4A6KA

Crystal structure of slm1-ph domain in complex with d-myo-inositol-4- phosphate
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
119
structure length
110
Chain Sequence
DHPFTEIKSGFLERRSKFLKSYSKGYYVLTPNFLHEFKTADRKKDLVPVMSLALSECTVTEHSRKNSDAKFVLHAKQNGIIRRGHNWVFKADSYESMMSWFDNLKILTST
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords PHOSPHATIDYLINOSITOL 4,5-BISPHOSPHATE-BINDING PROTEIN SLM1
publication title Structural Analyses of Slm1-Ph Domain Demonstrate Ligand Binding in the Non-Canonical Site
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Signaling protein
total genus 24
structure length 110
sequence length 119
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2011-11-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00169 PH PH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 4a6kA00
1QQGA 4NSWA 1UNQA 3M1IB 2D9YA 2YRYA 1KZGA 3PEGA 3WA0A 2YS1A 3A8PA 1KZ7A 5HE3A 1XODA 3ML4A 2W2XC 2I1JA 2DHIA 4EMOA 5JHGA 2J0MA 2YF0A 5C79A 5DHAB 4EKUA 2RUKB 1H10A 2M38A 4HATB 1J0WA 1X1FA 2V76A 1NTVA 2D10A 4BBKA 1LW3A 1X86A 1TQZA 1WJMA 1DDVA 3ULBA 5CLLB 1U5FA 2J59M 2RLOA 4CYEA 4ZRJA 5LONB 1PLSA 2ROVA 3GYOA 2FJLA 2D9ZA 2IYBA 3AU4A 1GG3A 3D8FA 2KUPA 1B55A 1WGQA 4A6FA 3P7ZA 1U27A 2UZRA 1H4RA 4C0AA 3KRXA 2MKRA 2CY5A 1Y5OA 2H7DA 2J0KA 3QIJA 3AJ4A 3TCAA 1ZVRA 2K2JA 1DDMA 1BWNA 2BCJA 1MAIA 4KVGB 1WVHA 2M14A 3DXDA 4F7GA 5DH9B 2AEHA 2CODA 2UZSA 2ELAA 3D8EA 4KHBB 3HK0A 3KSYA 4GZUA 4K2PA 1AQCA 2COCA 4XWXA 4K81A 2GCJA 4H8SA 2G35A 2YVCA 5HE2A 1FB8A 2XQNM 1EVHA 4HDOA 3PSCA 4TKNA 4P7IA 2R09A 2K00A 2QKLA 1WJ1A 3SYXA 2DX1A 1K5GB 2W2WA 4HHVA 2Y8GA 2LKOA 2Y7BA 1MPHA 2EMSA 4DX8A 4DBBA 3PP2A 3SNHA 1W1DA 4HB3B 2DX5A 4WJ7A 4L6EA 1P3RA 3KZ1A 4HB2B 4A6KA 1WG7A 1PMSA 1M7EA 3A98B 2I5FA 1J19A 2ADZA 2HTHB 2YT0A 4MT7A 2PZ1A 2N0YA 2D2QA 4GXBA 3BINA 2I1KA 1V61A 1MK7B 2EMTA 3FEHA 1RJ2A 1SHCA 3ULCA 3UZTA 3QBVB 2R0DA 5KQ4A 4HAZB 4F7UP 1ZC3B 3AU5A 2UVMA 3D8DA 3X23A 2MDXA 4EJNA 2YSZA 2X18A 2DN6A 4YONA 1Y19B 1FAOA 2VSZA 3PVUA 1UPQA 2RSGA 1AWEA 3CXBB 1DBHA 3U8ZA 3TO1A 1X05A 1EGXA 1RRPB 3SO6A 3A8QA 4HAWB 2LYDA 4HB4B 2L1CA 2D9WA 2JP2A 1ZC4B 4MK0A 1WGUA 4YL8A 3PG7A 1N3HA 3BJIA 1NU2A 5C5BA 1XCGA 5D3YA 4HAVB 4B6HA 1FHOA 1P5TA 3FM8C 5KQ1A 2Q13A 5J3YA 3F0WA 3MDBC 1IRSA 5L81A 1FOEA 2P0HA 2D11A 2YT1A 1BTKA 2LULA 2IFSA 2HE7A 1MK9B 5C5BB 1FHWA 1QC6A 1NTYA 2MFQA 1BAKA 5FI0A 2RNRB 2VKIA 4GMXB 5DI9B 2GS0A 2L2IA 1FGYA 1Z87A 3OANA 5EFXA 1KI1B 1OQNA 1X11A 1GC6A 4A5KA 3KY9A 5JHHA 4PNKA 1U5EA 3FSSA 2NZ8B 3ODOA 4NY0A 5CLQB 1OY2A 1MIZB 4HDQA 3SV1A 2LOXA 3PVWA 3GYPA 1PFJA 2AL6A 2DKPA 3LJUX 2Z0PA 4K2OA 5J3QA 4Y94A 2ROZB 1V5MA 3F5RA 1W1HA 2KCJA 5DIFB 4A6HA 1E5WA 4HB0B 3KRWA 3IVFA 2ELBA 2CRFA 1K5DB 1UNRA 1TXDA 2EJ8A 2RGNB 2D4QA 5LOPB 5J3TA 4GPTB 2EC1A 4DXAB 2DTCA 1XX0A 2J0JA 3MPXA 1P6SA 1XD4A 4IFSA 2MWNB 4KAXB 2COAA 1X1GA 4GMVA 2CY4A 4CHJA 2E2XA 4ZRKA 4CHMA 4PQ0A 3DXEA 2DYNA 1XR0B 5KCVA 2DFKA 4HAXB 1V5PA 5D3VA 2GCLA 2Z0QA 2H7EA 4HAUB 1V88A 3N7CA 2QKMA 3WYFB 5D3WA 5FI1A 2DLWA 2ZPYA 1OMWA 1U29A 2D9XA 2LG1A 3P6AA 2OTXA 3ZVRA 3ODWA 2LOZA 5C16A 1MKEA 2D9VA 5DHFB 5JP4A 1I2HA 3ZDTA 1DDWA 5D3XA 5HE0A 2P8VA 3DXCA 2NMBA 3V5WA 3RCPA 1GC7A 1BTNA 5D27A 1UEFA 4TYZA 5JLJB 1UPRA 2GJYA 2Y8FA 1WI1A 3TVVA 2P0FA 1V89A 5GOWB 2DKQA 2K2UA 1EAZA 4A6FB 2DA0A 3SUZA 4Z2NA 5HE1A 2YS3A 2DHKA 3HW2B 4DX90 2RVBB 1FHXA 1U5GA 2VRWB 3TFMA 4IOYX 4K17A 1NI2A 4Z2MB 4D0NB 1U5DA 2N23A 1ISNA 4WVFB 4GN1A 2I5CA 1ZSQA 3VOQA 2CAYA 2KGXB 4KHOA 3PZDA 1XKEA 3O96A 4F7HA 3G9WA 5C6RA 3TW1A 1TJ6A 3ODXA 1Q67A 3HQCA 4MY6A 3PVLA 1M7RA 4WSFA 3U7DA 1LB1A 3NSUA 1I7AA 2YS5A 4HAYB 3QWMA 2P0DA 2DHJA 1U2BA 1MIXA 2COFA 2Z0OA 4ZRIA 1DYNA 1V5UA 3VIAA 4IAPA 2DYQA 1DROA 1FGZA 2W2XD 1ZM0A 3CIKA 1EF1A 2OQBA 4KHAA 3T06A 1UNPA 1W1GA 1SGHA
chains in the Genus database with same CATH superfamily
4OT1A 1QQGA 4NSWA 1UNQA 3M1IB 2D9YA 2YRYA 1KZGA 3PEGA 3WA0A 2YS1A 3A8PA 1KZ7A 5HE3A 1XODA 3ML4A 2YT2A 2W2XC 2I1JA 2DHIA 4EMOA 5JHGA 2J0MA 2YF0A 5C79A 5DHAB 4EKUA 2RUKB 1H10A 2M38A 4HATB 1J0WA 1X1FA 2V76A 1NTVA 2D10A 4BBKA 1LW3A 1X86A 1TQZA 1WJMA 1DDVA 3ULBA 5CLLB 1U5FA 2J59M 2RLOA 4CYEA 4ZRJA 5LONB 1PLSA 2ROVA 3GYOA 3HIEA 2FJLA 2D9ZA 2IYBA 4QJ3B 3AU4A 1GG3A 2ZKMX 3D8FA 2KUPA 1B55A 1WGQA 4A6FA 3P7ZA 1U27A 2UZRA 1H4RA 4C0AA 3KRXA 2MKRA 2CY5A 1Y5OA 2H7DA 2J0KA 3QIJA 3AJ4A 4KHBA 3TCAA 1ZVRA 2K2JA 1DDMA 1BWNA 2Z59A 2BCJA 2K49A 1MAIA 3U12A 4KVGB 1WVHA 2M14A 1ZYIA 3DXDA 4F7GA 5DH9B 2AEHA 2CODA 2UZSA 2ELAA 3D8EA 4KHBB 3HK0A 3KSYA 4GZUA 4K2PA 1AQCA 2COCA 2KIEA 4XWXA 4K81A 2GCJA 4H8SA 2G35A 2YVCA 5HE2A 3FVCA 1FB8A 2XQNM 1EVHA 4HDOA 3PSCA 4TKNA 4P7IA 5M4YB 2Z4DA 2R09A 2K00A 2QKLA 2Z14A 1WJ1A 3SYXA 2DX1A 1K5GB 2W2WA 2Z13A 4HHVA 2Y8GA 2LKOA 2Y7BA 1MPHA 2EMSA 4DX8A 4DBBA 3PP2A 3SNHA 1W1DA 4HB3B 2DX5A 4WJ7A 4L6EA 2K8EA 1P3RA 3KZ1A 4HB2B 4A6KA 1WG7A 1PMSA 3HSAA 3NWFA 1M7EA 3A98B 2I5FA 1J19A 2ADZA 2HTHB 5LG4B 4QXAB 2YT0A 4MT7A 2PZ1A 2N0YA 2D2QA 4GXBA 3BINA 2I1KA 1V61A 1MK7B 2EMTA 3FEHA 1RJ2A 1SHCA 3ULCA 2KUQA 3UZTA 3QBVB 2R0DA 5KQ4A 4HAZB 4F7UP 1ZC3B 3AU5A 2UVMA 3D8DA 3X23A 2MDXA 4EJNA 2YSZA 2X18A 2DN6A 4YONA 1Y19B 1FAOA 2VSZA 3PVUA 1UPQA 2RSGA 1AWEA 3CXBB 1DBHA 3U8ZA 3TO1A 1X05A 1EGXA 1RRPB 3A58A 3SO6A 3A8QA 4HAWB 2LYDA 4HB4B 2L1CA 2D9WA 2JP2A 1ZC4B 2NBVA 1WGUA 4MK0A 4YL8A 3PG7A 1N3HA 3BJIA 1NU2A 5C5BA 1XCGA 5D3YA 4HAVB 4B6HA 1FHOA 1P5TA 3FM8C 5KQ1A 2Q13A 5J3YA 3F0WA 3MDBC 5IRSA 1IRSA 5L81A 1FOEA 2P0HA 2D11A 2YT1A 2GUMA 1BTKA 2LULA 2IFSA 2HE7A 1MK9B 5C5BB 1FHWA 1QC6A 1NTYA 2MFQA 1BAKA 5FI0A 2RNRB 2VKIA 4GMXB 5DI9B 2GS0A 2L2IA 1FGYA 1Z87A 3OANA 5EFXA 1KI1B 1OQNA 5I2SA 1X11A 1GC6A 4A5KA 3KY9A 5JHHA 4PNKA 4L1RA 1U5EA 3FSSA 2NZ8B 3ODOA 4NY0A 5CLQB 1OY2A 1MIZB 4HDQA 4OSNA 3SV1A 2LOXA 3PVWA 3GYPA 1PFJA 2AL6A 2DKPA 3LJUX 2Z0PA 4K2OA 5J3QA 4Y94A 2ROZB 1V5MA 3NWDA 3F5RA 3OHMB 1W1HA 4HSIA 1T77A 2KCJA 5DIFB 4A6HA 4QJ5B 1E5WA 2KR0A 4HB0B 3KRWA 3IVFA 2ELBA 2CRFA 1K5DB 1UNRA 1TXDA 2EJ8A 2FJUB 2RGNB 3NW8A 2D4QA 5LOPB 5J3TA 4GPTB 2EC1A 4D6WA 4DXAB 2DTCA 1XX0A 2J0JA 3MPXA 1P6SA 1XD4A 4IFSA 2MWNB 4KAXB 3NWAA 2COAA 1X1GA 4GMVA 3B77A 2CY4A 4CHJA 2E2XA 4ZRKA 4CHMA 4PQ0A 3DXEA 2DYNA 1XR0B 5KCVA 2DFKA 4HAXB 4CSQA 1V5PA 5D3VA 2GCLA 2Z0QA 2H7EA 2KIGA 4HAUB 1V88A 3N7CA 2QKMA 3WYFB 5D3WA 1MI1A 4GNKB 5FI1A 2DLWA 2ZPYA 1OMWA 1U29A 2D9XA 2LG1A 3P6AA 2OTXA 3ZVRA 3ODWA 2LOZA 5C16A 1MKEA 2D9VA 5DHFB 5JP4A 1I2HA 3ZDTA 1DDWA 5D3XA 5HE0A 2P8VA 3DXCA 2NMBA 3V5WA 3RCPA 1GC7A 1BTNA 5D27A 1UEFA 4TYZA 5JLJB 1UPRA 2GJYA 2Y8FA 1WI1A 3TVVA 2P0FA 1V89A 5GOWB 2DKQA 2K2UA 1EAZA 4GOUA 4A6FB 2DA0A 3SUZA 4Z2NA 5HE1A 2YS3A 2DHKA 3DCXA 3HW2B 4DX90 4DIXA 2RVBB 1FHXA 1U5GA 2VRWB 3TFMA 4IOYX 4K17A 1NI2A 4Z2MB 4D0NB 1U5DA 2N23A 1ISNA 4WVFB 4GN1A 2I5CA 1ZSQA 3VOQA 2CAYA 2KGXB 4KHOA 3PZDA 1XKEA 3O96A 4F7HA 3G9WA 5C6RA 3TW1A 1TJ6A 3ODXA 1Q67A 3HQCA 4MY6A 3PVLA 1M7RA 4QJ4B 4WSFA 3U7DA 1LB1A 2R2YA 3NSUA 1I7AA 2YS5A 4HAYB 3QWMA 2RRFA 2P0DA 2DHJA 1U2BA 1MIXA 5I2MA 2COFA 2Z0OA 4ZRIA 1DYNA 1V5UA 3VIAA 4IAPA 2DYQA 1DROA 1FGZA 2W2XD 1ZM0A 3CIKA 1EF1A 2OQBA 4KHAA 3T06A 1UNPA 1W1GA 1SGHA
chains in the Genus database with same CATH topology
1QQGA 4NSWA 1UNQA 3M1IB 2D9YA 2YRYA 1KZGA 3PEGA 3WA0A 2YS1A 3A8PA 1KZ7A 5HE3A 1XODA 3ML4A 2W2XC 2I1JA 2DHIA 4EMOA 5JHGA 2J0MA 2YF0A 5C79A 5DHAB 4EKUA 2RUKB 1H10A 2M38A 4HATB 1J0WA 1X1FA 2V76A 1NTVA 2D10A 4BBKA 1LW3A 1X86A 1TQZA 1WJMA 1DDVA 3ULBA 5CLLB 1U5FA 2J59M 2RLOA 4CYEA 4ZRJA 5LONB 1PLSA 2ROVA 3GYOA 2FJLA 2D9ZA 2IYBA 3AU4A 1GG3A 3D8FA 2KUPA 1B55A 1WGQA 4A6FA 3P7ZA 1U27A 2UZRA 1H4RA 4C0AA 3KRXA 2MKRA 2CY5A 1Y5OA 2H7DA 2J0KA 3QIJA 3AJ4A 3TCAA 1ZVRA 2K2JA 1DDMA 1BWNA 2BCJA 1MAIA 4KVGB 1WVHA 2M14A 3DXDA 4F7GA 5DH9B 2AEHA 2CODA 2UZSA 2ELAA 3D8EA 4KHBB 3HK0A 3KSYA 4GZUA 4K2PA 1AQCA 2COCA 4XWXA 4K81A 2GCJA 4H8SA 2G35A 2YVCA 5HE2A 1FB8A 2XQNM 1EVHA 4HDOA 3PSCA 4TKNA 4P7IA 2R09A 2K00A 2QKLA 1WJ1A 3SYXA 2DX1A 1K5GB 2W2WA 4HHVA 2Y8GA 2LKOA 2Y7BA 1MPHA 2EMSA 4DX8A 4DBBA 3PP2A 3SNHA 1W1DA 4HB3B 2DX5A 4WJ7A 4L6EA 1P3RA 3KZ1A 4HB2B 4A6KA 1WG7A 1PMSA 1M7EA 3A98B 2I5FA 1J19A 2ADZA 2HTHB 2YT0A 4MT7A 2PZ1A 2N0YA 2D2QA 4GXBA 3BINA 2I1KA 1V61A 1MK7B 2EMTA 3FEHA 1RJ2A 1SHCA 3ULCA 3UZTA 3QBVB 2R0DA 5KQ4A 4HAZB 4F7UP 1ZC3B 3AU5A 2UVMA 3D8DA 3X23A 2MDXA 4EJNA 2YSZA 2X18A 2DN6A 4YONA 1Y19B 1FAOA 2VSZA 3PVUA 1UPQA 2RSGA 1AWEA 3CXBB 1DBHA 3U8ZA 3TO1A 1X05A 1EGXA 1RRPB 3SO6A 3A8QA 4HAWB 2LYDA 4HB4B 2L1CA 2D9WA 2JP2A 1ZC4B 4MK0A 1WGUA 4YL8A 3PG7A 1N3HA 3BJIA 1NU2A 5C5BA 1XCGA 5D3YA 4HAVB 4B6HA 1FHOA 1P5TA 3FM8C 5KQ1A 2Q13A 5J3YA 3F0WA 3MDBC 1IRSA 5L81A 1FOEA 2P0HA 2D11A 2YT1A 1BTKA 2LULA 2IFSA 2HE7A 1MK9B 5C5BB 1FHWA 1QC6A 1NTYA 2MFQA 1BAKA 5FI0A 2RNRB 2VKIA 4GMXB 5DI9B 2GS0A 2L2IA 1FGYA 1Z87A 3OANA 5EFXA 1KI1B 1OQNA 1X11A 1GC6A 4A5KA 3KY9A 5JHHA 4PNKA 1U5EA 3FSSA 2NZ8B 3ODOA 4NY0A 5CLQB 1OY2A 1MIZB 4HDQA 3SV1A 2LOXA 3PVWA 3GYPA 1PFJA 2AL6A 2DKPA 3LJUX 2Z0PA 4K2OA 5J3QA 4Y94A 2ROZB 1V5MA 3F5RA 1W1HA 2KCJA 5DIFB 4A6HA 1E5WA 4HB0B 3KRWA 3IVFA 2ELBA 2CRFA 1K5DB 1UNRA 1TXDA 2EJ8A 2RGNB 2D4QA 5LOPB 5J3TA 4GPTB 2EC1A 4DXAB 2DTCA 1XX0A 2J0JA 3MPXA 1P6SA 1XD4A 4IFSA 2MWNB 4KAXB 2COAA 1X1GA 4GMVA 2CY4A 4CHJA 2E2XA 4ZRKA 4CHMA 4PQ0A 3DXEA 2DYNA 1XR0B 5KCVA 2DFKA 4HAXB 1V5PA 5D3VA 2GCLA 2Z0QA 2H7EA 4HAUB 1V88A 3N7CA 2QKMA 3WYFB 5D3WA 5FI1A 2DLWA 2ZPYA 1OMWA 1U29A 2D9XA 2LG1A 3P6AA 2OTXA 3ZVRA 3ODWA 2LOZA 5C16A 1MKEA 2D9VA 5DHFB 5JP4A 1I2HA 3ZDTA 1DDWA 5D3XA 5HE0A 2P8VA 3DXCA 2NMBA 3V5WA 3RCPA 1GC7A 1BTNA 5D27A 1UEFA 4TYZA 5JLJB 1UPRA 2GJYA 2Y8FA 1WI1A 3TVVA 2P0FA 1V89A 5GOWB 2DKQA 2K2UA 1EAZA 4A6FB 2DA0A 3SUZA 4Z2NA 5HE1A 2YS3A 2DHKA 3HW2B 4DX90 2RVBB 1FHXA 1U5GA 2VRWB 3TFMA 4IOYX 4K17A 1NI2A 4Z2MB 4D0NB 1U5DA 2N23A 1ISNA 4WVFB 4GN1A 2I5CA 1ZSQA 3VOQA 2CAYA 2KGXB 4KHOA 3PZDA 1XKEA 3O96A 4F7HA 3G9WA 5C6RA 3TW1A 1TJ6A 3ODXA 1Q67A 3HQCA 4MY6A 3PVLA 1M7RA 4WSFA 3U7DA 1LB1A 3NSUA 1I7AA 2YS5A 4HAYB 3QWMA 2P0DA 2DHJA 1U2BA 1MIXA 2COFA 2Z0OA 4ZRIA 1DYNA 1V5UA 3VIAA 4IAPA 2DYQA 1DROA 1FGZA 2W2XD 1ZM0A 3CIKA 1EF1A 2OQBA 4KHAA 3T06A 1UNPA 1W1GA 1SGHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QQG A;  4NSW A;  1UNQ A;  3M1I B;  2D9Y A;  2YRY A;  1KZG A;  3PEG A;  3WA0 A;  2YS1 A;  3A8P A;  1KZ7 A;  5HE3 A;  1XOD A;  3ML4 A;  2W2X C;  2I1J A;  2DHI A;  4EMO A;  5JHG A;  2J0M A;  2YF0 A;  5C79 A;  5DHA B;  4EKU A;  2RUK B;  1H10 A;  2M38 A;  4HAT B;  1J0W A;  1X1F A;  2V76 A;  1NTV A;  2D10 A;  4BBK A;  1LW3 A;  1X86 A;  1TQZ A;  1WJM A;  1DDV A;  3ULB A;  5CLL B;  1U5F A;  2J59 M;  2RLO A;  4CYE A;  4ZRJ A;  5LON B;  1PLS A;  2ROV A;  3GYO A;  2FJL A;  2D9Z A;  2IYB A;  3AU4 A;  1GG3 A;  3D8F A;  2KUP A;  1B55 A;  1WGQ A;  4A6F A;  3P7Z A;  1U27 A;  2UZR A;  1H4R A;  4C0A A;  3KRX A;  2MKR A;  2CY5 A;  1Y5O A;  2H7D A;  2J0K A;  3QIJ A;  3AJ4 A;  3TCA A;  1ZVR A;  2K2J A;  1DDM A;  1BWN A;  2BCJ A;  1MAI A;  4KVG B;  1WVH A;  2M14 A;  3DXD A;  4F7G A;  5DH9 B;  2AEH A;  2COD A;  2UZS A;  2ELA A;  3D8E A;  4KHB B;  3HK0 A;  3KSY A;  4GZU A;  4K2P A;  1AQC A;  2COC A;  4XWX A;  4K81 A;  2GCJ A;  4H8S A;  2G35 A;  2YVC A;  5HE2 A;  1FB8 A;  2XQN M;  1EVH A;  4HDO A;  3PSC A;  4TKN A;  4P7I A;  2R09 A;  2K00 A;  2QKL A;  1WJ1 A;  3SYX A;  2DX1 A;  1K5G B;  2W2W A;  4HHV A;  2Y8G A;  2LKO A;  2Y7B A;  1MPH A;  2EMS A;  4DX8 A;  4DBB A;  3PP2 A;  3SNH A;  1W1D A;  4HB3 B;  2DX5 A;  4WJ7 A;  4L6E A;  1P3R A;  3KZ1 A;  4HB2 B;  4A6K A;  1WG7 A;  1PMS A;  1M7E A;  3A98 B;  2I5F A;  1J19 A;  2ADZ A;  2HTH B;  2YT0 A;  4MT7 A;  2PZ1 A;  2N0Y A;  2D2Q A;  4GXB A;  3BIN A;  2I1K A;  1V61 A;  1MK7 B;  2EMT A;  3FEH A;  1RJ2 A;  1SHC A;  3ULC A;  3UZT A;  3QBV B;  2R0D A;  5KQ4 A;  4HAZ B;  4F7U P;  1ZC3 B;  3AU5 A;  2UVM A;  3D8D A;  3X23 A;  2MDX A;  4EJN A;  2YSZ A;  2X18 A;  2DN6 A;  4YON A;  1Y19 B;  1FAO A;  2VSZ A;  3PVU A;  1UPQ A;  2RSG A;  1AWE A;  3CXB B;  1DBH A;  3U8Z A;  3TO1 A;  1X05 A;  1EGX A;  1RRP B;  3SO6 A;  3A8Q A;  4HAW B;  2LYD A;  4HB4 B;  2L1C A;  2D9W A;  2JP2 A;  1ZC4 B;  4MK0 A;  1WGU A;  4YL8 A;  3PG7 A;  1N3H A;  3BJI A;  1NU2 A;  5C5B A;  1XCG A;  5D3Y A;  4HAV B;  4B6H A;  1FHO A;  1P5T A;  3FM8 C;  5KQ1 A;  2Q13 A;  5J3Y A;  3F0W A;  3MDB C;  1IRS A;  5L81 A;  1FOE A;  2P0H A;  2D11 A;  2YT1 A;  1BTK A;  2LUL A;  2IFS A;  2HE7 A;  1MK9 B;  5C5B B;  1FHW A;  1QC6 A;  1NTY A;  2MFQ A;  1BAK A;  5FI0 A;  2RNR B;  2VKI A;  4GMX B;  5DI9 B;  2GS0 A;  2L2I A;  1FGY A;  1Z87 A;  3OAN A;  5EFX A;  1KI1 B;  1OQN A;  1X11 A;  1GC6 A;  4A5K A;  3KY9 A;  5JHH A;  4PNK A;  1U5E A;  3FSS A;  2NZ8 B;  3ODO A;  4NY0 A;  5CLQ B;  1OY2 A;  1MIZ B;  4HDQ A;  3SV1 A;  2LOX A;  3PVW A;  3GYP A;  1PFJ A;  2AL6 A;  2DKP A;  3LJU X;  2Z0P A;  4K2O A;  5J3Q A;  4Y94 A;  2ROZ B;  1V5M A;  3F5R A;  1W1H A;  2KCJ A;  5DIF B;  4A6H A;  1E5W A;  4HB0 B;  3KRW A;  3IVF A;  2ELB A;  2CRF A;  1K5D B;  1UNR A;  1TXD A;  2EJ8 A;  2RGN B;  2D4Q A;  5LOP B;  5J3T A;  4GPT B;  2EC1 A;  4DXA B;  2DTC A;  1XX0 A;  2J0J A;  3MPX A;  1P6S A;  1XD4 A;  4IFS A;  2MWN B;  4KAX B;  2COA A;  1X1G A;  4GMV A;  2CY4 A;  4CHJ A;  2E2X A;  4ZRK A;  4CHM A;  4PQ0 A;  3DXE A;  2DYN A;  1XR0 B;  5KCV A;  2DFK A;  4HAX B;  1V5P A;  5D3V A;  2GCL A;  2Z0Q A;  2H7E A;  4HAU B;  1V88 A;  3N7C A;  2QKM A;  3WYF B;  5D3W A;  5FI1 A;  2DLW A;  2ZPY A;  1OMW A;  1U29 A;  2D9X A;  2LG1 A;  3P6A A;  2OTX A;  3ZVR A;  3ODW A;  2LOZ A;  5C16 A;  1MKE A;  2D9V A;  5DHF B;  5JP4 A;  1I2H A;  3ZDT A;  1DDW A;  5D3X A;  5HE0 A;  2P8V A;  3DXC A;  2NMB A;  3V5W A;  3RCP A;  1GC7 A;  1BTN A;  5D27 A;  1UEF A;  4TYZ A;  5JLJ B;  1UPR A;  2GJY A;  2Y8F A;  1WI1 A;  3TVV A;  2P0F A;  1V89 A;  5GOW B;  2DKQ A;  2K2U A;  1EAZ A;  4A6F B;  2DA0 A;  3SUZ A;  4Z2N A;  5HE1 A;  2YS3 A;  2DHK A;  3HW2 B;  4DX9 0;  2RVB B;  1FHX A;  1U5G A;  2VRW B;  3TFM A;  4IOY X;  4K17 A;  1NI2 A;  4Z2M B;  4D0N B;  1U5D A;  2N23 A;  1ISN A;  4WVF B;  4GN1 A;  2I5C A;  1ZSQ A;  3VOQ A;  2CAY A;  2KGX B;  4KHO A;  3PZD A;  1XKE A;  3O96 A;  4F7H A;  3G9W A;  5C6R A;  3TW1 A;  1TJ6 A;  3ODX A;  1Q67 A;  3HQC A;  4MY6 A;  3PVL A;  1M7R A;  4WSF A;  3U7D A;  1LB1 A;  3NSU A;  1I7A A;  2YS5 A;  4HAY B;  3QWM A;  2P0D A;  2DHJ A;  1U2B A;  1MIX A;  2COF A;  2Z0O A;  4ZRI A;  1DYN A;  1V5U A;  3VIA A;  4IAP A;  2DYQ A;  1DRO A;  1FGZ A;  2W2X D;  1ZM0 A;  3CIK A;  1EF1 A;  2OQB A;  4KHA A;  3T06 A;  1UNP A;  1W1G A;  1SGH A; 
#chains in the Genus database with same CATH topology
 4OT1 A;  1QQG A;  4NSW A;  1UNQ A;  3M1I B;  2D9Y A;  2YRY A;  1KZG A;  3PEG A;  3WA0 A;  2YS1 A;  3A8P A;  1KZ7 A;  5HE3 A;  1XOD A;  3ML4 A;  2YT2 A;  2W2X C;  2I1J A;  2DHI A;  4EMO A;  5JHG A;  2J0M A;  2YF0 A;  5C79 A;  5DHA B;  4EKU A;  2RUK B;  1H10 A;  2M38 A;  4HAT B;  1J0W A;  1X1F A;  2V76 A;  1NTV A;  2D10 A;  4BBK A;  1LW3 A;  1X86 A;  1TQZ A;  1WJM A;  1DDV A;  3ULB A;  5CLL B;  1U5F A;  2J59 M;  2RLO A;  4CYE A;  4ZRJ A;  5LON B;  1PLS A;  2ROV A;  3GYO A;  3HIE A;  2FJL A;  2D9Z A;  2IYB A;  4QJ3 B;  3AU4 A;  1GG3 A;  2ZKM X;  3D8F A;  2KUP A;  1B55 A;  1WGQ A;  4A6F A;  3P7Z A;  1U27 A;  2UZR A;  1H4R A;  4C0A A;  3KRX A;  2MKR A;  2CY5 A;  1Y5O A;  2H7D A;  2J0K A;  3QIJ A;  3AJ4 A;  4KHB A;  3TCA A;  1ZVR A;  2K2J A;  1DDM A;  1BWN A;  2Z59 A;  2BCJ A;  2K49 A;  1MAI A;  3U12 A;  4KVG B;  1WVH A;  2M14 A;  1ZYI A;  3DXD A;  4F7G A;  5DH9 B;  2AEH A;  2COD A;  2UZS A;  2ELA A;  3D8E A;  4KHB B;  3HK0 A;  3KSY A;  4GZU A;  4K2P A;  1AQC A;  2COC A;  2KIE A;  4XWX A;  4K81 A;  2GCJ A;  4H8S A;  2G35 A;  2YVC A;  5HE2 A;  3FVC A;  1FB8 A;  2XQN M;  1EVH A;  4HDO A;  3PSC A;  4TKN A;  4P7I A;  5M4Y B;  2Z4D A;  2R09 A;  2K00 A;  2QKL A;  2Z14 A;  1WJ1 A;  3SYX A;  2DX1 A;  1K5G B;  2W2W A;  2Z13 A;  4HHV A;  2Y8G A;  2LKO A;  2Y7B A;  1MPH A;  2EMS A;  4DX8 A;  4DBB A;  3PP2 A;  3SNH A;  1W1D A;  4HB3 B;  2DX5 A;  4WJ7 A;  4L6E A;  2K8E A;  1P3R A;  3KZ1 A;  4HB2 B;  4A6K A;  1WG7 A;  1PMS A;  3HSA A;  3NWF A;  1M7E A;  3A98 B;  2I5F A;  1J19 A;  2ADZ A;  2HTH B;  5LG4 B;  4QXA B;  2YT0 A;  4MT7 A;  2PZ1 A;  2N0Y A;  2D2Q A;  4GXB A;  3BIN A;  2I1K A;  1V61 A;  1MK7 B;  2EMT A;  3FEH A;  1RJ2 A;  1SHC A;  3ULC A;  2KUQ A;  3UZT A;  3QBV B;  2R0D A;  5KQ4 A;  4HAZ B;  4F7U P;  1ZC3 B;  3AU5 A;  2UVM A;  3D8D A;  3X23 A;  2MDX A;  4EJN A;  2YSZ A;  2X18 A;  2DN6 A;  4YON A;  1Y19 B;  1FAO A;  2VSZ A;  3PVU A;  1UPQ A;  2RSG A;  1AWE A;  3CXB B;  1DBH A;  3U8Z A;  3TO1 A;  1X05 A;  1EGX A;  1RRP B;  3A58 A;  3SO6 A;  3A8Q A;  4HAW B;  2LYD A;  4HB4 B;  2L1C A;  2D9W A;  2JP2 A;  1ZC4 B;  2NBV A;  1WGU A;  4MK0 A;  4YL8 A;  3PG7 A;  1N3H A;  3BJI A;  1NU2 A;  5C5B A;  1XCG A;  5D3Y A;  4HAV B;  4B6H A;  1FHO A;  1P5T A;  3FM8 C;  5KQ1 A;  2Q13 A;  5J3Y A;  3F0W A;  3MDB C;  5IRS A;  1IRS A;  5L81 A;  1FOE A;  2P0H A;  2D11 A;  2YT1 A;  2GUM A;  1BTK A;  2LUL A;  2IFS A;  2HE7 A;  1MK9 B;  5C5B B;  1FHW A;  1QC6 A;  1NTY A;  2MFQ A;  1BAK A;  5FI0 A;  2RNR B;  2VKI A;  4GMX B;  5DI9 B;  2GS0 A;  2L2I A;  1FGY A;  1Z87 A;  3OAN A;  5EFX A;  1KI1 B;  1OQN A;  5I2S A;  1X11 A;  1GC6 A;  4A5K A;  3KY9 A;  5JHH A;  4PNK A;  4L1R A;  1U5E A;  3FSS A;  2NZ8 B;  3ODO A;  4NY0 A;  5CLQ B;  1OY2 A;  1MIZ B;  4HDQ A;  4OSN A;  3SV1 A;  2LOX A;  3PVW A;  3GYP A;  1PFJ A;  2AL6 A;  2DKP A;  3LJU X;  2Z0P A;  4K2O A;  5J3Q A;  4Y94 A;  2ROZ B;  1V5M A;  3NWD A;  3F5R A;  3OHM B;  1W1H A;  4HSI A;  1T77 A;  2KCJ A;  5DIF B;  4A6H A;  4QJ5 B;  1E5W A;  2KR0 A;  4HB0 B;  3KRW A;  3IVF A;  2ELB A;  2CRF A;  1K5D B;  1UNR A;  1TXD A;  2EJ8 A;  2FJU B;  2RGN B;  3NW8 A;  2D4Q A;  5LOP B;  5J3T A;  4GPT B;  2EC1 A;  4D6W A;  4DXA B;  2DTC A;  1XX0 A;  2J0J A;  3MPX A;  1P6S A;  1XD4 A;  4IFS A;  2MWN B;  4KAX B;  3NWA A;  2COA A;  1X1G A;  4GMV A;  3B77 A;  2CY4 A;  4CHJ A;  2E2X A;  4ZRK A;  4CHM A;  4PQ0 A;  3DXE A;  2DYN A;  1XR0 B;  5KCV A;  2DFK A;  4HAX B;  4CSQ A;  1V5P A;  5D3V A;  2GCL A;  2Z0Q A;  2H7E A;  2KIG A;  4HAU B;  1V88 A;  3N7C A;  2QKM A;  3WYF B;  5D3W A;  1MI1 A;  4GNK B;  5FI1 A;  2DLW A;  2ZPY A;  1OMW A;  1U29 A;  2D9X A;  2LG1 A;  3P6A A;  2OTX A;  3ZVR A;  3ODW A;  2LOZ A;  5C16 A;  1MKE A;  2D9V A;  5DHF B;  5JP4 A;  1I2H A;  3ZDT A;  1DDW A;  5D3X A;  5HE0 A;  2P8V A;  3DXC A;  2NMB A;  3V5W A;  3RCP A;  1GC7 A;  1BTN A;  5D27 A;  1UEF A;  4TYZ A;  5JLJ B;  1UPR A;  2GJY A;  2Y8F A;  1WI1 A;  3TVV A;  2P0F A;  1V89 A;  5GOW B;  2DKQ A;  2K2U A;  1EAZ A;  4GOU A;  4A6F B;  2DA0 A;  3SUZ A;  4Z2N A;  5HE1 A;  2YS3 A;  2DHK A;  3DCX A;  3HW2 B;  4DX9 0;  4DIX A;  2RVB B;  1FHX A;  1U5G A;  2VRW B;  3TFM A;  4IOY X;  4K17 A;  1NI2 A;  4Z2M B;  4D0N B;  1U5D A;  2N23 A;  1ISN A;  4WVF B;  4GN1 A;  2I5C A;  1ZSQ A;  3VOQ A;  2CAY A;  2KGX B;  4KHO A;  3PZD A;  1XKE A;  3O96 A;  4F7H A;  3G9W A;  5C6R A;  3TW1 A;  1TJ6 A;  3ODX A;  1Q67 A;  3HQC A;  4MY6 A;  3PVL A;  1M7R A;  4QJ4 B;  4WSF A;  3U7D A;  1LB1 A;  2R2Y A;  3NSU A;  1I7A A;  2YS5 A;  4HAY B;  3QWM A;  2RRF A;  2P0D A;  2DHJ A;  1U2B A;  1MIX A;  5I2M A;  2COF A;  2Z0O A;  4ZRI A;  1DYN A;  1V5U A;  3VIA A;  4IAP A;  2DYQ A;  1DRO A;  1FGZ A;  2W2X D;  1ZM0 A;  3CIK A;  1EF1 A;  2OQB A;  4KHA A;  3T06 A;  1UNP A;  1W1G A;  1SGH A; 
#chains in the Genus database with same CATH homology
 1QQG A;  4NSW A;  1UNQ A;  3M1I B;  2D9Y A;  2YRY A;  1KZG A;  3PEG A;  3WA0 A;  2YS1 A;  3A8P A;  1KZ7 A;  5HE3 A;  1XOD A;  3ML4 A;  2W2X C;  2I1J A;  2DHI A;  4EMO A;  5JHG A;  2J0M A;  2YF0 A;  5C79 A;  5DHA B;  4EKU A;  2RUK B;  1H10 A;  2M38 A;  4HAT B;  1J0W A;  1X1F A;  2V76 A;  1NTV A;  2D10 A;  4BBK A;  1LW3 A;  1X86 A;  1TQZ A;  1WJM A;  1DDV A;  3ULB A;  5CLL B;  1U5F A;  2J59 M;  2RLO A;  4CYE A;  4ZRJ A;  5LON B;  1PLS A;  2ROV A;  3GYO A;  2FJL A;  2D9Z A;  2IYB A;  3AU4 A;  1GG3 A;  3D8F A;  2KUP A;  1B55 A;  1WGQ A;  4A6F A;  3P7Z A;  1U27 A;  2UZR A;  1H4R A;  4C0A A;  3KRX A;  2MKR A;  2CY5 A;  1Y5O A;  2H7D A;  2J0K A;  3QIJ A;  3AJ4 A;  3TCA A;  1ZVR A;  2K2J A;  1DDM A;  1BWN A;  2BCJ A;  1MAI A;  4KVG B;  1WVH A;  2M14 A;  3DXD A;  4F7G A;  5DH9 B;  2AEH A;  2COD A;  2UZS A;  2ELA A;  3D8E A;  4KHB B;  3HK0 A;  3KSY A;  4GZU A;  4K2P A;  1AQC A;  2COC A;  4XWX A;  4K81 A;  2GCJ A;  4H8S A;  2G35 A;  2YVC A;  5HE2 A;  1FB8 A;  2XQN M;  1EVH A;  4HDO A;  3PSC A;  4TKN A;  4P7I A;  2R09 A;  2K00 A;  2QKL A;  1WJ1 A;  3SYX A;  2DX1 A;  1K5G B;  2W2W A;  4HHV A;  2Y8G A;  2LKO A;  2Y7B A;  1MPH A;  2EMS A;  4DX8 A;  4DBB A;  3PP2 A;  3SNH A;  1W1D A;  4HB3 B;  2DX5 A;  4WJ7 A;  4L6E A;  1P3R A;  3KZ1 A;  4HB2 B;  4A6K A;  1WG7 A;  1PMS A;  1M7E A;  3A98 B;  2I5F A;  1J19 A;  2ADZ A;  2HTH B;  2YT0 A;  4MT7 A;  2PZ1 A;  2N0Y A;  2D2Q A;  4GXB A;  3BIN A;  2I1K A;  1V61 A;  1MK7 B;  2EMT A;  3FEH A;  1RJ2 A;  1SHC A;  3ULC A;  3UZT A;  3QBV B;  2R0D A;  5KQ4 A;  4HAZ B;  4F7U P;  1ZC3 B;  3AU5 A;  2UVM A;  3D8D A;  3X23 A;  2MDX A;  4EJN A;  2YSZ A;  2X18 A;  2DN6 A;  4YON A;  1Y19 B;  1FAO A;  2VSZ A;  3PVU A;  1UPQ A;  2RSG A;  1AWE A;  3CXB B;  1DBH A;  3U8Z A;  3TO1 A;  1X05 A;  1EGX A;  1RRP B;  3SO6 A;  3A8Q A;  4HAW B;  2LYD A;  4HB4 B;  2L1C A;  2D9W A;  2JP2 A;  1ZC4 B;  4MK0 A;  1WGU A;  4YL8 A;  3PG7 A;  1N3H A;  3BJI A;  1NU2 A;  5C5B A;  1XCG A;  5D3Y A;  4HAV B;  4B6H A;  1FHO A;  1P5T A;  3FM8 C;  5KQ1 A;  2Q13 A;  5J3Y A;  3F0W A;  3MDB C;  1IRS A;  5L81 A;  1FOE A;  2P0H A;  2D11 A;  2YT1 A;  1BTK A;  2LUL A;  2IFS A;  2HE7 A;  1MK9 B;  5C5B B;  1FHW A;  1QC6 A;  1NTY A;  2MFQ A;  1BAK A;  5FI0 A;  2RNR B;  2VKI A;  4GMX B;  5DI9 B;  2GS0 A;  2L2I A;  1FGY A;  1Z87 A;  3OAN A;  5EFX A;  1KI1 B;  1OQN A;  1X11 A;  1GC6 A;  4A5K A;  3KY9 A;  5JHH A;  4PNK A;  1U5E A;  3FSS A;  2NZ8 B;  3ODO A;  4NY0 A;  5CLQ B;  1OY2 A;  1MIZ B;  4HDQ A;  3SV1 A;  2LOX A;  3PVW A;  3GYP A;  1PFJ A;  2AL6 A;  2DKP A;  3LJU X;  2Z0P A;  4K2O A;  5J3Q A;  4Y94 A;  2ROZ B;  1V5M A;  3F5R A;  1W1H A;  2KCJ A;  5DIF B;  4A6H A;  1E5W A;  4HB0 B;  3KRW A;  3IVF A;  2ELB A;  2CRF A;  1K5D B;  1UNR A;  1TXD A;  2EJ8 A;  2RGN B;  2D4Q A;  5LOP B;  5J3T A;  4GPT B;  2EC1 A;  4DXA B;  2DTC A;  1XX0 A;  2J0J A;  3MPX A;  1P6S A;  1XD4 A;  4IFS A;  2MWN B;  4KAX B;  2COA A;  1X1G A;  4GMV A;  2CY4 A;  4CHJ A;  2E2X A;  4ZRK A;  4CHM A;  4PQ0 A;  3DXE A;  2DYN A;  1XR0 B;  5KCV A;  2DFK A;  4HAX B;  1V5P A;  5D3V A;  2GCL A;  2Z0Q A;  2H7E A;  4HAU B;  1V88 A;  3N7C A;  2QKM A;  3WYF B;  5D3W A;  5FI1 A;  2DLW A;  2ZPY A;  1OMW A;  1U29 A;  2D9X A;  2LG1 A;  3P6A A;  2OTX A;  3ZVR A;  3ODW A;  2LOZ A;  5C16 A;  1MKE A;  2D9V A;  5DHF B;  5JP4 A;  1I2H A;  3ZDT A;  1DDW A;  5D3X A;  5HE0 A;  2P8V A;  3DXC A;  2NMB A;  3V5W A;  3RCP A;  1GC7 A;  1BTN A;  5D27 A;  1UEF A;  4TYZ A;  5JLJ B;  1UPR A;  2GJY A;  2Y8F A;  1WI1 A;  3TVV A;  2P0F A;  1V89 A;  5GOW B;  2DKQ A;  2K2U A;  1EAZ A;  4A6F B;  2DA0 A;  3SUZ A;  4Z2N A;  5HE1 A;  2YS3 A;  2DHK A;  3HW2 B;  4DX9 0;  2RVB B;  1FHX A;  1U5G A;  2VRW B;  3TFM A;  4IOY X;  4K17 A;  1NI2 A;  4Z2M B;  4D0N B;  1U5D A;  2N23 A;  1ISN A;  4WVF B;  4GN1 A;  2I5C A;  1ZSQ A;  3VOQ A;  2CAY A;  2KGX B;  4KHO A;  3PZD A;  1XKE A;  3O96 A;  4F7H A;  3G9W A;  5C6R A;  3TW1 A;  1TJ6 A;  3ODX A;  1Q67 A;  3HQC A;  4MY6 A;  3PVL A;  1M7R A;  4WSF A;  3U7D A;  1LB1 A;  3NSU A;  1I7A A;  2YS5 A;  4HAY B;  3QWM A;  2P0D A;  2DHJ A;  1U2B A;  1MIX A;  2COF A;  2Z0O A;  4ZRI A;  1DYN A;  1V5U A;  3VIA A;  4IAP A;  2DYQ A;  1DRO A;  1FGZ A;  2W2X D;  1ZM0 A;  3CIK A;  1EF1 A;  2OQB A;  4KHA A;  3T06 A;  1UNP A;  1W1G A;  1SGH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...