4A6KA

Crystal structure of slm1-ph domain in complex with d-myo-inositol-4- phosphate
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
119
structure length
110
Chain Sequence
DHPFTEIKSGFLERRSKFLKSYSKGYYVLTPNFLHEFKTADRKKDLVPVMSLALSECTVTEHSRKNSDAKFVLHAKQNGIIRRGHNWVFKADSYESMMSWFDNLKILTST
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural Analyses of Slm1-Ph Domain Demonstrate Ligand Binding in the Non-Canonical Site
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Signaling protein
molecule keywords PHOSPHATIDYLINOSITOL 4,5-BISPHOSPHATE-BINDING PROTEIN SLM1
total genus 24
structure length 110
sequence length 119
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2011-11-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00169 PH PH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 4a6kA00
1U2BA 1DROA 1DDMA 2DFKA 3PG7A 2EMTA 1V5MA 2W2XC 2YF0A 3F5RA 2KUPA 3DXCA 3WA0A 2DKQA 2UZRA 4HAZB 3TFMA 2YVCA 2DLWA 1M7RA 1V88A 1MIZB 5C79A 3ODWA 5J3YA 4WVFB 1FHXA 2ELBA 2I1JA 4CHJA 1ISNA 2DYQA 4A6KA 1ZM0A 5LOPB 2RUKB 3PVUA 5FI1A 4KHAA 1X1GA 1BAKA 4GPTB 1FHWA 3BJIA 2Z0PA 2DHJA 4HB0B 3ODOA 2ADZA 3T06A 4ZRKA 1V89A 3P7ZA 4F7GA 1OQNA 2CAYA 2PZ1A 3DXEA 5KQ4A 2VKIA 4K2OA 3ZDTA 1EGXA 3QIJA 4HAVB 4K2PA 4A6FB 1SGHA 1U5GA 2UZSA 1NU2A 2AEHA 3AJ4A 1ZC3B 1LB1A 4HB3B 5DHFB 5L81A 4HAUB 2YT0A 2LULA 2ROVA 2MKRA 2DYNA 5JHHA 1TXDA 3U8ZA 3A8PA 1P6SA 2E2XA 1X1FA 5C5BB 4CYEA 1FB8A 2MWNB 1H10A 3TO1A 2VRWB 5HE0A 4HAYB 3A98B 4WJ7A 3KY9A 3PP2A 1P3RA 3GYOA 3M1IB 4HHVA 1U5FA 5D3YA 4EJNA 4TKNA 3BINA 5KCVA 3SYXA 1K5DB 3AU5A 1V61A 1KZGA 2COCA 1KZ7A 1BTKA 2VSZA 1WG7A 1UNQA 3N7CA 1MK7B 2XQNM 2COAA 5FI0A 2Y7BA 3RCPA 2L2IA 4HAXB 2OTXA 1Y5OA 1PMSA 4Y94A 3A8QA 1AWEA 4IAPA 2P0FA 2RNRB 2H7DA 3G9WA 1Z87A 4Z2NA 5C5BA 2W2WA 1FHOA 1ZVRA 3LJUX 1U5EA 1MKEA 1EAZA 3FEHA 3MDBC 1K5GB 4HB4B 2ROZB 5J3QA 2N23A 4A6HA 3ULCA 1I7AA 2EMSA 2YS5A 4D0NB 4YONA 1Q67A 3FM8C 4WSFA 2Z0OA 4F7UP 2LOXA 4EMOA 5CLLB 4A6FA 1ZC4B 2QKMA 1X11A 1U5DA 3SO6A 4F7HA 4EKUA 2R0DA 1W1DA 5GOWB 1DYNA 2D2QA 2G35A 3F0WA 3CXBB 4C0AA 1H4RA 1XD4A 2D4QA 1DBHA 2I1KA 5D3VA 1V5PA 2Q13A 2YS1A 2V76A 1J19A 3KRXA 2AL6A 4NSWA 2K2JA 3ODXA 2J0JA 1NTVA 4DX8A 2KCJA 4KAXB 2W2XD 1WJMA 1TQZA 1U27A 3PVWA 2I5CA 1GC7A 3IVFA 3ULBA 2CRFA 5D3XA 1N3HA 4PQ0A 2J0MA 1FGYA 1OY2A 4DXAB 2J59M 4HATB 1PFJA 3D8EA 2HTHB 3SNHA 3SV1A 2P0HA 1Y19B 2MDXA 2KGXB 2J0KA 2Z0QA 4BBKA 1DDWA 1NTYA 5J3TA 3DXDA 2D11A 2Y8FA 2MFQA 5D3WA 2D9ZA 1PLSA 3UZTA 4H8SA 2DX1A 2D9VA 5HE1A 3PEGA 4ZRIA 2RLOA 1NI2A 1MAIA 3TCAA 2GS0A 1RRPB 3P6AA 3HW2B 2I5FA 2BCJA 4CHMA 2NZ8B 4K17A 1W1GA 5HE3A 2EJ8A 5DI9B 4B6HA 3KSYA 2D9WA 4HAWB 4MT7A 4K81A 2DA0A 1UNPA 3TVVA 2LG1A 2D10A 4GN1A 2M38A 4L6EA 1IRSA 2Y8GA 2DKPA 1MPHA 5D27A 2DHKA 2M14A 1FOEA 2FJLA 2UVMA 1UPRA 1B55A 4ZRJA 2K2UA 3D8FA 1WI1A 2ZPYA 5DHAB 2CY5A 2RVBB 4GMXB 3ML4A 3PSCA 2IFSA 2COFA 1XX0A 3AU4A 2LOZA 1GC6A 3HK0A 1X86A 1TJ6A 2R09A 3GYPA 1WGQA 1OMWA 1U29A 4DBBA 2YS3A 2DHIA 2OQBA 2IYBA 3D8DA 1EVHA 4KHOA 1X05A 1SHCA 1KI1B 3HQCA 2K00A 4DX90 1XR0B 2CODA 4TYZA 1XCGA 3OANA 4KHBB 5DH9B 1P5TA 5C6RA 4A5KA 3NSUA 2YT1A 3VOQA 1QC6A 4IOYX 1XODA 3QWMA 5LONB 3QBVB 2LYDA 1DDVA 3CIKA 2DN6A 4GXBA 1FGZA 1FAOA 2N0YA 4IFSA 1I2HA 4HDQA 3U7DA 2H7EA 1UPQA 2RSGA 5DIFB 2DTCA 2L1CA 1RJ2A 3ZVRA 2ELAA 2LKOA 3PZDA 2X18A 5EFXA 3X23A 4PNKA 2GCJA 1MIXA 3V5WA 2P8VA 1XKEA 3PVLA 5KQ1A 1E5WA 4KVGB 1AQCA 1LW3A 2EC1A 1J0WA 2DX5A 2GJYA 5HE2A 3KZ1A 4GZUA 1ZSQA 2YRYA 5JHGA 1MK9B 3FSSA 1M7EA 4HB2B 2D9XA 2D9YA 3WYFB 4GMVA 4HDOA 1EF1A 1V5UA 4P7IA 2HE7A 4MY6A 1BWNA 4XWXA 5JLJB 4MK0A 2YSZA 2NMBA 4NY0A 5CLQB 2JP2A 1GG3A 5JP4A 3VIAA 1UNRA 1W1HA 2GCLA 3KRWA 1BTNA 1WGUA 4YL8A 3SUZA 2RGNB 5C16A 2P0DA 2QKLA 3TW1A 2CY4A 3MPXA 1UEFA 3O96A 1WJ1A 1WVHA 4Z2MB 1QQGA
chains in the Genus database with same CATH superfamily
1U2BA 1DROA 1DDMA 2DFKA 3PG7A 1T77A 2EMTA 1V5MA 2W2XC 2YF0A 3F5RA 2KUPA 3DXCA 3WA0A 4OT1A 2DKQA 2UZRA 4HAZB 3TFMA 2YVCA 4OSNA 2DLWA 1M7RA 1V88A 1MIZB 5C79A 2K8EA 3ODWA 5J3YA 4WVFB 1FHXA 2ELBA 2I1JA 4CHJA 1ISNA 2DYQA 4A6KA 1ZM0A 5LOPB 2RUKB 3PVUA 5FI1A 4KHAA 1X1GA 1BAKA 4GPTB 1FHWA 3BJIA 2Z0PA 4D6WA 2DHJA 4GOUA 4GNKB 4HB0B 3ODOA 2ADZA 3T06A 4ZRKA 2K49A 1V89A 3P7ZA 4F7GA 1OQNA 2CAYA 2PZ1A 3DXEA 5KQ4A 2VKIA 4K2OA 3ZDTA 1EGXA 3QIJA 4HAVB 4K2PA 4A6FB 1SGHA 1U5GA 2UZSA 1NU2A 2AEHA 3AJ4A 1ZC3B 1LB1A 4HB3B 5DHFB 5L81A 4HAUB 3A58A 2YT0A 2LULA 2ROVA 5IRSA 2MKRA 2DYNA 5JHHA 1TXDA 3U8ZA 3A8PA 1P6SA 2E2XA 2KR0A 1X1FA 5C5BB 4CYEA 1FB8A 2MWNB 1H10A 3TO1A 2VRWB 5HE0A 4HAYB 3A98B 4WJ7A 3KY9A 3PP2A 1P3RA 2YT2A 3GYOA 3M1IB 1U5FA 4HHVA 5D3YA 4EJNA 3DCXA 4TKNA 3BINA 5KCVA 3SYXA 1K5DB 2RRFA 3AU5A 1V61A 1KZGA 2COCA 1KZ7A 1BTKA 2VSZA 1WG7A 1UNQA 3N7CA 1MK7B 2XQNM 2COAA 5FI0A 2Y7BA 3RCPA 2L2IA 4HAXB 2OTXA 1Y5OA 3HIEA 1PMSA 4Y94A 3A8QA 1AWEA 4IAPA 2P0FA 2RNRB 2H7DA 3G9WA 1Z87A 4Z2NA 5C5BA 2W2WA 1FHOA 1ZVRA 3LJUX 5I2MA 1U5EA 1MKEA 1EAZA 3FEHA 3MDBC 1K5GB 2KIGA 4HB4B 2ROZB 5J3QA 2N23A 4A6HA 3ULCA 1I7AA 2EMSA 2YS5A 4D0NB 4YONA 1Q67A 3FM8C 4WSFA 2Z0OA 4F7UP 3NWDA 2LOXA 4EMOA 5CLLB 4A6FA 1ZC4B 2QKMA 1X11A 1U5DA 3SO6A 4F7HA 4EKUA 2R0DA 1W1DA 5GOWB 1DYNA 2D2QA 4CSQA 2G35A 3F0WA 3CXBB 5M4YB 4C0AA 1H4RA 1XD4A 2Z13A 3NWFA 2D4QA 1DBHA 2I1KA 5D3VA 1V5PA 2Q13A 2YS1A 2V76A 1J19A 3KRXA 2AL6A 4NSWA 3U12A 2K2JA 3ODXA 2J0JA 1NTVA 4DX8A 3OHMB 2KCJA 4KAXB 3FVCA 2W2XD 1WJMA 1TQZA 1U27A 3PVWA 2I5CA 1GC7A 3IVFA 3ULBA 2CRFA 5D3XA 1N3HA 5LG4B 4PQ0A 2J0MA 1FGYA 1OY2A 4DXAB 2J59M 4HATB 1PFJA 3D8EA 2HTHB 3SNHA 3SV1A 2P0HA 1Y19B 2MDXA 2KGXB 2FJUB 5I2SA 2J0KA 2Z0QA 2KUQA 4BBKA 1DDWA 1NTYA 5J3TA 3DXDA 2D11A 2Y8FA 2MFQA 5D3WA 2D9ZA 1PLSA 3UZTA 4H8SA 2DX1A 2D9VA 5HE1A 3PEGA 4ZRIA 2RLOA 1NI2A 1MAIA 4QXAB 3TCAA 2GS0A 1RRPB 3P6AA 3HW2B 2I5FA 2BCJA 4CHMA 2NZ8B 4K17A 1MI1A 1W1GA 5HE3A 2EJ8A 5DI9B 4B6HA 3KSYA 2D9WA 4HAWB 3NWAA 4MT7A 4K81A 2DA0A 1UNPA 3TVVA 2LG1A 2D10A 4GN1A 2M38A 4L6EA 1IRSA 2Y8GA 2DKPA 1MPHA 5D27A 2DHKA 2M14A 1FOEA 2FJLA 2UVMA 1UPRA 1B55A 4ZRJA 2K2UA 3D8FA 1WI1A 2ZPYA 5DHAB 2CY5A 2RVBB 4GMXB 2Z4DA 3ML4A 3PSCA 2IFSA 2COFA 1XX0A 3AU4A 2LOZA 1GC6A 3HK0A 1X86A 1TJ6A 2R09A 3GYPA 1WGQA 1OMWA 1U29A 4DBBA 2YS3A 2DHIA 2Z59A 2OQBA 2IYBA 3D8DA 1EVHA 4KHOA 1X05A 1SHCA 1KI1B 3HQCA 2K00A 4DX90 1XR0B 2CODA 4TYZA 2ZKMX 1XCGA 3OANA 4KHBB 5DH9B 1P5TA 5C6RA 4A5KA 3NSUA 2YT1A 3VOQA 1QC6A 3NW8A 1XODA 4IOYX 3QWMA 5LONB 3QBVB 2LYDA 1DDVA 3CIKA 2DN6A 4GXBA 2R2YA 1FGZA 1FAOA 2N0YA 4IFSA 1I2HA 4HDQA 3U7DA 2H7EA 1UPQA 2RSGA 5DIFB 4QJ5B 2DTCA 2GUMA 2L1CA 1RJ2A 3ZVRA 2ELAA 4QJ3B 2LKOA 3PZDA 2X18A 3B77A 5EFXA 3X23A 4PNKA 2GCJA 1MIXA 3V5WA 2P8VA 1XKEA 3PVLA 4L1RA 2KIEA 1E5WA 4KVGB 5KQ1A 1AQCA 1LW3A 2EC1A 1J0WA 2DX5A 2GJYA 5HE2A 2NBVA 3KZ1A 4GZUA 1ZSQA 2YRYA 5JHGA 1MK9B 3FSSA 1M7EA 4HB2B 2D9XA 2D9YA 3WYFB 4HSIA 4GMVA 4HDOA 1EF1A 1V5UA 4P7IA 2HE7A 4MY6A 1BWNA 4XWXA 5JLJB 4MK0A 2YSZA 2NMBA 4NY0A 5CLQB 4DIXA 2JP2A 1GG3A 5JP4A 3VIAA 1UNRA 1W1HA 2GCLA 3KRWA 1BTNA 1WGUA 4YL8A 1ZYIA 3SUZA 2Z14A 2RGNB 3HSAA 5C16A 2P0DA 2QKLA 4QJ4B 3TW1A 2CY4A 3MPXA 4KHBA 1UEFA 3O96A 1WJ1A 1WVHA 4Z2MB 1QQGA
chains in the Genus database with same CATH topology
1U2BA 1DROA 1DDMA 2DFKA 3PG7A 2EMTA 1V5MA 2W2XC 2YF0A 3F5RA 2KUPA 3DXCA 3WA0A 2DKQA 2UZRA 4HAZB 3TFMA 2YVCA 2DLWA 1M7RA 1V88A 1MIZB 5C79A 3ODWA 5J3YA 4WVFB 1FHXA 2ELBA 2I1JA 4CHJA 1ISNA 2DYQA 4A6KA 1ZM0A 5LOPB 2RUKB 3PVUA 5FI1A 4KHAA 1X1GA 1BAKA 4GPTB 1FHWA 3BJIA 2Z0PA 2DHJA 4HB0B 3ODOA 2ADZA 3T06A 4ZRKA 1V89A 3P7ZA 4F7GA 1OQNA 2CAYA 2PZ1A 3DXEA 5KQ4A 2VKIA 4K2OA 3ZDTA 1EGXA 3QIJA 4HAVB 4K2PA 4A6FB 1SGHA 1U5GA 2UZSA 1NU2A 2AEHA 3AJ4A 1ZC3B 1LB1A 4HB3B 5DHFB 5L81A 4HAUB 2YT0A 2LULA 2ROVA 2MKRA 2DYNA 5JHHA 1TXDA 3U8ZA 3A8PA 1P6SA 2E2XA 1X1FA 5C5BB 4CYEA 1FB8A 2MWNB 1H10A 3TO1A 2VRWB 5HE0A 4HAYB 3A98B 4WJ7A 3KY9A 3PP2A 1P3RA 3GYOA 3M1IB 4HHVA 1U5FA 5D3YA 4EJNA 4TKNA 3BINA 5KCVA 3SYXA 1K5DB 3AU5A 1V61A 1KZGA 2COCA 1KZ7A 1BTKA 2VSZA 1WG7A 1UNQA 3N7CA 1MK7B 2XQNM 2COAA 5FI0A 2Y7BA 3RCPA 2L2IA 4HAXB 2OTXA 1Y5OA 1PMSA 4Y94A 3A8QA 1AWEA 4IAPA 2P0FA 2RNRB 2H7DA 3G9WA 1Z87A 4Z2NA 5C5BA 2W2WA 1FHOA 1ZVRA 3LJUX 1U5EA 1MKEA 1EAZA 3FEHA 3MDBC 1K5GB 4HB4B 2ROZB 5J3QA 2N23A 4A6HA 3ULCA 1I7AA 2EMSA 2YS5A 4D0NB 4YONA 1Q67A 3FM8C 4WSFA 2Z0OA 4F7UP 2LOXA 4EMOA 5CLLB 4A6FA 1ZC4B 2QKMA 1X11A 1U5DA 3SO6A 4F7HA 4EKUA 2R0DA 1W1DA 5GOWB 1DYNA 2D2QA 2G35A 3F0WA 3CXBB 4C0AA 1H4RA 1XD4A 2D4QA 1DBHA 2I1KA 5D3VA 1V5PA 2Q13A 2YS1A 2V76A 1J19A 3KRXA 2AL6A 4NSWA 2K2JA 3ODXA 2J0JA 1NTVA 4DX8A 2KCJA 4KAXB 2W2XD 1WJMA 1TQZA 1U27A 3PVWA 2I5CA 1GC7A 3IVFA 3ULBA 2CRFA 5D3XA 1N3HA 4PQ0A 2J0MA 1FGYA 1OY2A 4DXAB 2J59M 4HATB 1PFJA 3D8EA 2HTHB 3SNHA 3SV1A 2P0HA 1Y19B 2MDXA 2KGXB 2J0KA 2Z0QA 4BBKA 1DDWA 1NTYA 5J3TA 3DXDA 2D11A 2Y8FA 2MFQA 5D3WA 2D9ZA 1PLSA 3UZTA 4H8SA 2DX1A 2D9VA 5HE1A 3PEGA 4ZRIA 2RLOA 1NI2A 1MAIA 3TCAA 2GS0A 1RRPB 3P6AA 3HW2B 2I5FA 2BCJA 4CHMA 2NZ8B 4K17A 1W1GA 5HE3A 2EJ8A 5DI9B 4B6HA 3KSYA 2D9WA 4HAWB 4MT7A 4K81A 2DA0A 1UNPA 3TVVA 2LG1A 2D10A 4GN1A 2M38A 4L6EA 1IRSA 2Y8GA 2DKPA 1MPHA 5D27A 2DHKA 2M14A 1FOEA 2FJLA 2UVMA 1UPRA 1B55A 4ZRJA 2K2UA 3D8FA 1WI1A 2ZPYA 5DHAB 2CY5A 2RVBB 4GMXB 3ML4A 3PSCA 2IFSA 2COFA 1XX0A 3AU4A 2LOZA 1GC6A 3HK0A 1X86A 1TJ6A 2R09A 3GYPA 1WGQA 1OMWA 1U29A 4DBBA 2YS3A 2DHIA 2OQBA 2IYBA 3D8DA 1EVHA 4KHOA 1X05A 1SHCA 1KI1B 3HQCA 2K00A 4DX90 1XR0B 2CODA 4TYZA 1XCGA 3OANA 4KHBB 5DH9B 1P5TA 5C6RA 4A5KA 3NSUA 2YT1A 3VOQA 1QC6A 4IOYX 1XODA 3QWMA 5LONB 3QBVB 2LYDA 1DDVA 3CIKA 2DN6A 4GXBA 1FGZA 1FAOA 2N0YA 4IFSA 1I2HA 4HDQA 3U7DA 2H7EA 1UPQA 2RSGA 5DIFB 2DTCA 2L1CA 1RJ2A 3ZVRA 2ELAA 2LKOA 3PZDA 2X18A 5EFXA 3X23A 4PNKA 2GCJA 1MIXA 3V5WA 2P8VA 1XKEA 3PVLA 5KQ1A 1E5WA 4KVGB 1AQCA 1LW3A 2EC1A 1J0WA 2DX5A 2GJYA 5HE2A 3KZ1A 4GZUA 1ZSQA 2YRYA 5JHGA 1MK9B 3FSSA 1M7EA 4HB2B 2D9XA 2D9YA 3WYFB 4GMVA 4HDOA 1EF1A 1V5UA 4P7IA 2HE7A 4MY6A 1BWNA 4XWXA 5JLJB 4MK0A 2YSZA 2NMBA 4NY0A 5CLQB 2JP2A 1GG3A 5JP4A 3VIAA 1UNRA 1W1HA 2GCLA 3KRWA 1BTNA 1WGUA 4YL8A 3SUZA 2RGNB 5C16A 2P0DA 2QKLA 3TW1A 2CY4A 3MPXA 1UEFA 3O96A 1WJ1A 1WVHA 4Z2MB 1QQGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1U2B A;  1DRO A;  1DDM A;  2DFK A;  3PG7 A;  2EMT A;  1V5M A;  2W2X C;  2YF0 A;  3F5R A;  2KUP A;  3DXC A;  3WA0 A;  2DKQ A;  2UZR A;  4HAZ B;  3TFM A;  2YVC A;  2DLW A;  1M7R A;  1V88 A;  1MIZ B;  5C79 A;  3ODW A;  5J3Y A;  4WVF B;  1FHX A;  2ELB A;  2I1J A;  4CHJ A;  1ISN A;  2DYQ A;  4A6K A;  1ZM0 A;  5LOP B;  2RUK B;  3PVU A;  5FI1 A;  4KHA A;  1X1G A;  1BAK A;  4GPT B;  1FHW A;  3BJI A;  2Z0P A;  2DHJ A;  4HB0 B;  3ODO A;  2ADZ A;  3T06 A;  4ZRK A;  1V89 A;  3P7Z A;  4F7G A;  1OQN A;  2CAY A;  2PZ1 A;  3DXE A;  5KQ4 A;  2VKI A;  4K2O A;  3ZDT A;  1EGX A;  3QIJ A;  4HAV B;  4K2P A;  4A6F B;  1SGH A;  1U5G A;  2UZS A;  1NU2 A;  2AEH A;  3AJ4 A;  1ZC3 B;  1LB1 A;  4HB3 B;  5DHF B;  5L81 A;  4HAU B;  2YT0 A;  2LUL A;  2ROV A;  2MKR A;  2DYN A;  5JHH A;  1TXD A;  3U8Z A;  3A8P A;  1P6S A;  2E2X A;  1X1F A;  5C5B B;  4CYE A;  1FB8 A;  2MWN B;  1H10 A;  3TO1 A;  2VRW B;  5HE0 A;  4HAY B;  3A98 B;  4WJ7 A;  3KY9 A;  3PP2 A;  1P3R A;  3GYO A;  3M1I B;  4HHV A;  1U5F A;  5D3Y A;  4EJN A;  4TKN A;  3BIN A;  5KCV A;  3SYX A;  1K5D B;  3AU5 A;  1V61 A;  1KZG A;  2COC A;  1KZ7 A;  1BTK A;  2VSZ A;  1WG7 A;  1UNQ A;  3N7C A;  1MK7 B;  2XQN M;  2COA A;  5FI0 A;  2Y7B A;  3RCP A;  2L2I A;  4HAX B;  2OTX A;  1Y5O A;  1PMS A;  4Y94 A;  3A8Q A;  1AWE A;  4IAP A;  2P0F A;  2RNR B;  2H7D A;  3G9W A;  1Z87 A;  4Z2N A;  5C5B A;  2W2W A;  1FHO A;  1ZVR A;  3LJU X;  1U5E A;  1MKE A;  1EAZ A;  3FEH A;  3MDB C;  1K5G B;  4HB4 B;  2ROZ B;  5J3Q A;  2N23 A;  4A6H A;  3ULC A;  1I7A A;  2EMS A;  2YS5 A;  4D0N B;  4YON A;  1Q67 A;  3FM8 C;  4WSF A;  2Z0O A;  4F7U P;  2LOX A;  4EMO A;  5CLL B;  4A6F A;  1ZC4 B;  2QKM A;  1X11 A;  1U5D A;  3SO6 A;  4F7H A;  4EKU A;  2R0D A;  1W1D A;  5GOW B;  1DYN A;  2D2Q A;  2G35 A;  3F0W A;  3CXB B;  4C0A A;  1H4R A;  1XD4 A;  2D4Q A;  1DBH A;  2I1K A;  5D3V A;  1V5P A;  2Q13 A;  2YS1 A;  2V76 A;  1J19 A;  3KRX A;  2AL6 A;  4NSW A;  2K2J A;  3ODX A;  2J0J A;  1NTV A;  4DX8 A;  2KCJ A;  4KAX B;  2W2X D;  1WJM A;  1TQZ A;  1U27 A;  3PVW A;  2I5C A;  1GC7 A;  3IVF A;  3ULB A;  2CRF A;  5D3X A;  1N3H A;  4PQ0 A;  2J0M A;  1FGY A;  1OY2 A;  4DXA B;  2J59 M;  4HAT B;  1PFJ A;  3D8E A;  2HTH B;  3SNH A;  3SV1 A;  2P0H A;  1Y19 B;  2MDX A;  2KGX B;  2J0K A;  2Z0Q A;  4BBK A;  1DDW A;  1NTY A;  5J3T A;  3DXD A;  2D11 A;  2Y8F A;  2MFQ A;  5D3W A;  2D9Z A;  1PLS A;  3UZT A;  4H8S A;  2DX1 A;  2D9V A;  5HE1 A;  3PEG A;  4ZRI A;  2RLO A;  1NI2 A;  1MAI A;  3TCA A;  2GS0 A;  1RRP B;  3P6A A;  3HW2 B;  2I5F A;  2BCJ A;  4CHM A;  2NZ8 B;  4K17 A;  1W1G A;  5HE3 A;  2EJ8 A;  5DI9 B;  4B6H A;  3KSY A;  2D9W A;  4HAW B;  4MT7 A;  4K81 A;  2DA0 A;  1UNP A;  3TVV A;  2LG1 A;  2D10 A;  4GN1 A;  2M38 A;  4L6E A;  1IRS A;  2Y8G A;  2DKP A;  1MPH A;  5D27 A;  2DHK A;  2M14 A;  1FOE A;  2FJL A;  2UVM A;  1UPR A;  1B55 A;  4ZRJ A;  2K2U A;  3D8F A;  1WI1 A;  2ZPY A;  5DHA B;  2CY5 A;  2RVB B;  4GMX B;  3ML4 A;  3PSC A;  2IFS A;  2COF A;  1XX0 A;  3AU4 A;  2LOZ A;  1GC6 A;  3HK0 A;  1X86 A;  1TJ6 A;  2R09 A;  3GYP A;  1WGQ A;  1OMW A;  1U29 A;  4DBB A;  2YS3 A;  2DHI A;  2OQB A;  2IYB A;  3D8D A;  1EVH A;  4KHO A;  1X05 A;  1SHC A;  1KI1 B;  3HQC A;  2K00 A;  4DX9 0;  1XR0 B;  2COD A;  4TYZ A;  1XCG A;  3OAN A;  4KHB B;  5DH9 B;  1P5T A;  5C6R A;  4A5K A;  3NSU A;  2YT1 A;  3VOQ A;  1QC6 A;  4IOY X;  1XOD A;  3QWM A;  5LON B;  3QBV B;  2LYD A;  1DDV A;  3CIK A;  2DN6 A;  4GXB A;  1FGZ A;  1FAO A;  2N0Y A;  4IFS A;  1I2H A;  4HDQ A;  3U7D A;  2H7E A;  1UPQ A;  2RSG A;  5DIF B;  2DTC A;  2L1C A;  1RJ2 A;  3ZVR A;  2ELA A;  2LKO A;  3PZD A;  2X18 A;  5EFX A;  3X23 A;  4PNK A;  2GCJ A;  1MIX A;  3V5W A;  2P8V A;  1XKE A;  3PVL A;  5KQ1 A;  1E5W A;  4KVG B;  1AQC A;  1LW3 A;  2EC1 A;  1J0W A;  2DX5 A;  2GJY A;  5HE2 A;  3KZ1 A;  4GZU A;  1ZSQ A;  2YRY A;  5JHG A;  1MK9 B;  3FSS A;  1M7E A;  4HB2 B;  2D9X A;  2D9Y A;  3WYF B;  4GMV A;  4HDO A;  1EF1 A;  1V5U A;  4P7I A;  2HE7 A;  4MY6 A;  1BWN A;  4XWX A;  5JLJ B;  4MK0 A;  2YSZ A;  2NMB A;  4NY0 A;  5CLQ B;  2JP2 A;  1GG3 A;  5JP4 A;  3VIA A;  1UNR A;  1W1H A;  2GCL A;  3KRW A;  1BTN A;  1WGU A;  4YL8 A;  3SUZ A;  2RGN B;  5C16 A;  2P0D A;  2QKL A;  3TW1 A;  2CY4 A;  3MPX A;  1UEF A;  3O96 A;  1WJ1 A;  1WVH A;  4Z2M B;  1QQG A; 
#chains in the Genus database with same CATH topology
 1U2B A;  1DRO A;  1DDM A;  2DFK A;  3PG7 A;  1T77 A;  2EMT A;  1V5M A;  2W2X C;  2YF0 A;  3F5R A;  2KUP A;  3DXC A;  3WA0 A;  4OT1 A;  2DKQ A;  2UZR A;  4HAZ B;  3TFM A;  2YVC A;  4OSN A;  2DLW A;  1M7R A;  1V88 A;  1MIZ B;  5C79 A;  2K8E A;  3ODW A;  5J3Y A;  4WVF B;  1FHX A;  2ELB A;  2I1J A;  4CHJ A;  1ISN A;  2DYQ A;  4A6K A;  1ZM0 A;  5LOP B;  2RUK B;  3PVU A;  5FI1 A;  4KHA A;  1X1G A;  1BAK A;  4GPT B;  1FHW A;  3BJI A;  2Z0P A;  4D6W A;  2DHJ A;  4GOU A;  4GNK B;  4HB0 B;  3ODO A;  2ADZ A;  3T06 A;  4ZRK A;  2K49 A;  1V89 A;  3P7Z A;  4F7G A;  1OQN A;  2CAY A;  2PZ1 A;  3DXE A;  5KQ4 A;  2VKI A;  4K2O A;  3ZDT A;  1EGX A;  3QIJ A;  4HAV B;  4K2P A;  4A6F B;  1SGH A;  1U5G A;  2UZS A;  1NU2 A;  2AEH A;  3AJ4 A;  1ZC3 B;  1LB1 A;  4HB3 B;  5DHF B;  5L81 A;  4HAU B;  3A58 A;  2YT0 A;  2LUL A;  2ROV A;  5IRS A;  2MKR A;  2DYN A;  5JHH A;  1TXD A;  3U8Z A;  3A8P A;  1P6S A;  2E2X A;  2KR0 A;  1X1F A;  5C5B B;  4CYE A;  1FB8 A;  2MWN B;  1H10 A;  3TO1 A;  2VRW B;  5HE0 A;  4HAY B;  3A98 B;  4WJ7 A;  3KY9 A;  3PP2 A;  1P3R A;  2YT2 A;  3GYO A;  3M1I B;  1U5F A;  4HHV A;  5D3Y A;  4EJN A;  3DCX A;  4TKN A;  3BIN A;  5KCV A;  3SYX A;  1K5D B;  2RRF A;  3AU5 A;  1V61 A;  1KZG A;  2COC A;  1KZ7 A;  1BTK A;  2VSZ A;  1WG7 A;  1UNQ A;  3N7C A;  1MK7 B;  2XQN M;  2COA A;  5FI0 A;  2Y7B A;  3RCP A;  2L2I A;  4HAX B;  2OTX A;  1Y5O A;  3HIE A;  1PMS A;  4Y94 A;  3A8Q A;  1AWE A;  4IAP A;  2P0F A;  2RNR B;  2H7D A;  3G9W A;  1Z87 A;  4Z2N A;  5C5B A;  2W2W A;  1FHO A;  1ZVR A;  3LJU X;  5I2M A;  1U5E A;  1MKE A;  1EAZ A;  3FEH A;  3MDB C;  1K5G B;  2KIG A;  4HB4 B;  2ROZ B;  5J3Q A;  2N23 A;  4A6H A;  3ULC A;  1I7A A;  2EMS A;  2YS5 A;  4D0N B;  4YON A;  1Q67 A;  3FM8 C;  4WSF A;  2Z0O A;  4F7U P;  3NWD A;  2LOX A;  4EMO A;  5CLL B;  4A6F A;  1ZC4 B;  2QKM A;  1X11 A;  1U5D A;  3SO6 A;  4F7H A;  4EKU A;  2R0D A;  1W1D A;  5GOW B;  1DYN A;  2D2Q A;  4CSQ A;  2G35 A;  3F0W A;  3CXB B;  5M4Y B;  4C0A A;  1H4R A;  1XD4 A;  2Z13 A;  3NWF A;  2D4Q A;  1DBH A;  2I1K A;  5D3V A;  1V5P A;  2Q13 A;  2YS1 A;  2V76 A;  1J19 A;  3KRX A;  2AL6 A;  4NSW A;  3U12 A;  2K2J A;  3ODX A;  2J0J A;  1NTV A;  4DX8 A;  3OHM B;  2KCJ A;  4KAX B;  3FVC A;  2W2X D;  1WJM A;  1TQZ A;  1U27 A;  3PVW A;  2I5C A;  1GC7 A;  3IVF A;  3ULB A;  2CRF A;  5D3X A;  1N3H A;  5LG4 B;  4PQ0 A;  2J0M A;  1FGY A;  1OY2 A;  4DXA B;  2J59 M;  4HAT B;  1PFJ A;  3D8E A;  2HTH B;  3SNH A;  3SV1 A;  2P0H A;  1Y19 B;  2MDX A;  2KGX B;  2FJU B;  5I2S A;  2J0K A;  2Z0Q A;  2KUQ A;  4BBK A;  1DDW A;  1NTY A;  5J3T A;  3DXD A;  2D11 A;  2Y8F A;  2MFQ A;  5D3W A;  2D9Z A;  1PLS A;  3UZT A;  4H8S A;  2DX1 A;  2D9V A;  5HE1 A;  3PEG A;  4ZRI A;  2RLO A;  1NI2 A;  1MAI A;  4QXA B;  3TCA A;  2GS0 A;  1RRP B;  3P6A A;  3HW2 B;  2I5F A;  2BCJ A;  4CHM A;  2NZ8 B;  4K17 A;  1MI1 A;  1W1G A;  5HE3 A;  2EJ8 A;  5DI9 B;  4B6H A;  3KSY A;  2D9W A;  4HAW B;  3NWA A;  4MT7 A;  4K81 A;  2DA0 A;  1UNP A;  3TVV A;  2LG1 A;  2D10 A;  4GN1 A;  2M38 A;  4L6E A;  1IRS A;  2Y8G A;  2DKP A;  1MPH A;  5D27 A;  2DHK A;  2M14 A;  1FOE A;  2FJL A;  2UVM A;  1UPR A;  1B55 A;  4ZRJ A;  2K2U A;  3D8F A;  1WI1 A;  2ZPY A;  5DHA B;  2CY5 A;  2RVB B;  4GMX B;  2Z4D A;  3ML4 A;  3PSC A;  2IFS A;  2COF A;  1XX0 A;  3AU4 A;  2LOZ A;  1GC6 A;  3HK0 A;  1X86 A;  1TJ6 A;  2R09 A;  3GYP A;  1WGQ A;  1OMW A;  1U29 A;  4DBB A;  2YS3 A;  2DHI A;  2Z59 A;  2OQB A;  2IYB A;  3D8D A;  1EVH A;  4KHO A;  1X05 A;  1SHC A;  1KI1 B;  3HQC A;  2K00 A;  4DX9 0;  1XR0 B;  2COD A;  4TYZ A;  2ZKM X;  1XCG A;  3OAN A;  4KHB B;  5DH9 B;  1P5T A;  5C6R A;  4A5K A;  3NSU A;  2YT1 A;  3VOQ A;  1QC6 A;  3NW8 A;  1XOD A;  4IOY X;  3QWM A;  5LON B;  3QBV B;  2LYD A;  1DDV A;  3CIK A;  2DN6 A;  4GXB A;  2R2Y A;  1FGZ A;  1FAO A;  2N0Y A;  4IFS A;  1I2H A;  4HDQ A;  3U7D A;  2H7E A;  1UPQ A;  2RSG A;  5DIF B;  4QJ5 B;  2DTC A;  2GUM A;  2L1C A;  1RJ2 A;  3ZVR A;  2ELA A;  4QJ3 B;  2LKO A;  3PZD A;  2X18 A;  3B77 A;  5EFX A;  3X23 A;  4PNK A;  2GCJ A;  1MIX A;  3V5W A;  2P8V A;  1XKE A;  3PVL A;  4L1R A;  2KIE A;  1E5W A;  4KVG B;  5KQ1 A;  1AQC A;  1LW3 A;  2EC1 A;  1J0W A;  2DX5 A;  2GJY A;  5HE2 A;  2NBV A;  3KZ1 A;  4GZU A;  1ZSQ A;  2YRY A;  5JHG A;  1MK9 B;  3FSS A;  1M7E A;  4HB2 B;  2D9X A;  2D9Y A;  3WYF B;  4HSI A;  4GMV A;  4HDO A;  1EF1 A;  1V5U A;  4P7I A;  2HE7 A;  4MY6 A;  1BWN A;  4XWX A;  5JLJ B;  4MK0 A;  2YSZ A;  2NMB A;  4NY0 A;  5CLQ B;  4DIX A;  2JP2 A;  1GG3 A;  5JP4 A;  3VIA A;  1UNR A;  1W1H A;  2GCL A;  3KRW A;  1BTN A;  1WGU A;  4YL8 A;  1ZYI A;  3SUZ A;  2Z14 A;  2RGN B;  3HSA A;  5C16 A;  2P0D A;  2QKL A;  4QJ4 B;  3TW1 A;  2CY4 A;  3MPX A;  4KHB A;  1UEF A;  3O96 A;  1WJ1 A;  1WVH A;  4Z2M B;  1QQG A; 
#chains in the Genus database with same CATH homology
 1U2B A;  1DRO A;  1DDM A;  2DFK A;  3PG7 A;  2EMT A;  1V5M A;  2W2X C;  2YF0 A;  3F5R A;  2KUP A;  3DXC A;  3WA0 A;  2DKQ A;  2UZR A;  4HAZ B;  3TFM A;  2YVC A;  2DLW A;  1M7R A;  1V88 A;  1MIZ B;  5C79 A;  3ODW A;  5J3Y A;  4WVF B;  1FHX A;  2ELB A;  2I1J A;  4CHJ A;  1ISN A;  2DYQ A;  4A6K A;  1ZM0 A;  5LOP B;  2RUK B;  3PVU A;  5FI1 A;  4KHA A;  1X1G A;  1BAK A;  4GPT B;  1FHW A;  3BJI A;  2Z0P A;  2DHJ A;  4HB0 B;  3ODO A;  2ADZ A;  3T06 A;  4ZRK A;  1V89 A;  3P7Z A;  4F7G A;  1OQN A;  2CAY A;  2PZ1 A;  3DXE A;  5KQ4 A;  2VKI A;  4K2O A;  3ZDT A;  1EGX A;  3QIJ A;  4HAV B;  4K2P A;  4A6F B;  1SGH A;  1U5G A;  2UZS A;  1NU2 A;  2AEH A;  3AJ4 A;  1ZC3 B;  1LB1 A;  4HB3 B;  5DHF B;  5L81 A;  4HAU B;  2YT0 A;  2LUL A;  2ROV A;  2MKR A;  2DYN A;  5JHH A;  1TXD A;  3U8Z A;  3A8P A;  1P6S A;  2E2X A;  1X1F A;  5C5B B;  4CYE A;  1FB8 A;  2MWN B;  1H10 A;  3TO1 A;  2VRW B;  5HE0 A;  4HAY B;  3A98 B;  4WJ7 A;  3KY9 A;  3PP2 A;  1P3R A;  3GYO A;  3M1I B;  4HHV A;  1U5F A;  5D3Y A;  4EJN A;  4TKN A;  3BIN A;  5KCV A;  3SYX A;  1K5D B;  3AU5 A;  1V61 A;  1KZG A;  2COC A;  1KZ7 A;  1BTK A;  2VSZ A;  1WG7 A;  1UNQ A;  3N7C A;  1MK7 B;  2XQN M;  2COA A;  5FI0 A;  2Y7B A;  3RCP A;  2L2I A;  4HAX B;  2OTX A;  1Y5O A;  1PMS A;  4Y94 A;  3A8Q A;  1AWE A;  4IAP A;  2P0F A;  2RNR B;  2H7D A;  3G9W A;  1Z87 A;  4Z2N A;  5C5B A;  2W2W A;  1FHO A;  1ZVR A;  3LJU X;  1U5E A;  1MKE A;  1EAZ A;  3FEH A;  3MDB C;  1K5G B;  4HB4 B;  2ROZ B;  5J3Q A;  2N23 A;  4A6H A;  3ULC A;  1I7A A;  2EMS A;  2YS5 A;  4D0N B;  4YON A;  1Q67 A;  3FM8 C;  4WSF A;  2Z0O A;  4F7U P;  2LOX A;  4EMO A;  5CLL B;  4A6F A;  1ZC4 B;  2QKM A;  1X11 A;  1U5D A;  3SO6 A;  4F7H A;  4EKU A;  2R0D A;  1W1D A;  5GOW B;  1DYN A;  2D2Q A;  2G35 A;  3F0W A;  3CXB B;  4C0A A;  1H4R A;  1XD4 A;  2D4Q A;  1DBH A;  2I1K A;  5D3V A;  1V5P A;  2Q13 A;  2YS1 A;  2V76 A;  1J19 A;  3KRX A;  2AL6 A;  4NSW A;  2K2J A;  3ODX A;  2J0J A;  1NTV A;  4DX8 A;  2KCJ A;  4KAX B;  2W2X D;  1WJM A;  1TQZ A;  1U27 A;  3PVW A;  2I5C A;  1GC7 A;  3IVF A;  3ULB A;  2CRF A;  5D3X A;  1N3H A;  4PQ0 A;  2J0M A;  1FGY A;  1OY2 A;  4DXA B;  2J59 M;  4HAT B;  1PFJ A;  3D8E A;  2HTH B;  3SNH A;  3SV1 A;  2P0H A;  1Y19 B;  2MDX A;  2KGX B;  2J0K A;  2Z0Q A;  4BBK A;  1DDW A;  1NTY A;  5J3T A;  3DXD A;  2D11 A;  2Y8F A;  2MFQ A;  5D3W A;  2D9Z A;  1PLS A;  3UZT A;  4H8S A;  2DX1 A;  2D9V A;  5HE1 A;  3PEG A;  4ZRI A;  2RLO A;  1NI2 A;  1MAI A;  3TCA A;  2GS0 A;  1RRP B;  3P6A A;  3HW2 B;  2I5F A;  2BCJ A;  4CHM A;  2NZ8 B;  4K17 A;  1W1G A;  5HE3 A;  2EJ8 A;  5DI9 B;  4B6H A;  3KSY A;  2D9W A;  4HAW B;  4MT7 A;  4K81 A;  2DA0 A;  1UNP A;  3TVV A;  2LG1 A;  2D10 A;  4GN1 A;  2M38 A;  4L6E A;  1IRS A;  2Y8G A;  2DKP A;  1MPH A;  5D27 A;  2DHK A;  2M14 A;  1FOE A;  2FJL A;  2UVM A;  1UPR A;  1B55 A;  4ZRJ A;  2K2U A;  3D8F A;  1WI1 A;  2ZPY A;  5DHA B;  2CY5 A;  2RVB B;  4GMX B;  3ML4 A;  3PSC A;  2IFS A;  2COF A;  1XX0 A;  3AU4 A;  2LOZ A;  1GC6 A;  3HK0 A;  1X86 A;  1TJ6 A;  2R09 A;  3GYP A;  1WGQ A;  1OMW A;  1U29 A;  4DBB A;  2YS3 A;  2DHI A;  2OQB A;  2IYB A;  3D8D A;  1EVH A;  4KHO A;  1X05 A;  1SHC A;  1KI1 B;  3HQC A;  2K00 A;  4DX9 0;  1XR0 B;  2COD A;  4TYZ A;  1XCG A;  3OAN A;  4KHB B;  5DH9 B;  1P5T A;  5C6R A;  4A5K A;  3NSU A;  2YT1 A;  3VOQ A;  1QC6 A;  4IOY X;  1XOD A;  3QWM A;  5LON B;  3QBV B;  2LYD A;  1DDV A;  3CIK A;  2DN6 A;  4GXB A;  1FGZ A;  1FAO A;  2N0Y A;  4IFS A;  1I2H A;  4HDQ A;  3U7D A;  2H7E A;  1UPQ A;  2RSG A;  5DIF B;  2DTC A;  2L1C A;  1RJ2 A;  3ZVR A;  2ELA A;  2LKO A;  3PZD A;  2X18 A;  5EFX A;  3X23 A;  4PNK A;  2GCJ A;  1MIX A;  3V5W A;  2P8V A;  1XKE A;  3PVL A;  5KQ1 A;  1E5W A;  4KVG B;  1AQC A;  1LW3 A;  2EC1 A;  1J0W A;  2DX5 A;  2GJY A;  5HE2 A;  3KZ1 A;  4GZU A;  1ZSQ A;  2YRY A;  5JHG A;  1MK9 B;  3FSS A;  1M7E A;  4HB2 B;  2D9X A;  2D9Y A;  3WYF B;  4GMV A;  4HDO A;  1EF1 A;  1V5U A;  4P7I A;  2HE7 A;  4MY6 A;  1BWN A;  4XWX A;  5JLJ B;  4MK0 A;  2YSZ A;  2NMB A;  4NY0 A;  5CLQ B;  2JP2 A;  1GG3 A;  5JP4 A;  3VIA A;  1UNR A;  1W1H A;  2GCL A;  3KRW A;  1BTN A;  1WGU A;  4YL8 A;  3SUZ A;  2RGN B;  5C16 A;  2P0D A;  2QKL A;  3TW1 A;  2CY4 A;  3MPX A;  1UEF A;  3O96 A;  1WJ1 A;  1WVH A;  4Z2M B;  1QQG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...