1V61A

Solution structure of the pleckstrin homology domain of alpha-pix
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
132
structure length
132
Chain Sequence
GSSGSSGQILSEPIQAWEGDDIKTLGNVIFMSQVVMQHGACEEKEERYFLLFSSVLIMLSASPRMSGFMYQGKIPIAGMVVNRLDEIEGSDCMFEITGSTVERIVVHCNNNQDFQEWMEQLNRLTKSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Rac/Cdc42 guanine nucleotide exchange factor (GEF) 6
publication title Solution Structure of the Pleckstrin Homology Domain of alpha-Pix
rcsb
source organism Mus musculus
molecule tags Signaling protein
total genus 15
structure length 132
sequence length 132
ec nomenclature
pdb deposition date 2003-11-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00169 PH PH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 1v61A00
3KSYA 1V88A 1OY2A 1J0WA 2I5CA 1WG7A 1M7RA 1MIZB 2D9ZA 2CAYA 2ROZB 1K5GB 3CIKA 5DHFB 2YS5A 4HB2B 2CRFA 2Y8FA 5KQ1A 2HTHB 1FGZA 1WVHA 1GG3A 2VSZA 2D9VA 2Y8GA 3P7ZA 1FB8A 4HATB 5HE0A 2W2XD 2UZRA 2RNRB 2KCJA 4CYEA 3BINA 3ODXA 2GCLA 1MK9B 2NMBA 2EC1A 1I7AA 2PZ1A 1FHWA 1EAZA 1GC7A 2YS1A 3LJUX 1WJMA 3UZTA 2J0JA 1XX0A 1EF1A 1RJ2A 2EMSA 3F0WA 3ULBA 1UEFA 4HB4B 3PVWA 3NSUA 4ZRKA 1KZ7A 2H7EA 2H7DA 3GYPA 3PP2A 2L1CA 2D2QA 1WGUA 2ELAA 1GC6A 5DHAB 1KI1B 2Q13A 3ODOA 3TO1A 4IFSA 2LYDA 2K00A 3A8QA 2Z0PA 4KHBB 1NTYA 2HE7A 4HAUB 1OQNA 1TQZA 4XWXA 1N3HA 4EKUA 3ZDTA 4A6FB 3KRXA 1MK7B 2L2IA 5L81A 2VRWB 4WVFB 5JHGA 3IVFA 1Q67A 1MIXA 1LW3A 2RSGA 2DYQA 4CHJA 4CHMA 5C79A 4GPTB 2MWNB 1FHXA 2R0DA 2M38A 1MAIA 1UPQA 4EJNA 3AU4A 4TKNA 4HDQA 3A8PA 5FI0A 4GMXB 1PLSA 2GJYA 3D8DA 4MK0A 2P0HA 5KCVA 2DX1A 2X18A 5C6RA 5GOWB 5J3TA 5DIFB 2OQBA 2COAA 3ZVRA 1P5TA 2K2JA 4P7IA 2BCJA 4K2PA 1RRPB 4HHVA 1V89A 1U5GA 1U2BA 4H8SA 2DHJA 2E2XA 2RUKB 3SYXA 3BJIA 1IRSA 1FAOA 4MY6A 2XQNM 2VKIA 2YF0A 2Z0QA 1KZGA 2I1JA 2V76A 1XD4A 2ZPYA 3OANA 4HB0B 4DBBA 1XR0B 3T06A 5HE3A 3GYOA 3HK0A 2JP2A 3DXEA 2DHKA 2KGXB 2LOXA 3M1IB 4DXAB 3FEHA 3MDBC 3PVLA 3HW2B 1MPHA 2D10A 3DXCA 4KVGB 3D8EA 3ODWA 4A6FA 2MDXA 1EVHA 5D3WA 2DHIA 2D9YA 1U27A 3TW1A 2D11A 4GMVA 1NTVA 2YT1A 2EJ8A 3AJ4A 3SUZA 3PSCA 3FM8C 5D3VA 1V5PA 2AL6A 1UNQA 3G9WA 2P8VA 1DROA 2CODA 3ULCA 2N23A 1M7EA 5D3YA 4F7UP 5HE1A 2DLWA 2DYNA 1XCGA 3HQCA 2DKPA 4KHOA 5KQ4A 2MFQA 5C5BA 1H4RA 1FOEA 2CY5A 2P0FA 2ROVA 2RGNB 1ZC3B 4HAVB 3QBVB 1UPRA 1XODA 2YT0A 3ML4A 5D27A 4HAXB 3FSSA 5C16A 4TYZA 2IYBA 3PZDA 2DA0A 2RVBB 4K81A 1DBHA 4WSFA 5EFXA 4WJ7A 2I1KA 3F5RA 2Z0OA 1LB1A 4GN1A 2YSZA 1WJ1A 2D9XA 5FI1A 2J0MA 2UZSA 4Z2MB 1J19A 2FJLA 2QKMA 4F7GA 4Z2NA 1U5FA 1V61A 3VOQA 2DX5A 2ELBA 1UNPA 1U5DA 1X86A 1Y19B 4PQ0A 3V5WA 3WA0A 3SO6A 4BBKA 4KHAA 5J3YA 2GCJA 3KZ1A 1EGXA 1W1HA 2DTCA 2J0KA 1TXDA 3CXBB 1XKEA 3U7DA 2YS3A 2IFSA 1U5EA 1W1GA 1SHCA 1X1FA 4EMOA 1Z87A 2DFKA 2EMTA 3D8FA 2K2UA 2LOZA 4Y94A 1FGYA 3O96A 4HB3B 4KAXB 1Y5OA 4NSWA 5DH9B 2N0YA 2AEHA 4HAZB 2LULA 4K2OA 4ZRIA 1DDMA 4YL8A 1P3RA 4HDOA 1SGHA 1QQGA 1W1DA 1BTNA 2KUPA 2W2XC 1I2HA 3TFMA 1B55A 5JP4A 3TCAA 3P6AA 1UNRA 5DI9B 3QWMA 2YRYA 5CLLB 5D3XA 1ZVRA 2MKRA 4A6HA 2COFA 4HAYB 3AU5A 4IAPA 5HE2A 2G35A 4D0NB 3RCPA 5LOPB 2RLOA 1AWEA 1P6SA 5JHHA 1ZC4B 1E5WA 3PEGA 1PFJA 1V5UA 4HAWB 1X05A 2OTXA 2P0DA 1NU2A 2UVMA 2Y7BA 1ZM0A 4K17A 2COCA 5JLJB 2R09A 3N7CA 2ADZA 1AQCA 1QC6A 1BWNA 2J59M 2LG1A 1K5DB 2I5FA 2DN6A 1PMSA 5CLQB 3PG7A 3PVUA 3KY9A 4MT7A 4F7HA 1BAKA 1V5MA 4YONA 1X1GA 2YVCA 1WGQA 4IOYX 2NZ8B 4PNKA 2D9WA 3A98B 1BTKA 3KRWA 4A5KA 1DYNA 2M14A 5LONB 1ZSQA 4GZUA 1U29A 2W2WA 3DXDA 4L6EA 1WI1A 3TVVA 2LKOA 5J3QA 3U8ZA 4C0AA 3X23A 1DDWA 1X11A 4NY0A 1MKEA 4GXBA 1ISNA 4B6HA 1FHOA 3SNHA 2CY4A 2DKQA 3QIJA 4DX90 4A6KA 1OMWA 4DX8A 3SV1A 3MPXA 5C5BB 1DDVA 1NI2A 1TJ6A 2QKLA 3VIAA 4ZRJA 2D4QA 2GS0A 1H10A 3WYFB
chains in the Genus database with same CATH superfamily
3KSYA 1V88A 1OY2A 1J0WA 2I5CA 1WG7A 1M7RA 1MIZB 2D9ZA 2CAYA 2KIGA 2ROZB 1K5GB 3CIKA 2Z13A 5DHFB 2YS5A 4HB2B 2CRFA 2Y8FA 5KQ1A 2HTHB 1FGZA 1WVHA 1GG3A 1MI1A 5IRSA 2VSZA 2D9VA 2Y8GA 3P7ZA 1FB8A 4HATB 5HE0A 2W2XD 2UZRA 2RNRB 2KCJA 4CYEA 3BINA 3ODXA 2GCLA 1MK9B 2RRFA 2NMBA 3OHMB 2EC1A 1I7AA 2PZ1A 1FHWA 2Z59A 1EAZA 1GC7A 2YS1A 3LJUX 1WJMA 3UZTA 2J0JA 1XX0A 1EF1A 1RJ2A 2EMSA 3F0WA 3ULBA 1T77A 1UEFA 4HB4B 3PVWA 3NSUA 4ZRKA 1KZ7A 2H7EA 2H7DA 3GYPA 3PP2A 3NWFA 2L1CA 2D2QA 1WGUA 2ELAA 1GC6A 5DHAB 2KR0A 1KI1B 2Q13A 3ODOA 3TO1A 4IFSA 2LYDA 2K00A 3A8QA 2Z0PA 4KHBB 1NTYA 2HE7A 3HSAA 1OQNA 1TQZA 4HAUB 4XWXA 1N3HA 4EKUA 3ZDTA 4A6FB 3KRXA 1MK7B 2L2IA 5L81A 2VRWB 4WVFB 5JHGA 3IVFA 1Q67A 1MIXA 1LW3A 2RSGA 3DCXA 2DYQA 4CHJA 4CHMA 5C79A 4GPTB 2MWNB 1FHXA 2R0DA 2M38A 1MAIA 1UPQA 4EJNA 3NWAA 3AU4A 4TKNA 4HDQA 3A8PA 5FI0A 4GMXB 1PLSA 2GJYA 3D8DA 4MK0A 2P0HA 5KCVA 2DX1A 2X18A 5C6RA 5GOWB 3FVCA 5J3TA 5DIFB 2OQBA 2COAA 3ZVRA 1P5TA 2K2JA 4P7IA 2BCJA 4K2PA 1RRPB 4HHVA 1V89A 1U5GA 1U2BA 4H8SA 2DHJA 2E2XA 4L1RA 2RUKB 3SYXA 3BJIA 1IRSA 1FAOA 4MY6A 2XQNM 2VKIA 2K49A 2YF0A 2Z0QA 1ZYIA 1KZGA 2ZKMX 2I1JA 2V76A 1XD4A 2ZPYA 3OANA 4HB0B 4DBBA 1XR0B 3T06A 5HE3A 3GYOA 3HK0A 2JP2A 3DXEA 2DHKA 2KGXB 2LOXA 3M1IB 4DXAB 3FEHA 3MDBC 3PVLA 3HW2B 1MPHA 2D10A 3DXCA 4KVGB 3D8EA 3ODWA 4A6FA 2MDXA 1EVHA 5D3WA 4HSIA 2DHIA 2D9YA 1U27A 3TW1A 2D11A 4GMVA 3U12A 1NTVA 2R2YA 2YT1A 2EJ8A 3AJ4A 3SUZA 2Z4DA 3PSCA 3FM8C 4D6WA 5D3VA 1V5PA 2AL6A 1UNQA 3G9WA 2P8VA 1DROA 3B77A 2CODA 2K8EA 3ULCA 2N23A 1M7EA 2YT2A 5D3YA 4F7UP 5HE1A 2DLWA 2DYNA 1XCGA 3HQCA 2DKPA 2FJUB 4KHOA 5KQ4A 2MFQA 5C5BA 1H4RA 1FOEA 4GNKB 2CY5A 4CSQA 2P0FA 2ROVA 2RGNB 1ZC3B 4HAVB 3QBVB 1UPRA 1XODA 2YT0A 3ML4A 5D27A 4HAXB 2NBVA 3FSSA 2Z14A 5C16A 4TYZA 2IYBA 3PZDA 2DA0A 2RVBB 4K81A 5I2MA 1DBHA 4WSFA 5EFXA 4WJ7A 2I1KA 3F5RA 2Z0OA 1LB1A 4GN1A 2YSZA 1WJ1A 2D9XA 5FI1A 2J0MA 2UZSA 4Z2MB 4QJ3B 1J19A 2FJLA 5LG4B 2QKMA 4F7GA 4Z2NA 1U5FA 1V61A 3VOQA 2DX5A 2ELBA 1UNPA 1U5DA 1X86A 1Y19B 4PQ0A 3V5WA 3WA0A 3SO6A 4BBKA 2GUMA 4KHAA 5J3YA 2GCJA 3KZ1A 1EGXA 1W1HA 2DTCA 2J0KA 1TXDA 3CXBB 1XKEA 4QJ5B 3U7DA 2YS3A 2IFSA 1U5EA 1W1GA 1SHCA 1X1FA 4EMOA 1Z87A 2DFKA 2EMTA 3D8FA 2K2UA 2LOZA 4Y94A 1FGYA 3O96A 4HB3B 4KAXB 1Y5OA 4NSWA 5DH9B 2N0YA 2AEHA 4HAZB 2LULA 4K2OA 4ZRIA 4GOUA 1DDMA 4YL8A 1P3RA 4HDOA 1SGHA 1QQGA 1W1DA 1BTNA 4KHBA 2KUPA 2W2XC 1I2HA 3TFMA 1B55A 5JP4A 2KIEA 3TCAA 3P6AA 1UNRA 5DI9B 3QWMA 2YRYA 4QXAB 5CLLB 5D3XA 1ZVRA 2MKRA 4A6HA 2COFA 4HAYB 3AU5A 4IAPA 5M4YB 4QJ4B 5HE2A 2G35A 4OSNA 4D0NB 3RCPA 5LOPB 2RLOA 1AWEA 1P6SA 5JHHA 4DIXA 1ZC4B 1E5WA 3PEGA 1PFJA 1V5UA 4HAWB 1X05A 2OTXA 2P0DA 1NU2A 2UVMA 2Y7BA 1ZM0A 4K17A 2COCA 5JLJB 2R09A 3N7CA 2ADZA 1AQCA 1QC6A 1BWNA 2J59M 2LG1A 1K5DB 2I5FA 2DN6A 1PMSA 5CLQB 3PG7A 3PVUA 3KY9A 4MT7A 4OT1A 4F7HA 1BAKA 1V5MA 4YONA 1X1GA 2YVCA 1WGQA 4IOYX 2NZ8B 4PNKA 2D9WA 3A58A 3A98B 1BTKA 3KRWA 4A5KA 1DYNA 2M14A 5LONB 1ZSQA 4GZUA 1U29A 2W2WA 3NW8A 3DXDA 4L6EA 1WI1A 3TVVA 2LKOA 5J3QA 3U8ZA 4C0AA 3X23A 2KUQA 1DDWA 1X11A 5I2SA 4NY0A 1MKEA 4GXBA 1ISNA 4B6HA 1FHOA 3SNHA 2CY4A 2DKQA 3QIJA 4DX90 4A6KA 1OMWA 3HIEA 4DX8A 3SV1A 3MPXA 5C5BB 1DDVA 3NWDA 1NI2A 1TJ6A 2QKLA 3VIAA 4ZRJA 2D4QA 2GS0A 1H10A 3WYFB
chains in the Genus database with same CATH topology
3KSYA 1V88A 1OY2A 1J0WA 2I5CA 1WG7A 1M7RA 1MIZB 2D9ZA 2CAYA 2ROZB 1K5GB 3CIKA 5DHFB 2YS5A 4HB2B 2CRFA 2Y8FA 5KQ1A 2HTHB 1FGZA 1WVHA 1GG3A 2VSZA 2D9VA 2Y8GA 3P7ZA 1FB8A 4HATB 5HE0A 2W2XD 2UZRA 2RNRB 2KCJA 4CYEA 3BINA 3ODXA 2GCLA 1MK9B 2NMBA 2EC1A 1I7AA 2PZ1A 1FHWA 1EAZA 1GC7A 2YS1A 3LJUX 1WJMA 3UZTA 2J0JA 1XX0A 1EF1A 1RJ2A 2EMSA 3F0WA 3ULBA 1UEFA 4HB4B 3PVWA 3NSUA 4ZRKA 1KZ7A 2H7EA 2H7DA 3GYPA 3PP2A 2L1CA 2D2QA 1WGUA 2ELAA 1GC6A 5DHAB 1KI1B 2Q13A 3ODOA 3TO1A 4IFSA 2LYDA 2K00A 3A8QA 2Z0PA 4KHBB 1NTYA 2HE7A 4HAUB 1OQNA 1TQZA 4XWXA 1N3HA 4EKUA 3ZDTA 4A6FB 3KRXA 1MK7B 2L2IA 5L81A 2VRWB 4WVFB 5JHGA 3IVFA 1Q67A 1MIXA 1LW3A 2RSGA 2DYQA 4CHJA 4CHMA 5C79A 4GPTB 2MWNB 1FHXA 2R0DA 2M38A 1MAIA 1UPQA 4EJNA 3AU4A 4TKNA 4HDQA 3A8PA 5FI0A 4GMXB 1PLSA 2GJYA 3D8DA 4MK0A 2P0HA 5KCVA 2DX1A 2X18A 5C6RA 5GOWB 5J3TA 5DIFB 2OQBA 2COAA 3ZVRA 1P5TA 2K2JA 4P7IA 2BCJA 4K2PA 1RRPB 4HHVA 1V89A 1U5GA 1U2BA 4H8SA 2DHJA 2E2XA 2RUKB 3SYXA 3BJIA 1IRSA 1FAOA 4MY6A 2XQNM 2VKIA 2YF0A 2Z0QA 1KZGA 2I1JA 2V76A 1XD4A 2ZPYA 3OANA 4HB0B 4DBBA 1XR0B 3T06A 5HE3A 3GYOA 3HK0A 2JP2A 3DXEA 2DHKA 2KGXB 2LOXA 3M1IB 4DXAB 3FEHA 3MDBC 3PVLA 3HW2B 1MPHA 2D10A 3DXCA 4KVGB 3D8EA 3ODWA 4A6FA 2MDXA 1EVHA 5D3WA 2DHIA 2D9YA 1U27A 3TW1A 2D11A 4GMVA 1NTVA 2YT1A 2EJ8A 3AJ4A 3SUZA 3PSCA 3FM8C 5D3VA 1V5PA 2AL6A 1UNQA 3G9WA 2P8VA 1DROA 2CODA 3ULCA 2N23A 1M7EA 5D3YA 4F7UP 5HE1A 2DLWA 2DYNA 1XCGA 3HQCA 2DKPA 4KHOA 5KQ4A 2MFQA 5C5BA 1H4RA 1FOEA 2CY5A 2P0FA 2ROVA 2RGNB 1ZC3B 4HAVB 3QBVB 1UPRA 1XODA 2YT0A 3ML4A 5D27A 4HAXB 3FSSA 5C16A 4TYZA 2IYBA 3PZDA 2DA0A 2RVBB 4K81A 1DBHA 4WSFA 5EFXA 4WJ7A 2I1KA 3F5RA 2Z0OA 1LB1A 4GN1A 2YSZA 1WJ1A 2D9XA 5FI1A 2J0MA 2UZSA 4Z2MB 1J19A 2FJLA 2QKMA 4F7GA 4Z2NA 1U5FA 1V61A 3VOQA 2DX5A 2ELBA 1UNPA 1U5DA 1X86A 1Y19B 4PQ0A 3V5WA 3WA0A 3SO6A 4BBKA 4KHAA 5J3YA 2GCJA 3KZ1A 1EGXA 1W1HA 2DTCA 2J0KA 1TXDA 3CXBB 1XKEA 3U7DA 2YS3A 2IFSA 1U5EA 1W1GA 1SHCA 1X1FA 4EMOA 1Z87A 2DFKA 2EMTA 3D8FA 2K2UA 2LOZA 4Y94A 1FGYA 3O96A 4HB3B 4KAXB 1Y5OA 4NSWA 5DH9B 2N0YA 2AEHA 4HAZB 2LULA 4K2OA 4ZRIA 1DDMA 4YL8A 1P3RA 4HDOA 1SGHA 1QQGA 1W1DA 1BTNA 2KUPA 2W2XC 1I2HA 3TFMA 1B55A 5JP4A 3TCAA 3P6AA 1UNRA 5DI9B 3QWMA 2YRYA 5CLLB 5D3XA 1ZVRA 2MKRA 4A6HA 2COFA 4HAYB 3AU5A 4IAPA 5HE2A 2G35A 4D0NB 3RCPA 5LOPB 2RLOA 1AWEA 1P6SA 5JHHA 1ZC4B 1E5WA 3PEGA 1PFJA 1V5UA 4HAWB 1X05A 2OTXA 2P0DA 1NU2A 2UVMA 2Y7BA 1ZM0A 4K17A 2COCA 5JLJB 2R09A 3N7CA 2ADZA 1AQCA 1QC6A 1BWNA 2J59M 2LG1A 1K5DB 2I5FA 2DN6A 1PMSA 5CLQB 3PG7A 3PVUA 3KY9A 4MT7A 4F7HA 1BAKA 1V5MA 4YONA 1X1GA 2YVCA 1WGQA 4IOYX 2NZ8B 4PNKA 2D9WA 3A98B 1BTKA 3KRWA 4A5KA 1DYNA 2M14A 5LONB 1ZSQA 4GZUA 1U29A 2W2WA 3DXDA 4L6EA 1WI1A 3TVVA 2LKOA 5J3QA 3U8ZA 4C0AA 3X23A 1DDWA 1X11A 4NY0A 1MKEA 4GXBA 1ISNA 4B6HA 1FHOA 3SNHA 2CY4A 2DKQA 3QIJA 4DX90 4A6KA 1OMWA 4DX8A 3SV1A 3MPXA 5C5BB 1DDVA 1NI2A 1TJ6A 2QKLA 3VIAA 4ZRJA 2D4QA 2GS0A 1H10A 3WYFB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KSY A;  1V88 A;  1OY2 A;  1J0W A;  2I5C A;  1WG7 A;  1M7R A;  1MIZ B;  2D9Z A;  2CAY A;  2ROZ B;  1K5G B;  3CIK A;  5DHF B;  2YS5 A;  4HB2 B;  2CRF A;  2Y8F A;  5KQ1 A;  2HTH B;  1FGZ A;  1WVH A;  1GG3 A;  2VSZ A;  2D9V A;  2Y8G A;  3P7Z A;  1FB8 A;  4HAT B;  5HE0 A;  2W2X D;  2UZR A;  2RNR B;  2KCJ A;  4CYE A;  3BIN A;  3ODX A;  2GCL A;  1MK9 B;  2NMB A;  2EC1 A;  1I7A A;  2PZ1 A;  1FHW A;  1EAZ A;  1GC7 A;  2YS1 A;  3LJU X;  1WJM A;  3UZT A;  2J0J A;  1XX0 A;  1EF1 A;  1RJ2 A;  2EMS A;  3F0W A;  3ULB A;  1UEF A;  4HB4 B;  3PVW A;  3NSU A;  4ZRK A;  1KZ7 A;  2H7E A;  2H7D A;  3GYP A;  3PP2 A;  2L1C A;  2D2Q A;  1WGU A;  2ELA A;  1GC6 A;  5DHA B;  1KI1 B;  2Q13 A;  3ODO A;  3TO1 A;  4IFS A;  2LYD A;  2K00 A;  3A8Q A;  2Z0P A;  4KHB B;  1NTY A;  2HE7 A;  4HAU B;  1OQN A;  1TQZ A;  4XWX A;  1N3H A;  4EKU A;  3ZDT A;  4A6F B;  3KRX A;  1MK7 B;  2L2I A;  5L81 A;  2VRW B;  4WVF B;  5JHG A;  3IVF A;  1Q67 A;  1MIX A;  1LW3 A;  2RSG A;  2DYQ A;  4CHJ A;  4CHM A;  5C79 A;  4GPT B;  2MWN B;  1FHX A;  2R0D A;  2M38 A;  1MAI A;  1UPQ A;  4EJN A;  3AU4 A;  4TKN A;  4HDQ A;  3A8P A;  5FI0 A;  4GMX B;  1PLS A;  2GJY A;  3D8D A;  4MK0 A;  2P0H A;  5KCV A;  2DX1 A;  2X18 A;  5C6R A;  5GOW B;  5J3T A;  5DIF B;  2OQB A;  2COA A;  3ZVR A;  1P5T A;  2K2J A;  4P7I A;  2BCJ A;  4K2P A;  1RRP B;  4HHV A;  1V89 A;  1U5G A;  1U2B A;  4H8S A;  2DHJ A;  2E2X A;  2RUK B;  3SYX A;  3BJI A;  1IRS A;  1FAO A;  4MY6 A;  2XQN M;  2VKI A;  2YF0 A;  2Z0Q A;  1KZG A;  2I1J A;  2V76 A;  1XD4 A;  2ZPY A;  3OAN A;  4HB0 B;  4DBB A;  1XR0 B;  3T06 A;  5HE3 A;  3GYO A;  3HK0 A;  2JP2 A;  3DXE A;  2DHK A;  2KGX B;  2LOX A;  3M1I B;  4DXA B;  3FEH A;  3MDB C;  3PVL A;  3HW2 B;  1MPH A;  2D10 A;  3DXC A;  4KVG B;  3D8E A;  3ODW A;  4A6F A;  2MDX A;  1EVH A;  5D3W A;  2DHI A;  2D9Y A;  1U27 A;  3TW1 A;  2D11 A;  4GMV A;  1NTV A;  2YT1 A;  2EJ8 A;  3AJ4 A;  3SUZ A;  3PSC A;  3FM8 C;  5D3V A;  1V5P A;  2AL6 A;  1UNQ A;  3G9W A;  2P8V A;  1DRO A;  2COD A;  3ULC A;  2N23 A;  1M7E A;  5D3Y A;  4F7U P;  5HE1 A;  2DLW A;  2DYN A;  1XCG A;  3HQC A;  2DKP A;  4KHO A;  5KQ4 A;  2MFQ A;  5C5B A;  1H4R A;  1FOE A;  2CY5 A;  2P0F A;  2ROV A;  2RGN B;  1ZC3 B;  4HAV B;  3QBV B;  1UPR A;  1XOD A;  2YT0 A;  3ML4 A;  5D27 A;  4HAX B;  3FSS A;  5C16 A;  4TYZ A;  2IYB A;  3PZD A;  2DA0 A;  2RVB B;  4K81 A;  1DBH A;  4WSF A;  5EFX A;  4WJ7 A;  2I1K A;  3F5R A;  2Z0O A;  1LB1 A;  4GN1 A;  2YSZ A;  1WJ1 A;  2D9X A;  5FI1 A;  2J0M A;  2UZS A;  4Z2M B;  1J19 A;  2FJL A;  2QKM A;  4F7G A;  4Z2N A;  1U5F A;  1V61 A;  3VOQ A;  2DX5 A;  2ELB A;  1UNP A;  1U5D A;  1X86 A;  1Y19 B;  4PQ0 A;  3V5W A;  3WA0 A;  3SO6 A;  4BBK A;  4KHA A;  5J3Y A;  2GCJ A;  3KZ1 A;  1EGX A;  1W1H A;  2DTC A;  2J0K A;  1TXD A;  3CXB B;  1XKE A;  3U7D A;  2YS3 A;  2IFS A;  1U5E A;  1W1G A;  1SHC A;  1X1F A;  4EMO A;  1Z87 A;  2DFK A;  2EMT A;  3D8F A;  2K2U A;  2LOZ A;  4Y94 A;  1FGY A;  3O96 A;  4HB3 B;  4KAX B;  1Y5O A;  4NSW A;  5DH9 B;  2N0Y A;  2AEH A;  4HAZ B;  2LUL A;  4K2O A;  4ZRI A;  1DDM A;  4YL8 A;  1P3R A;  4HDO A;  1SGH A;  1QQG A;  1W1D A;  1BTN A;  2KUP A;  2W2X C;  1I2H A;  3TFM A;  1B55 A;  5JP4 A;  3TCA A;  3P6A A;  1UNR A;  5DI9 B;  3QWM A;  2YRY A;  5CLL B;  5D3X A;  1ZVR A;  2MKR A;  4A6H A;  2COF A;  4HAY B;  3AU5 A;  4IAP A;  5HE2 A;  2G35 A;  4D0N B;  3RCP A;  5LOP B;  2RLO A;  1AWE A;  1P6S A;  5JHH A;  1ZC4 B;  1E5W A;  3PEG A;  1PFJ A;  1V5U A;  4HAW B;  1X05 A;  2OTX A;  2P0D A;  1NU2 A;  2UVM A;  2Y7B A;  1ZM0 A;  4K17 A;  2COC A;  5JLJ B;  2R09 A;  3N7C A;  2ADZ A;  1AQC A;  1QC6 A;  1BWN A;  2J59 M;  2LG1 A;  1K5D B;  2I5F A;  2DN6 A;  1PMS A;  5CLQ B;  3PG7 A;  3PVU A;  3KY9 A;  4MT7 A;  4F7H A;  1BAK A;  1V5M A;  4YON A;  1X1G A;  2YVC A;  1WGQ A;  4IOY X;  2NZ8 B;  4PNK A;  2D9W A;  3A98 B;  1BTK A;  3KRW A;  4A5K A;  1DYN A;  2M14 A;  5LON B;  1ZSQ A;  4GZU A;  1U29 A;  2W2W A;  3DXD A;  4L6E A;  1WI1 A;  3TVV A;  2LKO A;  5J3Q A;  3U8Z A;  4C0A A;  3X23 A;  1DDW A;  1X11 A;  4NY0 A;  1MKE A;  4GXB A;  1ISN A;  4B6H A;  1FHO A;  3SNH A;  2CY4 A;  2DKQ A;  3QIJ A;  4DX9 0;  4A6K A;  1OMW A;  4DX8 A;  3SV1 A;  3MPX A;  5C5B B;  1DDV A;  1NI2 A;  1TJ6 A;  2QKL A;  3VIA A;  4ZRJ A;  2D4Q A;  2GS0 A;  1H10 A;  3WYF B; 
#chains in the Genus database with same CATH topology
 3KSY A;  1V88 A;  1OY2 A;  1J0W A;  2I5C A;  1WG7 A;  1M7R A;  1MIZ B;  2D9Z A;  2CAY A;  2KIG A;  2ROZ B;  1K5G B;  3CIK A;  2Z13 A;  5DHF B;  2YS5 A;  4HB2 B;  2CRF A;  2Y8F A;  5KQ1 A;  2HTH B;  1FGZ A;  1WVH A;  1GG3 A;  1MI1 A;  5IRS A;  2VSZ A;  2D9V A;  2Y8G A;  3P7Z A;  1FB8 A;  4HAT B;  5HE0 A;  2W2X D;  2UZR A;  2RNR B;  2KCJ A;  4CYE A;  3BIN A;  3ODX A;  2GCL A;  1MK9 B;  2RRF A;  2NMB A;  3OHM B;  2EC1 A;  1I7A A;  2PZ1 A;  1FHW A;  2Z59 A;  1EAZ A;  1GC7 A;  2YS1 A;  3LJU X;  1WJM A;  3UZT A;  2J0J A;  1XX0 A;  1EF1 A;  1RJ2 A;  2EMS A;  3F0W A;  3ULB A;  1T77 A;  1UEF A;  4HB4 B;  3PVW A;  3NSU A;  4ZRK A;  1KZ7 A;  2H7E A;  2H7D A;  3GYP A;  3PP2 A;  3NWF A;  2L1C A;  2D2Q A;  1WGU A;  2ELA A;  1GC6 A;  5DHA B;  2KR0 A;  1KI1 B;  2Q13 A;  3ODO A;  3TO1 A;  4IFS A;  2LYD A;  2K00 A;  3A8Q A;  2Z0P A;  4KHB B;  1NTY A;  2HE7 A;  3HSA A;  1OQN A;  1TQZ A;  4HAU B;  4XWX A;  1N3H A;  4EKU A;  3ZDT A;  4A6F B;  3KRX A;  1MK7 B;  2L2I A;  5L81 A;  2VRW B;  4WVF B;  5JHG A;  3IVF A;  1Q67 A;  1MIX A;  1LW3 A;  2RSG A;  3DCX A;  2DYQ A;  4CHJ A;  4CHM A;  5C79 A;  4GPT B;  2MWN B;  1FHX A;  2R0D A;  2M38 A;  1MAI A;  1UPQ A;  4EJN A;  3NWA A;  3AU4 A;  4TKN A;  4HDQ A;  3A8P A;  5FI0 A;  4GMX B;  1PLS A;  2GJY A;  3D8D A;  4MK0 A;  2P0H A;  5KCV A;  2DX1 A;  2X18 A;  5C6R A;  5GOW B;  3FVC A;  5J3T A;  5DIF B;  2OQB A;  2COA A;  3ZVR A;  1P5T A;  2K2J A;  4P7I A;  2BCJ A;  4K2P A;  1RRP B;  4HHV A;  1V89 A;  1U5G A;  1U2B A;  4H8S A;  2DHJ A;  2E2X A;  4L1R A;  2RUK B;  3SYX A;  3BJI A;  1IRS A;  1FAO A;  4MY6 A;  2XQN M;  2VKI A;  2K49 A;  2YF0 A;  2Z0Q A;  1ZYI A;  1KZG A;  2ZKM X;  2I1J A;  2V76 A;  1XD4 A;  2ZPY A;  3OAN A;  4HB0 B;  4DBB A;  1XR0 B;  3T06 A;  5HE3 A;  3GYO A;  3HK0 A;  2JP2 A;  3DXE A;  2DHK A;  2KGX B;  2LOX A;  3M1I B;  4DXA B;  3FEH A;  3MDB C;  3PVL A;  3HW2 B;  1MPH A;  2D10 A;  3DXC A;  4KVG B;  3D8E A;  3ODW A;  4A6F A;  2MDX A;  1EVH A;  5D3W A;  4HSI A;  2DHI A;  2D9Y A;  1U27 A;  3TW1 A;  2D11 A;  4GMV A;  3U12 A;  1NTV A;  2R2Y A;  2YT1 A;  2EJ8 A;  3AJ4 A;  3SUZ A;  2Z4D A;  3PSC A;  3FM8 C;  4D6W A;  5D3V A;  1V5P A;  2AL6 A;  1UNQ A;  3G9W A;  2P8V A;  1DRO A;  3B77 A;  2COD A;  2K8E A;  3ULC A;  2N23 A;  1M7E A;  2YT2 A;  5D3Y A;  4F7U P;  5HE1 A;  2DLW A;  2DYN A;  1XCG A;  3HQC A;  2DKP A;  2FJU B;  4KHO A;  5KQ4 A;  2MFQ A;  5C5B A;  1H4R A;  1FOE A;  4GNK B;  2CY5 A;  4CSQ A;  2P0F A;  2ROV A;  2RGN B;  1ZC3 B;  4HAV B;  3QBV B;  1UPR A;  1XOD A;  2YT0 A;  3ML4 A;  5D27 A;  4HAX B;  2NBV A;  3FSS A;  2Z14 A;  5C16 A;  4TYZ A;  2IYB A;  3PZD A;  2DA0 A;  2RVB B;  4K81 A;  5I2M A;  1DBH A;  4WSF A;  5EFX A;  4WJ7 A;  2I1K A;  3F5R A;  2Z0O A;  1LB1 A;  4GN1 A;  2YSZ A;  1WJ1 A;  2D9X A;  5FI1 A;  2J0M A;  2UZS A;  4Z2M B;  4QJ3 B;  1J19 A;  2FJL A;  5LG4 B;  2QKM A;  4F7G A;  4Z2N A;  1U5F A;  1V61 A;  3VOQ A;  2DX5 A;  2ELB A;  1UNP A;  1U5D A;  1X86 A;  1Y19 B;  4PQ0 A;  3V5W A;  3WA0 A;  3SO6 A;  4BBK A;  2GUM A;  4KHA A;  5J3Y A;  2GCJ A;  3KZ1 A;  1EGX A;  1W1H A;  2DTC A;  2J0K A;  1TXD A;  3CXB B;  1XKE A;  4QJ5 B;  3U7D A;  2YS3 A;  2IFS A;  1U5E A;  1W1G A;  1SHC A;  1X1F A;  4EMO A;  1Z87 A;  2DFK A;  2EMT A;  3D8F A;  2K2U A;  2LOZ A;  4Y94 A;  1FGY A;  3O96 A;  4HB3 B;  4KAX B;  1Y5O A;  4NSW A;  5DH9 B;  2N0Y A;  2AEH A;  4HAZ B;  2LUL A;  4K2O A;  4ZRI A;  4GOU A;  1DDM A;  4YL8 A;  1P3R A;  4HDO A;  1SGH A;  1QQG A;  1W1D A;  1BTN A;  4KHB A;  2KUP A;  2W2X C;  1I2H A;  3TFM A;  1B55 A;  5JP4 A;  2KIE A;  3TCA A;  3P6A A;  1UNR A;  5DI9 B;  3QWM A;  2YRY A;  4QXA B;  5CLL B;  5D3X A;  1ZVR A;  2MKR A;  4A6H A;  2COF A;  4HAY B;  3AU5 A;  4IAP A;  5M4Y B;  4QJ4 B;  5HE2 A;  2G35 A;  4OSN A;  4D0N B;  3RCP A;  5LOP B;  2RLO A;  1AWE A;  1P6S A;  5JHH A;  4DIX A;  1ZC4 B;  1E5W A;  3PEG A;  1PFJ A;  1V5U A;  4HAW B;  1X05 A;  2OTX A;  2P0D A;  1NU2 A;  2UVM A;  2Y7B A;  1ZM0 A;  4K17 A;  2COC A;  5JLJ B;  2R09 A;  3N7C A;  2ADZ A;  1AQC A;  1QC6 A;  1BWN A;  2J59 M;  2LG1 A;  1K5D B;  2I5F A;  2DN6 A;  1PMS A;  5CLQ B;  3PG7 A;  3PVU A;  3KY9 A;  4MT7 A;  4OT1 A;  4F7H A;  1BAK A;  1V5M A;  4YON A;  1X1G A;  2YVC A;  1WGQ A;  4IOY X;  2NZ8 B;  4PNK A;  2D9W A;  3A58 A;  3A98 B;  1BTK A;  3KRW A;  4A5K A;  1DYN A;  2M14 A;  5LON B;  1ZSQ A;  4GZU A;  1U29 A;  2W2W A;  3NW8 A;  3DXD A;  4L6E A;  1WI1 A;  3TVV A;  2LKO A;  5J3Q A;  3U8Z A;  4C0A A;  3X23 A;  2KUQ A;  1DDW A;  1X11 A;  5I2S A;  4NY0 A;  1MKE A;  4GXB A;  1ISN A;  4B6H A;  1FHO A;  3SNH A;  2CY4 A;  2DKQ A;  3QIJ A;  4DX9 0;  4A6K A;  1OMW A;  3HIE A;  4DX8 A;  3SV1 A;  3MPX A;  5C5B B;  1DDV A;  3NWD A;  1NI2 A;  1TJ6 A;  2QKL A;  3VIA A;  4ZRJ A;  2D4Q A;  2GS0 A;  1H10 A;  3WYF B; 
#chains in the Genus database with same CATH homology
 3KSY A;  1V88 A;  1OY2 A;  1J0W A;  2I5C A;  1WG7 A;  1M7R A;  1MIZ B;  2D9Z A;  2CAY A;  2ROZ B;  1K5G B;  3CIK A;  5DHF B;  2YS5 A;  4HB2 B;  2CRF A;  2Y8F A;  5KQ1 A;  2HTH B;  1FGZ A;  1WVH A;  1GG3 A;  2VSZ A;  2D9V A;  2Y8G A;  3P7Z A;  1FB8 A;  4HAT B;  5HE0 A;  2W2X D;  2UZR A;  2RNR B;  2KCJ A;  4CYE A;  3BIN A;  3ODX A;  2GCL A;  1MK9 B;  2NMB A;  2EC1 A;  1I7A A;  2PZ1 A;  1FHW A;  1EAZ A;  1GC7 A;  2YS1 A;  3LJU X;  1WJM A;  3UZT A;  2J0J A;  1XX0 A;  1EF1 A;  1RJ2 A;  2EMS A;  3F0W A;  3ULB A;  1UEF A;  4HB4 B;  3PVW A;  3NSU A;  4ZRK A;  1KZ7 A;  2H7E A;  2H7D A;  3GYP A;  3PP2 A;  2L1C A;  2D2Q A;  1WGU A;  2ELA A;  1GC6 A;  5DHA B;  1KI1 B;  2Q13 A;  3ODO A;  3TO1 A;  4IFS A;  2LYD A;  2K00 A;  3A8Q A;  2Z0P A;  4KHB B;  1NTY A;  2HE7 A;  4HAU B;  1OQN A;  1TQZ A;  4XWX A;  1N3H A;  4EKU A;  3ZDT A;  4A6F B;  3KRX A;  1MK7 B;  2L2I A;  5L81 A;  2VRW B;  4WVF B;  5JHG A;  3IVF A;  1Q67 A;  1MIX A;  1LW3 A;  2RSG A;  2DYQ A;  4CHJ A;  4CHM A;  5C79 A;  4GPT B;  2MWN B;  1FHX A;  2R0D A;  2M38 A;  1MAI A;  1UPQ A;  4EJN A;  3AU4 A;  4TKN A;  4HDQ A;  3A8P A;  5FI0 A;  4GMX B;  1PLS A;  2GJY A;  3D8D A;  4MK0 A;  2P0H A;  5KCV A;  2DX1 A;  2X18 A;  5C6R A;  5GOW B;  5J3T A;  5DIF B;  2OQB A;  2COA A;  3ZVR A;  1P5T A;  2K2J A;  4P7I A;  2BCJ A;  4K2P A;  1RRP B;  4HHV A;  1V89 A;  1U5G A;  1U2B A;  4H8S A;  2DHJ A;  2E2X A;  2RUK B;  3SYX A;  3BJI A;  1IRS A;  1FAO A;  4MY6 A;  2XQN M;  2VKI A;  2YF0 A;  2Z0Q A;  1KZG A;  2I1J A;  2V76 A;  1XD4 A;  2ZPY A;  3OAN A;  4HB0 B;  4DBB A;  1XR0 B;  3T06 A;  5HE3 A;  3GYO A;  3HK0 A;  2JP2 A;  3DXE A;  2DHK A;  2KGX B;  2LOX A;  3M1I B;  4DXA B;  3FEH A;  3MDB C;  3PVL A;  3HW2 B;  1MPH A;  2D10 A;  3DXC A;  4KVG B;  3D8E A;  3ODW A;  4A6F A;  2MDX A;  1EVH A;  5D3W A;  2DHI A;  2D9Y A;  1U27 A;  3TW1 A;  2D11 A;  4GMV A;  1NTV A;  2YT1 A;  2EJ8 A;  3AJ4 A;  3SUZ A;  3PSC A;  3FM8 C;  5D3V A;  1V5P A;  2AL6 A;  1UNQ A;  3G9W A;  2P8V A;  1DRO A;  2COD A;  3ULC A;  2N23 A;  1M7E A;  5D3Y A;  4F7U P;  5HE1 A;  2DLW A;  2DYN A;  1XCG A;  3HQC A;  2DKP A;  4KHO A;  5KQ4 A;  2MFQ A;  5C5B A;  1H4R A;  1FOE A;  2CY5 A;  2P0F A;  2ROV A;  2RGN B;  1ZC3 B;  4HAV B;  3QBV B;  1UPR A;  1XOD A;  2YT0 A;  3ML4 A;  5D27 A;  4HAX B;  3FSS A;  5C16 A;  4TYZ A;  2IYB A;  3PZD A;  2DA0 A;  2RVB B;  4K81 A;  1DBH A;  4WSF A;  5EFX A;  4WJ7 A;  2I1K A;  3F5R A;  2Z0O A;  1LB1 A;  4GN1 A;  2YSZ A;  1WJ1 A;  2D9X A;  5FI1 A;  2J0M A;  2UZS A;  4Z2M B;  1J19 A;  2FJL A;  2QKM A;  4F7G A;  4Z2N A;  1U5F A;  1V61 A;  3VOQ A;  2DX5 A;  2ELB A;  1UNP A;  1U5D A;  1X86 A;  1Y19 B;  4PQ0 A;  3V5W A;  3WA0 A;  3SO6 A;  4BBK A;  4KHA A;  5J3Y A;  2GCJ A;  3KZ1 A;  1EGX A;  1W1H A;  2DTC A;  2J0K A;  1TXD A;  3CXB B;  1XKE A;  3U7D A;  2YS3 A;  2IFS A;  1U5E A;  1W1G A;  1SHC A;  1X1F A;  4EMO A;  1Z87 A;  2DFK A;  2EMT A;  3D8F A;  2K2U A;  2LOZ A;  4Y94 A;  1FGY A;  3O96 A;  4HB3 B;  4KAX B;  1Y5O A;  4NSW A;  5DH9 B;  2N0Y A;  2AEH A;  4HAZ B;  2LUL A;  4K2O A;  4ZRI A;  1DDM A;  4YL8 A;  1P3R A;  4HDO A;  1SGH A;  1QQG A;  1W1D A;  1BTN A;  2KUP A;  2W2X C;  1I2H A;  3TFM A;  1B55 A;  5JP4 A;  3TCA A;  3P6A A;  1UNR A;  5DI9 B;  3QWM A;  2YRY A;  5CLL B;  5D3X A;  1ZVR A;  2MKR A;  4A6H A;  2COF A;  4HAY B;  3AU5 A;  4IAP A;  5HE2 A;  2G35 A;  4D0N B;  3RCP A;  5LOP B;  2RLO A;  1AWE A;  1P6S A;  5JHH A;  1ZC4 B;  1E5W A;  3PEG A;  1PFJ A;  1V5U A;  4HAW B;  1X05 A;  2OTX A;  2P0D A;  1NU2 A;  2UVM A;  2Y7B A;  1ZM0 A;  4K17 A;  2COC A;  5JLJ B;  2R09 A;  3N7C A;  2ADZ A;  1AQC A;  1QC6 A;  1BWN A;  2J59 M;  2LG1 A;  1K5D B;  2I5F A;  2DN6 A;  1PMS A;  5CLQ B;  3PG7 A;  3PVU A;  3KY9 A;  4MT7 A;  4F7H A;  1BAK A;  1V5M A;  4YON A;  1X1G A;  2YVC A;  1WGQ A;  4IOY X;  2NZ8 B;  4PNK A;  2D9W A;  3A98 B;  1BTK A;  3KRW A;  4A5K A;  1DYN A;  2M14 A;  5LON B;  1ZSQ A;  4GZU A;  1U29 A;  2W2W A;  3DXD A;  4L6E A;  1WI1 A;  3TVV A;  2LKO A;  5J3Q A;  3U8Z A;  4C0A A;  3X23 A;  1DDW A;  1X11 A;  4NY0 A;  1MKE A;  4GXB A;  1ISN A;  4B6H A;  1FHO A;  3SNH A;  2CY4 A;  2DKQ A;  3QIJ A;  4DX9 0;  4A6K A;  1OMW A;  4DX8 A;  3SV1 A;  3MPX A;  5C5B B;  1DDV A;  1NI2 A;  1TJ6 A;  2QKL A;  3VIA A;  4ZRJ A;  2D4Q A;  2GS0 A;  1H10 A;  3WYF B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...