1V61A

Solution structure of the pleckstrin homology domain of alpha-pix
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
132
structure length
132
Chain Sequence
GSSGSSGQILSEPIQAWEGDDIKTLGNVIFMSQVVMQHGACEEKEERYFLLFSSVLIMLSASPRMSGFMYQGKIPIAGMVVNRLDEIEGSDCMFEITGSTVERIVVHCNNNQDFQEWMEQLNRLTKSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords Rac/Cdc42 guanine nucleotide exchange factor (GEF) 6
publication title Solution Structure of the Pleckstrin Homology Domain of alpha-Pix
rcsb
source organism Mus musculus
total genus 15
structure length 132
sequence length 132
ec nomenclature
pdb deposition date 2003-11-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00169 PH PH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 1v61A00
2EJ8A 3PVWA 3SNHA 3N7CA 2DHKA 1RRPB 3TW1A 1RJ2A 1FAOA 3TFMA 1OMWA 3SO6A 3D8DA 3SYXA 4Z2MB 3A8PA 3PEGA 1TJ6A 4KHBB 2HE7A 1FHXA 4IAPA 1EAZA 1LW3A 1TXDA 2EMTA 2YT1A 3T06A 4CYEA 1FB8A 3PG7A 5JHGA 2D11A 2Y8GA 2I1KA 1H4RA 2MWNB 1WJMA 1PFJA 1Q67A 1DYNA 4HATB 4KVGB 4PQ0A 4WSFA 1AQCA 2EC1A 4H8SA 1Z87A 2N23A 4DX90 4HAXB 2D9WA 4A6KA 4WJ7A 3ODWA 5CLQB 1MKEA 2DTCA 2K2UA 2I5CA 1N3HA 1KZ7A 1QC6A 3KRXA 1WI1A 2YS1A 5EFXA 3KRWA 4ZRIA 2EMSA 1XODA 3MPXA 2RLOA 4HAYB 4B6HA 2ELBA 1DDMA 1Y5OA 3VIAA 3UZTA 3RCPA 1GG3A 2D9YA 2GCLA 1M7EA 4HDOA 1SHCA 1U27A 4HAUB 1DDVA 1EVHA 2ZPYA 1OY2A 5DI9B 2LKOA 4ZRJA 2ELAA 2X18A 2UZRA 3A8QA 3QIJA 4YL8A 3U8ZA 1P5TA 2R0DA 2LULA 3GYOA 2NMBA 1WVHA 2PZ1A 2YS3A 4C0AA 3WA0A 2Z0OA 1J19A 3KZ1A 4HDQA 1I7AA 1MPHA 4KHAA 1FHOA 3MDBC 2DHJA 2W2WA 3KSYA 1BTNA 3BINA 5HE2A 1BTKA 5J3TA 4HB0B 2W2XC 1BWNA 1U5EA 3NSUA 1EGXA 5KQ1A 4HAWB 2YF0A 1ZM0A 4DXAB 4XWXA 4A6HA 3P7ZA 2UZSA 3DXEA 1GC7A 2R09A 2OTXA 4HHVA 1NI2A 5KQ4A 4HAZB 4IFSA 5J3YA 1U5FA 3D8FA 5DIFB 4K2OA 1V5UA 1XR0B 1V5MA 2Z0PA 4HB3B 4CHMA 2D9XA 1WG7A 3ZVRA 3F0WA 5J3QA 3D8EA 4GN1A 5L81A 1U5DA 5C16A 4D0NB 3ML4A 3PZDA 1K5GB 4GZUA 1W1HA 3U7DA 1QQGA 3HQCA 4GPTB 1XKEA 3CIKA 3V5WA 5HE0A 3CXBB 1KZGA 1DDWA 1X86A 3TVVA 3ULCA 5D3XA 1EF1A 3M1IB 3PVLA 4Z2NA 2D9ZA 4NY0A 1U5GA 1X05A 2Y7BA 1MIZB 5DHFB 3SV1A 4YONA 2DHIA 3LJUX 1P3RA 4HB2B 4GMVA 1FOEA 1MAIA 1SGHA 4EJNA 4HAVB 1J0WA 4MT7A 5C5BB 2DKQA 5KCVA 4WVFB 1NTYA 2RGNB 2IYBA 1UPRA 1UPQA 2KGXB 5HE1A 4EMOA 1W1GA 1PMSA 1X11A 2MDXA 3IVFA 1TQZA 4ZRKA 4PNKA 1FGYA 5GOWB 2DN6A 2H7EA 1E5WA 1DBHA 4KHOA 3FEHA 4TYZA 4A5KA 1ZSQA 2H7DA 3SUZA 2DYNA 4F7GA 3PVUA 3P6AA 2BCJA 2LOXA 3QBVB 5D27A 5C6RA 3BJIA 5FI1A 1U29A 2RUKB 1M7RA 1NTVA 1PLSA 1UNRA 3G9WA 2QKLA 3X23A 1UNQA 1NU2A 2NZ8B 5LOPB 2P8VA 2YSZA 4GMXB 5DHAB 2LYDA 4F7HA 5CLLB 2COFA 2XQNM 5DH9B 3FSSA 4P7IA 2MKRA 2CY5A 1UNPA 2LG1A 5JP4A 2HTHB 2VSZA 2KUPA 2P0HA 2I5FA 2J0KA 1V5PA 2L2IA 5D3YA 2J0JA 2OQBA 1WGUA 5C79A 2D2QA 5D3VA 2K00A 3QWMA 5LONB 2RNRB 3PP2A 1I2HA 2VRWB 1XX0A 3TO1A 2DX1A 3HK0A 4A6FA 4BBKA 2CY4A 2DFKA 3F5RA 1OQNA 4DBBA 5JHHA 4K17A 1DROA 1GC6A 2CAYA 2Y8FA 2GJYA 1V61A 2YS5A 2VKIA 1WGQA 4EKUA 2GS0A 1B55A 3AU4A 1Y19B 3DXCA 3A98B 2M38A 4F7UP 1ZC3B 2GCJA 4GXBA 2ADZA 2YT0A 2YRYA 5D3WA 3ODOA 2V76A 2QKMA 3OANA 1UEFA 1FGZA 1ZVRA 1X1FA 2AEHA 1MK7B 1V88A 2D10A 5FI0A 4IOYX 1V89A 2J59M 1P6SA 1WJ1A 3PSCA 2DKPA 1XD4A 4KAXB 4CHJA 3FM8C 2P0DA 2COAA 1W1DA 3O96A 1K5DB 2DX5A 1XCGA 4HB4B 1KI1B 4L6EA 3GYPA 3ULBA 2CRFA 1BAKA 2Q13A 4A6FB 2I1JA 2L1CA 2P0FA 5HE3A 2FJLA 2YVCA 1MK9B 2W2XD 2G35A 2K2JA 2M14A 3ODXA 1LB1A 1ISNA 5JLJB 4K2PA 2COCA 2ROVA 3VOQA 2DA0A 4NSWA 2D9VA 2DLWA 3KY9A 2ROZB 2LOZA 4MK0A 2DYQA 2KCJA 4TKNA 1AWEA 1ZC4B 2RVBB 2IFSA 3ZDTA 2JP2A 2J0MA 2RSGA 2D4QA 1H10A 1IRSA 3WYFB 2N0YA 1U2BA 3TCAA 3AU5A 4MY6A 4K81A 3AJ4A 1X1GA 2CODA 1MIXA 3HW2B 1FHWA 2Z0QA 2UVMA 4Y94A 2AL6A 5C5BA 4DX8A 2E2XA 2MFQA 3DXDA
chains in the Genus database with same CATH superfamily
2EJ8A 3PVWA 3SNHA 3N7CA 2DHKA 1RRPB 3TW1A 1RJ2A 1FAOA 1ZYIA 1OMWA 2Z4DA 3SO6A 3TFMA 3D8DA 3SYXA 4Z2MB 3HIEA 3B77A 3A8PA 3PEGA 1TJ6A 4KHBB 2HE7A 1FHXA 4IAPA 1EAZA 1LW3A 1TXDA 2EMTA 2YT1A 3T06A 4CYEA 1FB8A 3PG7A 5JHGA 2D11A 2Y8GA 2I1KA 1H4RA 2MWNB 3NW8A 1WJMA 1PFJA 1Q67A 1DYNA 2NBVA 4HATB 4KVGB 4PQ0A 4WSFA 1AQCA 2EC1A 4H8SA 1Z87A 2N23A 4DX90 4HAXB 2D9WA 4GOUA 4A6KA 4WJ7A 4OT1A 2KUQA 3ODWA 5CLQB 1MKEA 2DTCA 2K2UA 2I5CA 1N3HA 1KZ7A 1QC6A 3KRXA 2Z14A 3A58A 1WI1A 2YS1A 5LG4B 5EFXA 3KRWA 4ZRIA 2EMSA 1XODA 3MPXA 2RLOA 4HAYB 4B6HA 2ELBA 1DDMA 1Y5OA 3VIAA 3UZTA 3RCPA 1GG3A 2D9YA 2GCLA 4DIXA 1M7EA 4HDOA 1SHCA 1U27A 4HAUB 1DDVA 1EVHA 2ZPYA 1OY2A 2K49A 5DI9B 2LKOA 2KIGA 4ZRJA 2ELAA 2X18A 2UZRA 3A8QA 3QIJA 4YL8A 3U8ZA 1P5TA 2R0DA 2LULA 3GYOA 2NMBA 1WVHA 2PZ1A 2R2YA 2YS3A 4C0AA 3WA0A 2Z0OA 1J19A 3KZ1A 4HDQA 1I7AA 4OSNA 1MPHA 4KHAA 1FHOA 3MDBC 2DHJA 2W2WA 3KSYA 1BTNA 3BINA 4QJ4B 5HE2A 1BTKA 5J3TA 2ZKMX 4CSQA 4HB0B 2W2XC 1BWNA 1U5EA 3NSUA 1EGXA 5KQ1A 4HAWB 2YF0A 1ZM0A 5I2MA 4DXAB 4XWXA 4A6HA 3P7ZA 2UZSA 3DXEA 1GC7A 2R09A 2OTXA 4HHVA 1NI2A 5KQ4A 4HAZB 4IFSA 5J3YA 1U5FA 3D8FA 5DIFB 4K2OA 1V5UA 1XR0B 1V5MA 2Z0PA 4HB3B 4CHMA 2D9XA 1WG7A 3ZVRA 3F0WA 5J3QA 3D8EA 4GN1A 5L81A 1U5DA 5C16A 5M4YB 4D0NB 3ML4A 1K5GB 3PZDA 4GZUA 1W1HA 3U7DA 1QQGA 3HQCA 4GPTB 1XKEA 3CIKA 3V5WA 5HE0A 3CXBB 1KZGA 1DDWA 1X86A 3TVVA 3ULCA 5D3XA 1EF1A 3M1IB 3PVLA 4Z2NA 2D9ZA 4NY0A 1U5GA 1X05A 2Y7BA 1MIZB 5DHFB 3SV1A 4QJ3B 4YONA 5I2SA 2YT2A 2DHIA 3LJUX 1P3RA 4HB2B 4GMVA 1FOEA 1MAIA 1T77A 1SGHA 4EJNA 4HAVB 4QJ5B 1J0WA 4MT7A 5C5BB 1MI1A 2DKQA 3HSAA 5KCVA 4WVFB 1NTYA 2RGNB 2IYBA 1UPRA 1UPQA 3OHMB 4L1RA 2KGXB 5HE1A 4HSIA 4EMOA 1W1GA 1PMSA 1X11A 2MDXA 3IVFA 1TQZA 4D6WA 4ZRKA 4PNKA 1FGYA 5GOWB 2DN6A 2H7EA 1E5WA 1DBHA 4KHOA 3FEHA 4TYZA 4A5KA 1ZSQA 2H7DA 3SUZA 2DYNA 4F7GA 3PVUA 3P6AA 2BCJA 2LOXA 2FJUB 3QBVB 5D27A 5C6RA 3BJIA 2Z59A 4KHBA 5FI1A 3DCXA 1U29A 2K8EA 2RUKB 1M7RA 1NTVA 1PLSA 1UNRA 3G9WA 2QKLA 3X23A 1UNQA 1NU2A 2NZ8B 2RRFA 2P8VA 5LOPB 2YSZA 4GMXB 3NWDA 5DHAB 2LYDA 4F7HA 5CLLB 2COFA 2XQNM 5DH9B 3FSSA 4P7IA 2MKRA 2CY5A 1UNPA 2LG1A 5JP4A 2HTHB 2VSZA 2KUPA 2P0HA 2KR0A 2I5FA 2J0KA 1V5PA 2L2IA 5D3YA 2J0JA 2OQBA 1WGUA 5C79A 2D2QA 5D3VA 2K00A 4QXAB 3QWMA 5LONB 2RNRB 3PP2A 1I2HA 2VRWB 1XX0A 3TO1A 2DX1A 3HK0A 4A6FA 4BBKA 2CY4A 2DFKA 3F5RA 1OQNA 4DBBA 5JHHA 4K17A 1DROA 1GC6A 3FVCA 2CAYA 2Y8FA 2GJYA 1V61A 2YS5A 2VKIA 1WGQA 4EKUA 2GS0A 1B55A 3AU4A 1Y19B 3DXCA 3A98B 2M38A 4F7UP 1ZC3B 4GNKB 2GUMA 2GCJA 4GXBA 2ADZA 2YT0A 2YRYA 5D3WA 3ODOA 2V76A 3U12A 2QKMA 3OANA 1UEFA 1FGZA 1ZVRA 1X1FA 2AEHA 1MK7B 3NWFA 1V88A 2D10A 5FI0A 4IOYX 1V89A 2J59M 1P6SA 1WJ1A 3PSCA 2DKPA 1XD4A 4KAXB 4CHJA 3FM8C 2P0DA 2COAA 1W1DA 3O96A 1K5DB 2DX5A 1XCGA 4HB4B 1KI1B 4L6EA 3GYPA 3ULBA 2CRFA 1BAKA 2Q13A 4A6FB 2I1JA 2L1CA 2P0FA 5HE3A 2FJLA 2YVCA 5IRSA 1MK9B 2W2XD 2G35A 2K2JA 2M14A 3ODXA 1LB1A 1ISNA 5JLJB 4K2PA 2KIEA 2COCA 2ROVA 3VOQA 2DA0A 4NSWA 2D9VA 2DLWA 3KY9A 2ROZB 2LOZA 4MK0A 2DYQA 2KCJA 4TKNA 1AWEA 1ZC4B 2RVBB 2IFSA 3ZDTA 2JP2A 2J0MA 2RSGA 2D4QA 1H10A 1IRSA 2Z13A 3NWAA 3WYFB 2N0YA 1U2BA 3TCAA 3AU5A 4MY6A 4K81A 3AJ4A 1X1GA 2CODA 1MIXA 3HW2B 1FHWA 2Z0QA 2UVMA 4Y94A 2AL6A 5C5BA 4DX8A 2E2XA 2MFQA 3DXDA
chains in the Genus database with same CATH topology
2EJ8A 3PVWA 3SNHA 3N7CA 2DHKA 1RRPB 3TW1A 1RJ2A 1FAOA 3TFMA 1OMWA 3SO6A 3D8DA 3SYXA 4Z2MB 3A8PA 3PEGA 1TJ6A 4KHBB 2HE7A 1FHXA 4IAPA 1EAZA 1LW3A 1TXDA 2EMTA 2YT1A 3T06A 4CYEA 1FB8A 3PG7A 5JHGA 2D11A 2Y8GA 2I1KA 1H4RA 2MWNB 1WJMA 1PFJA 1Q67A 1DYNA 4HATB 4KVGB 4PQ0A 4WSFA 1AQCA 2EC1A 4H8SA 1Z87A 2N23A 4DX90 4HAXB 2D9WA 4A6KA 4WJ7A 3ODWA 5CLQB 1MKEA 2DTCA 2K2UA 2I5CA 1N3HA 1KZ7A 1QC6A 3KRXA 1WI1A 2YS1A 5EFXA 3KRWA 4ZRIA 2EMSA 1XODA 3MPXA 2RLOA 4HAYB 4B6HA 2ELBA 1DDMA 1Y5OA 3VIAA 3UZTA 3RCPA 1GG3A 2D9YA 2GCLA 1M7EA 4HDOA 1SHCA 1U27A 4HAUB 1DDVA 1EVHA 2ZPYA 1OY2A 5DI9B 2LKOA 4ZRJA 2ELAA 2X18A 2UZRA 3A8QA 3QIJA 4YL8A 3U8ZA 1P5TA 2R0DA 2LULA 3GYOA 2NMBA 1WVHA 2PZ1A 2YS3A 4C0AA 3WA0A 2Z0OA 1J19A 3KZ1A 4HDQA 1I7AA 1MPHA 4KHAA 1FHOA 3MDBC 2DHJA 2W2WA 3KSYA 1BTNA 3BINA 5HE2A 1BTKA 5J3TA 4HB0B 2W2XC 1BWNA 1U5EA 3NSUA 1EGXA 5KQ1A 4HAWB 2YF0A 1ZM0A 4DXAB 4XWXA 4A6HA 3P7ZA 2UZSA 3DXEA 1GC7A 2R09A 2OTXA 4HHVA 1NI2A 5KQ4A 4HAZB 4IFSA 5J3YA 1U5FA 3D8FA 5DIFB 4K2OA 1V5UA 1XR0B 1V5MA 2Z0PA 4HB3B 4CHMA 2D9XA 1WG7A 3ZVRA 3F0WA 5J3QA 3D8EA 4GN1A 5L81A 1U5DA 5C16A 4D0NB 3ML4A 3PZDA 1K5GB 4GZUA 1W1HA 3U7DA 1QQGA 3HQCA 4GPTB 1XKEA 3CIKA 3V5WA 5HE0A 3CXBB 1KZGA 1DDWA 1X86A 3TVVA 3ULCA 5D3XA 1EF1A 3M1IB 3PVLA 4Z2NA 2D9ZA 4NY0A 1U5GA 1X05A 2Y7BA 1MIZB 5DHFB 3SV1A 4YONA 2DHIA 3LJUX 1P3RA 4HB2B 4GMVA 1FOEA 1MAIA 1SGHA 4EJNA 4HAVB 1J0WA 4MT7A 5C5BB 2DKQA 5KCVA 4WVFB 1NTYA 2RGNB 2IYBA 1UPRA 1UPQA 2KGXB 5HE1A 4EMOA 1W1GA 1PMSA 1X11A 2MDXA 3IVFA 1TQZA 4ZRKA 4PNKA 1FGYA 5GOWB 2DN6A 2H7EA 1E5WA 1DBHA 4KHOA 3FEHA 4TYZA 4A5KA 1ZSQA 2H7DA 3SUZA 2DYNA 4F7GA 3PVUA 3P6AA 2BCJA 2LOXA 3QBVB 5D27A 5C6RA 3BJIA 5FI1A 1U29A 2RUKB 1M7RA 1NTVA 1PLSA 1UNRA 3G9WA 2QKLA 3X23A 1UNQA 1NU2A 2NZ8B 5LOPB 2P8VA 2YSZA 4GMXB 5DHAB 2LYDA 4F7HA 5CLLB 2COFA 2XQNM 5DH9B 3FSSA 4P7IA 2MKRA 2CY5A 1UNPA 2LG1A 5JP4A 2HTHB 2VSZA 2KUPA 2P0HA 2I5FA 2J0KA 1V5PA 2L2IA 5D3YA 2J0JA 2OQBA 1WGUA 5C79A 2D2QA 5D3VA 2K00A 3QWMA 5LONB 2RNRB 3PP2A 1I2HA 2VRWB 1XX0A 3TO1A 2DX1A 3HK0A 4A6FA 4BBKA 2CY4A 2DFKA 3F5RA 1OQNA 4DBBA 5JHHA 4K17A 1DROA 1GC6A 2CAYA 2Y8FA 2GJYA 1V61A 2YS5A 2VKIA 1WGQA 4EKUA 2GS0A 1B55A 3AU4A 1Y19B 3DXCA 3A98B 2M38A 4F7UP 1ZC3B 2GCJA 4GXBA 2ADZA 2YT0A 2YRYA 5D3WA 3ODOA 2V76A 2QKMA 3OANA 1UEFA 1FGZA 1ZVRA 1X1FA 2AEHA 1MK7B 1V88A 2D10A 5FI0A 4IOYX 1V89A 2J59M 1P6SA 1WJ1A 3PSCA 2DKPA 1XD4A 4KAXB 4CHJA 3FM8C 2P0DA 2COAA 1W1DA 3O96A 1K5DB 2DX5A 1XCGA 4HB4B 1KI1B 4L6EA 3GYPA 3ULBA 2CRFA 1BAKA 2Q13A 4A6FB 2I1JA 2L1CA 2P0FA 5HE3A 2FJLA 2YVCA 1MK9B 2W2XD 2G35A 2K2JA 2M14A 3ODXA 1LB1A 1ISNA 5JLJB 4K2PA 2COCA 2ROVA 3VOQA 2DA0A 4NSWA 2D9VA 2DLWA 3KY9A 2ROZB 2LOZA 4MK0A 2DYQA 2KCJA 4TKNA 1AWEA 1ZC4B 2RVBB 2IFSA 3ZDTA 2JP2A 2J0MA 2RSGA 2D4QA 1H10A 1IRSA 3WYFB 2N0YA 1U2BA 3TCAA 3AU5A 4MY6A 4K81A 3AJ4A 1X1GA 2CODA 1MIXA 3HW2B 1FHWA 2Z0QA 2UVMA 4Y94A 2AL6A 5C5BA 4DX8A 2E2XA 2MFQA 3DXDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EJ8 A;  3PVW A;  3SNH A;  3N7C A;  2DHK A;  1RRP B;  3TW1 A;  1RJ2 A;  1FAO A;  3TFM A;  1OMW A;  3SO6 A;  3D8D A;  3SYX A;  4Z2M B;  3A8P A;  3PEG A;  1TJ6 A;  4KHB B;  2HE7 A;  1FHX A;  4IAP A;  1EAZ A;  1LW3 A;  1TXD A;  2EMT A;  2YT1 A;  3T06 A;  4CYE A;  1FB8 A;  3PG7 A;  5JHG A;  2D11 A;  2Y8G A;  2I1K A;  1H4R A;  2MWN B;  1WJM A;  1PFJ A;  1Q67 A;  1DYN A;  4HAT B;  4KVG B;  4PQ0 A;  4WSF A;  1AQC A;  2EC1 A;  4H8S A;  1Z87 A;  2N23 A;  4DX9 0;  4HAX B;  2D9W A;  4A6K A;  4WJ7 A;  3ODW A;  5CLQ B;  1MKE A;  2DTC A;  2K2U A;  2I5C A;  1N3H A;  1KZ7 A;  1QC6 A;  3KRX A;  1WI1 A;  2YS1 A;  5EFX A;  3KRW A;  4ZRI A;  2EMS A;  1XOD A;  3MPX A;  2RLO A;  4HAY B;  4B6H A;  2ELB A;  1DDM A;  1Y5O A;  3VIA A;  3UZT A;  3RCP A;  1GG3 A;  2D9Y A;  2GCL A;  1M7E A;  4HDO A;  1SHC A;  1U27 A;  4HAU B;  1DDV A;  1EVH A;  2ZPY A;  1OY2 A;  5DI9 B;  2LKO A;  4ZRJ A;  2ELA A;  2X18 A;  2UZR A;  3A8Q A;  3QIJ A;  4YL8 A;  3U8Z A;  1P5T A;  2R0D A;  2LUL A;  3GYO A;  2NMB A;  1WVH A;  2PZ1 A;  2YS3 A;  4C0A A;  3WA0 A;  2Z0O A;  1J19 A;  3KZ1 A;  4HDQ A;  1I7A A;  1MPH A;  4KHA A;  1FHO A;  3MDB C;  2DHJ A;  2W2W A;  3KSY A;  1BTN A;  3BIN A;  5HE2 A;  1BTK A;  5J3T A;  4HB0 B;  2W2X C;  1BWN A;  1U5E A;  3NSU A;  1EGX A;  5KQ1 A;  4HAW B;  2YF0 A;  1ZM0 A;  4DXA B;  4XWX A;  4A6H A;  3P7Z A;  2UZS A;  3DXE A;  1GC7 A;  2R09 A;  2OTX A;  4HHV A;  1NI2 A;  5KQ4 A;  4HAZ B;  4IFS A;  5J3Y A;  1U5F A;  3D8F A;  5DIF B;  4K2O A;  1V5U A;  1XR0 B;  1V5M A;  2Z0P A;  4HB3 B;  4CHM A;  2D9X A;  1WG7 A;  3ZVR A;  3F0W A;  5J3Q A;  3D8E A;  4GN1 A;  5L81 A;  1U5D A;  5C16 A;  4D0N B;  3ML4 A;  3PZD A;  1K5G B;  4GZU A;  1W1H A;  3U7D A;  1QQG A;  3HQC A;  4GPT B;  1XKE A;  3CIK A;  3V5W A;  5HE0 A;  3CXB B;  1KZG A;  1DDW A;  1X86 A;  3TVV A;  3ULC A;  5D3X A;  1EF1 A;  3M1I B;  3PVL A;  4Z2N A;  2D9Z A;  4NY0 A;  1U5G A;  1X05 A;  2Y7B A;  1MIZ B;  5DHF B;  3SV1 A;  4YON A;  2DHI A;  3LJU X;  1P3R A;  4HB2 B;  4GMV A;  1FOE A;  1MAI A;  1SGH A;  4EJN A;  4HAV B;  1J0W A;  4MT7 A;  5C5B B;  2DKQ A;  5KCV A;  4WVF B;  1NTY A;  2RGN B;  2IYB A;  1UPR A;  1UPQ A;  2KGX B;  5HE1 A;  4EMO A;  1W1G A;  1PMS A;  1X11 A;  2MDX A;  3IVF A;  1TQZ A;  4ZRK A;  4PNK A;  1FGY A;  5GOW B;  2DN6 A;  2H7E A;  1E5W A;  1DBH A;  4KHO A;  3FEH A;  4TYZ A;  4A5K A;  1ZSQ A;  2H7D A;  3SUZ A;  2DYN A;  4F7G A;  3PVU A;  3P6A A;  2BCJ A;  2LOX A;  3QBV B;  5D27 A;  5C6R A;  3BJI A;  5FI1 A;  1U29 A;  2RUK B;  1M7R A;  1NTV A;  1PLS A;  1UNR A;  3G9W A;  2QKL A;  3X23 A;  1UNQ A;  1NU2 A;  2NZ8 B;  5LOP B;  2P8V A;  2YSZ A;  4GMX B;  5DHA B;  2LYD A;  4F7H A;  5CLL B;  2COF A;  2XQN M;  5DH9 B;  3FSS A;  4P7I A;  2MKR A;  2CY5 A;  1UNP A;  2LG1 A;  5JP4 A;  2HTH B;  2VSZ A;  2KUP A;  2P0H A;  2I5F A;  2J0K A;  1V5P A;  2L2I A;  5D3Y A;  2J0J A;  2OQB A;  1WGU A;  5C79 A;  2D2Q A;  5D3V A;  2K00 A;  3QWM A;  5LON B;  2RNR B;  3PP2 A;  1I2H A;  2VRW B;  1XX0 A;  3TO1 A;  2DX1 A;  3HK0 A;  4A6F A;  4BBK A;  2CY4 A;  2DFK A;  3F5R A;  1OQN A;  4DBB A;  5JHH A;  4K17 A;  1DRO A;  1GC6 A;  2CAY A;  2Y8F A;  2GJY A;  1V61 A;  2YS5 A;  2VKI A;  1WGQ A;  4EKU A;  2GS0 A;  1B55 A;  3AU4 A;  1Y19 B;  3DXC A;  3A98 B;  2M38 A;  4F7U P;  1ZC3 B;  2GCJ A;  4GXB A;  2ADZ A;  2YT0 A;  2YRY A;  5D3W A;  3ODO A;  2V76 A;  2QKM A;  3OAN A;  1UEF A;  1FGZ A;  1ZVR A;  1X1F A;  2AEH A;  1MK7 B;  1V88 A;  2D10 A;  5FI0 A;  4IOY X;  1V89 A;  2J59 M;  1P6S A;  1WJ1 A;  3PSC A;  2DKP A;  1XD4 A;  4KAX B;  4CHJ A;  3FM8 C;  2P0D A;  2COA A;  1W1D A;  3O96 A;  1K5D B;  2DX5 A;  1XCG A;  4HB4 B;  1KI1 B;  4L6E A;  3GYP A;  3ULB A;  2CRF A;  1BAK A;  2Q13 A;  4A6F B;  2I1J A;  2L1C A;  2P0F A;  5HE3 A;  2FJL A;  2YVC A;  1MK9 B;  2W2X D;  2G35 A;  2K2J A;  2M14 A;  3ODX A;  1LB1 A;  1ISN A;  5JLJ B;  4K2P A;  2COC A;  2ROV A;  3VOQ A;  2DA0 A;  4NSW A;  2D9V A;  2DLW A;  3KY9 A;  2ROZ B;  2LOZ A;  4MK0 A;  2DYQ A;  2KCJ A;  4TKN A;  1AWE A;  1ZC4 B;  2RVB B;  2IFS A;  3ZDT A;  2JP2 A;  2J0M A;  2RSG A;  2D4Q A;  1H10 A;  1IRS A;  3WYF B;  2N0Y A;  1U2B A;  3TCA A;  3AU5 A;  4MY6 A;  4K81 A;  3AJ4 A;  1X1G A;  2COD A;  1MIX A;  3HW2 B;  1FHW A;  2Z0Q A;  2UVM A;  4Y94 A;  2AL6 A;  5C5B A;  4DX8 A;  2E2X A;  2MFQ A;  3DXD A; 
#chains in the Genus database with same CATH topology
 2EJ8 A;  3PVW A;  3SNH A;  3N7C A;  2DHK A;  1RRP B;  3TW1 A;  1RJ2 A;  1FAO A;  1ZYI A;  1OMW A;  2Z4D A;  3SO6 A;  3TFM A;  3D8D A;  3SYX A;  4Z2M B;  3HIE A;  3B77 A;  3A8P A;  3PEG A;  1TJ6 A;  4KHB B;  2HE7 A;  1FHX A;  4IAP A;  1EAZ A;  1LW3 A;  1TXD A;  2EMT A;  2YT1 A;  3T06 A;  4CYE A;  1FB8 A;  3PG7 A;  5JHG A;  2D11 A;  2Y8G A;  2I1K A;  1H4R A;  2MWN B;  3NW8 A;  1WJM A;  1PFJ A;  1Q67 A;  1DYN A;  2NBV A;  4HAT B;  4KVG B;  4PQ0 A;  4WSF A;  1AQC A;  2EC1 A;  4H8S A;  1Z87 A;  2N23 A;  4DX9 0;  4HAX B;  2D9W A;  4GOU A;  4A6K A;  4WJ7 A;  4OT1 A;  2KUQ A;  3ODW A;  5CLQ B;  1MKE A;  2DTC A;  2K2U A;  2I5C A;  1N3H A;  1KZ7 A;  1QC6 A;  3KRX A;  2Z14 A;  3A58 A;  1WI1 A;  2YS1 A;  5LG4 B;  5EFX A;  3KRW A;  4ZRI A;  2EMS A;  1XOD A;  3MPX A;  2RLO A;  4HAY B;  4B6H A;  2ELB A;  1DDM A;  1Y5O A;  3VIA A;  3UZT A;  3RCP A;  1GG3 A;  2D9Y A;  2GCL A;  4DIX A;  1M7E A;  4HDO A;  1SHC A;  1U27 A;  4HAU B;  1DDV A;  1EVH A;  2ZPY A;  1OY2 A;  2K49 A;  5DI9 B;  2LKO A;  2KIG A;  4ZRJ A;  2ELA A;  2X18 A;  2UZR A;  3A8Q A;  3QIJ A;  4YL8 A;  3U8Z A;  1P5T A;  2R0D A;  2LUL A;  3GYO A;  2NMB A;  1WVH A;  2PZ1 A;  2R2Y A;  2YS3 A;  4C0A A;  3WA0 A;  2Z0O A;  1J19 A;  3KZ1 A;  4HDQ A;  1I7A A;  4OSN A;  1MPH A;  4KHA A;  1FHO A;  3MDB C;  2DHJ A;  2W2W A;  3KSY A;  1BTN A;  3BIN A;  4QJ4 B;  5HE2 A;  1BTK A;  5J3T A;  2ZKM X;  4CSQ A;  4HB0 B;  2W2X C;  1BWN A;  1U5E A;  3NSU A;  1EGX A;  5KQ1 A;  4HAW B;  2YF0 A;  1ZM0 A;  5I2M A;  4DXA B;  4XWX A;  4A6H A;  3P7Z A;  2UZS A;  3DXE A;  1GC7 A;  2R09 A;  2OTX A;  4HHV A;  1NI2 A;  5KQ4 A;  4HAZ B;  4IFS A;  5J3Y A;  1U5F A;  3D8F A;  5DIF B;  4K2O A;  1V5U A;  1XR0 B;  1V5M A;  2Z0P A;  4HB3 B;  4CHM A;  2D9X A;  1WG7 A;  3ZVR A;  3F0W A;  5J3Q A;  3D8E A;  4GN1 A;  5L81 A;  1U5D A;  5C16 A;  5M4Y B;  4D0N B;  3ML4 A;  1K5G B;  3PZD A;  4GZU A;  1W1H A;  3U7D A;  1QQG A;  3HQC A;  4GPT B;  1XKE A;  3CIK A;  3V5W A;  5HE0 A;  3CXB B;  1KZG A;  1DDW A;  1X86 A;  3TVV A;  3ULC A;  5D3X A;  1EF1 A;  3M1I B;  3PVL A;  4Z2N A;  2D9Z A;  4NY0 A;  1U5G A;  1X05 A;  2Y7B A;  1MIZ B;  5DHF B;  3SV1 A;  4QJ3 B;  4YON A;  5I2S A;  2YT2 A;  2DHI A;  3LJU X;  1P3R A;  4HB2 B;  4GMV A;  1FOE A;  1MAI A;  1T77 A;  1SGH A;  4EJN A;  4HAV B;  4QJ5 B;  1J0W A;  4MT7 A;  5C5B B;  1MI1 A;  2DKQ A;  3HSA A;  5KCV A;  4WVF B;  1NTY A;  2RGN B;  2IYB A;  1UPR A;  1UPQ A;  3OHM B;  4L1R A;  2KGX B;  5HE1 A;  4HSI A;  4EMO A;  1W1G A;  1PMS A;  1X11 A;  2MDX A;  3IVF A;  1TQZ A;  4D6W A;  4ZRK A;  4PNK A;  1FGY A;  5GOW B;  2DN6 A;  2H7E A;  1E5W A;  1DBH A;  4KHO A;  3FEH A;  4TYZ A;  4A5K A;  1ZSQ A;  2H7D A;  3SUZ A;  2DYN A;  4F7G A;  3PVU A;  3P6A A;  2BCJ A;  2LOX A;  2FJU B;  3QBV B;  5D27 A;  5C6R A;  3BJI A;  2Z59 A;  4KHB A;  5FI1 A;  3DCX A;  1U29 A;  2K8E A;  2RUK B;  1M7R A;  1NTV A;  1PLS A;  1UNR A;  3G9W A;  2QKL A;  3X23 A;  1UNQ A;  1NU2 A;  2NZ8 B;  2RRF A;  2P8V A;  5LOP B;  2YSZ A;  4GMX B;  3NWD A;  5DHA B;  2LYD A;  4F7H A;  5CLL B;  2COF A;  2XQN M;  5DH9 B;  3FSS A;  4P7I A;  2MKR A;  2CY5 A;  1UNP A;  2LG1 A;  5JP4 A;  2HTH B;  2VSZ A;  2KUP A;  2P0H A;  2KR0 A;  2I5F A;  2J0K A;  1V5P A;  2L2I A;  5D3Y A;  2J0J A;  2OQB A;  1WGU A;  5C79 A;  2D2Q A;  5D3V A;  2K00 A;  4QXA B;  3QWM A;  5LON B;  2RNR B;  3PP2 A;  1I2H A;  2VRW B;  1XX0 A;  3TO1 A;  2DX1 A;  3HK0 A;  4A6F A;  4BBK A;  2CY4 A;  2DFK A;  3F5R A;  1OQN A;  4DBB A;  5JHH A;  4K17 A;  1DRO A;  1GC6 A;  3FVC A;  2CAY A;  2Y8F A;  2GJY A;  1V61 A;  2YS5 A;  2VKI A;  1WGQ A;  4EKU A;  2GS0 A;  1B55 A;  3AU4 A;  1Y19 B;  3DXC A;  3A98 B;  2M38 A;  4F7U P;  1ZC3 B;  4GNK B;  2GUM A;  2GCJ A;  4GXB A;  2ADZ A;  2YT0 A;  2YRY A;  5D3W A;  3ODO A;  2V76 A;  3U12 A;  2QKM A;  3OAN A;  1UEF A;  1FGZ A;  1ZVR A;  1X1F A;  2AEH A;  1MK7 B;  3NWF A;  1V88 A;  2D10 A;  5FI0 A;  4IOY X;  1V89 A;  2J59 M;  1P6S A;  1WJ1 A;  3PSC A;  2DKP A;  1XD4 A;  4KAX B;  4CHJ A;  3FM8 C;  2P0D A;  2COA A;  1W1D A;  3O96 A;  1K5D B;  2DX5 A;  1XCG A;  4HB4 B;  1KI1 B;  4L6E A;  3GYP A;  3ULB A;  2CRF A;  1BAK A;  2Q13 A;  4A6F B;  2I1J A;  2L1C A;  2P0F A;  5HE3 A;  2FJL A;  2YVC A;  5IRS A;  1MK9 B;  2W2X D;  2G35 A;  2K2J A;  2M14 A;  3ODX A;  1LB1 A;  1ISN A;  5JLJ B;  4K2P A;  2KIE A;  2COC A;  2ROV A;  3VOQ A;  2DA0 A;  4NSW A;  2D9V A;  2DLW A;  3KY9 A;  2ROZ B;  2LOZ A;  4MK0 A;  2DYQ A;  2KCJ A;  4TKN A;  1AWE A;  1ZC4 B;  2RVB B;  2IFS A;  3ZDT A;  2JP2 A;  2J0M A;  2RSG A;  2D4Q A;  1H10 A;  1IRS A;  2Z13 A;  3NWA A;  3WYF B;  2N0Y A;  1U2B A;  3TCA A;  3AU5 A;  4MY6 A;  4K81 A;  3AJ4 A;  1X1G A;  2COD A;  1MIX A;  3HW2 B;  1FHW A;  2Z0Q A;  2UVM A;  4Y94 A;  2AL6 A;  5C5B A;  4DX8 A;  2E2X A;  2MFQ A;  3DXD A; 
#chains in the Genus database with same CATH homology
 2EJ8 A;  3PVW A;  3SNH A;  3N7C A;  2DHK A;  1RRP B;  3TW1 A;  1RJ2 A;  1FAO A;  3TFM A;  1OMW A;  3SO6 A;  3D8D A;  3SYX A;  4Z2M B;  3A8P A;  3PEG A;  1TJ6 A;  4KHB B;  2HE7 A;  1FHX A;  4IAP A;  1EAZ A;  1LW3 A;  1TXD A;  2EMT A;  2YT1 A;  3T06 A;  4CYE A;  1FB8 A;  3PG7 A;  5JHG A;  2D11 A;  2Y8G A;  2I1K A;  1H4R A;  2MWN B;  1WJM A;  1PFJ A;  1Q67 A;  1DYN A;  4HAT B;  4KVG B;  4PQ0 A;  4WSF A;  1AQC A;  2EC1 A;  4H8S A;  1Z87 A;  2N23 A;  4DX9 0;  4HAX B;  2D9W A;  4A6K A;  4WJ7 A;  3ODW A;  5CLQ B;  1MKE A;  2DTC A;  2K2U A;  2I5C A;  1N3H A;  1KZ7 A;  1QC6 A;  3KRX A;  1WI1 A;  2YS1 A;  5EFX A;  3KRW A;  4ZRI A;  2EMS A;  1XOD A;  3MPX A;  2RLO A;  4HAY B;  4B6H A;  2ELB A;  1DDM A;  1Y5O A;  3VIA A;  3UZT A;  3RCP A;  1GG3 A;  2D9Y A;  2GCL A;  1M7E A;  4HDO A;  1SHC A;  1U27 A;  4HAU B;  1DDV A;  1EVH A;  2ZPY A;  1OY2 A;  5DI9 B;  2LKO A;  4ZRJ A;  2ELA A;  2X18 A;  2UZR A;  3A8Q A;  3QIJ A;  4YL8 A;  3U8Z A;  1P5T A;  2R0D A;  2LUL A;  3GYO A;  2NMB A;  1WVH A;  2PZ1 A;  2YS3 A;  4C0A A;  3WA0 A;  2Z0O A;  1J19 A;  3KZ1 A;  4HDQ A;  1I7A A;  1MPH A;  4KHA A;  1FHO A;  3MDB C;  2DHJ A;  2W2W A;  3KSY A;  1BTN A;  3BIN A;  5HE2 A;  1BTK A;  5J3T A;  4HB0 B;  2W2X C;  1BWN A;  1U5E A;  3NSU A;  1EGX A;  5KQ1 A;  4HAW B;  2YF0 A;  1ZM0 A;  4DXA B;  4XWX A;  4A6H A;  3P7Z A;  2UZS A;  3DXE A;  1GC7 A;  2R09 A;  2OTX A;  4HHV A;  1NI2 A;  5KQ4 A;  4HAZ B;  4IFS A;  5J3Y A;  1U5F A;  3D8F A;  5DIF B;  4K2O A;  1V5U A;  1XR0 B;  1V5M A;  2Z0P A;  4HB3 B;  4CHM A;  2D9X A;  1WG7 A;  3ZVR A;  3F0W A;  5J3Q A;  3D8E A;  4GN1 A;  5L81 A;  1U5D A;  5C16 A;  4D0N B;  3ML4 A;  3PZD A;  1K5G B;  4GZU A;  1W1H A;  3U7D A;  1QQG A;  3HQC A;  4GPT B;  1XKE A;  3CIK A;  3V5W A;  5HE0 A;  3CXB B;  1KZG A;  1DDW A;  1X86 A;  3TVV A;  3ULC A;  5D3X A;  1EF1 A;  3M1I B;  3PVL A;  4Z2N A;  2D9Z A;  4NY0 A;  1U5G A;  1X05 A;  2Y7B A;  1MIZ B;  5DHF B;  3SV1 A;  4YON A;  2DHI A;  3LJU X;  1P3R A;  4HB2 B;  4GMV A;  1FOE A;  1MAI A;  1SGH A;  4EJN A;  4HAV B;  1J0W A;  4MT7 A;  5C5B B;  2DKQ A;  5KCV A;  4WVF B;  1NTY A;  2RGN B;  2IYB A;  1UPR A;  1UPQ A;  2KGX B;  5HE1 A;  4EMO A;  1W1G A;  1PMS A;  1X11 A;  2MDX A;  3IVF A;  1TQZ A;  4ZRK A;  4PNK A;  1FGY A;  5GOW B;  2DN6 A;  2H7E A;  1E5W A;  1DBH A;  4KHO A;  3FEH A;  4TYZ A;  4A5K A;  1ZSQ A;  2H7D A;  3SUZ A;  2DYN A;  4F7G A;  3PVU A;  3P6A A;  2BCJ A;  2LOX A;  3QBV B;  5D27 A;  5C6R A;  3BJI A;  5FI1 A;  1U29 A;  2RUK B;  1M7R A;  1NTV A;  1PLS A;  1UNR A;  3G9W A;  2QKL A;  3X23 A;  1UNQ A;  1NU2 A;  2NZ8 B;  5LOP B;  2P8V A;  2YSZ A;  4GMX B;  5DHA B;  2LYD A;  4F7H A;  5CLL B;  2COF A;  2XQN M;  5DH9 B;  3FSS A;  4P7I A;  2MKR A;  2CY5 A;  1UNP A;  2LG1 A;  5JP4 A;  2HTH B;  2VSZ A;  2KUP A;  2P0H A;  2I5F A;  2J0K A;  1V5P A;  2L2I A;  5D3Y A;  2J0J A;  2OQB A;  1WGU A;  5C79 A;  2D2Q A;  5D3V A;  2K00 A;  3QWM A;  5LON B;  2RNR B;  3PP2 A;  1I2H A;  2VRW B;  1XX0 A;  3TO1 A;  2DX1 A;  3HK0 A;  4A6F A;  4BBK A;  2CY4 A;  2DFK A;  3F5R A;  1OQN A;  4DBB A;  5JHH A;  4K17 A;  1DRO A;  1GC6 A;  2CAY A;  2Y8F A;  2GJY A;  1V61 A;  2YS5 A;  2VKI A;  1WGQ A;  4EKU A;  2GS0 A;  1B55 A;  3AU4 A;  1Y19 B;  3DXC A;  3A98 B;  2M38 A;  4F7U P;  1ZC3 B;  2GCJ A;  4GXB A;  2ADZ A;  2YT0 A;  2YRY A;  5D3W A;  3ODO A;  2V76 A;  2QKM A;  3OAN A;  1UEF A;  1FGZ A;  1ZVR A;  1X1F A;  2AEH A;  1MK7 B;  1V88 A;  2D10 A;  5FI0 A;  4IOY X;  1V89 A;  2J59 M;  1P6S A;  1WJ1 A;  3PSC A;  2DKP A;  1XD4 A;  4KAX B;  4CHJ A;  3FM8 C;  2P0D A;  2COA A;  1W1D A;  3O96 A;  1K5D B;  2DX5 A;  1XCG A;  4HB4 B;  1KI1 B;  4L6E A;  3GYP A;  3ULB A;  2CRF A;  1BAK A;  2Q13 A;  4A6F B;  2I1J A;  2L1C A;  2P0F A;  5HE3 A;  2FJL A;  2YVC A;  1MK9 B;  2W2X D;  2G35 A;  2K2J A;  2M14 A;  3ODX A;  1LB1 A;  1ISN A;  5JLJ B;  4K2P A;  2COC A;  2ROV A;  3VOQ A;  2DA0 A;  4NSW A;  2D9V A;  2DLW A;  3KY9 A;  2ROZ B;  2LOZ A;  4MK0 A;  2DYQ A;  2KCJ A;  4TKN A;  1AWE A;  1ZC4 B;  2RVB B;  2IFS A;  3ZDT A;  2JP2 A;  2J0M A;  2RSG A;  2D4Q A;  1H10 A;  1IRS A;  3WYF B;  2N0Y A;  1U2B A;  3TCA A;  3AU5 A;  4MY6 A;  4K81 A;  3AJ4 A;  1X1G A;  2COD A;  1MIX A;  3HW2 B;  1FHW A;  2Z0Q A;  2UVM A;  4Y94 A;  2AL6 A;  5C5B A;  4DX8 A;  2E2X A;  2MFQ A;  3DXD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...