4A6KA

Crystal structure of slm1-ph domain in complex with d-myo-inositol-4- phosphate
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
119
structure length
110
Chain Sequence
DHPFTEIKSGFLERRSKFLKSYSKGYYVLTPNFLHEFKTADRKKDLVPVMSLALSECTVTEHSRKNSDAKFVLHAKQNGIIRRGHNWVFKADSYESMMSWFDNLKILTST
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Signaling protein
molecule keywords PHOSPHATIDYLINOSITOL 4,5-BISPHOSPHATE-BINDING PROTEIN SLM1
publication title Structural Analyses of Slm1-Ph Domain Demonstrate Ligand Binding in the Non-Canonical Site
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 24
structure length 110
sequence length 119
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2011-11-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00169 PH PH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 4a6kA00
1P3RA 5JHHA 1K5GB 1NI2A 4PQ0A 3KRWA 4TKNA 4HAUB 4DBBA 1BTKA 3ML4A 3NSUA 4HAZB 3D8EA 1DDVA 3VIAA 2I1JA 2J59M 3GYPA 2DKQA 2ELBA 3O96A 1V5MA 1I7AA 2QKMA 3DXDA 1PFJA 2UVMA 3P7ZA 2DHIA 4KHAA 5C5BB 4ZRJA 2LKOA 3X23A 1BWNA 2GCLA 3MPXA 1XD4A 1ZC4B 2COAA 2YRYA 1UNPA 1FGYA 2D11A 2DYQA 2YF0A 5FI0A 5D27A 2IYBA 2MFQA 2DYNA 3ULBA 2KGXB 3HK0A 1FHOA 1U2BA 1DDMA 2N23A 2YSZA 1MPHA 1SHCA 2I5FA 4NY0A 4KAXB 1SGHA 2I1KA 4HAWB 4MY6A 2DTCA 4A6FB 2KUPA 3ODWA 2Y7BA 1PLSA 4IOYX 1MKEA 2P0FA 1J19A 2Z0QA 1V88A 3DXEA 4HDOA 1N3HA 5CLLB 1UPQA 1XCGA 4DX90 2RUKB 2LG1A 1FHWA 5HE1A 3A8PA 3ZVRA 1MAIA 4HB0B 3TFMA 1IRSA 1P6SA 3BINA 2HTHB 2L1CA 4K81A 1X05A 3FSSA 3HQCA 5L81A 3PEGA 1ISNA 1MIXA 1BAKA 4HATB 3BJIA 3RCPA 1X1GA 4IAPA 4KHBB 1PMSA 1NU2A 4PNKA 1U5GA 2RNRB 3SNHA 2X18A 4H8SA 4P7IA 1WG7A 4A6KA 4B6HA 1W1GA 2N0YA 2Z0OA 3CXBB 4ZRIA 5CLQB 4D0NB 4NSWA 1WJMA 1U27A 4DX8A 1KZ7A 1WVHA 1H10A 1X86A 4Y94A 2H7DA 2K2JA 1FHXA 2ROVA 3PG7A 3WA0A 1EAZA 1U29A 1WJ1A 3PZDA 2AEHA 1ZVRA 3WYFB 3KZ1A 2PZ1A 3TCAA 4DXAB 1X11A 2LOXA 2BCJA 2M38A 1H4RA 2VKIA 2D9VA 2DHKA 2FJLA 2YS3A 1EVHA 2ADZA 1I2HA 2EMSA 3DXCA 4HAYB 1OMWA 1OY2A 3IVFA 3CIKA 4HDQA 2QKLA 2Y8GA 3PVLA 2AL6A 2H7EA 2Q13A 2GS0A 4KVGB 2G35A 1ZSQA 2D2QA 1DBHA 2W2XC 4WJ7A 1K5DB 1W1DA 2CY5A 2MDXA 3AU4A 3GYOA 2W2XD 3SV1A 2LYDA 4CHJA 4HB3B 2HE7A 4CYEA 2ROZB 1EGXA 5LONB 4YL8A 1QQGA 4MK0A 2RGNB 2V76A 1XR0B 3ODXA 3TVVA 2GCJA 4GPTB 3KRXA 2DX1A 3T06A 5C79A 4HAXB 1GG3A 2DN6A 2EC1A 2GJYA 5KCVA 5HE3A 5KQ1A 2P0HA 5HE0A 2DKPA 1U5DA 2OTXA 4EKUA 1V5PA 2K00A 2UZRA 2D4QA 1GC7A 2D9WA 3SUZA 2K2UA 1Q67A 2NZ8B 1UNQA 4C0AA 4A5KA 2R0DA 4K2OA 5HE2A 1FB8A 1V89A 1BTNA 4IFSA 2LULA 1V5UA 3M1IB 2J0JA 2LOZA 2D9YA 2JP2A 4YONA 5DHAB 1OQNA 5DIFB 2RSGA 5D3WA 3FEHA 3F0WA 1M7RA 3KSYA 3TO1A 4BBKA 3PP2A 2P0DA 1J0WA 2D9ZA 5LOPB 5DI9B 1M7EA 1Y5OA 2M14A 4MT7A 2RLOA 1WGQA 1DYNA 3P6AA 4F7HA 3V5WA 3KY9A 2YS1A 2ZPYA 3SO6A 3PVWA 3QIJA 3LJUX 2R09A 3QBVB 2DHJA 5GOWB 2OQBA 1UEFA 1ZC3B 4L6EA 5JHGA 1TXDA 1XKEA 1XODA 4TYZA 4ZRKA 3ZDTA 1UPRA 1DROA 2COCA 5C5BA 2YT1A 5J3QA 5EFXA 3G9WA 2CAYA 4GMVA 3U8ZA 3D8DA 3A8QA 3ULCA 2COFA 5C16A 5JLJB 1DDWA 1UNRA 4WSFA 2DLWA 1FGZA 2CY4A 1TJ6A 2J0KA 4F7UP 4GMXB 4XWXA 3PSCA 2L2IA 1FAOA 5D3VA 2YVCA 3TW1A 3N7CA 4GXBA 4EMOA 1Y19B 1ZM0A 4WVFB 2D10A 4A6FA 3A98B 1NTVA 2CODA 2DFKA 2I5CA 5C6RA 4F7GA 1MIZB 1KZGA 3U7DA 2E2XA 2EMTA 2D9XA 2DA0A 2ELAA 3SYXA 1GC6A 1WGUA 2NMBA 2IFSA 1RRPB 2EJ8A 4HAVB 2UZSA 2YS5A 2Y8FA 1X1FA 4A6HA 1U5FA 4K17A 4GZUA 2DX5A 2J0MA 2VSZA 1P5TA 2XQNM 4Z2MB 1B55A 3D8FA 4GN1A 1XX0A 3ODOA 5JP4A 1U5EA 2MWNB 1TQZA 2VRWB 1W1HA 1QC6A 1V61A 3FM8C 4HHVA 3AU5A 1E5WA 1LW3A 4HB2B 4KHOA 5KQ4A 1WI1A 5D3YA 1MK9B 2W2WA 3MDBC 4Z2NA 3PVUA 1KI1B 3HW2B 1NTYA 4K2PA 5FI1A 5D3XA 3QWMA 3F5RA 3UZTA 5DHFB 3OANA 2KCJA 1Z87A 1AQCA 1RJ2A 3AJ4A 1MK7B 2MKRA 5DH9B 5J3YA 4CHMA 2CRFA 5J3TA 2P8VA 1EF1A 1FOEA 4HB4B 4EJNA 1AWEA 3VOQA 2YT0A 2RVBB 2Z0PA 1LB1A
chains in the Genus database with same CATH superfamily
2Z4DA 1P3RA 3FVCA 5JHHA 1K5GB 1NI2A 3DCXA 2KUQA 4PQ0A 3KRWA 4TKNA 4HAUB 4DBBA 1BTKA 3ML4A 3NWFA 3NSUA 4HAZB 3D8EA 1DDVA 3VIAA 2I1JA 2J59M 3GYPA 2DKQA 2ELBA 3O96A 1V5MA 4OSNA 5I2MA 1I7AA 2QKMA 3DXDA 4GOUA 1PFJA 4QJ5B 2UVMA 3P7ZA 2DHIA 4KHAA 5C5BB 4ZRJA 2LKOA 3X23A 1BWNA 2GCLA 3MPXA 2RRFA 1XD4A 3U12A 1ZC4B 2COAA 2YRYA 1UNPA 1FGYA 2D11A 3OHMB 2DYQA 2YF0A 5FI0A 5D27A 2IYBA 2MFQA 2DYNA 3ULBA 2KGXB 3HK0A 1FHOA 1U2BA 3B77A 1DDMA 2N23A 2YSZA 1MPHA 1SHCA 2I5FA 4NY0A 4KAXB 1SGHA 2I1KA 4HAWB 4MY6A 2DTCA 4A6FB 2KUPA 2GUMA 3ODWA 2Y7BA 1PLSA 4IOYX 1MKEA 2P0FA 1J19A 2Z0QA 1V88A 3DXEA 4HDOA 1N3HA 5CLLB 1UPQA 1XCGA 4DX90 2RUKB 2LG1A 1FHWA 5HE1A 3A8PA 3ZVRA 1MAIA 4HB0B 3TFMA 1IRSA 1P6SA 3BINA 2HTHB 2L1CA 4K81A 1X05A 3FSSA 3HQCA 5L81A 3PEGA 1ISNA 1MIXA 1BAKA 4HATB 3BJIA 3RCPA 1X1GA 4IAPA 5M4YB 4KHBB 1PMSA 1NU2A 4PNKA 1U5GA 2RNRB 3SNHA 2X18A 4H8SA 5IRSA 4P7IA 1WG7A 4A6KA 4B6HA 1W1GA 2N0YA 2Z0OA 3CXBB 4ZRIA 5CLQB 4D0NB 4NSWA 1WJMA 1U27A 4DX8A 3A58A 1KZ7A 1WVHA 4D6WA 1H10A 1X86A 4Y94A 2H7DA 2K2JA 1FHXA 2ROVA 3PG7A 3WA0A 1EAZA 1U29A 2ZKMX 1WJ1A 3PZDA 4QJ4B 2AEHA 1ZVRA 3WYFB 3KZ1A 2PZ1A 3TCAA 4DXAB 1X11A 2LOXA 2BCJA 2NBVA 2R2YA 2M38A 1H4RA 2VKIA 2D9VA 2DHKA 2FJLA 2Z13A 2YS3A 1EVHA 2ADZA 1I2HA 2EMSA 3DXCA 4HAYB 1OMWA 1OY2A 3IVFA 3CIKA 4HDQA 2QKLA 2Y8GA 3PVLA 2AL6A 2H7EA 2Q13A 2GS0A 4KVGB 2G35A 1ZSQA 2D2QA 1DBHA 2W2XC 4WJ7A 1K5DB 1W1DA 2CY5A 2MDXA 3AU4A 3GYOA 2W2XD 3SV1A 2LYDA 4CHJA 4HB3B 2HE7A 4CYEA 2ROZB 1EGXA 5LONB 4YL8A 1QQGA 2KR0A 4L1RA 4MK0A 2RGNB 2V76A 1XR0B 3ODXA 3TVVA 2GCJA 4GPTB 3KRXA 5LG4B 2DX1A 3T06A 5C79A 4HAXB 1GG3A 2DN6A 4DIXA 2EC1A 2GJYA 5KCVA 5HE3A 5KQ1A 2P0HA 5HE0A 2DKPA 1U5DA 2OTXA 4EKUA 1V5PA 2K00A 2UZRA 2D4QA 1GC7A 2K8EA 2D9WA 3SUZA 2K2UA 1Q67A 2NZ8B 1UNQA 4C0AA 4A5KA 2R0DA 4K2OA 5HE2A 1FB8A 1V89A 1BTNA 4IFSA 1MI1A 2LULA 1V5UA 3M1IB 2J0JA 3HIEA 1T77A 2LOZA 2D9YA 2JP2A 4YONA 2YT2A 5DHAB 1OQNA 5DIFB 2RSGA 5D3WA 3FEHA 3F0WA 4QJ3B 1M7RA 3KSYA 3TO1A 4BBKA 3PP2A 4GNKB 2P0DA 3NW8A 1J0WA 2D9ZA 5LOPB 5DI9B 5I2SA 1M7EA 1Y5OA 2M14A 4MT7A 2RLOA 1WGQA 1DYNA 3P6AA 4F7HA 3V5WA 3KY9A 2YS1A 2ZPYA 3SO6A 3PVWA 3QIJA 3LJUX 2R09A 4OT1A 3QBVB 2DHJA 5GOWB 2OQBA 1UEFA 1ZC3B 4QXAB 4L6EA 5JHGA 1TXDA 1XKEA 1XODA 4TYZA 4ZRKA 3ZDTA 1UPRA 1DROA 2COCA 5C5BA 2YT1A 5J3QA 5EFXA 3G9WA 2CAYA 4GMVA 3U8ZA 3D8DA 3A8QA 3ULCA 2COFA 5C16A 3HSAA 5JLJB 1DDWA 1UNRA 4WSFA 2DLWA 1FGZA 2CY4A 1TJ6A 2J0KA 4F7UP 4GMXB 4XWXA 3PSCA 2L2IA 1FAOA 5D3VA 2YVCA 3TW1A 3N7CA 4GXBA 4EMOA 1Y19B 1ZM0A 4WVFB 2D10A 4A6FA 3A98B 1NTVA 2CODA 2DFKA 4CSQA 2I5CA 5C6RA 4F7GA 1MIZB 1KZGA 3U7DA 2E2XA 2EMTA 2D9XA 2KIGA 2DA0A 2ELAA 3SYXA 1GC6A 1WGUA 2NMBA 2K49A 2IFSA 2Z59A 1RRPB 2EJ8A 4HAVB 2UZSA 2YS5A 2Y8FA 1X1FA 2KIEA 3NWAA 4A6HA 1U5FA 2FJUB 4K17A 4GZUA 4KHBA 2DX5A 2J0MA 2VSZA 1P5TA 2XQNM 4Z2MB 1B55A 3D8FA 4GN1A 1XX0A 3ODOA 5JP4A 1U5EA 2MWNB 1TQZA 2VRWB 1W1HA 1QC6A 1V61A 3FM8C 4HHVA 3AU5A 1E5WA 1LW3A 4HB2B 4KHOA 5KQ4A 1WI1A 5D3YA 2Z14A 1MK9B 3NWDA 2W2WA 3MDBC 4Z2NA 3PVUA 1KI1B 1ZYIA 3HW2B 1NTYA 4K2PA 5FI1A 5D3XA 3QWMA 3F5RA 3UZTA 5DHFB 3OANA 2KCJA 1Z87A 1AQCA 4HSIA 1RJ2A 3AJ4A 1MK7B 2MKRA 5DH9B 5J3YA 4CHMA 2CRFA 5J3TA 2P8VA 1EF1A 1FOEA 4HB4B 4EJNA 1AWEA 3VOQA 2YT0A 2RVBB 2Z0PA 1LB1A
chains in the Genus database with same CATH topology
1P3RA 5JHHA 1K5GB 1NI2A 4PQ0A 3KRWA 4TKNA 4HAUB 4DBBA 1BTKA 3ML4A 3NSUA 4HAZB 3D8EA 1DDVA 3VIAA 2I1JA 2J59M 3GYPA 2DKQA 2ELBA 3O96A 1V5MA 1I7AA 2QKMA 3DXDA 1PFJA 2UVMA 3P7ZA 2DHIA 4KHAA 5C5BB 4ZRJA 2LKOA 3X23A 1BWNA 2GCLA 3MPXA 1XD4A 1ZC4B 2COAA 2YRYA 1UNPA 1FGYA 2D11A 2DYQA 2YF0A 5FI0A 5D27A 2IYBA 2MFQA 2DYNA 3ULBA 2KGXB 3HK0A 1FHOA 1U2BA 1DDMA 2N23A 2YSZA 1MPHA 1SHCA 2I5FA 4NY0A 4KAXB 1SGHA 2I1KA 4HAWB 4MY6A 2DTCA 4A6FB 2KUPA 3ODWA 2Y7BA 1PLSA 4IOYX 1MKEA 2P0FA 1J19A 2Z0QA 1V88A 3DXEA 4HDOA 1N3HA 5CLLB 1UPQA 1XCGA 4DX90 2RUKB 2LG1A 1FHWA 5HE1A 3A8PA 3ZVRA 1MAIA 4HB0B 3TFMA 1IRSA 1P6SA 3BINA 2HTHB 2L1CA 4K81A 1X05A 3FSSA 3HQCA 5L81A 3PEGA 1ISNA 1MIXA 1BAKA 4HATB 3BJIA 3RCPA 1X1GA 4IAPA 4KHBB 1PMSA 1NU2A 4PNKA 1U5GA 2RNRB 3SNHA 2X18A 4H8SA 4P7IA 1WG7A 4A6KA 4B6HA 1W1GA 2N0YA 2Z0OA 3CXBB 4ZRIA 5CLQB 4D0NB 4NSWA 1WJMA 1U27A 4DX8A 1KZ7A 1WVHA 1H10A 1X86A 4Y94A 2H7DA 2K2JA 1FHXA 2ROVA 3PG7A 3WA0A 1EAZA 1U29A 1WJ1A 3PZDA 2AEHA 1ZVRA 3WYFB 3KZ1A 2PZ1A 3TCAA 4DXAB 1X11A 2LOXA 2BCJA 2M38A 1H4RA 2VKIA 2D9VA 2DHKA 2FJLA 2YS3A 1EVHA 2ADZA 1I2HA 2EMSA 3DXCA 4HAYB 1OMWA 1OY2A 3IVFA 3CIKA 4HDQA 2QKLA 2Y8GA 3PVLA 2AL6A 2H7EA 2Q13A 2GS0A 4KVGB 2G35A 1ZSQA 2D2QA 1DBHA 2W2XC 4WJ7A 1K5DB 1W1DA 2CY5A 2MDXA 3AU4A 3GYOA 2W2XD 3SV1A 2LYDA 4CHJA 4HB3B 2HE7A 4CYEA 2ROZB 1EGXA 5LONB 4YL8A 1QQGA 4MK0A 2RGNB 2V76A 1XR0B 3ODXA 3TVVA 2GCJA 4GPTB 3KRXA 2DX1A 3T06A 5C79A 4HAXB 1GG3A 2DN6A 2EC1A 2GJYA 5KCVA 5HE3A 5KQ1A 2P0HA 5HE0A 2DKPA 1U5DA 2OTXA 4EKUA 1V5PA 2K00A 2UZRA 2D4QA 1GC7A 2D9WA 3SUZA 2K2UA 1Q67A 2NZ8B 1UNQA 4C0AA 4A5KA 2R0DA 4K2OA 5HE2A 1FB8A 1V89A 1BTNA 4IFSA 2LULA 1V5UA 3M1IB 2J0JA 2LOZA 2D9YA 2JP2A 4YONA 5DHAB 1OQNA 5DIFB 2RSGA 5D3WA 3FEHA 3F0WA 1M7RA 3KSYA 3TO1A 4BBKA 3PP2A 2P0DA 1J0WA 2D9ZA 5LOPB 5DI9B 1M7EA 1Y5OA 2M14A 4MT7A 2RLOA 1WGQA 1DYNA 3P6AA 4F7HA 3V5WA 3KY9A 2YS1A 2ZPYA 3SO6A 3PVWA 3QIJA 3LJUX 2R09A 3QBVB 2DHJA 5GOWB 2OQBA 1UEFA 1ZC3B 4L6EA 5JHGA 1TXDA 1XKEA 1XODA 4TYZA 4ZRKA 3ZDTA 1UPRA 1DROA 2COCA 5C5BA 2YT1A 5J3QA 5EFXA 3G9WA 2CAYA 4GMVA 3U8ZA 3D8DA 3A8QA 3ULCA 2COFA 5C16A 5JLJB 1DDWA 1UNRA 4WSFA 2DLWA 1FGZA 2CY4A 1TJ6A 2J0KA 4F7UP 4GMXB 4XWXA 3PSCA 2L2IA 1FAOA 5D3VA 2YVCA 3TW1A 3N7CA 4GXBA 4EMOA 1Y19B 1ZM0A 4WVFB 2D10A 4A6FA 3A98B 1NTVA 2CODA 2DFKA 2I5CA 5C6RA 4F7GA 1MIZB 1KZGA 3U7DA 2E2XA 2EMTA 2D9XA 2DA0A 2ELAA 3SYXA 1GC6A 1WGUA 2NMBA 2IFSA 1RRPB 2EJ8A 4HAVB 2UZSA 2YS5A 2Y8FA 1X1FA 4A6HA 1U5FA 4K17A 4GZUA 2DX5A 2J0MA 2VSZA 1P5TA 2XQNM 4Z2MB 1B55A 3D8FA 4GN1A 1XX0A 3ODOA 5JP4A 1U5EA 2MWNB 1TQZA 2VRWB 1W1HA 1QC6A 1V61A 3FM8C 4HHVA 3AU5A 1E5WA 1LW3A 4HB2B 4KHOA 5KQ4A 1WI1A 5D3YA 1MK9B 2W2WA 3MDBC 4Z2NA 3PVUA 1KI1B 3HW2B 1NTYA 4K2PA 5FI1A 5D3XA 3QWMA 3F5RA 3UZTA 5DHFB 3OANA 2KCJA 1Z87A 1AQCA 1RJ2A 3AJ4A 1MK7B 2MKRA 5DH9B 5J3YA 4CHMA 2CRFA 5J3TA 2P8VA 1EF1A 1FOEA 4HB4B 4EJNA 1AWEA 3VOQA 2YT0A 2RVBB 2Z0PA 1LB1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1P3R A;  5JHH A;  1K5G B;  1NI2 A;  4PQ0 A;  3KRW A;  4TKN A;  4HAU B;  4DBB A;  1BTK A;  3ML4 A;  3NSU A;  4HAZ B;  3D8E A;  1DDV A;  3VIA A;  2I1J A;  2J59 M;  3GYP A;  2DKQ A;  2ELB A;  3O96 A;  1V5M A;  1I7A A;  2QKM A;  3DXD A;  1PFJ A;  2UVM A;  3P7Z A;  2DHI A;  4KHA A;  5C5B B;  4ZRJ A;  2LKO A;  3X23 A;  1BWN A;  2GCL A;  3MPX A;  1XD4 A;  1ZC4 B;  2COA A;  2YRY A;  1UNP A;  1FGY A;  2D11 A;  2DYQ A;  2YF0 A;  5FI0 A;  5D27 A;  2IYB A;  2MFQ A;  2DYN A;  3ULB A;  2KGX B;  3HK0 A;  1FHO A;  1U2B A;  1DDM A;  2N23 A;  2YSZ A;  1MPH A;  1SHC A;  2I5F A;  4NY0 A;  4KAX B;  1SGH A;  2I1K A;  4HAW B;  4MY6 A;  2DTC A;  4A6F B;  2KUP A;  3ODW A;  2Y7B A;  1PLS A;  4IOY X;  1MKE A;  2P0F A;  1J19 A;  2Z0Q A;  1V88 A;  3DXE A;  4HDO A;  1N3H A;  5CLL B;  1UPQ A;  1XCG A;  4DX9 0;  2RUK B;  2LG1 A;  1FHW A;  5HE1 A;  3A8P A;  3ZVR A;  1MAI A;  4HB0 B;  3TFM A;  1IRS A;  1P6S A;  3BIN A;  2HTH B;  2L1C A;  4K81 A;  1X05 A;  3FSS A;  3HQC A;  5L81 A;  3PEG A;  1ISN A;  1MIX A;  1BAK A;  4HAT B;  3BJI A;  3RCP A;  1X1G A;  4IAP A;  4KHB B;  1PMS A;  1NU2 A;  4PNK A;  1U5G A;  2RNR B;  3SNH A;  2X18 A;  4H8S A;  4P7I A;  1WG7 A;  4A6K A;  4B6H A;  1W1G A;  2N0Y A;  2Z0O A;  3CXB B;  4ZRI A;  5CLQ B;  4D0N B;  4NSW A;  1WJM A;  1U27 A;  4DX8 A;  1KZ7 A;  1WVH A;  1H10 A;  1X86 A;  4Y94 A;  2H7D A;  2K2J A;  1FHX A;  2ROV A;  3PG7 A;  3WA0 A;  1EAZ A;  1U29 A;  1WJ1 A;  3PZD A;  2AEH A;  1ZVR A;  3WYF B;  3KZ1 A;  2PZ1 A;  3TCA A;  4DXA B;  1X11 A;  2LOX A;  2BCJ A;  2M38 A;  1H4R A;  2VKI A;  2D9V A;  2DHK A;  2FJL A;  2YS3 A;  1EVH A;  2ADZ A;  1I2H A;  2EMS A;  3DXC A;  4HAY B;  1OMW A;  1OY2 A;  3IVF A;  3CIK A;  4HDQ A;  2QKL A;  2Y8G A;  3PVL A;  2AL6 A;  2H7E A;  2Q13 A;  2GS0 A;  4KVG B;  2G35 A;  1ZSQ A;  2D2Q A;  1DBH A;  2W2X C;  4WJ7 A;  1K5D B;  1W1D A;  2CY5 A;  2MDX A;  3AU4 A;  3GYO A;  2W2X D;  3SV1 A;  2LYD A;  4CHJ A;  4HB3 B;  2HE7 A;  4CYE A;  2ROZ B;  1EGX A;  5LON B;  4YL8 A;  1QQG A;  4MK0 A;  2RGN B;  2V76 A;  1XR0 B;  3ODX A;  3TVV A;  2GCJ A;  4GPT B;  3KRX A;  2DX1 A;  3T06 A;  5C79 A;  4HAX B;  1GG3 A;  2DN6 A;  2EC1 A;  2GJY A;  5KCV A;  5HE3 A;  5KQ1 A;  2P0H A;  5HE0 A;  2DKP A;  1U5D A;  2OTX A;  4EKU A;  1V5P A;  2K00 A;  2UZR A;  2D4Q A;  1GC7 A;  2D9W A;  3SUZ A;  2K2U A;  1Q67 A;  2NZ8 B;  1UNQ A;  4C0A A;  4A5K A;  2R0D A;  4K2O A;  5HE2 A;  1FB8 A;  1V89 A;  1BTN A;  4IFS A;  2LUL A;  1V5U A;  3M1I B;  2J0J A;  2LOZ A;  2D9Y A;  2JP2 A;  4YON A;  5DHA B;  1OQN A;  5DIF B;  2RSG A;  5D3W A;  3FEH A;  3F0W A;  1M7R A;  3KSY A;  3TO1 A;  4BBK A;  3PP2 A;  2P0D A;  1J0W A;  2D9Z A;  5LOP B;  5DI9 B;  1M7E A;  1Y5O A;  2M14 A;  4MT7 A;  2RLO A;  1WGQ A;  1DYN A;  3P6A A;  4F7H A;  3V5W A;  3KY9 A;  2YS1 A;  2ZPY A;  3SO6 A;  3PVW A;  3QIJ A;  3LJU X;  2R09 A;  3QBV B;  2DHJ A;  5GOW B;  2OQB A;  1UEF A;  1ZC3 B;  4L6E A;  5JHG A;  1TXD A;  1XKE A;  1XOD A;  4TYZ A;  4ZRK A;  3ZDT A;  1UPR A;  1DRO A;  2COC A;  5C5B A;  2YT1 A;  5J3Q A;  5EFX A;  3G9W A;  2CAY A;  4GMV A;  3U8Z A;  3D8D A;  3A8Q A;  3ULC A;  2COF A;  5C16 A;  5JLJ B;  1DDW A;  1UNR A;  4WSF A;  2DLW A;  1FGZ A;  2CY4 A;  1TJ6 A;  2J0K A;  4F7U P;  4GMX B;  4XWX A;  3PSC A;  2L2I A;  1FAO A;  5D3V A;  2YVC A;  3TW1 A;  3N7C A;  4GXB A;  4EMO A;  1Y19 B;  1ZM0 A;  4WVF B;  2D10 A;  4A6F A;  3A98 B;  1NTV A;  2COD A;  2DFK A;  2I5C A;  5C6R A;  4F7G A;  1MIZ B;  1KZG A;  3U7D A;  2E2X A;  2EMT A;  2D9X A;  2DA0 A;  2ELA A;  3SYX A;  1GC6 A;  1WGU A;  2NMB A;  2IFS A;  1RRP B;  2EJ8 A;  4HAV B;  2UZS A;  2YS5 A;  2Y8F A;  1X1F A;  4A6H A;  1U5F A;  4K17 A;  4GZU A;  2DX5 A;  2J0M A;  2VSZ A;  1P5T A;  2XQN M;  4Z2M B;  1B55 A;  3D8F A;  4GN1 A;  1XX0 A;  3ODO A;  5JP4 A;  1U5E A;  2MWN B;  1TQZ A;  2VRW B;  1W1H A;  1QC6 A;  1V61 A;  3FM8 C;  4HHV A;  3AU5 A;  1E5W A;  1LW3 A;  4HB2 B;  4KHO A;  5KQ4 A;  1WI1 A;  5D3Y A;  1MK9 B;  2W2W A;  3MDB C;  4Z2N A;  3PVU A;  1KI1 B;  3HW2 B;  1NTY A;  4K2P A;  5FI1 A;  5D3X A;  3QWM A;  3F5R A;  3UZT A;  5DHF B;  3OAN A;  2KCJ A;  1Z87 A;  1AQC A;  1RJ2 A;  3AJ4 A;  1MK7 B;  2MKR A;  5DH9 B;  5J3Y A;  4CHM A;  2CRF A;  5J3T A;  2P8V A;  1EF1 A;  1FOE A;  4HB4 B;  4EJN A;  1AWE A;  3VOQ A;  2YT0 A;  2RVB B;  2Z0P A;  1LB1 A; 
#chains in the Genus database with same CATH topology
 2Z4D A;  1P3R A;  3FVC A;  5JHH A;  1K5G B;  1NI2 A;  3DCX A;  2KUQ A;  4PQ0 A;  3KRW A;  4TKN A;  4HAU B;  4DBB A;  1BTK A;  3ML4 A;  3NWF A;  3NSU A;  4HAZ B;  3D8E A;  1DDV A;  3VIA A;  2I1J A;  2J59 M;  3GYP A;  2DKQ A;  2ELB A;  3O96 A;  1V5M A;  4OSN A;  5I2M A;  1I7A A;  2QKM A;  3DXD A;  4GOU A;  1PFJ A;  4QJ5 B;  2UVM A;  3P7Z A;  2DHI A;  4KHA A;  5C5B B;  4ZRJ A;  2LKO A;  3X23 A;  1BWN A;  2GCL A;  3MPX A;  2RRF A;  1XD4 A;  3U12 A;  1ZC4 B;  2COA A;  2YRY A;  1UNP A;  1FGY A;  2D11 A;  3OHM B;  2DYQ A;  2YF0 A;  5FI0 A;  5D27 A;  2IYB A;  2MFQ A;  2DYN A;  3ULB A;  2KGX B;  3HK0 A;  1FHO A;  1U2B A;  3B77 A;  1DDM A;  2N23 A;  2YSZ A;  1MPH A;  1SHC A;  2I5F A;  4NY0 A;  4KAX B;  1SGH A;  2I1K A;  4HAW B;  4MY6 A;  2DTC A;  4A6F B;  2KUP A;  2GUM A;  3ODW A;  2Y7B A;  1PLS A;  4IOY X;  1MKE A;  2P0F A;  1J19 A;  2Z0Q A;  1V88 A;  3DXE A;  4HDO A;  1N3H A;  5CLL B;  1UPQ A;  1XCG A;  4DX9 0;  2RUK B;  2LG1 A;  1FHW A;  5HE1 A;  3A8P A;  3ZVR A;  1MAI A;  4HB0 B;  3TFM A;  1IRS A;  1P6S A;  3BIN A;  2HTH B;  2L1C A;  4K81 A;  1X05 A;  3FSS A;  3HQC A;  5L81 A;  3PEG A;  1ISN A;  1MIX A;  1BAK A;  4HAT B;  3BJI A;  3RCP A;  1X1G A;  4IAP A;  5M4Y B;  4KHB B;  1PMS A;  1NU2 A;  4PNK A;  1U5G A;  2RNR B;  3SNH A;  2X18 A;  4H8S A;  5IRS A;  4P7I A;  1WG7 A;  4A6K A;  4B6H A;  1W1G A;  2N0Y A;  2Z0O A;  3CXB B;  4ZRI A;  5CLQ B;  4D0N B;  4NSW A;  1WJM A;  1U27 A;  4DX8 A;  3A58 A;  1KZ7 A;  1WVH A;  4D6W A;  1H10 A;  1X86 A;  4Y94 A;  2H7D A;  2K2J A;  1FHX A;  2ROV A;  3PG7 A;  3WA0 A;  1EAZ A;  1U29 A;  2ZKM X;  1WJ1 A;  3PZD A;  4QJ4 B;  2AEH A;  1ZVR A;  3WYF B;  3KZ1 A;  2PZ1 A;  3TCA A;  4DXA B;  1X11 A;  2LOX A;  2BCJ A;  2NBV A;  2R2Y A;  2M38 A;  1H4R A;  2VKI A;  2D9V A;  2DHK A;  2FJL A;  2Z13 A;  2YS3 A;  1EVH A;  2ADZ A;  1I2H A;  2EMS A;  3DXC A;  4HAY B;  1OMW A;  1OY2 A;  3IVF A;  3CIK A;  4HDQ A;  2QKL A;  2Y8G A;  3PVL A;  2AL6 A;  2H7E A;  2Q13 A;  2GS0 A;  4KVG B;  2G35 A;  1ZSQ A;  2D2Q A;  1DBH A;  2W2X C;  4WJ7 A;  1K5D B;  1W1D A;  2CY5 A;  2MDX A;  3AU4 A;  3GYO A;  2W2X D;  3SV1 A;  2LYD A;  4CHJ A;  4HB3 B;  2HE7 A;  4CYE A;  2ROZ B;  1EGX A;  5LON B;  4YL8 A;  1QQG A;  2KR0 A;  4L1R A;  4MK0 A;  2RGN B;  2V76 A;  1XR0 B;  3ODX A;  3TVV A;  2GCJ A;  4GPT B;  3KRX A;  5LG4 B;  2DX1 A;  3T06 A;  5C79 A;  4HAX B;  1GG3 A;  2DN6 A;  4DIX A;  2EC1 A;  2GJY A;  5KCV A;  5HE3 A;  5KQ1 A;  2P0H A;  5HE0 A;  2DKP A;  1U5D A;  2OTX A;  4EKU A;  1V5P A;  2K00 A;  2UZR A;  2D4Q A;  1GC7 A;  2K8E A;  2D9W A;  3SUZ A;  2K2U A;  1Q67 A;  2NZ8 B;  1UNQ A;  4C0A A;  4A5K A;  2R0D A;  4K2O A;  5HE2 A;  1FB8 A;  1V89 A;  1BTN A;  4IFS A;  1MI1 A;  2LUL A;  1V5U A;  3M1I B;  2J0J A;  3HIE A;  1T77 A;  2LOZ A;  2D9Y A;  2JP2 A;  4YON A;  2YT2 A;  5DHA B;  1OQN A;  5DIF B;  2RSG A;  5D3W A;  3FEH A;  3F0W A;  4QJ3 B;  1M7R A;  3KSY A;  3TO1 A;  4BBK A;  3PP2 A;  4GNK B;  2P0D A;  3NW8 A;  1J0W A;  2D9Z A;  5LOP B;  5DI9 B;  5I2S A;  1M7E A;  1Y5O A;  2M14 A;  4MT7 A;  2RLO A;  1WGQ A;  1DYN A;  3P6A A;  4F7H A;  3V5W A;  3KY9 A;  2YS1 A;  2ZPY A;  3SO6 A;  3PVW A;  3QIJ A;  3LJU X;  2R09 A;  4OT1 A;  3QBV B;  2DHJ A;  5GOW B;  2OQB A;  1UEF A;  1ZC3 B;  4QXA B;  4L6E A;  5JHG A;  1TXD A;  1XKE A;  1XOD A;  4TYZ A;  4ZRK A;  3ZDT A;  1UPR A;  1DRO A;  2COC A;  5C5B A;  2YT1 A;  5J3Q A;  5EFX A;  3G9W A;  2CAY A;  4GMV A;  3U8Z A;  3D8D A;  3A8Q A;  3ULC A;  2COF A;  5C16 A;  3HSA A;  5JLJ B;  1DDW A;  1UNR A;  4WSF A;  2DLW A;  1FGZ A;  2CY4 A;  1TJ6 A;  2J0K A;  4F7U P;  4GMX B;  4XWX A;  3PSC A;  2L2I A;  1FAO A;  5D3V A;  2YVC A;  3TW1 A;  3N7C A;  4GXB A;  4EMO A;  1Y19 B;  1ZM0 A;  4WVF B;  2D10 A;  4A6F A;  3A98 B;  1NTV A;  2COD A;  2DFK A;  4CSQ A;  2I5C A;  5C6R A;  4F7G A;  1MIZ B;  1KZG A;  3U7D A;  2E2X A;  2EMT A;  2D9X A;  2KIG A;  2DA0 A;  2ELA A;  3SYX A;  1GC6 A;  1WGU A;  2NMB A;  2K49 A;  2IFS A;  2Z59 A;  1RRP B;  2EJ8 A;  4HAV B;  2UZS A;  2YS5 A;  2Y8F A;  1X1F A;  2KIE A;  3NWA A;  4A6H A;  1U5F A;  2FJU B;  4K17 A;  4GZU A;  4KHB A;  2DX5 A;  2J0M A;  2VSZ A;  1P5T A;  2XQN M;  4Z2M B;  1B55 A;  3D8F A;  4GN1 A;  1XX0 A;  3ODO A;  5JP4 A;  1U5E A;  2MWN B;  1TQZ A;  2VRW B;  1W1H A;  1QC6 A;  1V61 A;  3FM8 C;  4HHV A;  3AU5 A;  1E5W A;  1LW3 A;  4HB2 B;  4KHO A;  5KQ4 A;  1WI1 A;  5D3Y A;  2Z14 A;  1MK9 B;  3NWD A;  2W2W A;  3MDB C;  4Z2N A;  3PVU A;  1KI1 B;  1ZYI A;  3HW2 B;  1NTY A;  4K2P A;  5FI1 A;  5D3X A;  3QWM A;  3F5R A;  3UZT A;  5DHF B;  3OAN A;  2KCJ A;  1Z87 A;  1AQC A;  4HSI A;  1RJ2 A;  3AJ4 A;  1MK7 B;  2MKR A;  5DH9 B;  5J3Y A;  4CHM A;  2CRF A;  5J3T A;  2P8V A;  1EF1 A;  1FOE A;  4HB4 B;  4EJN A;  1AWE A;  3VOQ A;  2YT0 A;  2RVB B;  2Z0P A;  1LB1 A; 
#chains in the Genus database with same CATH homology
 1P3R A;  5JHH A;  1K5G B;  1NI2 A;  4PQ0 A;  3KRW A;  4TKN A;  4HAU B;  4DBB A;  1BTK A;  3ML4 A;  3NSU A;  4HAZ B;  3D8E A;  1DDV A;  3VIA A;  2I1J A;  2J59 M;  3GYP A;  2DKQ A;  2ELB A;  3O96 A;  1V5M A;  1I7A A;  2QKM A;  3DXD A;  1PFJ A;  2UVM A;  3P7Z A;  2DHI A;  4KHA A;  5C5B B;  4ZRJ A;  2LKO A;  3X23 A;  1BWN A;  2GCL A;  3MPX A;  1XD4 A;  1ZC4 B;  2COA A;  2YRY A;  1UNP A;  1FGY A;  2D11 A;  2DYQ A;  2YF0 A;  5FI0 A;  5D27 A;  2IYB A;  2MFQ A;  2DYN A;  3ULB A;  2KGX B;  3HK0 A;  1FHO A;  1U2B A;  1DDM A;  2N23 A;  2YSZ A;  1MPH A;  1SHC A;  2I5F A;  4NY0 A;  4KAX B;  1SGH A;  2I1K A;  4HAW B;  4MY6 A;  2DTC A;  4A6F B;  2KUP A;  3ODW A;  2Y7B A;  1PLS A;  4IOY X;  1MKE A;  2P0F A;  1J19 A;  2Z0Q A;  1V88 A;  3DXE A;  4HDO A;  1N3H A;  5CLL B;  1UPQ A;  1XCG A;  4DX9 0;  2RUK B;  2LG1 A;  1FHW A;  5HE1 A;  3A8P A;  3ZVR A;  1MAI A;  4HB0 B;  3TFM A;  1IRS A;  1P6S A;  3BIN A;  2HTH B;  2L1C A;  4K81 A;  1X05 A;  3FSS A;  3HQC A;  5L81 A;  3PEG A;  1ISN A;  1MIX A;  1BAK A;  4HAT B;  3BJI A;  3RCP A;  1X1G A;  4IAP A;  4KHB B;  1PMS A;  1NU2 A;  4PNK A;  1U5G A;  2RNR B;  3SNH A;  2X18 A;  4H8S A;  4P7I A;  1WG7 A;  4A6K A;  4B6H A;  1W1G A;  2N0Y A;  2Z0O A;  3CXB B;  4ZRI A;  5CLQ B;  4D0N B;  4NSW A;  1WJM A;  1U27 A;  4DX8 A;  1KZ7 A;  1WVH A;  1H10 A;  1X86 A;  4Y94 A;  2H7D A;  2K2J A;  1FHX A;  2ROV A;  3PG7 A;  3WA0 A;  1EAZ A;  1U29 A;  1WJ1 A;  3PZD A;  2AEH A;  1ZVR A;  3WYF B;  3KZ1 A;  2PZ1 A;  3TCA A;  4DXA B;  1X11 A;  2LOX A;  2BCJ A;  2M38 A;  1H4R A;  2VKI A;  2D9V A;  2DHK A;  2FJL A;  2YS3 A;  1EVH A;  2ADZ A;  1I2H A;  2EMS A;  3DXC A;  4HAY B;  1OMW A;  1OY2 A;  3IVF A;  3CIK A;  4HDQ A;  2QKL A;  2Y8G A;  3PVL A;  2AL6 A;  2H7E A;  2Q13 A;  2GS0 A;  4KVG B;  2G35 A;  1ZSQ A;  2D2Q A;  1DBH A;  2W2X C;  4WJ7 A;  1K5D B;  1W1D A;  2CY5 A;  2MDX A;  3AU4 A;  3GYO A;  2W2X D;  3SV1 A;  2LYD A;  4CHJ A;  4HB3 B;  2HE7 A;  4CYE A;  2ROZ B;  1EGX A;  5LON B;  4YL8 A;  1QQG A;  4MK0 A;  2RGN B;  2V76 A;  1XR0 B;  3ODX A;  3TVV A;  2GCJ A;  4GPT B;  3KRX A;  2DX1 A;  3T06 A;  5C79 A;  4HAX B;  1GG3 A;  2DN6 A;  2EC1 A;  2GJY A;  5KCV A;  5HE3 A;  5KQ1 A;  2P0H A;  5HE0 A;  2DKP A;  1U5D A;  2OTX A;  4EKU A;  1V5P A;  2K00 A;  2UZR A;  2D4Q A;  1GC7 A;  2D9W A;  3SUZ A;  2K2U A;  1Q67 A;  2NZ8 B;  1UNQ A;  4C0A A;  4A5K A;  2R0D A;  4K2O A;  5HE2 A;  1FB8 A;  1V89 A;  1BTN A;  4IFS A;  2LUL A;  1V5U A;  3M1I B;  2J0J A;  2LOZ A;  2D9Y A;  2JP2 A;  4YON A;  5DHA B;  1OQN A;  5DIF B;  2RSG A;  5D3W A;  3FEH A;  3F0W A;  1M7R A;  3KSY A;  3TO1 A;  4BBK A;  3PP2 A;  2P0D A;  1J0W A;  2D9Z A;  5LOP B;  5DI9 B;  1M7E A;  1Y5O A;  2M14 A;  4MT7 A;  2RLO A;  1WGQ A;  1DYN A;  3P6A A;  4F7H A;  3V5W A;  3KY9 A;  2YS1 A;  2ZPY A;  3SO6 A;  3PVW A;  3QIJ A;  3LJU X;  2R09 A;  3QBV B;  2DHJ A;  5GOW B;  2OQB A;  1UEF A;  1ZC3 B;  4L6E A;  5JHG A;  1TXD A;  1XKE A;  1XOD A;  4TYZ A;  4ZRK A;  3ZDT A;  1UPR A;  1DRO A;  2COC A;  5C5B A;  2YT1 A;  5J3Q A;  5EFX A;  3G9W A;  2CAY A;  4GMV A;  3U8Z A;  3D8D A;  3A8Q A;  3ULC A;  2COF A;  5C16 A;  5JLJ B;  1DDW A;  1UNR A;  4WSF A;  2DLW A;  1FGZ A;  2CY4 A;  1TJ6 A;  2J0K A;  4F7U P;  4GMX B;  4XWX A;  3PSC A;  2L2I A;  1FAO A;  5D3V A;  2YVC A;  3TW1 A;  3N7C A;  4GXB A;  4EMO A;  1Y19 B;  1ZM0 A;  4WVF B;  2D10 A;  4A6F A;  3A98 B;  1NTV A;  2COD A;  2DFK A;  2I5C A;  5C6R A;  4F7G A;  1MIZ B;  1KZG A;  3U7D A;  2E2X A;  2EMT A;  2D9X A;  2DA0 A;  2ELA A;  3SYX A;  1GC6 A;  1WGU A;  2NMB A;  2IFS A;  1RRP B;  2EJ8 A;  4HAV B;  2UZS A;  2YS5 A;  2Y8F A;  1X1F A;  4A6H A;  1U5F A;  4K17 A;  4GZU A;  2DX5 A;  2J0M A;  2VSZ A;  1P5T A;  2XQN M;  4Z2M B;  1B55 A;  3D8F A;  4GN1 A;  1XX0 A;  3ODO A;  5JP4 A;  1U5E A;  2MWN B;  1TQZ A;  2VRW B;  1W1H A;  1QC6 A;  1V61 A;  3FM8 C;  4HHV A;  3AU5 A;  1E5W A;  1LW3 A;  4HB2 B;  4KHO A;  5KQ4 A;  1WI1 A;  5D3Y A;  1MK9 B;  2W2W A;  3MDB C;  4Z2N A;  3PVU A;  1KI1 B;  3HW2 B;  1NTY A;  4K2P A;  5FI1 A;  5D3X A;  3QWM A;  3F5R A;  3UZT A;  5DHF B;  3OAN A;  2KCJ A;  1Z87 A;  1AQC A;  1RJ2 A;  3AJ4 A;  1MK7 B;  2MKR A;  5DH9 B;  5J3Y A;  4CHM A;  2CRF A;  5J3T A;  2P8V A;  1EF1 A;  1FOE A;  4HB4 B;  4EJN A;  1AWE A;  3VOQ A;  2YT0 A;  2RVB B;  2Z0P A;  1LB1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...