF1A 2NMBA 3ODWA 2YSZA 1I2HA 1UNPA 4NY0A 3ZVRA 2Z0OA 2UVMA 2VRWB 3QIJA 2QKMA 1PMSA 2DN6A 1MAIA 5J3QA 2P0FA 3F0WA 4EJNA 2M14A 1KZ7A 5HE0A 4DBBA 4KHAA 4B6HA 5JLJB 4HAZB 4CHJA 5D3WA 2OTXA 1RRPB 1ISNA 2YT1A 1WG7A 4F7UP 1EVHA 2R09A 1SGHA 5EFXA 3ZDTA 5DHFB 3UZTA 3BJIA 1WGQA 2COAA 1N3HA 2Z0QA 2LG1A 3HQCA 2OQBA 4C0AA 4EKUA 2RGNB 1NTVA 1XKEA 2Y8FA 3RCPA 2YRYA 4A6FA 2YS3A 1X1FA 2DX5A 1LB1A 2BCJA 4HAWB 1RJ2A 1FHXA 3CIKA 1TJ6A 3F5RA 4HAYB 2DKPA 1ZC3B 2DA0A 2L1CA 1ZSQA 1WVHA 2CRFA 1UEFA 1EAZA 2KCJA 2I5CA 2UZSA 2EMSA 2UZRA 1U29A 1XCGA 2IFSA 1FGYA 4Y94A 4D0NB 1FAOA 1WJ1A 1U5FA 5CLLB 2D2QA 2RLOA 2J0JA 4HAXB 5D27A 2CAYA 2DTCA 3G9WA 3ODXA 2GCLA 1AQCA 3SYXA 2K2UA 2Y7BA 1TQZA 5JP4A 3MPXA 3FSSA 2D11A 2HTHB 1X11A 3TFMA 2J0MA 3DXEA 2ZPYA 2P0HA 3TVVA 5C79A 2AL6A 2D9YA 1PFJA 3VOQA 1U27A 4DX90 1U2BA 4F7GA 1Z87A 5C6RA 1E5WA 3A8PA 4WVFB 3KY9A 2KGXB 3DXCA 1V89A 5D3XA 1BAKA 1P6SA 3PVLA 1UNQA 1V5UA 4KHOA 4MT7A 4WSFA 4HHVA 1ZVRA 5J3YA 1M7RA 1AWEA 4MY6A 4H8SA 1FGZA 3LJUX 2I5FA 2MDXA 3ULBA 1LW3A 1XX0A 2CODA 3D8DA 1OY2A 3AU4A 1OMWA 2CY5A 4CHMA 1MIXA 1BWNA 2D9ZA 1DDWA 3KRWA 1FB8A 3V5WA 4L6EA 2EJ8A 1B55A 4KHBB 2P0DA 4TYZA 3PG7A 5C5BB 2YF0A 3OANA 3QBVB 5J3TA 4F7HA 3CXBB 4DXAB 2W2WA 3FEHA 4A6KA 1Y5OA 4KAXB 2ADZA 1WI1A 2AEHA 2J0KA 1OQNA 4HB0B 2R0DA 2ELAA 3KSYA 1J0WA 3SO6A 3PP2A 3IVFA 2P8VA 4HB4B 3SNHA 5L81A 4GXBA 5DI9B 1DYNA 1UPQA 4GMVA 4CYEA 5HE2A 1UNRA 4TKNA 3T06A 1H10A 1ZM0A 5D3VA 2RVBB 2MKRA 3PZDA 4GMXB 4HDOA 4A5KA 1WJMA 1MK7B 4XWXA 2VSZA 2Z0PA 1NI2A 1KZGA 2YS5A 3BINA 4IFSA 3X23A 1DDVA 5D3YA 4HDQA 3GYPA 1MIZB 4GN1A 4HAUB 4MK0A 3PEGA 2K00A 4GZUA 4HAVB 1WGUA 2HE7A 1XD4A 4K2PA 1IRSA 2IYBA 2D10A 2D4QA 2D9VA 2LKOA 4PQ0A 2RSGA 4YL8A 1GG3A 2RNRB 1QQGA 3D8FA 1U5DA 5DIFB 3U7DA 3KZ1A 1V88A 2GS0A 2RUKB 5DH9B 1H4RA 3O96A 3WYFB 4PNKA 4ZRKA 2DHIA 2PZ1A 2N23A 2CY4A 1PLSA 4GPTB 5CLQB 2JP2A 1J19A 3AJ4A 1I7AA 5LONB 1M7EA 4K17A 2Y8GA 2DHJA 2COFA 2GJYA 3NSUA 4ZRJA 3ULCA 3QWMA 2I1KA 2XQNM 4NSWA 4K2OA 1UPRA 1K5GB 3FM8C 3HK0A 3TCAA 1Y19B 4Z2MB 3PSCA 3SUZA 1FHWA 1NU2A 1W1GA 2W2XC 4DX8A 1SHCA 2EMTA 1FHOA 2QKLA 3A98B 1X05A 3TO1A 2YVCA 3U8ZA 2D9XA 1KI1B 3HW2B 2MFQA 5KQ1A 5KCVA 2FJLA 4WJ7A 1GC6A 2DYNA 4ZRIA 2COCA 1MK9B 2GCJA 4K81A 1XODA 5JHHA 3ML4A 3PVUA 3VIAA 2VKIA 1DBHA 1BTKA 3N7CA 2Q13A 2LOZA 2ROZB 4HB3B 3GYOA 1W1HA 2L2IA 5HE1A 4HB2B 1ZC4B 2E2XA 1NTYA 2DLWA 1MKEA 2MWNB 2N0YA 3MDBC 4YONA 4A6FB 2NZ8B 2G35A 2X18A 3P6AA 2DYQA 5DHAB 1W1DA 1GC7A 4P7IA 5KQ4A 3KRXA 4KVGB 2DFKA 3DXDA 3M1IB 1U5GA
chains in the Genus database with same CATH superfamily
4BBKA 1K5DB 1V5PA 2J59M 5FI1A 3PVWA 5JHGA 2EC1A 2YT0A 4IOYX 2DKQA 2K2JA 2H7DA 2M38A 4KHBA 1MPHA 1DDMA 1FOEA 3TW1A 5FI0A 1P5TA 2ELBA 2ROVA 2LOXA 4QJ3B 5C5BA 2W2XD 2H7EA 3AU5A 3ODOA 2K8EA 5C16A 1Q67A 1TXDA 3WA0A 3SV1A 2DHKA 2LYDA 1U5EA 1P3RA 3A8QA 4EMOA 4QXAB 1X1GA 1BTNA 1X86A 2FJUB 5I2MA 2V76A 3P7ZA 2DX1A 2LULA 2KIEA 5LOPB 1V5MA 2D9WA 2KUPA 4HATB 5GOWB 2YS1A 2KR0A 4QJ4B 1ZYIA 1EGXA 1XR0B 1DROA 1V61A 3D8EA 4IAPA 1QC6A 2I1JA 4A6HA 4Z2NA 5HE3A 1EF1A 2NMBA 3ODWA 2YSZA 3NW8A 1I2HA 1UNPA 4NY0A 3ZVRA 2Z0OA 2UVMA 1T77A 2VRWB 3QIJA 2QKMA 2R2YA 1PMSA 2DN6A 1MAIA 5J3QA 2P0FA 3F0WA 4EJNA 2M14A 1KZ7A 5HE0A 4DBBA 4KHAA 4B6HA 5JLJB 4HAZB 4CHJA 5D3WA 2OTXA 1RRPB 1ISNA 2YT1A 1WG7A 5M4YB 4F7UP 1EVHA 2R09A 4DIXA 1SGHA 4GOUA 5EFXA 3ZDTA 5DHFB 2Z13A 3UZTA 3BJIA 1WGQA 2COAA 1N3HA 2Z0QA 2LG1A 3HQCA 2OQBA 4C0AA 4EKUA 2RGNB 1NTVA 1XKEA 2Y8FA 3RCPA 2YRYA 4A6FA 2YS3A 1X1FA 2DX5A 1LB1A 1MI1A 2BCJA 4HAWB 1RJ2A 1FHXA 3CIKA 1TJ6A 3F5RA 4HAYB 2DKPA 1ZC3B 2DA0A 2L1CA 1ZSQA 1WVHA 2CRFA 1UEFA 1EAZA 2KCJA 4CSQA 2I5CA 2UZSA 2EMSA 2UZRA 1U29A 1XCGA 2IFSA 1FGYA 4Y94A 4D0NB 1FAOA 1WJ1A 1U5FA 5CLLB 2D2QA 2RLOA 4D6WA 2J0JA 4HAXB 5D27A 2CAYA 2DTCA 3G9WA 3ODXA 2GCLA 2RRFA 1AQCA 3SYXA 2K2UA 2Y7BA 1TQZA 5JP4A 3MPXA 3FSSA 2D11A 2HTHB 1X11A 3TFMA 2J0MA 3DXEA 2ZPYA 2P0HA 3TVVA 5C79A 2YT2A 2AL6A 2D9YA 1PFJA 3VOQA 1U27A 4DX90 1U2BA 4F7GA 1Z87A 5C6RA 1E5WA 3A8PA 4WVFB 3KY9A 2KGXB 3DXCA 1V89A 5D3XA 1BAKA 1P6SA 3PVLA 1UNQA 1V5UA 4KHOA 4MT7A 4WSFA 4HHVA 1ZVRA 5J3YA 1M7RA 1AWEA 4MY6A 4H8SA 1FGZA 3LJUX 2I5FA 2MDXA 3ULBA 1LW3A 1XX0A 2CODA 3D8DA 1OY2A 2KUQA 1OMWA 3AU4A 2CY5A 4CHMA 1MIXA 1BWNA 3B77A 2Z14A 2D9ZA 1DDWA 3KRWA 1FB8A 3V5WA 4L6EA 2EJ8A 1B55A 3HSAA 4KHBB 2P0DA 4TYZA 3PG7A 5C5BB 2YF0A 3OANA 3QBVB 5J3TA 4F7HA 3CXBB 4DXAB 2W2WA 3FEHA 4A6KA 1Y5OA 4KAXB 2ADZA 1WI1A 2AEHA 3NWAA 2J0KA 1OQNA 4HB0B 2R0DA 2ELAA 3KSYA 1J0WA 3SO6A 3PP2A 3IVFA 2P8VA 4HB4B 3SNHA 5L81A 4GXBA 5DI9B 1DYNA 1UPQA 2Z4DA 4GMVA 4CYEA 3FVCA 5HE2A 1UNRA 4TKNA 3T06A 1H10A 1ZM0A 5D3VA 2RVBB 2KIGA 2MKRA 3PZDA 4GMXB 4HDOA 4A5KA 1WJMA 1MK7B 4XWXA 2VSZA 2Z0PA 1NI2A 1KZGA 2YS5A 3BINA 4IFSA 3X23A 1DDVA 5D3YA 4HDQA 3GYPA 1MIZB 4GN1A 3HIEA 3OHMB 4HAUB 4MK0A 3PEGA 2K00A 4GZUA 4HAVB 1WGUA 2HE7A 1XD4A 4K2PA 1IRSA 2IYBA 2D10A 4QJ5B 5I2SA 2D4QA 2D9VA 2LKOA 4PQ0A 2RSGA 4YL8A 1GG3A 2RNRB 1QQGA 3D8FA 5LG4B 1U5DA 5DIFB 3U7DA 3KZ1A 1V88A 2GS0A 2RUKB 5DH9B 1H4RA 3O96A 3WYFB 4PNKA 4ZRKA 2DHIA 2PZ1A 2N23A 2CY4A 1PLSA 2K49A 4GPTB 5CLQB 2JP2A 1J19A 3AJ4A 1I7AA 5LONB 2GUMA 1M7EA 4K17A 2Y8GA 2DHJA 4OSNA 5IRSA 2COFA 2GJYA 3NSUA 4ZRJA 3NWFA 3ULCA 3QWMA 2I1KA 2XQNM 4GNKB 4NSWA 4K2OA 2NBVA 4HSIA 1UPRA 1K5GB 3U12A 4L1RA 3FM8C 4OT1A 3HK0A 3TCAA 1Y19B 4Z2MB 3PSCA 3SUZA 1FHWA 1NU2A 1W1GA 2W2XC 3NWDA 4DX8A 1SHCA 2EMTA 1FHOA 2QKLA 3A98B 1X05A 3TO1A 2YVCA 3U8ZA 2D9XA 1KI1B 3HW2B 2MFQA 5KQ1A 5KCVA 2FJLA 4WJ7A 1GC6A 2DYNA 4ZRIA 2COCA 1MK9B 2GCJA 4K81A 1XODA 5JHHA 3ML4A 3PVUA 3VIAA 2VKIA 1DBHA 1BTKA 3N7CA 2Q13A 2LOZA 2ROZB 4HB3B 3GYOA 1W1HA 2L2IA 5HE1A 4HB2B 1ZC4B 2E2XA 1NTYA 2DLWA 1MKEA 2MWNB 2N0YA 3MDBC 2Z59A 3A58A 4YONA 4A6FB 2NZ8B 2G35A 3DCXA 2X18A 3P6AA 2DYQA 5DHAB 1W1DA 1GC7A 4P7IA 5KQ4A 3KRXA 4KVGB 2DFKA 2ZKMX 3DXDA 3M1IB 1U5GA
chains in the Genus database with same CATH topology
4BBKA 1K5DB 1V5PA 2J59M 5FI1A 3PVWA 5JHGA 2EC1A 2YT0A 4IOYX 2DKQA 2K2JA 2H7DA 2M38A 1MPHA 1DDMA 1FOEA 3TW1A 5FI0A 1P5TA 2ELBA 2ROVA 2LOXA 5C5BA 2W2XD 2H7EA 3AU5A 3ODOA 5C16A 1Q67A 1TXDA 3WA0A 3SV1A 2DHKA 2LYDA 1U5EA 1P3RA 3A8QA 4EMOA 1X1GA 1BTNA 1X86A 2V76A 3P7ZA 2DX1A 2LULA 5LOPB 1V5MA 2D9WA 2KUPA 4HATB 5GOWB 2YS1A 1EGXA 1XR0B 1DROA 1V61A 3D8EA 4IAPA 1QC6A 2I1JA 4A6HA 4Z2NA 5HE3A 1EF1A 2NMBA 3ODWA 2YSZA 1I2HA 1UNPA 4NY0A 3ZVRA 2Z0OA 2UVMA 2VRWB 3QIJA 2QKMA 1PMSA 2DN6A 1MAIA 5J3QA 2P0FA 3F0WA 4EJNA 2M14A 1KZ7A 5HE0A 4DBBA 4KHAA 4B6HA 5JLJB 4HAZB 4CHJA 5D3WA 2OTXA 1RRPB 1ISNA 2YT1A 1WG7A 4F7UP 1EVHA 2R09A 1SGHA 5EFXA 3ZDTA 5DHFB 3UZTA 3BJIA 1WGQA 2COAA 1N3HA 2Z0QA 2LG1A 3HQCA 2OQBA 4C0AA 4EKUA 2RGNB 1NTVA 1XKEA 2Y8FA 3RCPA 2YRYA 4A6FA 2YS3A 1X1FA 2DX5A 1LB1A 2BCJA 4HAWB 1RJ2A 1FHXA 3CIKA 1TJ6A 3F5RA 4HAYB 2DKPA 1ZC3B 2DA0A 2L1CA 1ZSQA 1WVHA 2CRFA 1UEFA 1EAZA 2KCJA 2I5CA 2UZSA 2EMSA 2UZRA 1U29A 1XCGA 2IFSA 1FGYA 4Y94A 4D0NB 1FAOA 1WJ1A 1U5FA 5CLLB 2D2QA 2RLOA 2J0JA 4HAXB 5D27A 2CAYA 2DTCA 3G9WA 3ODXA 2GCLA 1AQCA 3SYXA 2K2UA 2Y7BA 1TQZA 5JP4A 3MPXA 3FSSA 2D11A 2HTHB 1X11A 3TFMA 2J0MA 3DXEA 2ZPYA 2P0HA 3TVVA 5C79A 2AL6A 2D9YA 1PFJA 3VOQA 1U27A 4DX90 1U2BA 4F7GA 1Z87A 5C6RA 1E5WA 3A8PA 4WVFB 3KY9A 2KGXB 3DXCA 1V89A 5D3XA 1BAKA 1P6SA 3PVLA 1UNQA 1V5UA 4KHOA 4MT7A 4WSFA 4HHVA 1ZVRA 5J3YA 1M7RA 1AWEA 4MY6A 4H8SA 1FGZA 3LJUX 2I5FA 2MDXA 3ULBA 1LW3A 1XX0A 2CODA 3D8DA 1OY2A 3AU4A 1OMWA 2CY5A 4CHMA 1MIXA 1BWNA 2D9ZA 1DDWA 3KRWA 1FB8A 3V5WA 4L6EA 2EJ8A 1B55A 4KHBB 2P0DA 4TYZA 3PG7A 5C5BB 2YF0A 3OANA 3QBVB 5J3TA 4F7HA 3CXBB 4DXAB 2W2WA 3FEHA 4A6KA 1Y5OA 4KAXB 2ADZA 1WI1A 2AEHA 2J0KA 1OQNA 4HB0B 2R0DA 2ELAA 3KSYA 1J0WA 3SO6A 3PP2A 3IVFA 2P8VA 4HB4B 3SNHA 5L81A 4GXBA 5DI9B 1DYNA 1UPQA 4GMVA 4CYEA 5HE2A 1UNRA 4TKNA 3T06A 1H10A 1ZM0A 5D3VA 2RVBB 2MKRA 3PZDA 4GMXB 4HDOA 4A5KA 1WJMA 1MK7B 4XWXA 2VSZA 2Z0PA 1NI2A 1KZGA 2YS5A 3BINA 4IFSA 3X23A 1DDVA 5D3YA 4HDQA 3GYPA 1MIZB 4GN1A 4HAUB 4MK0A 3PEGA 2K00A 4GZUA 4HAVB 1WGUA 2HE7A 1XD4A 4K2PA 1IRSA 2IYBA 2D10A 2D4QA 2D9VA 2LKOA 4PQ0A 2RSGA 4YL8A 1GG3A 2RNRB 1QQGA 3D8FA 1U5DA 5DIFB 3U7DA 3KZ1A 1V88A 2GS0A 2RUKB 5DH9B 1H4RA 3O96A 3WYFB 4PNKA 4ZRKA 2DHIA 2PZ1A 2N23A 2CY4A 1PLSA 4GPTB 5CLQB 2JP2A 1J19A 3AJ4A 1I7AA 5LONB 1M7EA 4K17A 2Y8GA 2DHJA 2COFA 2GJYA 3NSUA 4ZRJA 3ULCA 3QWMA 2I1KA 2XQNM 4NSWA 4K2OA 1UPRA 1K5GB 3FM8C 3HK0A 3TCAA 1Y19B 4Z2MB 3PSCA 3SUZA 1FHWA 1NU2A 1W1GA 2W2XC 4DX8A 1SHCA 2EMTA 1FHOA 2QKLA 3A98B 1X05A 3TO1A 2YVCA 3U8ZA 2D9XA 1KI1B 3HW2B 2MFQA 5KQ1A 5KCVA 2FJLA 4WJ7A 1GC6A 2DYNA 4ZRIA 2COCA 1MK9B 2GCJA 4K81A 1XODA 5JHHA 3ML4A 3PVUA 3VIAA 2VKIA 1DBHA 1BTKA 3N7CA 2Q13A 2LOZA 2ROZB 4HB3B 3GYOA 1W1HA 2L2IA 5HE1A 4HB2B 1ZC4B 2E2XA 1NTYA 2DLWA 1MKEA 2MWNB 2N0YA 3MDBC 4YONA 4A6FB 2NZ8B 2G35A 2X18A 3P6AA 2DYQA 5DHAB 1W1DA 1GC7A 4P7IA 5KQ4A 3KRXA 4KVGB 2DFKA 3DXDA 3M1IB 1U5GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BBK A;  1K5D B;  1V5P A;  2J59 M;  5FI1 A;  3PVW A;  5JHG A;  2EC1 A;  2YT0 A;  4IOY X;  2DKQ A;  2K2J A;  2H7D A;  2M38 A;  1MPH A;  1DDM A;  1FOE A;  3TW1 A;  5FI0 A;  1P5T A;  2ELB A;  2ROV A;  2LOX A;  5C5B A;  2W2X D;  2H7E A;  3AU5 A;  3ODO A;  5C16 A;  1Q67 A;  1TXD A;  3WA0 A;  3SV1 A;  2DHK A;  2LYD A;  1U5E A;  1P3R A;  3A8Q A;  4EMO A;  1X1G A;  1BTN A;  1X86 A;  2V76 A;  3P7Z A;  2DX1 A;  2LUL A;  5LOP B;  1V5M A;  2D9W A;  2KUP A;  4HAT B;  5GOW B;  2YS1 A;  1EGX A;  1XR0 B;  1DRO A;  1V61 A;  3D8E A;  4IAP A;  1QC6 A;  2I1J A;  4A6H A;  4Z2N A;  5HE3 A;  1EF1 A;  2NMB A;  3ODW A;  2YSZ A;  1I2H A;  1UNP A;  4NY0 A;  3ZVR A;  2Z0O A;  2UVM A;  2VRW B;  3QIJ A;  2QKM A;  1PMS A;  2DN6 A;  1MAI A;  5J3Q A;  2P0F A;  3F0W A;  4EJN A;  2M14 A;  1KZ7 A;  5HE0 A;  4DBB A;  4KHA A;  4B6H A;  5JLJ B;  4HAZ B;  4CHJ A;  5D3W A;  2OTX A;  1RRP B;  1ISN A;  2YT1 A;  1WG7 A;  4F7U P;  1EVH A;  2R09 A;  1SGH A;  5EFX A;  3ZDT A;  5DHF B;  3UZT A;  3BJI A;  1WGQ A;  2COA A;  1N3H A;  2Z0Q A;  2LG1 A;  3HQC A;  2OQB A;  4C0A A;  4EKU A;  2RGN B;  1NTV A;  1XKE A;  2Y8F A;  3RCP A;  2YRY A;  4A6F A;  2YS3 A;  1X1F A;  2DX5 A;  1LB1 A;  2BCJ A;  4HAW B;  1RJ2 A;  1FHX A;  3CIK A;  1TJ6 A;  3F5R A;  4HAY B;  2DKP A;  1ZC3 B;  2DA0 A;  2L1C A;  1ZSQ A;  1WVH A;  2CRF A;  1UEF A;  1EAZ A;  2KCJ A;  2I5C A;  2UZS A;  2EMS A;  2UZR A;  1U29 A;  1XCG A;  2IFS A;  1FGY A;  4Y94 A;  4D0N B;  1FAO A;  1WJ1 A;  1U5F A;  5CLL B;  2D2Q A;  2RLO A;  2J0J A;  4HAX B;  5D27 A;  2CAY A;  2DTC A;  3G9W A;  3ODX A;  2GCL A;  1AQC A;  3SYX A;  2K2U A;  2Y7B A;  1TQZ A;  5JP4 A;  3MPX A;  3FSS A;  2D11 A;  2HTH B;  1X11 A;  3TFM A;  2J0M A;  3DXE A;  2ZPY A;  2P0H A;  3TVV A;  5C79 A;  2AL6 A;  2D9Y A;  1PFJ A;  3VOQ A;  1U27 A;  4DX9 0;  1U2B A;  4F7G A;  1Z87 A;  5C6R A;  1E5W A;  3A8P A;  4WVF B;  3KY9 A;  2KGX B;  3DXC A;  1V89 A;  5D3X A;  1BAK A;  1P6S A;  3PVL A;  1UNQ A;  1V5U A;  4KHO A;  4MT7 A;  4WSF A;  4HHV A;  1ZVR A;  5J3Y A;  1M7R A;  1AWE A;  4MY6 A;  4H8S A;  1FGZ A;  3LJU X;  2I5F A;  2MDX A;  3ULB A;  1LW3 A;  1XX0 A;  2COD A;  3D8D A;  1OY2 A;  3AU4 A;  1OMW A;  2CY5 A;  4CHM A;  1MIX A;  1BWN A;  2D9Z A;  1DDW A;  3KRW A;  1FB8 A;  3V5W A;  4L6E A;  2EJ8 A;  1B55 A;  4KHB B;  2P0D A;  4TYZ A;  3PG7 A;  5C5B B;  2YF0 A;  3OAN A;  3QBV B;  5J3T A;  4F7H A;  3CXB B;  4DXA B;  2W2W A;  3FEH A;  4A6K A;  1Y5O A;  4KAX B;  2ADZ A;  1WI1 A;  2AEH A;  2J0K A;  1OQN A;  4HB0 B;  2R0D A;  2ELA A;  3KSY A;  1J0W A;  3SO6 A;  3PP2 A;  3IVF A;  2P8V A;  4HB4 B;  3SNH A;  5L81 A;  4GXB A;  5DI9 B;  1DYN A;  1UPQ A;  4GMV A;  4CYE A;  5HE2 A;  1UNR A;  4TKN A;  3T06 A;  1H10 A;  1ZM0 A;  5D3V A;  2RVB B;  2MKR A;  3PZD A;  4GMX B;  4HDO A;  4A5K A;  1WJM A;  1MK7 B;  4XWX A;  2VSZ A;  2Z0P A;  1NI2 A;  1KZG A;  2YS5 A;  3BIN A;  4IFS A;  3X23 A;  1DDV A;  5D3Y A;  4HDQ A;  3GYP A;  1MIZ B;  4GN1 A;  4HAU B;  4MK0 A;  3PEG A;  2K00 A;  4GZU A;  4HAV B;  1WGU A;  2HE7 A;  1XD4 A;  4K2P A;  1IRS A;  2IYB A;  2D10 A;  2D4Q A;  2D9V A;  2LKO A;  4PQ0 A;  2RSG A;  4YL8 A;  1GG3 A;  2RNR B;  1QQG A;  3D8F A;  1U5D A;  5DIF B;  3U7D A;  3KZ1 A;  1V88 A;  2GS0 A;  2RUK B;  5DH9 B;  1H4R A;  3O96 A;  3WYF B;  4PNK A;  4ZRK A;  2DHI A;  2PZ1 A;  2N23 A;  2CY4 A;  1PLS A;  4GPT B;  5CLQ B;  2JP2 A;  1J19 A;  3AJ4 A;  1I7A A;  5LON B;  1M7E A;  4K17 A;  2Y8G A;  2DHJ A;  2COF A;  2GJY A;  3NSU A;  4ZRJ A;  3ULC A;  3QWM A;  2I1K A;  2XQN M;  4NSW A;  4K2O A;  1UPR A;  1K5G B;  3FM8 C;  3HK0 A;  3TCA A;  1Y19 B;  4Z2M B;  3PSC A;  3SUZ A;  1FHW A;  1NU2 A;  1W1G A;  2W2X C;  4DX8 A;  1SHC A;  2EMT A;  1FHO A;  2QKL A;  3A98 B;  1X05 A;  3TO1 A;  2YVC A;  3U8Z A;  2D9X A;  1KI1 B;  3HW2 B;  2MFQ A;  5KQ1 A;  5KCV A;  2FJL A;  4WJ7 A;  1GC6 A;  2DYN A;  4ZRI A;  2COC A;  1MK9 B;  2GCJ A;  4K81 A;  1XOD A;  5JHH A;  3ML4 A;  3PVU A;  3VIA A;  2VKI A;  1DBH A;  1BTK A;  3N7C A;  2Q13 A;  2LOZ A;  2ROZ B;  4HB3 B;  3GYO A;  1W1H A;  2L2I A;  5HE1 A;  4HB2 B;  1ZC4 B;  2E2X A;  1NTY A;  2DLW A;  1MKE A;  2MWN B;  2N0Y A;  3MDB C;  4YON A;  4A6F B;  2NZ8 B;  2G35 A;  2X18 A;  3P6A A;  2DYQ A;  5DHA B;  1W1D A;  1GC7 A;  4P7I A;  5KQ4 A;  3KRX A;  4KVG B;  2DFK A;  3DXD A;  3M1I B;  1U5G A; 
#chains in the Genus database with same CATH topology
 4BBK A;  1K5D B;  1V5P A;  2J59 M;  5FI1 A;  3PVW A;  5JHG A;  2EC1 A;  2YT0 A;  4IOY X;  2DKQ A;  2K2J A;  2H7D A;  2M38 A;  4KHB A;  1MPH A;  1DDM A;  1FOE A;  3TW1 A;  5FI0 A;  1P5T A;  2ELB A;  2ROV A;  2LOX A;  4QJ3 B;  5C5B A;  2W2X D;  2H7E A;  3AU5 A;  3ODO A;  2K8E A;  5C16 A;  1Q67 A;  1TXD A;  3WA0 A;  3SV1 A;  2DHK A;  2LYD A;  1U5E A;  1P3R A;  3A8Q A;  4EMO A;  4QXA B;  1X1G A;  1BTN A;  1X86 A;  2FJU B;  5I2M A;  2V76 A;  3P7Z A;  2DX1 A;  2LUL A;  2KIE A;  5LOP B;  1V5M A;  2D9W A;  2KUP A;  4HAT B;  5GOW B;  2YS1 A;  2KR0 A;  4QJ4 B;  1ZYI A;  1EGX A;  1XR0 B;  1DRO A;  1V61 A;  3D8E A;  4IAP A;  1QC6 A;  2I1J A;  4A6H A;  4Z2N A;  5HE3 A;  1EF1 A;  2NMB A;  3ODW A;  2YSZ A;  3NW8 A;  1I2H A;  1UNP A;  4NY0 A;  3ZVR A;  2Z0O A;  2UVM A;  1T77 A;  2VRW B;  3QIJ A;  2QKM A;  2R2Y A;  1PMS A;  2DN6 A;  1MAI A;  5J3Q A;  2P0F A;  3F0W A;  4EJN A;  2M14 A;  1KZ7 A;  5HE0 A;  4DBB A;  4KHA A;  4B6H A;  5JLJ B;  4HAZ B;  4CHJ A;  5D3W A;  2OTX A;  1RRP B;  1ISN A;  2YT1 A;  1WG7 A;  5M4Y B;  4F7U P;  1EVH A;  2R09 A;  4DIX A;  1SGH A;  4GOU A;  5EFX A;  3ZDT A;  5DHF B;  2Z13 A;  3UZT A;  3BJI A;  1WGQ A;  2COA A;  1N3H A;  2Z0Q A;  2LG1 A;  3HQC A;  2OQB A;  4C0A A;  4EKU A;  2RGN B;  1NTV A;  1XKE A;  2Y8F A;  3RCP A;  2YRY A;  4A6F A;  2YS3 A;  1X1F A;  2DX5 A;  1LB1 A;  1MI1 A;  2BCJ A;  4HAW B;  1RJ2 A;  1FHX A;  3CIK A;  1TJ6 A;  3F5R A;  4HAY B;  2DKP A;  1ZC3 B;  2DA0 A;  2L1C A;  1ZSQ A;  1WVH A;  2CRF A;  1UEF A;  1EAZ A;  2KCJ A;  4CSQ A;  2I5C A;  2UZS A;  2EMS A;  2UZR A;  1U29 A;  1XCG A;  2IFS A;  1FGY A;  4Y94 A;  4D0N B;  1FAO A;  1WJ1 A;  1U5F A;  5CLL B;  2D2Q A;  2RLO A;  4D6W A;  2J0J A;  4HAX B;  5D27 A;  2CAY A;  2DTC A;  3G9W A;  3ODX A;  2GCL A;  2RRF A;  1AQC A;  3SYX A;  2K2U A;  2Y7B A;  1TQZ A;  5JP4 A;  3MPX A;  3FSS A;  2D11 A;  2HTH B;  1X11 A;  3TFM A;  2J0M A;  3DXE A;  2ZPY A;  2P0H A;  3TVV A;  5C79 A;  2YT2 A;  2AL6 A;  2D9Y A;  1PFJ A;  3VOQ A;  1U27 A;  4DX9 0;  1U2B A;  4F7G A;  1Z87 A;  5C6R A;  1E5W A;  3A8P A;  4WVF B;  3KY9 A;  2KGX B;  3DXC A;  1V89 A;  5D3X A;  1BAK A;  1P6S A;  3PVL A;  1UNQ A;  1V5U A;  4KHO A;  4MT7 A;  4WSF A;  4HHV A;  1ZVR A;  5J3Y A;  1M7R A;  1AWE A;  4MY6 A;  4H8S A;  1FGZ A;  3LJU X;  2I5F A;  2MDX A;  3ULB A;  1LW3 A;  1XX0 A;  2COD A;  3D8D A;  1OY2 A;  2KUQ A;  1OMW A;  3AU4 A;  2CY5 A;  4CHM A;  1MIX A;  1BWN A;  3B77 A;  2Z14 A;  2D9Z A;  1DDW A;  3KRW A;  1FB8 A;  3V5W A;  4L6E A;  2EJ8 A;  1B55 A;  3HSA A;  4KHB B;  2P0D A;  4TYZ A;  3PG7 A;  5C5B B;  2YF0 A;  3OAN A;  3QBV B;  5J3T A;  4F7H A;  3CXB B;  4DXA B;  2W2W A;  3FEH A;  4A6K A;  1Y5O A;  4KAX B;  2ADZ A;  1WI1 A;  2AEH A;  3NWA A;  2J0K A;  1OQN A;  4HB0 B;  2R0D A;  2ELA A;  3KSY A;  1J0W A;  3SO6 A;  3PP2 A;  3IVF A;  2P8V A;  4HB4 B;  3SNH A;  5L81 A;  4GXB A;  5DI9 B;  1DYN A;  1UPQ A;  2Z4D A;  4GMV A;  4CYE A;  3FVC A;  5HE2 A;  1UNR A;  4TKN A;  3T06 A;  1H10 A;  1ZM0 A;  5D3V A;  2RVB B;  2KIG A;  2MKR A;  3PZD A;  4GMX B;  4HDO A;  4A5K A;  1WJM A;  1MK7 B;  4XWX A;  2VSZ A;  2Z0P A;  1NI2 A;  1KZG A;  2YS5 A;  3BIN A;  4IFS A;  3X23 A;  1DDV A;  5D3Y A;  4HDQ A;  3GYP A;  1MIZ B;  4GN1 A;  3HIE A;  3OHM B;  4HAU B;  4MK0 A;  3PEG A;  2K00 A;  4GZU A;  4HAV B;  1WGU A;  2HE7 A;  1XD4 A;  4K2P A;  1IRS A;  2IYB A;  2D10 A;  4QJ5 B;  5I2S A;  2D4Q A;  2D9V A;  2LKO A;  4PQ0 A;  2RSG A;  4YL8 A;  1GG3 A;  2RNR B;  1QQG A;  3D8F A;  5LG4 B;  1U5D A;  5DIF B;  3U7D A;  3KZ1 A;  1V88 A;  2GS0 A;  2RUK B;  5DH9 B;  1H4R A;  3O96 A;  3WYF B;  4PNK A;  4ZRK A;  2DHI A;  2PZ1 A;  2N23 A;  2CY4 A;  1PLS A;  2K49 A;  4GPT B;  5CLQ B;  2JP2 A;  1J19 A;  3AJ4 A;  1I7A A;  5LON B;  2GUM A;  1M7E A;  4K17 A;  2Y8G A;  2DHJ A;  4OSN A;  5IRS A;  2COF A;  2GJY A;  3NSU A;  4ZRJ A;  3NWF A;  3ULC A;  3QWM A;  2I1K A;  2XQN M;  4GNK B;  4NSW A;  4K2O A;  2NBV A;  4HSI A;  1UPR A;  1K5G B;  3U12 A;  4L1R A;  3FM8 C;  4OT1 A;  3HK0 A;  3TCA A;  1Y19 B;  4Z2M B;  3PSC A;  3SUZ A;  1FHW A;  1NU2 A;  1W1G A;  2W2X C;  3NWD A;  4DX8 A;  1SHC A;  2EMT A;  1FHO A;  2QKL A;  3A98 B;  1X05 A;  3TO1 A;  2YVC A;  3U8Z A;  2D9X A;  1KI1 B;  3HW2 B;  2MFQ A;  5KQ1 A;  5KCV A;  2FJL A;  4WJ7 A;  1GC6 A;  2DYN A;  4ZRI A;  2COC A;  1MK9 B;  2GCJ A;  4K81 A;  1XOD A;  5JHH A;  3ML4 A;  3PVU A;  3VIA A;  2VKI A;  1DBH A;  1BTK A;  3N7C A;  2Q13 A;  2LOZ A;  2ROZ B;  4HB3 B;  3GYO A;  1W1H A;  2L2I A;  5HE1 A;  4HB2 B;  1ZC4 B;  2E2X A;  1NTY A;  2DLW A;  1MKE A;  2MWN B;  2N0Y A;  3MDB C;  2Z59 A;  3A58 A;  4YON A;  4A6F B;  2NZ8 B;  2G35 A;  3DCX A;  2X18 A;  3P6A A;  2DYQ A;  5DHA B;  1W1D A;  1GC7 A;  4P7I A;  5KQ4 A;  3KRX A;  4KVG B;  2DFK A;  2ZKM X;  3DXD A;  3M1I B;  1U5G A; 
#chains in the Genus database with same CATH homology
 4BBK A;  1K5D B;  1V5P A;  2J59 M;  5FI1 A;  3PVW A;  5JHG A;  2EC1 A;  2YT0 A;  4IOY X;  2DKQ A;  2K2J A;  2H7D A;  2M38 A;  1MPH A;  1DDM A;  1FOE A;  3TW1 A;  5FI0 A;  1P5T A;  2ELB A;  2ROV A;  2LOX A;  5C5B A;  2W2X D;  2H7E A;  3AU5 A;  3ODO A;  5C16 A;  1Q67 A;  1TXD A;  3WA0 A;  3SV1 A;  2DHK A;  2LYD A;  1U5E A;  1P3R A;  3A8Q A;  4EMO A;  1X1G A;  1BTN A;  1X86 A;  2V76 A;  3P7Z A;  2DX1 A;  2LUL A;  5LOP B;  1V5M A;  2D9W A;  2KUP A;  4HAT B;  5GOW B;  2YS1 A;  1EGX A;  1XR0 B;  1DRO A;  1V61 A;  3D8E A;  4IAP A;  1QC6 A;  2I1J A;  4A6H A;  4Z2N A;  5HE3 A;  1EF1 A;  2NMB A;  3ODW A;  2YSZ A;  1I2H A;  1UNP A;  4NY0 A;  3ZVR A;  2Z0O A;  2UVM A;  2VRW B;  3QIJ A;  2QKM A;  1PMS A;  2DN6 A;  1MAI A;  5J3Q A;  2P0F A;  3F0W A;  4EJN A;  2M14 A;  1KZ7 A;  5HE0 A;  4DBB A;  4KHA A;  4B6H A;  5JLJ B;  4HAZ B;  4CHJ A;  5D3W A;  2OTX A;  1RRP B;  1ISN A;  2YT1 A;  1WG7 A;  4F7U P;  1EVH A;  2R09 A;  1SGH A;  5EFX A;  3ZDT A;  5DHF B;  3UZT A;  3BJI A;  1WGQ A;  2COA A;  1N3H A;  2Z0Q A;  2LG1 A;  3HQC A;  2OQB A;  4C0A A;  4EKU A;  2RGN B;  1NTV A;  1XKE A;  2Y8F A;  3RCP A;  2YRY A;  4A6F A;  2YS3 A;  1X1F A;  2DX5 A;  1LB1 A;  2BCJ A;  4HAW B;  1RJ2 A;  1FHX A;  3CIK A;  1TJ6 A;  3F5R A;  4HAY B;  2DKP A;  1ZC3 B;  2DA0 A;  2L1C A;  1ZSQ A;  1WVH A;  2CRF A;  1UEF A;  1EAZ A;  2KCJ A;  2I5C A;  2UZS A;  2EMS A;  2UZR A;  1U29 A;  1XCG A;  2IFS A;  1FGY A;  4Y94 A;  4D0N B;  1FAO A;  1WJ1 A;  1U5F A;  5CLL B;  2D2Q A;  2RLO A;  2J0J A;  4HAX B;  5D27 A;  2CAY A;  2DTC A;  3G9W A;  3ODX A;  2GCL A;  1AQC A;  3SYX A;  2K2U A;  2Y7B A;  1TQZ A;  5JP4 A;  3MPX A;  3FSS A;  2D11 A;  2HTH B;  1X11 A;  3TFM A;  2J0M A;  3DXE A;  2ZPY A;  2P0H A;  3TVV A;  5C79 A;  2AL6 A;  2D9Y A;  1PFJ A;  3VOQ A;  1U27 A;  4DX9 0;  1U2B A;  4F7G A;  1Z87 A;  5C6R A;  1E5W A;  3A8P A;  4WVF B;  3KY9 A;  2KGX B;  3DXC A;  1V89 A;  5D3X A;  1BAK A;  1P6S A;  3PVL A;  1UNQ A;  1V5U A;  4KHO A;  4MT7 A;  4WSF A;  4HHV A;  1ZVR A;  5J3Y A;  1M7R A;  1AWE A;  4MY6 A;  4H8S A;  1FGZ A;  3LJU X;  2I5F A;  2MDX A;  3ULB A;  1LW3 A;  1XX0 A;  2COD A;  3D8D A;  1OY2 A;  3AU4 A;  1OMW A;  2CY5 A;  4CHM A;  1MIX A;  1BWN A;  2D9Z A;  1DDW A;  3KRW A;  1FB8 A;  3V5W A;  4L6E A;  2EJ8 A;  1B55 A;  4KHB B;  2P0D A;  4TYZ A;  3PG7 A;  5C5B B;  2YF0 A;  3OAN A;  3QBV B;  5J3T A;  4F7H A;  3CXB B;  4DXA B;  2W2W A;  3FEH A;  4A6K A;  1Y5O A;  4KAX B;  2ADZ A;  1WI1 A;  2AEH A;  2J0K A;  1OQN A;  4HB0 B;  2R0D A;  2ELA A;  3KSY A;  1J0W A;  3SO6 A;  3PP2 A;  3IVF A;  2P8V A;  4HB4 B;  3SNH A;  5L81 A;  4GXB A;  5DI9 B;  1DYN A;  1UPQ A;  4GMV A;  4CYE A;  5HE2 A;  1UNR A;  4TKN A;  3T06 A;  1H10 A;  1ZM0 A;  5D3V A;  2RVB B;  2MKR A;  3PZD A;  4GMX B;  4HDO A;  4A5K A;  1WJM A;  1MK7 B;  4XWX A;  2VSZ A;  2Z0P A;  1NI2 A;  1KZG A;  2YS5 A;  3BIN A;  4IFS A;  3X23 A;  1DDV A;  5D3Y A;  4HDQ A;  3GYP A;  1MIZ B;  4GN1 A;  4HAU B;  4MK0 A;  3PEG A;  2K00 A;  4GZU A;  4HAV B;  1WGU A;  2HE7 A;  1XD4 A;  4K2P A;  1IRS A;  2IYB A;  2D10 A;  2D4Q A;  2D9V A;  2LKO A;  4PQ0 A;  2RSG A;  4YL8 A;  1GG3 A;  2RNR B;  1QQG A;  3D8F A;  1U5D A;  5DIF B;  3U7D A;  3KZ1 A;  1V88 A;  2GS0 A;  2RUK B;  5DH9 B;  1H4R A;  3O96 A;  3WYF B;  4PNK A;  4ZRK A;  2DHI A;  2PZ1 A;  2N23 A;  2CY4 A;  1PLS A;  4GPT B;  5CLQ B;  2JP2 A;  1J19 A;  3AJ4 A;  1I7A A;  5LON B;  1M7E A;  4K17 A;  2Y8G A;  2DHJ A;  2COF A;  2GJY A;  3NSU A;  4ZRJ A;  3ULC A;  3QWM A;  2I1K A;  2XQN M;  4NSW A;  4K2O A;  1UPR A;  1K5G B;  3FM8 C;  3HK0 A;  3TCA A;  1Y19 B;  4Z2M B;  3PSC A;  3SUZ A;  1FHW A;  1NU2 A;  1W1G A;  2W2X C;  4DX8 A;  1SHC A;  2EMT A;  1FHO A;  2QKL A;  3A98 B;  1X05 A;  3TO1 A;  2YVC A;  3U8Z A;  2D9X A;  1KI1 B;  3HW2 B;  2MFQ A;  5KQ1 A;  5KCV A;  2FJL A;  4WJ7 A;  1GC6 A;  2DYN A;  4ZRI A;  2COC A;  1MK9 B;  2GCJ A;  4K81 A;  1XOD A;  5JHH A;  3ML4 A;  3PVU A;  3VIA A;  2VKI A;  1DBH A;  1BTK A;  3N7C A;  2Q13 A;  2LOZ A;  2ROZ B;  4HB3 B;  3GYO A;  1W1H A;  2L2I A;  5HE1 A;  4HB2 B;  1ZC4 B;  2E2X A;  1NTY A;  2DLW A;  1MKE A;  2MWN B;  2N0Y A;  3MDB C;  4YON A;  4A6F B;  2NZ8 B;  2G35 A;  2X18 A;  3P6A A;  2DYQ A;  5DHA B;  1W1D A;  1GC7 A;  4P7I A;  5KQ4 A;  3KRX A;  4KVG B;  2DFK A;  3DXD A;  3M1I B;  1U5G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...