1V61A

Solution structure of the pleckstrin homology domain of alpha-pix
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
132
structure length
132
Chain Sequence
b'GSSGSSGQILSEPIQAWEGDDIKTLGNVIFMSQVVMQHGACEEKEERYFLLFSSVLIMLSASPRMSGFMYQGKIPIAGMVVNRLDEIEGSDCMFEITGSTVERIVVHCNNNQDFQEWMEQLNRLTKSGPSSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Rac/Cdc42 guanine nucleotide exchange factor (GEF) 6
molecule tags Signaling protein
source organism Mus musculus
publication title Solution Structure of the Pleckstrin Homology Domain of alpha-Pix
rcsb
total genus 15
structure length 132
sequence length 132
ec nomenclature
pdb deposition date 2003-11-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00169 PH PH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 1v61A00
1FAOA 1X11A 2M14A 4WSFA 3ULBA 3AJ4A 2LKOA 1MK7B 2RLOA 1DDVA 1EF1A 3FEHA 4HDOA 1EGXA 3KRWA 3TFMA 2Y7BA 3WYFB 1UPRA 5C79A 1XCGA 1PLSA 4WVFB 1W1GA 2GJYA 5D3WA 2OQBA 2KUPA 2J0KA 2YS5A 2OTXA 1V5UA 3PVLA 4IAPA 1XD4A 5D3YA 1BTKA 5DHAB 1U5GA 1FGYA 1UEFA 1U27A 2N23A 2DKQA 4K2OA 3HW2B 1NTYA 1FOEA 3TO1A 3NSUA 2EMTA 2YSZA 2R0DA 4ZRJA 2HE7A 4DBBA 2DX1A 2Y8GA 5DH9B 3GYOA 3TVVA 3ODOA 1X05A 2PZ1A 2JP2A 3DXCA 2UVMA 2D9WA 2QKMA 3TW1A 1I7AA 1MKEA 4A6KA 1MK9B 3A8PA 3PEGA 4HAZB 3UZTA 1M7EA 1UNRA 5JHGA 4C0AA 2DLWA 2DHJA 3ODXA 1N3HA 1AWEA 1DDWA 3G9WA 2P8VA 1ZM0A 2LULA 4MT7A 2X18A 3KZ1A 2EMSA 4NSWA 2ELBA 4KAXB 2DYNA 1FB8A 3F5RA 4YL8A 1IRSA 1OQNA 1NU2A 2GS0A 3OANA 2ROZB 1ZSQA 3P6AA 4HB0B 1AQCA 2CODA 4ZRKA 4K2PA 1BAKA 1V88A 3RCPA 2YS1A 1ZC3B 1P6SA 5CLLB 2MFQA 1ZVRA 4Y94A 4D0NB 2GCJA 1KZGA 1WJ1A 2GCLA 4A5KA 2DTCA 2UZSA 3F0WA 4HB4B 3QBVB 4EKUA 4MK0A 3BJIA 2YT0A 2K00A 2YRYA 2LYDA 1K5DB 2NZ8B 2RNRB 3PSCA 4HB3B 3VIAA 4EJNA 5J3TA 3KRXA 2I1KA 4K17A 3O96A 2P0FA 5J3QA 2J0MA 2DHIA 3PP2A 4B6HA 1QC6A 3SO6A 5KCVA 1U2BA 2I5FA 2IYBA 4HB2B 1TXDA 1DDMA 3IVFA 1B55A 1WGUA 2W2XC 4GMXB 1WJMA 2ZPYA 1H4RA 2COCA 1X1FA 1V5MA 1RJ2A 4WJ7A 2W2WA 3KY9A 4HHVA 4K81A 1UPQA 5DHFB 3BINA 3PZDA 1DBHA 2UZRA 2CY5A 2ADZA 3GYPA 4KHBB 1I2HA 2D4QA 4Z2NA 1XR0B 3VOQA 4TKNA 4MY6A 5C5BB 3ODWA 1UNPA 4HDQA 3PG7A 2G35A 4HAVB 1GC7A 1BWNA 1V61A 1EVHA 5L81A 2EC1A 2CRFA 2RUKB 3A8QA 4KHOA 2L2IA 2W2XD 1Q67A 2D9YA 4HAUB 1V5PA 4DX90 5LONB 3SV1A 2VRWB 3ML4A 4PQ0A 3MPXA 1FGZA 1PFJA 4KVGB 3CIKA 1BTNA 3HQCA 2Z0PA 3LJUX 4A6FA 2DYQA 2COAA 1U29A 3PVWA 5JHHA 3ZDTA 4HATB 2DA0A 3KSYA 2D11A 1X1GA 2D9XA 4HAYB 1GG3A 1QQGA 1RRPB 3FSSA 2I5CA 2VSZA 2ELAA 1K5GB 4XWXA 2I1JA 2AEHA 3P7ZA 2D9VA 1OY2A 3PVUA 1Y19B 1EAZA 2YS3A 2VKIA 2KCJA 1U5DA 4CHMA 2P0DA 3D8EA 1KI1B 2E2XA 5FI0A 1ISNA 4GXBA 1P3RA 5JP4A 3U7DA 1DROA 2N0YA 3U8ZA 2YVCA 4PNKA 2DKPA 5DI9B 2RVBB 1J0WA 2KGXB 1P5TA 3D8DA 5LOPB 2COFA 1NI2A 2P0HA 3QIJA 2K2UA 2J59M 3SYXA 4GN1A 4F7UP 4GZUA 3DXEA 4CHJA 4F7GA 4L6EA 1W1DA 3M1IB 2V76A 4IOYX 1LW3A 2Z0OA 2IFSA 1UNQA 1NTVA 2EJ8A 4TYZA 4F7HA 2HTHB 4DX8A 2D2QA 3V5WA 1TJ6A 2MWNB 1TQZA 1E5WA 5FI1A 2Y8FA 4YONA 1DYNA 1WVHA 2Z0QA 1FHXA 3D8FA 2CY4A 5HE0A 1X86A 5HE2A 5HE3A 2L1CA 3A98B 1ZC4B 2R09A 1SHCA 2NMBA 1OMWA 4Z2MB 2RGNB 4A6FB 5HE1A 5JLJB 3N7CA 2D10A 4NY0A 5J3YA 1Z87A 1MAIA 5KQ4A 2H7DA 4DXAB 2LOXA 5D3XA 2H7EA 1FHWA 3SNHA 4HAWB 5CLQB 1Y5OA 3X23A 1V89A 4H8SA 2K2JA 5C5BA 2MDXA 3CXBB 5KQ1A 3SUZA 2DN6A 2ROVA 1LB1A 4GPTB 2LOZA 1H10A 1U5EA 5GOWB 1SGHA 1GC6A 1MIZB 4HAXB 4BBKA 1WI1A 3HK0A 3DXDA 1XKEA 1XX0A 3T06A 5D27A 4A6HA 3ULCA 1MIXA 3FM8C 3ZVRA 2BCJA 2AL6A 4KHAA 4GMVA 1W1HA 1KZ7A 3WA0A 5D3VA 2Q13A 4EMOA 2M38A 1WG7A 1J19A 5DIFB 4ZRIA 5C16A 2LG1A 3QWMA 1M7RA 1MPHA 2FJLA 4P7IA 4IFSA 2DX5A 2DFKA 3AU4A 2CAYA 2RSGA 3MDBC 2XQNM 2YT1A 5EFXA 1WGQA 2DHKA 4CYEA 1FHOA 5C6RA 2YF0A 3AU5A 1PMSA 2MKRA 1U5FA 3TCAA 2D9ZA 2J0JA 2QKLA 1XODA
chains in the Genus database with same CATH superfamily
2KIGA 1FAOA 1X11A 2M14A 4WSFA 3ULBA 3AJ4A 2LKOA 1MK7B 2RLOA 1DDVA 1EF1A 3FEHA 4HDOA 1EGXA 3KRWA 3TFMA 2Y7BA 3WYFB 1UPRA 5C79A 1XCGA 2NBVA 1PLSA 4WVFB 1W1GA 2GJYA 2K49A 5D3WA 2OQBA 3U12A 2KUPA 2J0KA 2YS5A 2OTXA 1V5UA 3PVLA 4IAPA 1XD4A 5D3YA 1BTKA 5DHAB 1U5GA 1FGYA 1UEFA 1U27A 2N23A 2DKQA 4K2OA 3HW2B 1NTYA 2KUQA 1FOEA 3TO1A 4QXAB 3NSUA 2EMTA 2YSZA 2R0DA 4ZRJA 2HE7A 4DBBA 2DX1A 2Y8GA 5DH9B 2FJUB 3GYOA 4DIXA 2Z14A 5IRSA 3TVVA 3ODOA 1X05A 2PZ1A 2JP2A 3DXCA 2UVMA 2D9WA 2QKMA 3TW1A 1I7AA 1MKEA 4A6KA 1MK9B 3A8PA 3B77A 3PEGA 4HAZB 3UZTA 1M7EA 1UNRA 5JHGA 4QJ4B 4C0AA 2DLWA 4QJ5B 2DHJA 3ODXA 1N3HA 1AWEA 1DDWA 3G9WA 2P8VA 1ZM0A 2LULA 4MT7A 3OHMB 4GNKB 3NWFA 2X18A 3KZ1A 2EMSA 4NSWA 2ELBA 4KAXB 2DYNA 1FB8A 3F5RA 4YL8A 1IRSA 1OQNA 1MI1A 1NU2A 4QJ3B 2GS0A 3OANA 2ROZB 1ZSQA 3P6AA 4HB0B 1AQCA 2CODA 4ZRKA 4K2PA 1BAKA 1V88A 3RCPA 2YS1A 1ZC3B 1P6SA 5CLLB 2MFQA 1ZVRA 4Y94A 4D0NB 2GCJA 1KZGA 1WJ1A 2GCLA 4A5KA 2DTCA 2UZSA 3F0WA 4HB4B 3QBVB 4EKUA 4MK0A 3BJIA 2YT0A 2K00A 2YRYA 2LYDA 1K5DB 2NZ8B 2RNRB 3PSCA 4HB3B 3VIAA 4EJNA 5J3TA 2GUMA 3KRXA 2I1KA 4K17A 3O96A 2P0FA 5J3QA 2J0MA 2DHIA 3PP2A 4B6HA 1QC6A 3SO6A 3HIEA 5KCVA 1U2BA 2I5FA 2IYBA 4HB2B 1TXDA 1DDMA 3IVFA 1B55A 1WGUA 2W2XC 4GMXB 1WJMA 2ZPYA 1H4RA 2COCA 2KR0A 5I2MA 1X1FA 1V5MA 1RJ2A 4WJ7A 2W2WA 3KY9A 4HHVA 4K81A 1UPQA 5DHFB 3BINA 3PZDA 1DBHA 2UZRA 2CY5A 2ADZA 3GYPA 1T77A 4KHBB 1I2HA 2D4QA 4Z2NA 1XR0B 3VOQA 4TKNA 4MY6A 5C5BB 3ODWA 1UNPA 4HDQA 3PG7A 2G35A 4HAVB 1GC7A 1BWNA 1V61A 3NWAA 1EVHA 5L81A 2EC1A 2CRFA 2Z13A 2RUKB 5LG4B 3A8QA 2RRFA 4KHOA 2L2IA 2W2XD 3HSAA 1Q67A 2D9YA 4HAUB 1V5PA 4DX90 5LONB 3SV1A 2VRWB 3ML4A 4PQ0A 3MPXA 1FGZA 1PFJA 2Z59A 4KVGB 3CIKA 1BTNA 3HQCA 2Z0PA 3LJUX 4A6FA 2DYQA 2COAA 1U29A 3PVWA 5JHHA 3ZDTA 4HATB 2DA0A 3KSYA 2D11A 1X1GA 2D9XA 4HAYB 1GG3A 1QQGA 1RRPB 3FSSA 2I5CA 2VSZA 2ELAA 1K5GB 2ZKMX 4XWXA 2I1JA 2K8EA 2AEHA 3P7ZA 2D9VA 1OY2A 3PVUA 1Y19B 1EAZA 2YS3A 4D6WA 2VKIA 2KCJA 1U5DA 4CHMA 2P0DA 3D8EA 1KI1B 2E2XA 5FI0A 1ISNA 3NWDA 1P3RA 4GXBA 3U7DA 3A58A 5JP4A 1DROA 2N0YA 3U8ZA 2YVCA 4PNKA 2DKPA 5DI9B 2RVBB 1J0WA 2KGXB 1P5TA 3D8DA 5LOPB 2COFA 1NI2A 2P0HA 3QIJA 2K2UA 2J59M 3SYXA 4GN1A 4F7UP 4GZUA 3DXEA 4CHJA 3NW8A 4F7GA 4L6EA 1W1DA 3M1IB 2V76A 4IOYX 1LW3A 2Z0OA 2IFSA 1UNQA 1NTVA 2EJ8A 4TYZA 4F7HA 2HTHB 4DX8A 2D2QA 3V5WA 4CSQA 1TJ6A 2MWNB 1TQZA 4OSNA 1E5WA 5FI1A 2Y8FA 4YONA 1DYNA 5M4YB 1WVHA 2Z0QA 1FHXA 3D8FA 2CY4A 5HE0A 1X86A 5HE2A 5HE3A 2L1CA 3A98B 1ZC4B 4HSIA 1ZYIA 2R09A 1SHCA 2NMBA 3DCXA 1OMWA 4Z2MB 2RGNB 4A6FB 5HE1A 5JLJB 3N7CA 2D10A 4NY0A 5J3YA 5I2SA 1Z87A 1MAIA 5KQ4A 2H7DA 4DXAB 2LOXA 5D3XA 2H7EA 1FHWA 3SNHA 4HAWB 2YT2A 5CLQB 1Y5OA 2R2YA 3X23A 1V89A 2Z4DA 4H8SA 2K2JA 5C5BA 2MDXA 3CXBB 5KQ1A 3SUZA 4L1RA 2KIEA 4KHBA 2DN6A 2ROVA 1LB1A 4GPTB 2LOZA 1H10A 1U5EA 5GOWB 1SGHA 1GC6A 1MIZB 4HAXB 4BBKA 1WI1A 3HK0A 3DXDA 1XKEA 1XX0A 3T06A 5D27A 4A6HA 3ULCA 1MIXA 3FM8C 3ZVRA 2BCJA 2AL6A 4KHAA 4GMVA 1W1HA 1KZ7A 3WA0A 5D3VA 2Q13A 4EMOA 4GOUA 2M38A 1WG7A 1J19A 5DIFB 4ZRIA 5C16A 2LG1A 3QWMA 1M7RA 1MPHA 2FJLA 4P7IA 4IFSA 2DX5A 2DFKA 3AU4A 2CAYA 2RSGA 3MDBC 2XQNM 2YT1A 5EFXA 3FVCA 4OT1A 1WGQA 2DHKA 4CYEA 1FHOA 5C6RA 2YF0A 3AU5A 1PMSA 2MKRA 1U5FA 3TCAA 2D9ZA 2J0JA 2QKLA 1XODA
chains in the Genus database with same CATH topology
1FAOA 1X11A 2M14A 4WSFA 3ULBA 3AJ4A 2LKOA 1MK7B 2RLOA 1DDVA 1EF1A 3FEHA 4HDOA 1EGXA 3KRWA 3TFMA 2Y7BA 3WYFB 1UPRA 5C79A 1XCGA 1PLSA 4WVFB 1W1GA 2GJYA 5D3WA 2OQBA 2KUPA 2J0KA 2YS5A 2OTXA 1V5UA 3PVLA 4IAPA 1XD4A 5D3YA 1BTKA 5DHAB 1U5GA 1FGYA 1UEFA 1U27A 2N23A 2DKQA 4K2OA 3HW2B 1NTYA 1FOEA 3TO1A 3NSUA 2EMTA 2YSZA 2R0DA 4ZRJA 2HE7A 4DBBA 2DX1A 2Y8GA 5DH9B 3GYOA 3TVVA 3ODOA 1X05A 2PZ1A 2JP2A 3DXCA 2UVMA 2D9WA 2QKMA 3TW1A 1I7AA 1MKEA 4A6KA 1MK9B 3A8PA 3PEGA 4HAZB 3UZTA 1M7EA 1UNRA 5JHGA 4C0AA 2DLWA 2DHJA 3ODXA 1N3HA 1AWEA 1DDWA 3G9WA 2P8VA 1ZM0A 2LULA 4MT7A 2X18A 3KZ1A 2EMSA 4NSWA 2ELBA 4KAXB 2DYNA 1FB8A 3F5RA 4YL8A 1IRSA 1OQNA 1NU2A 2GS0A 3OANA 2ROZB 1ZSQA 3P6AA 4HB0B 1AQCA 2CODA 4ZRKA 4K2PA 1BAKA 1V88A 3RCPA 2YS1A 1ZC3B 1P6SA 5CLLB 2MFQA 1ZVRA 4Y94A 4D0NB 2GCJA 1KZGA 1WJ1A 2GCLA 4A5KA 2DTCA 2UZSA 3F0WA 4HB4B 3QBVB 4EKUA 4MK0A 3BJIA 2YT0A 2K00A 2YRYA 2LYDA 1K5DB 2NZ8B 2RNRB 3PSCA 4HB3B 3VIAA 4EJNA 5J3TA 3KRXA 2I1KA 4K17A 3O96A 2P0FA 5J3QA 2J0MA 2DHIA 3PP2A 4B6HA 1QC6A 3SO6A 5KCVA 1U2BA 2I5FA 2IYBA 4HB2B 1TXDA 1DDMA 3IVFA 1B55A 1WGUA 2W2XC 4GMXB 1WJMA 2ZPYA 1H4RA 2COCA 1X1FA 1V5MA 1RJ2A 4WJ7A 2W2WA 3KY9A 4HHVA 4K81A 1UPQA 5DHFB 3BINA 3PZDA 1DBHA 2UZRA 2CY5A 2ADZA 3GYPA 4KHBB 1I2HA 2D4QA 4Z2NA 1XR0B 3VOQA 4TKNA 4MY6A 5C5BB 3ODWA 1UNPA 4HDQA 3PG7A 2G35A 4HAVB 1GC7A 1BWNA 1V61A 1EVHA 5L81A 2EC1A 2CRFA 2RUKB 3A8QA 4KHOA 2L2IA 2W2XD 1Q67A 2D9YA 4HAUB 1V5PA 4DX90 5LONB 3SV1A 2VRWB 3ML4A 4PQ0A 3MPXA 1FGZA 1PFJA 4KVGB 3CIKA 1BTNA 3HQCA 2Z0PA 3LJUX 4A6FA 2DYQA 2COAA 1U29A 3PVWA 5JHHA 3ZDTA 4HATB 2DA0A 3KSYA 2D11A 1X1GA 2D9XA 4HAYB 1GG3A 1QQGA 1RRPB 3FSSA 2I5CA 2VSZA 2ELAA 1K5GB 4XWXA 2I1JA 2AEHA 3P7ZA 2D9VA 1OY2A 3PVUA 1Y19B 1EAZA 2YS3A 2VKIA 2KCJA 1U5DA 4CHMA 2P0DA 3D8EA 1KI1B 2E2XA 5FI0A 1ISNA 4GXBA 1P3RA 5JP4A 3U7DA 1DROA 2N0YA 3U8ZA 2YVCA 4PNKA 2DKPA 5DI9B 2RVBB 1J0WA 2KGXB 1P5TA 3D8DA 5LOPB 2COFA 1NI2A 2P0HA 3QIJA 2K2UA 2J59M 3SYXA 4GN1A 4F7UP 4GZUA 3DXEA 4CHJA 4F7GA 4L6EA 1W1DA 3M1IB 2V76A 4IOYX 1LW3A 2Z0OA 2IFSA 1UNQA 1NTVA 2EJ8A 4TYZA 4F7HA 2HTHB 4DX8A 2D2QA 3V5WA 1TJ6A 2MWNB 1TQZA 1E5WA 5FI1A 2Y8FA 4YONA 1DYNA 1WVHA 2Z0QA 1FHXA 3D8FA 2CY4A 5HE0A 1X86A 5HE2A 5HE3A 2L1CA 3A98B 1ZC4B 2R09A 1SHCA 2NMBA 1OMWA 4Z2MB 2RGNB 4A6FB 5HE1A 5JLJB 3N7CA 2D10A 4NY0A 5J3YA 1Z87A 1MAIA 5KQ4A 2H7DA 4DXAB 2LOXA 5D3XA 2H7EA 1FHWA 3SNHA 4HAWB 5CLQB 1Y5OA 3X23A 1V89A 4H8SA 2K2JA 5C5BA 2MDXA 3CXBB 5KQ1A 3SUZA 2DN6A 2ROVA 1LB1A 4GPTB 2LOZA 1H10A 1U5EA 5GOWB 1SGHA 1GC6A 1MIZB 4HAXB 4BBKA 1WI1A 3HK0A 3DXDA 1XKEA 1XX0A 3T06A 5D27A 4A6HA 3ULCA 1MIXA 3FM8C 3ZVRA 2BCJA 2AL6A 4KHAA 4GMVA 1W1HA 1KZ7A 3WA0A 5D3VA 2Q13A 4EMOA 2M38A 1WG7A 1J19A 5DIFB 4ZRIA 5C16A 2LG1A 3QWMA 1M7RA 1MPHA 2FJLA 4P7IA 4IFSA 2DX5A 2DFKA 3AU4A 2CAYA 2RSGA 3MDBC 2XQNM 2YT1A 5EFXA 1WGQA 2DHKA 4CYEA 1FHOA 5C6RA 2YF0A 3AU5A 1PMSA 2MKRA 1U5FA 3TCAA 2D9ZA 2J0JA 2QKLA 1XODA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FAO A;  1X11 A;  2M14 A;  4WSF A;  3ULB A;  3AJ4 A;  2LKO A;  1MK7 B;  2RLO A;  1DDV A;  1EF1 A;  3FEH A;  4HDO A;  1EGX A;  3KRW A;  3TFM A;  2Y7B A;  3WYF B;  1UPR A;  5C79 A;  1XCG A;  1PLS A;  4WVF B;  1W1G A;  2GJY A;  5D3W A;  2OQB A;  2KUP A;  2J0K A;  2YS5 A;  2OTX A;  1V5U A;  3PVL A;  4IAP A;  1XD4 A;  5D3Y A;  1BTK A;  5DHA B;  1U5G A;  1FGY A;  1UEF A;  1U27 A;  2N23 A;  2DKQ A;  4K2O A;  3HW2 B;  1NTY A;  1FOE A;  3TO1 A;  3NSU A;  2EMT A;  2YSZ A;  2R0D A;  4ZRJ A;  2HE7 A;  4DBB A;  2DX1 A;  2Y8G A;  5DH9 B;  3GYO A;  3TVV A;  3ODO A;  1X05 A;  2PZ1 A;  2JP2 A;  3DXC A;  2UVM A;  2D9W A;  2QKM A;  3TW1 A;  1I7A A;  1MKE A;  4A6K A;  1MK9 B;  3A8P A;  3PEG A;  4HAZ B;  3UZT A;  1M7E A;  1UNR A;  5JHG A;  4C0A A;  2DLW A;  2DHJ A;  3ODX A;  1N3H A;  1AWE A;  1DDW A;  3G9W A;  2P8V A;  1ZM0 A;  2LUL A;  4MT7 A;  2X18 A;  3KZ1 A;  2EMS A;  4NSW A;  2ELB A;  4KAX B;  2DYN A;  1FB8 A;  3F5R A;  4YL8 A;  1IRS A;  1OQN A;  1NU2 A;  2GS0 A;  3OAN A;  2ROZ B;  1ZSQ A;  3P6A A;  4HB0 B;  1AQC A;  2COD A;  4ZRK A;  4K2P A;  1BAK A;  1V88 A;  3RCP A;  2YS1 A;  1ZC3 B;  1P6S A;  5CLL B;  2MFQ A;  1ZVR A;  4Y94 A;  4D0N B;  2GCJ A;  1KZG A;  1WJ1 A;  2GCL A;  4A5K A;  2DTC A;  2UZS A;  3F0W A;  4HB4 B;  3QBV B;  4EKU A;  4MK0 A;  3BJI A;  2YT0 A;  2K00 A;  2YRY A;  2LYD A;  1K5D B;  2NZ8 B;  2RNR B;  3PSC A;  4HB3 B;  3VIA A;  4EJN A;  5J3T A;  3KRX A;  2I1K A;  4K17 A;  3O96 A;  2P0F A;  5J3Q A;  2J0M A;  2DHI A;  3PP2 A;  4B6H A;  1QC6 A;  3SO6 A;  5KCV A;  1U2B A;  2I5F A;  2IYB A;  4HB2 B;  1TXD A;  1DDM A;  3IVF A;  1B55 A;  1WGU A;  2W2X C;  4GMX B;  1WJM A;  2ZPY A;  1H4R A;  2COC A;  1X1F A;  1V5M A;  1RJ2 A;  4WJ7 A;  2W2W A;  3KY9 A;  4HHV A;  4K81 A;  1UPQ A;  5DHF B;  3BIN A;  3PZD A;  1DBH A;  2UZR A;  2CY5 A;  2ADZ A;  3GYP A;  4KHB B;  1I2H A;  2D4Q A;  4Z2N A;  1XR0 B;  3VOQ A;  4TKN A;  4MY6 A;  5C5B B;  3ODW A;  1UNP A;  4HDQ A;  3PG7 A;  2G35 A;  4HAV B;  1GC7 A;  1BWN A;  1V61 A;  1EVH A;  5L81 A;  2EC1 A;  2CRF A;  2RUK B;  3A8Q A;  4KHO A;  2L2I A;  2W2X D;  1Q67 A;  2D9Y A;  4HAU B;  1V5P A;  4DX9 0;  5LON B;  3SV1 A;  2VRW B;  3ML4 A;  4PQ0 A;  3MPX A;  1FGZ A;  1PFJ A;  4KVG B;  3CIK A;  1BTN A;  3HQC A;  2Z0P A;  3LJU X;  4A6F A;  2DYQ A;  2COA A;  1U29 A;  3PVW A;  5JHH A;  3ZDT A;  4HAT B;  2DA0 A;  3KSY A;  2D11 A;  1X1G A;  2D9X A;  4HAY B;  1GG3 A;  1QQG A;  1RRP B;  3FSS A;  2I5C A;  2VSZ A;  2ELA A;  1K5G B;  4XWX A;  2I1J A;  2AEH A;  3P7Z A;  2D9V A;  1OY2 A;  3PVU A;  1Y19 B;  1EAZ A;  2YS3 A;  2VKI A;  2KCJ A;  1U5D A;  4CHM A;  2P0D A;  3D8E A;  1KI1 B;  2E2X A;  5FI0 A;  1ISN A;  4GXB A;  1P3R A;  5JP4 A;  3U7D A;  1DRO A;  2N0Y A;  3U8Z A;  2YVC A;  4PNK A;  2DKP A;  5DI9 B;  2RVB B;  1J0W A;  2KGX B;  1P5T A;  3D8D A;  5LOP B;  2COF A;  1NI2 A;  2P0H A;  3QIJ A;  2K2U A;  2J59 M;  3SYX A;  4GN1 A;  4F7U P;  4GZU A;  3DXE A;  4CHJ A;  4F7G A;  4L6E A;  1W1D A;  3M1I B;  2V76 A;  4IOY X;  1LW3 A;  2Z0O A;  2IFS A;  1UNQ A;  1NTV A;  2EJ8 A;  4TYZ A;  4F7H A;  2HTH B;  4DX8 A;  2D2Q A;  3V5W A;  1TJ6 A;  2MWN B;  1TQZ A;  1E5W A;  5FI1 A;  2Y8F A;  4YON A;  1DYN A;  1WVH A;  2Z0Q A;  1FHX A;  3D8F A;  2CY4 A;  5HE0 A;  1X86 A;  5HE2 A;  5HE3 A;  2L1C A;  3A98 B;  1ZC4 B;  2R09 A;  1SHC A;  2NMB A;  1OMW A;  4Z2M B;  2RGN B;  4A6F B;  5HE1 A;  5JLJ B;  3N7C A;  2D10 A;  4NY0 A;  5J3Y A;  1Z87 A;  1MAI A;  5KQ4 A;  2H7D A;  4DXA B;  2LOX A;  5D3X A;  2H7E A;  1FHW A;  3SNH A;  4HAW B;  5CLQ B;  1Y5O A;  3X23 A;  1V89 A;  4H8S A;  2K2J A;  5C5B A;  2MDX A;  3CXB B;  5KQ1 A;  3SUZ A;  2DN6 A;  2ROV A;  1LB1 A;  4GPT B;  2LOZ A;  1H10 A;  1U5E A;  5GOW B;  1SGH A;  1GC6 A;  1MIZ B;  4HAX B;  4BBK A;  1WI1 A;  3HK0 A;  3DXD A;  1XKE A;  1XX0 A;  3T06 A;  5D27 A;  4A6H A;  3ULC A;  1MIX A;  3FM8 C;  3ZVR A;  2BCJ A;  2AL6 A;  4KHA A;  4GMV A;  1W1H A;  1KZ7 A;  3WA0 A;  5D3V A;  2Q13 A;  4EMO A;  2M38 A;  1WG7 A;  1J19 A;  5DIF B;  4ZRI A;  5C16 A;  2LG1 A;  3QWM A;  1M7R A;  1MPH A;  2FJL A;  4P7I A;  4IFS A;  2DX5 A;  2DFK A;  3AU4 A;  2CAY A;  2RSG A;  3MDB C;  2XQN M;  2YT1 A;  5EFX A;  1WGQ A;  2DHK A;  4CYE A;  1FHO A;  5C6R A;  2YF0 A;  3AU5 A;  1PMS A;  2MKR A;  1U5F A;  3TCA A;  2D9Z A;  2J0J A;  2QKL A;  1XOD A; 
#chains in the Genus database with same CATH topology
 2KIG A;  1FAO A;  1X11 A;  2M14 A;  4WSF A;  3ULB A;  3AJ4 A;  2LKO A;  1MK7 B;  2RLO A;  1DDV A;  1EF1 A;  3FEH A;  4HDO A;  1EGX A;  3KRW A;  3TFM A;  2Y7B A;  3WYF B;  1UPR A;  5C79 A;  1XCG A;  2NBV A;  1PLS A;  4WVF B;  1W1G A;  2GJY A;  2K49 A;  5D3W A;  2OQB A;  3U12 A;  2KUP A;  2J0K A;  2YS5 A;  2OTX A;  1V5U A;  3PVL A;  4IAP A;  1XD4 A;  5D3Y A;  1BTK A;  5DHA B;  1U5G A;  1FGY A;  1UEF A;  1U27 A;  2N23 A;  2DKQ A;  4K2O A;  3HW2 B;  1NTY A;  2KUQ A;  1FOE A;  3TO1 A;  4QXA B;  3NSU A;  2EMT A;  2YSZ A;  2R0D A;  4ZRJ A;  2HE7 A;  4DBB A;  2DX1 A;  2Y8G A;  5DH9 B;  2FJU B;  3GYO A;  4DIX A;  2Z14 A;  5IRS A;  3TVV A;  3ODO A;  1X05 A;  2PZ1 A;  2JP2 A;  3DXC A;  2UVM A;  2D9W A;  2QKM A;  3TW1 A;  1I7A A;  1MKE A;  4A6K A;  1MK9 B;  3A8P A;  3B77 A;  3PEG A;  4HAZ B;  3UZT A;  1M7E A;  1UNR A;  5JHG A;  4QJ4 B;  4C0A A;  2DLW A;  4QJ5 B;  2DHJ A;  3ODX A;  1N3H A;  1AWE A;  1DDW A;  3G9W A;  2P8V A;  1ZM0 A;  2LUL A;  4MT7 A;  3OHM B;  4GNK B;  3NWF A;  2X18 A;  3KZ1 A;  2EMS A;  4NSW A;  2ELB A;  4KAX B;  2DYN A;  1FB8 A;  3F5R A;  4YL8 A;  1IRS A;  1OQN A;  1MI1 A;  1NU2 A;  4QJ3 B;  2GS0 A;  3OAN A;  2ROZ B;  1ZSQ A;  3P6A A;  4HB0 B;  1AQC A;  2COD A;  4ZRK A;  4K2P A;  1BAK A;  1V88 A;  3RCP A;  2YS1 A;  1ZC3 B;  1P6S A;  5CLL B;  2MFQ A;  1ZVR A;  4Y94 A;  4D0N B;  2GCJ A;  1KZG A;  1WJ1 A;  2GCL A;  4A5K A;  2DTC A;  2UZS A;  3F0W A;  4HB4 B;  3QBV B;  4EKU A;  4MK0 A;  3BJI A;  2YT0 A;  2K00 A;  2YRY A;  2LYD A;  1K5D B;  2NZ8 B;  2RNR B;  3PSC A;  4HB3 B;  3VIA A;  4EJN A;  5J3T A;  2GUM A;  3KRX A;  2I1K A;  4K17 A;  3O96 A;  2P0F A;  5J3Q A;  2J0M A;  2DHI A;  3PP2 A;  4B6H A;  1QC6 A;  3SO6 A;  3HIE A;  5KCV A;  1U2B A;  2I5F A;  2IYB A;  4HB2 B;  1TXD A;  1DDM A;  3IVF A;  1B55 A;  1WGU A;  2W2X C;  4GMX B;  1WJM A;  2ZPY A;  1H4R A;  2COC A;  2KR0 A;  5I2M A;  1X1F A;  1V5M A;  1RJ2 A;  4WJ7 A;  2W2W A;  3KY9 A;  4HHV A;  4K81 A;  1UPQ A;  5DHF B;  3BIN A;  3PZD A;  1DBH A;  2UZR A;  2CY5 A;  2ADZ A;  3GYP A;  1T77 A;  4KHB B;  1I2H A;  2D4Q A;  4Z2N A;  1XR0 B;  3VOQ A;  4TKN A;  4MY6 A;  5C5B B;  3ODW A;  1UNP A;  4HDQ A;  3PG7 A;  2G35 A;  4HAV B;  1GC7 A;  1BWN A;  1V61 A;  3NWA A;  1EVH A;  5L81 A;  2EC1 A;  2CRF A;  2Z13 A;  2RUK B;  5LG4 B;  3A8Q A;  2RRF A;  4KHO A;  2L2I A;  2W2X D;  3HSA A;  1Q67 A;  2D9Y A;  4HAU B;  1V5P A;  4DX9 0;  5LON B;  3SV1 A;  2VRW B;  3ML4 A;  4PQ0 A;  3MPX A;  1FGZ A;  1PFJ A;  2Z59 A;  4KVG B;  3CIK A;  1BTN A;  3HQC A;  2Z0P A;  3LJU X;  4A6F A;  2DYQ A;  2COA A;  1U29 A;  3PVW A;  5JHH A;  3ZDT A;  4HAT B;  2DA0 A;  3KSY A;  2D11 A;  1X1G A;  2D9X A;  4HAY B;  1GG3 A;  1QQG A;  1RRP B;  3FSS A;  2I5C A;  2VSZ A;  2ELA A;  1K5G B;  2ZKM X;  4XWX A;  2I1J A;  2K8E A;  2AEH A;  3P7Z A;  2D9V A;  1OY2 A;  3PVU A;  1Y19 B;  1EAZ A;  2YS3 A;  4D6W A;  2VKI A;  2KCJ A;  1U5D A;  4CHM A;  2P0D A;  3D8E A;  1KI1 B;  2E2X A;  5FI0 A;  1ISN A;  3NWD A;  1P3R A;  4GXB A;  3U7D A;  3A58 A;  5JP4 A;  1DRO A;  2N0Y A;  3U8Z A;  2YVC A;  4PNK A;  2DKP A;  5DI9 B;  2RVB B;  1J0W A;  2KGX B;  1P5T A;  3D8D A;  5LOP B;  2COF A;  1NI2 A;  2P0H A;  3QIJ A;  2K2U A;  2J59 M;  3SYX A;  4GN1 A;  4F7U P;  4GZU A;  3DXE A;  4CHJ A;  3NW8 A;  4F7G A;  4L6E A;  1W1D A;  3M1I B;  2V76 A;  4IOY X;  1LW3 A;  2Z0O A;  2IFS A;  1UNQ A;  1NTV A;  2EJ8 A;  4TYZ A;  4F7H A;  2HTH B;  4DX8 A;  2D2Q A;  3V5W A;  4CSQ A;  1TJ6 A;  2MWN B;  1TQZ A;  4OSN A;  1E5W A;  5FI1 A;  2Y8F A;  4YON A;  1DYN A;  5M4Y B;  1WVH A;  2Z0Q A;  1FHX A;  3D8F A;  2CY4 A;  5HE0 A;  1X86 A;  5HE2 A;  5HE3 A;  2L1C A;  3A98 B;  1ZC4 B;  4HSI A;  1ZYI A;  2R09 A;  1SHC A;  2NMB A;  3DCX A;  1OMW A;  4Z2M B;  2RGN B;  4A6F B;  5HE1 A;  5JLJ B;  3N7C A;  2D10 A;  4NY0 A;  5J3Y A;  5I2S A;  1Z87 A;  1MAI A;  5KQ4 A;  2H7D A;  4DXA B;  2LOX A;  5D3X A;  2H7E A;  1FHW A;  3SNH A;  4HAW B;  2YT2 A;  5CLQ B;  1Y5O A;  2R2Y A;  3X23 A;  1V89 A;  2Z4D A;  4H8S A;  2K2J A;  5C5B A;  2MDX A;  3CXB B;  5KQ1 A;  3SUZ A;  4L1R A;  2KIE A;  4KHB A;  2DN6 A;  2ROV A;  1LB1 A;  4GPT B;  2LOZ A;  1H10 A;  1U5E A;  5GOW B;  1SGH A;  1GC6 A;  1MIZ B;  4HAX B;  4BBK A;  1WI1 A;  3HK0 A;  3DXD A;  1XKE A;  1XX0 A;  3T06 A;  5D27 A;  4A6H A;  3ULC A;  1MIX A;  3FM8 C;  3ZVR A;  2BCJ A;  2AL6 A;  4KHA A;  4GMV A;  1W1H A;  1KZ7 A;  3WA0 A;  5D3V A;  2Q13 A;  4EMO A;  4GOU A;  2M38 A;  1WG7 A;  1J19 A;  5DIF B;  4ZRI A;  5C16 A;  2LG1 A;  3QWM A;  1M7R A;  1MPH A;  2FJL A;  4P7I A;  4IFS A;  2DX5 A;  2DFK A;  3AU4 A;  2CAY A;  2RSG A;  3MDB C;  2XQN M;  2YT1 A;  5EFX A;  3FVC A;  4OT1 A;  1WGQ A;  2DHK A;  4CYE A;  1FHO A;  5C6R A;  2YF0 A;  3AU5 A;  1PMS A;  2MKR A;  1U5F A;  3TCA A;  2D9Z A;  2J0J A;  2QKL A;  1XOD A; 
#chains in the Genus database with same CATH homology
 1FAO A;  1X11 A;  2M14 A;  4WSF A;  3ULB A;  3AJ4 A;  2LKO A;  1MK7 B;  2RLO A;  1DDV A;  1EF1 A;  3FEH A;  4HDO A;  1EGX A;  3KRW A;  3TFM A;  2Y7B A;  3WYF B;  1UPR A;  5C79 A;  1XCG A;  1PLS A;  4WVF B;  1W1G A;  2GJY A;  5D3W A;  2OQB A;  2KUP A;  2J0K A;  2YS5 A;  2OTX A;  1V5U A;  3PVL A;  4IAP A;  1XD4 A;  5D3Y A;  1BTK A;  5DHA B;  1U5G A;  1FGY A;  1UEF A;  1U27 A;  2N23 A;  2DKQ A;  4K2O A;  3HW2 B;  1NTY A;  1FOE A;  3TO1 A;  3NSU A;  2EMT A;  2YSZ A;  2R0D A;  4ZRJ A;  2HE7 A;  4DBB A;  2DX1 A;  2Y8G A;  5DH9 B;  3GYO A;  3TVV A;  3ODO A;  1X05 A;  2PZ1 A;  2JP2 A;  3DXC A;  2UVM A;  2D9W A;  2QKM A;  3TW1 A;  1I7A A;  1MKE A;  4A6K A;  1MK9 B;  3A8P A;  3PEG A;  4HAZ B;  3UZT A;  1M7E A;  1UNR A;  5JHG A;  4C0A A;  2DLW A;  2DHJ A;  3ODX A;  1N3H A;  1AWE A;  1DDW A;  3G9W A;  2P8V A;  1ZM0 A;  2LUL A;  4MT7 A;  2X18 A;  3KZ1 A;  2EMS A;  4NSW A;  2ELB A;  4KAX B;  2DYN A;  1FB8 A;  3F5R A;  4YL8 A;  1IRS A;  1OQN A;  1NU2 A;  2GS0 A;  3OAN A;  2ROZ B;  1ZSQ A;  3P6A A;  4HB0 B;  1AQC A;  2COD A;  4ZRK A;  4K2P A;  1BAK A;  1V88 A;  3RCP A;  2YS1 A;  1ZC3 B;  1P6S A;  5CLL B;  2MFQ A;  1ZVR A;  4Y94 A;  4D0N B;  2GCJ A;  1KZG A;  1WJ1 A;  2GCL A;  4A5K A;  2DTC A;  2UZS A;  3F0W A;  4HB4 B;  3QBV B;  4EKU A;  4MK0 A;  3BJI A;  2YT0 A;  2K00 A;  2YRY A;  2LYD A;  1K5D B;  2NZ8 B;  2RNR B;  3PSC A;  4HB3 B;  3VIA A;  4EJN A;  5J3T A;  3KRX A;  2I1K A;  4K17 A;  3O96 A;  2P0F A;  5J3Q A;  2J0M A;  2DHI A;  3PP2 A;  4B6H A;  1QC6 A;  3SO6 A;  5KCV A;  1U2B A;  2I5F A;  2IYB A;  4HB2 B;  1TXD A;  1DDM A;  3IVF A;  1B55 A;  1WGU A;  2W2X C;  4GMX B;  1WJM A;  2ZPY A;  1H4R A;  2COC A;  1X1F A;  1V5M A;  1RJ2 A;  4WJ7 A;  2W2W A;  3KY9 A;  4HHV A;  4K81 A;  1UPQ A;  5DHF B;  3BIN A;  3PZD A;  1DBH A;  2UZR A;  2CY5 A;  2ADZ A;  3GYP A;  4KHB B;  1I2H A;  2D4Q A;  4Z2N A;  1XR0 B;  3VOQ A;  4TKN A;  4MY6 A;  5C5B B;  3ODW A;  1UNP A;  4HDQ A;  3PG7 A;  2G35 A;  4HAV B;  1GC7 A;  1BWN A;  1V61 A;  1EVH A;  5L81 A;  2EC1 A;  2CRF A;  2RUK B;  3A8Q A;  4KHO A;  2L2I A;  2W2X D;  1Q67 A;  2D9Y A;  4HAU B;  1V5P A;  4DX9 0;  5LON B;  3SV1 A;  2VRW B;  3ML4 A;  4PQ0 A;  3MPX A;  1FGZ A;  1PFJ A;  4KVG B;  3CIK A;  1BTN A;  3HQC A;  2Z0P A;  3LJU X;  4A6F A;  2DYQ A;  2COA A;  1U29 A;  3PVW A;  5JHH A;  3ZDT A;  4HAT B;  2DA0 A;  3KSY A;  2D11 A;  1X1G A;  2D9X A;  4HAY B;  1GG3 A;  1QQG A;  1RRP B;  3FSS A;  2I5C A;  2VSZ A;  2ELA A;  1K5G B;  4XWX A;  2I1J A;  2AEH A;  3P7Z A;  2D9V A;  1OY2 A;  3PVU A;  1Y19 B;  1EAZ A;  2YS3 A;  2VKI A;  2KCJ A;  1U5D A;  4CHM A;  2P0D A;  3D8E A;  1KI1 B;  2E2X A;  5FI0 A;  1ISN A;  4GXB A;  1P3R A;  5JP4 A;  3U7D A;  1DRO A;  2N0Y A;  3U8Z A;  2YVC A;  4PNK A;  2DKP A;  5DI9 B;  2RVB B;  1J0W A;  2KGX B;  1P5T A;  3D8D A;  5LOP B;  2COF A;  1NI2 A;  2P0H A;  3QIJ A;  2K2U A;  2J59 M;  3SYX A;  4GN1 A;  4F7U P;  4GZU A;  3DXE A;  4CHJ A;  4F7G A;  4L6E A;  1W1D A;  3M1I B;  2V76 A;  4IOY X;  1LW3 A;  2Z0O A;  2IFS A;  1UNQ A;  1NTV A;  2EJ8 A;  4TYZ A;  4F7H A;  2HTH B;  4DX8 A;  2D2Q A;  3V5W A;  1TJ6 A;  2MWN B;  1TQZ A;  1E5W A;  5FI1 A;  2Y8F A;  4YON A;  1DYN A;  1WVH A;  2Z0Q A;  1FHX A;  3D8F A;  2CY4 A;  5HE0 A;  1X86 A;  5HE2 A;  5HE3 A;  2L1C A;  3A98 B;  1ZC4 B;  2R09 A;  1SHC A;  2NMB A;  1OMW A;  4Z2M B;  2RGN B;  4A6F B;  5HE1 A;  5JLJ B;  3N7C A;  2D10 A;  4NY0 A;  5J3Y A;  1Z87 A;  1MAI A;  5KQ4 A;  2H7D A;  4DXA B;  2LOX A;  5D3X A;  2H7E A;  1FHW A;  3SNH A;  4HAW B;  5CLQ B;  1Y5O A;  3X23 A;  1V89 A;  4H8S A;  2K2J A;  5C5B A;  2MDX A;  3CXB B;  5KQ1 A;  3SUZ A;  2DN6 A;  2ROV A;  1LB1 A;  4GPT B;  2LOZ A;  1H10 A;  1U5E A;  5GOW B;  1SGH A;  1GC6 A;  1MIZ B;  4HAX B;  4BBK A;  1WI1 A;  3HK0 A;  3DXD A;  1XKE A;  1XX0 A;  3T06 A;  5D27 A;  4A6H A;  3ULC A;  1MIX A;  3FM8 C;  3ZVR A;  2BCJ A;  2AL6 A;  4KHA A;  4GMV A;  1W1H A;  1KZ7 A;  3WA0 A;  5D3V A;  2Q13 A;  4EMO A;  2M38 A;  1WG7 A;  1J19 A;  5DIF B;  4ZRI A;  5C16 A;  2LG1 A;  3QWM A;  1M7R A;  1MPH A;  2FJL A;  4P7I A;  4IFS A;  2DX5 A;  2DFK A;  3AU4 A;  2CAY A;  2RSG A;  3MDB C;  2XQN M;  2YT1 A;  5EFX A;  1WGQ A;  2DHK A;  4CYE A;  1FHO A;  5C6R A;  2YF0 A;  3AU5 A;  1PMS A;  2MKR A;  1U5F A;  3TCA A;  2D9Z A;  2J0J A;  2QKL A;  1XOD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...