4A6KA

Crystal structure of slm1-ph domain in complex with d-myo-inositol-4- phosphate
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
119
structure length
110
Chain Sequence
DHPFTEIKSGFLERRSKFLKSYSKGYYVLTPNFLHEFKTADRKKDLVPVMSLALSECTVTEHSRKNSDAKFVLHAKQNGIIRRGHNWVFKADSYESMMSWFDNLKILTST
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural Analyses of Slm1-Ph Domain Demonstrate Ligand Binding in the Non-Canonical Site
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Signaling protein
molecule keywords PHOSPHATIDYLINOSITOL 4,5-BISPHOSPHATE-BINDING PROTEIN SLM1
total genus 24
structure length 110
sequence length 119
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2011-11-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00169 PH PH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 4a6kA00
2M14A 1AQCA 1EGXA 2DHKA 2AEHA 2LG1A 1H10A 2J59M 1BWNA 3QBVB 3WYFB 2KCJA 2D9WA 1P6SA 2GCJA 4HAZB 4Y94A 1U5FA 1W1DA 1DYNA 3PVUA 4GN1A 2P0FA 2VSZA 1FHXA 2D4QA 5DH9B 1SGHA 2W2XC 4GMVA 2EJ8A 2HTHB 1GG3A 1H4RA 1XX0A 2R09A 1LW3A 2PZ1A 1WJ1A 4HDQA 3A8PA 4P7IA 1Y19B 2CAYA 1P3RA 3SV1A 5D3VA 3VIAA 4HHVA 4TKNA 2D2QA 2Z0QA 2QKMA 3M1IB 1UPQA 4GPTB 1FHWA 3FM8C 2YS5A 5HE1A 2W2XD 1ZC4B 5C5BA 2KUPA 4EKUA 5LOPB 2CY4A 3F0WA 2L1CA 2D9ZA 2CY5A 3F5RA 2K00A 1FHOA 2M38A 2I5FA 1NI2A 4HAYB 5DHFB 1BAKA 2CODA 1UNRA 1DDMA 1WGQA 2DHIA 3U8ZA 4TYZA 1BTKA 2CRFA 1ZSQA 5KCVA 4K17A 3ZVRA 4MK0A 5L81A 1EVHA 2YS3A 2UVMA 3DXCA 3ML4A 3P7ZA 2GS0A 4GZUA 3AU4A 5HE3A 1M7EA 2P0DA 4DX90 5HE2A 1MPHA 1FB8A 3D8FA 4WJ7A 3PP2A 5JP4A 3TW1A 1PMSA 5J3YA 5JHHA 4XWXA 1TJ6A 1OQNA 1WVHA 2J0KA 4HB3B 3T06A 2VRWB 2EMSA 3SNHA 2V76A 1XODA 1UNPA 3SUZA 2I1JA 2LULA 2R0DA 4F7HA 2LKOA 3CIKA 2MKRA 3HK0A 4Z2NA 1ISNA 1OY2A 4A6FB 4L6EA 3QWMA 2D9XA 4HAUB 3PG7A 4ZRIA 3UZTA 3FEHA 5C6RA 2YS1A 2JP2A 2E2XA 2I1KA 4K2OA 1V5PA 1UNQA 3QIJA 2DYNA 3ODWA 2MWNB 2AL6A 1UEFA 1WG7A 2IFSA 2GCLA 1XR0B 2KGXB 4H8SA 5D3XA 4WSFA 2GJYA 4KAXB 5D3YA 1X1FA 1EF1A 1V5UA 1DROA 4YL8A 2DX1A 2RUKB 1TXDA 5LONB 4EMOA 1ZM0A 1V61A 2XQNM 4EJNA 1U27A 4KHOA 1KI1B 4DBBA 2D9YA 4IAPA 2YRYA 4HB4B 3TO1A 4ZRKA 2ADZA 1U5GA 1Q67A 1XD4A 3KSYA 3G9WA 5C5BB 3GYOA 4A5KA 1U2BA 5C79A 1MK9B 2MFQA 1J0WA 4IFSA 1DBHA 4PNKA 4D0NB 3ULCA 3MDBC 1Z87A 4HB2B 2YVCA 4KHAA 1X11A 3A98B 4HAWB 2DYQA 2J0MA 1W1GA 4ZRJA 1EAZA 1Y5OA 3KRXA 5C16A 2MDXA 3ODXA 2ROZB 1W1HA 2ZPYA 2N0YA 2OQBA 2DHJA 2NMBA 2Q13A 4WVFB 5FI1A 4B6HA 1K5GB 1J19A 2DKPA 1B55A 1E5WA 2J0JA 3TCAA 4F7UP 2K2UA 3PZDA 1MIXA 3SO6A 3FSSA 4BBKA 4KHBB 2DX5A 2I5CA 1U5DA 2RLOA 1AWEA 2RSGA 5DHAB 5J3QA 2HE7A 1FOEA 3SYXA 2COAA 1QQGA 3KY9A 3TVVA 3TFMA 2DN6A 3AJ4A 3AU5A 2EC1A 1NTVA 5KQ1A 1I7AA 5DIFB 1TQZA 1WJMA 4HDOA 1UPRA 1U29A 3N7CA 4CHMA 2D9VA 1FAOA 2P8VA 2ROVA 5D3WA 3X23A 1U5EA 1IRSA 2X18A 1PLSA 3ZDTA 1X1GA 4CYEA 4NSWA 2Z0OA 5HE0A 1FGZA 1ZVRA 4YONA 2H7DA 3BINA 5JLJB 3DXDA 1N3HA 5D27A 2DTCA 1FGYA 2G35A 2UZSA 2RVBB 2W2WA 4HAVB 4F7GA 3KRWA 1KZGA 1XCGA 2FJLA 2UZRA 4MY6A 1XKEA 4A6KA 1OMWA 2OTXA 3P6AA 3ODOA 4Z2MB 3CXBB 1P5TA 2BCJA 1ZC3B 1V5MA 3DXEA 1GC7A 2Y8FA 2YF0A 1MKEA 4DX8A 1KZ7A 2N23A 1MK7B 4K81A 1QC6A 1X86A 3RCPA 5KQ4A 3LJUX 3V5WA 4KVGB 1GC6A 2ELBA 1DDVA 2LOXA 2D10A 1BTNA 4HAXB 2L2IA 3KZ1A 2P0HA 1I2HA 3D8EA 1NTYA 2YT1A 5GOWB 2QKLA 4K2PA 2DLWA 3VOQA 3MPXA 2VKIA 1WGUA 1RJ2A 1NU2A 4C0AA 5CLLB 4NY0A 1DDWA 1X05A 2EMTA 2Y8GA 5CLQB 3BJIA 4IOYX 4MT7A 3PEGA 1WI1A 2RNRB 3U7DA 3A8QA 2Z0PA 3HW2B 2IYBA 2YT0A 2YSZA 2K2JA 2LOZA 3IVFA 3NSUA 3PVWA 5FI0A 3O96A 1SHCA 2DFKA 3D8DA 3OANA 2ELAA 1PFJA 4GMXB 4DXAB 2Y7BA 2COFA 3PVLA 2DKQA 4GXBA 2DA0A 1MAIA 3GYPA 1MIZB 5DI9B 2H7EA 4HB0B 2D11A 1V88A 2NZ8B 3WA0A 3HQCA 4PQ0A 4A6HA 5J3TA 4HATB 1M7RA 5EFXA 1V89A 4CHJA 2LYDA 5JHGA 3PSCA 1RRPB 2RGNB 4A6FA 3ULBA 1K5DB 2COCA 1LB1A
chains in the Genus database with same CATH superfamily
1MI1A 2M14A 1AQCA 1EGXA 2DHKA 5M4YB 2AEHA 3OHMB 2LG1A 1H10A 2J59M 1BWNA 3QBVB 3WYFB 2KCJA 2D9WA 4D6WA 2Z4DA 1P6SA 2GCJA 4HAZB 4Y94A 1U5FA 1W1DA 1DYNA 3PVUA 4GN1A 2P0FA 2VSZA 1FHXA 2D4QA 3NWDA 5DH9B 1SGHA 2Z14A 2W2XC 4GMVA 4QJ4B 2EJ8A 2HTHB 1GG3A 1H4RA 1XX0A 2R09A 1LW3A 2PZ1A 1WJ1A 4HDQA 3A8PA 4P7IA 1Y19B 2CAYA 1P3RA 3SV1A 5D3VA 3VIAA 4HHVA 4TKNA 2D2QA 3NWFA 2Z0QA 2QKMA 3M1IB 1UPQA 4GPTB 4QXAB 1FHWA 3FM8C 2YS5A 5HE1A 2W2XD 1ZC4B 5C5BA 2KUPA 4EKUA 5LOPB 2CY4A 3F0WA 2L1CA 2D9ZA 2CY5A 3F5RA 2K00A 1FHOA 2M38A 2I5FA 1NI2A 4HAYB 5DHFB 1BAKA 2YT2A 2CODA 1UNRA 1DDMA 1WGQA 2DHIA 3U8ZA 4TYZA 4QJ5B 1BTKA 2CRFA 1ZSQA 5KCVA 4K17A 3ZVRA 4MK0A 5L81A 1EVHA 2YS3A 2UVMA 3DXCA 3ML4A 3P7ZA 2GS0A 4GZUA 3AU4A 5HE3A 1M7EA 2P0DA 4DX90 5HE2A 1MPHA 1FB8A 3D8FA 4WJ7A 3PP2A 5JP4A 3TW1A 1PMSA 5J3YA 5JHHA 4XWXA 1TJ6A 1OQNA 1WVHA 2J0KA 4HB3B 3T06A 2VRWB 2EMSA 3SNHA 2V76A 1XODA 4L1RA 1UNPA 3SUZA 2I1JA 5LG4B 2LULA 2R0DA 4F7HA 2LKOA 3CIKA 2MKRA 3HK0A 4Z2NA 1ISNA 1OY2A 4A6FB 4L6EA 3QWMA 2D9XA 4HAUB 3PG7A 4ZRIA 3UZTA 3FEHA 4GOUA 5C6RA 2YS1A 2K49A 2JP2A 2E2XA 4OSNA 2I1KA 4K2OA 1V5PA 1UNQA 3QIJA 2DYNA 3ODWA 2MWNB 3FVCA 2K8EA 2AL6A 4KHBA 1UEFA 1WG7A 2IFSA 2GCLA 4QJ3B 1XR0B 2KGXB 4H8SA 2GUMA 5D3XA 4WSFA 2GJYA 4KAXB 5D3YA 1X1FA 1EF1A 1V5UA 1DROA 4YL8A 2DX1A 2RUKB 1TXDA 5LONB 4EMOA 1ZM0A 1V61A 2XQNM 4EJNA 1U27A 4KHOA 1KI1B 4DBBA 2D9YA 3HSAA 4IAPA 2YRYA 4HB4B 3TO1A 4ZRKA 2KIEA 2ADZA 1U5GA 1Q67A 1XD4A 3KSYA 3G9WA 5C5BB 3GYOA 4A5KA 1U2BA 4HSIA 5C79A 1MK9B 2MFQA 1J0WA 4IFSA 1DBHA 4PNKA 4D0NB 3ULCA 3MDBC 1Z87A 4HB2B 2YVCA 4KHAA 1X11A 3A98B 4HAWB 2DYQA 2J0MA 1W1GA 4ZRJA 1EAZA 1Y5OA 3KRXA 5C16A 2MDXA 3ODXA 2ROZB 1W1HA 2ZPYA 3NW8A 2N0YA 2OQBA 3U12A 2DHJA 2NMBA 2Q13A 4WVFB 5FI1A 4B6HA 5I2SA 1K5GB 5IRSA 1J19A 2DKPA 1B55A 1E5WA 2J0JA 3TCAA 4F7UP 2K2UA 3PZDA 1MIXA 3SO6A 3FSSA 4BBKA 4KHBB 2Z13A 2FJUB 2DX5A 3A58A 2I5CA 1U5DA 2RLOA 4CSQA 1AWEA 2RSGA 5DHAB 5J3QA 2HE7A 1FOEA 2KR0A 2Z59A 3SYXA 2COAA 1QQGA 3KY9A 3TVVA 3TFMA 2DN6A 2KUQA 3AJ4A 3AU5A 2EC1A 1NTVA 5KQ1A 1I7AA 5DIFB 1TQZA 2NBVA 1WJMA 4HDOA 1UPRA 1U29A 3N7CA 4CHMA 2D9VA 1FAOA 2P8VA 2ROVA 5D3WA 3X23A 1U5EA 1IRSA 2X18A 1PLSA 4OT1A 3ZDTA 1X1GA 4CYEA 4NSWA 2Z0OA 5HE0A 1FGZA 1ZVRA 4YONA 2H7DA 3BINA 5JLJB 3DXDA 1N3HA 5D27A 2DTCA 1FGYA 2G35A 2UZSA 2RVBB 2W2WA 4HAVB 4F7GA 3KRWA 1KZGA 1XCGA 2FJLA 2UZRA 4MY6A 1XKEA 4A6KA 1OMWA 2OTXA 3P6AA 3ODOA 4Z2MB 3CXBB 1P5TA 2BCJA 1ZC3B 1V5MA 3DXEA 1GC7A 2Y8FA 2YF0A 2ZKMX 1MKEA 1T77A 4DX8A 1KZ7A 3DCXA 2N23A 1MK7B 4K81A 1QC6A 1X86A 3HIEA 3RCPA 5KQ4A 3LJUX 3V5WA 4KVGB 1GC6A 2ELBA 2KIGA 1DDVA 2LOXA 2D10A 1BTNA 4HAXB 2L2IA 3KZ1A 2P0HA 1I2HA 3D8EA 1NTYA 2YT1A 5GOWB 2QKLA 4K2PA 2DLWA 4GNKB 3VOQA 3MPXA 2VKIA 1WGUA 1RJ2A 1NU2A 4C0AA 5CLLB 4NY0A 1DDWA 1X05A 2EMTA 2Y8GA 5CLQB 3BJIA 4IOYX 4MT7A 3PEGA 1WI1A 2RNRB 3U7DA 3A8QA 2Z0PA 3HW2B 2IYBA 2YT0A 2YSZA 2K2JA 2LOZA 1ZYIA 3IVFA 3NSUA 3NWAA 3PVWA 5FI0A 4DIXA 3O96A 1SHCA 2DFKA 3D8DA 3OANA 2ELAA 1PFJA 4GMXB 4DXAB 2Y7BA 2COFA 3PVLA 2DKQA 4GXBA 2DA0A 1MAIA 3GYPA 1MIZB 5DI9B 2H7EA 4HB0B 2D11A 1V88A 2NZ8B 3WA0A 5I2MA 3HQCA 4PQ0A 4A6HA 5J3TA 4HATB 2RRFA 1M7RA 5EFXA 1V89A 4CHJA 2R2YA 2LYDA 5JHGA 3PSCA 1RRPB 3B77A 2RGNB 4A6FA 3ULBA 1K5DB 2COCA 1LB1A
chains in the Genus database with same CATH topology
2M14A 1AQCA 1EGXA 2DHKA 2AEHA 2LG1A 1H10A 2J59M 1BWNA 3QBVB 3WYFB 2KCJA 2D9WA 1P6SA 2GCJA 4HAZB 4Y94A 1U5FA 1W1DA 1DYNA 3PVUA 4GN1A 2P0FA 2VSZA 1FHXA 2D4QA 5DH9B 1SGHA 2W2XC 4GMVA 2EJ8A 2HTHB 1GG3A 1H4RA 1XX0A 2R09A 1LW3A 2PZ1A 1WJ1A 4HDQA 3A8PA 4P7IA 1Y19B 2CAYA 1P3RA 3SV1A 5D3VA 3VIAA 4HHVA 4TKNA 2D2QA 2Z0QA 2QKMA 3M1IB 1UPQA 4GPTB 1FHWA 3FM8C 2YS5A 5HE1A 2W2XD 1ZC4B 5C5BA 2KUPA 4EKUA 5LOPB 2CY4A 3F0WA 2L1CA 2D9ZA 2CY5A 3F5RA 2K00A 1FHOA 2M38A 2I5FA 1NI2A 4HAYB 5DHFB 1BAKA 2CODA 1UNRA 1DDMA 1WGQA 2DHIA 3U8ZA 4TYZA 1BTKA 2CRFA 1ZSQA 5KCVA 4K17A 3ZVRA 4MK0A 5L81A 1EVHA 2YS3A 2UVMA 3DXCA 3ML4A 3P7ZA 2GS0A 4GZUA 3AU4A 5HE3A 1M7EA 2P0DA 4DX90 5HE2A 1MPHA 1FB8A 3D8FA 4WJ7A 3PP2A 5JP4A 3TW1A 1PMSA 5J3YA 5JHHA 4XWXA 1TJ6A 1OQNA 1WVHA 2J0KA 4HB3B 3T06A 2VRWB 2EMSA 3SNHA 2V76A 1XODA 1UNPA 3SUZA 2I1JA 2LULA 2R0DA 4F7HA 2LKOA 3CIKA 2MKRA 3HK0A 4Z2NA 1ISNA 1OY2A 4A6FB 4L6EA 3QWMA 2D9XA 4HAUB 3PG7A 4ZRIA 3UZTA 3FEHA 5C6RA 2YS1A 2JP2A 2E2XA 2I1KA 4K2OA 1V5PA 1UNQA 3QIJA 2DYNA 3ODWA 2MWNB 2AL6A 1UEFA 1WG7A 2IFSA 2GCLA 1XR0B 2KGXB 4H8SA 5D3XA 4WSFA 2GJYA 4KAXB 5D3YA 1X1FA 1EF1A 1V5UA 1DROA 4YL8A 2DX1A 2RUKB 1TXDA 5LONB 4EMOA 1ZM0A 1V61A 2XQNM 4EJNA 1U27A 4KHOA 1KI1B 4DBBA 2D9YA 4IAPA 2YRYA 4HB4B 3TO1A 4ZRKA 2ADZA 1U5GA 1Q67A 1XD4A 3KSYA 3G9WA 5C5BB 3GYOA 4A5KA 1U2BA 5C79A 1MK9B 2MFQA 1J0WA 4IFSA 1DBHA 4PNKA 4D0NB 3ULCA 3MDBC 1Z87A 4HB2B 2YVCA 4KHAA 1X11A 3A98B 4HAWB 2DYQA 2J0MA 1W1GA 4ZRJA 1EAZA 1Y5OA 3KRXA 5C16A 2MDXA 3ODXA 2ROZB 1W1HA 2ZPYA 2N0YA 2OQBA 2DHJA 2NMBA 2Q13A 4WVFB 5FI1A 4B6HA 1K5GB 1J19A 2DKPA 1B55A 1E5WA 2J0JA 3TCAA 4F7UP 2K2UA 3PZDA 1MIXA 3SO6A 3FSSA 4BBKA 4KHBB 2DX5A 2I5CA 1U5DA 2RLOA 1AWEA 2RSGA 5DHAB 5J3QA 2HE7A 1FOEA 3SYXA 2COAA 1QQGA 3KY9A 3TVVA 3TFMA 2DN6A 3AJ4A 3AU5A 2EC1A 1NTVA 5KQ1A 1I7AA 5DIFB 1TQZA 1WJMA 4HDOA 1UPRA 1U29A 3N7CA 4CHMA 2D9VA 1FAOA 2P8VA 2ROVA 5D3WA 3X23A 1U5EA 1IRSA 2X18A 1PLSA 3ZDTA 1X1GA 4CYEA 4NSWA 2Z0OA 5HE0A 1FGZA 1ZVRA 4YONA 2H7DA 3BINA 5JLJB 3DXDA 1N3HA 5D27A 2DTCA 1FGYA 2G35A 2UZSA 2RVBB 2W2WA 4HAVB 4F7GA 3KRWA 1KZGA 1XCGA 2FJLA 2UZRA 4MY6A 1XKEA 4A6KA 1OMWA 2OTXA 3P6AA 3ODOA 4Z2MB 3CXBB 1P5TA 2BCJA 1ZC3B 1V5MA 3DXEA 1GC7A 2Y8FA 2YF0A 1MKEA 4DX8A 1KZ7A 2N23A 1MK7B 4K81A 1QC6A 1X86A 3RCPA 5KQ4A 3LJUX 3V5WA 4KVGB 1GC6A 2ELBA 1DDVA 2LOXA 2D10A 1BTNA 4HAXB 2L2IA 3KZ1A 2P0HA 1I2HA 3D8EA 1NTYA 2YT1A 5GOWB 2QKLA 4K2PA 2DLWA 3VOQA 3MPXA 2VKIA 1WGUA 1RJ2A 1NU2A 4C0AA 5CLLB 4NY0A 1DDWA 1X05A 2EMTA 2Y8GA 5CLQB 3BJIA 4IOYX 4MT7A 3PEGA 1WI1A 2RNRB 3U7DA 3A8QA 2Z0PA 3HW2B 2IYBA 2YT0A 2YSZA 2K2JA 2LOZA 3IVFA 3NSUA 3PVWA 5FI0A 3O96A 1SHCA 2DFKA 3D8DA 3OANA 2ELAA 1PFJA 4GMXB 4DXAB 2Y7BA 2COFA 3PVLA 2DKQA 4GXBA 2DA0A 1MAIA 3GYPA 1MIZB 5DI9B 2H7EA 4HB0B 2D11A 1V88A 2NZ8B 3WA0A 3HQCA 4PQ0A 4A6HA 5J3TA 4HATB 1M7RA 5EFXA 1V89A 4CHJA 2LYDA 5JHGA 3PSCA 1RRPB 2RGNB 4A6FA 3ULBA 1K5DB 2COCA 1LB1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2M14 A;  1AQC A;  1EGX A;  2DHK A;  2AEH A;  2LG1 A;  1H10 A;  2J59 M;  1BWN A;  3QBV B;  3WYF B;  2KCJ A;  2D9W A;  1P6S A;  2GCJ A;  4HAZ B;  4Y94 A;  1U5F A;  1W1D A;  1DYN A;  3PVU A;  4GN1 A;  2P0F A;  2VSZ A;  1FHX A;  2D4Q A;  5DH9 B;  1SGH A;  2W2X C;  4GMV A;  2EJ8 A;  2HTH B;  1GG3 A;  1H4R A;  1XX0 A;  2R09 A;  1LW3 A;  2PZ1 A;  1WJ1 A;  4HDQ A;  3A8P A;  4P7I A;  1Y19 B;  2CAY A;  1P3R A;  3SV1 A;  5D3V A;  3VIA A;  4HHV A;  4TKN A;  2D2Q A;  2Z0Q A;  2QKM A;  3M1I B;  1UPQ A;  4GPT B;  1FHW A;  3FM8 C;  2YS5 A;  5HE1 A;  2W2X D;  1ZC4 B;  5C5B A;  2KUP A;  4EKU A;  5LOP B;  2CY4 A;  3F0W A;  2L1C A;  2D9Z A;  2CY5 A;  3F5R A;  2K00 A;  1FHO A;  2M38 A;  2I5F A;  1NI2 A;  4HAY B;  5DHF B;  1BAK A;  2COD A;  1UNR A;  1DDM A;  1WGQ A;  2DHI A;  3U8Z A;  4TYZ A;  1BTK A;  2CRF A;  1ZSQ A;  5KCV A;  4K17 A;  3ZVR A;  4MK0 A;  5L81 A;  1EVH A;  2YS3 A;  2UVM A;  3DXC A;  3ML4 A;  3P7Z A;  2GS0 A;  4GZU A;  3AU4 A;  5HE3 A;  1M7E A;  2P0D A;  4DX9 0;  5HE2 A;  1MPH A;  1FB8 A;  3D8F A;  4WJ7 A;  3PP2 A;  5JP4 A;  3TW1 A;  1PMS A;  5J3Y A;  5JHH A;  4XWX A;  1TJ6 A;  1OQN A;  1WVH A;  2J0K A;  4HB3 B;  3T06 A;  2VRW B;  2EMS A;  3SNH A;  2V76 A;  1XOD A;  1UNP A;  3SUZ A;  2I1J A;  2LUL A;  2R0D A;  4F7H A;  2LKO A;  3CIK A;  2MKR A;  3HK0 A;  4Z2N A;  1ISN A;  1OY2 A;  4A6F B;  4L6E A;  3QWM A;  2D9X A;  4HAU B;  3PG7 A;  4ZRI A;  3UZT A;  3FEH A;  5C6R A;  2YS1 A;  2JP2 A;  2E2X A;  2I1K A;  4K2O A;  1V5P A;  1UNQ A;  3QIJ A;  2DYN A;  3ODW A;  2MWN B;  2AL6 A;  1UEF A;  1WG7 A;  2IFS A;  2GCL A;  1XR0 B;  2KGX B;  4H8S A;  5D3X A;  4WSF A;  2GJY A;  4KAX B;  5D3Y A;  1X1F A;  1EF1 A;  1V5U A;  1DRO A;  4YL8 A;  2DX1 A;  2RUK B;  1TXD A;  5LON B;  4EMO A;  1ZM0 A;  1V61 A;  2XQN M;  4EJN A;  1U27 A;  4KHO A;  1KI1 B;  4DBB A;  2D9Y A;  4IAP A;  2YRY A;  4HB4 B;  3TO1 A;  4ZRK A;  2ADZ A;  1U5G A;  1Q67 A;  1XD4 A;  3KSY A;  3G9W A;  5C5B B;  3GYO A;  4A5K A;  1U2B A;  5C79 A;  1MK9 B;  2MFQ A;  1J0W A;  4IFS A;  1DBH A;  4PNK A;  4D0N B;  3ULC A;  3MDB C;  1Z87 A;  4HB2 B;  2YVC A;  4KHA A;  1X11 A;  3A98 B;  4HAW B;  2DYQ A;  2J0M A;  1W1G A;  4ZRJ A;  1EAZ A;  1Y5O A;  3KRX A;  5C16 A;  2MDX A;  3ODX A;  2ROZ B;  1W1H A;  2ZPY A;  2N0Y A;  2OQB A;  2DHJ A;  2NMB A;  2Q13 A;  4WVF B;  5FI1 A;  4B6H A;  1K5G B;  1J19 A;  2DKP A;  1B55 A;  1E5W A;  2J0J A;  3TCA A;  4F7U P;  2K2U A;  3PZD A;  1MIX A;  3SO6 A;  3FSS A;  4BBK A;  4KHB B;  2DX5 A;  2I5C A;  1U5D A;  2RLO A;  1AWE A;  2RSG A;  5DHA B;  5J3Q A;  2HE7 A;  1FOE A;  3SYX A;  2COA A;  1QQG A;  3KY9 A;  3TVV A;  3TFM A;  2DN6 A;  3AJ4 A;  3AU5 A;  2EC1 A;  1NTV A;  5KQ1 A;  1I7A A;  5DIF B;  1TQZ A;  1WJM A;  4HDO A;  1UPR A;  1U29 A;  3N7C A;  4CHM A;  2D9V A;  1FAO A;  2P8V A;  2ROV A;  5D3W A;  3X23 A;  1U5E A;  1IRS A;  2X18 A;  1PLS A;  3ZDT A;  1X1G A;  4CYE A;  4NSW A;  2Z0O A;  5HE0 A;  1FGZ A;  1ZVR A;  4YON A;  2H7D A;  3BIN A;  5JLJ B;  3DXD A;  1N3H A;  5D27 A;  2DTC A;  1FGY A;  2G35 A;  2UZS A;  2RVB B;  2W2W A;  4HAV B;  4F7G A;  3KRW A;  1KZG A;  1XCG A;  2FJL A;  2UZR A;  4MY6 A;  1XKE A;  4A6K A;  1OMW A;  2OTX A;  3P6A A;  3ODO A;  4Z2M B;  3CXB B;  1P5T A;  2BCJ A;  1ZC3 B;  1V5M A;  3DXE A;  1GC7 A;  2Y8F A;  2YF0 A;  1MKE A;  4DX8 A;  1KZ7 A;  2N23 A;  1MK7 B;  4K81 A;  1QC6 A;  1X86 A;  3RCP A;  5KQ4 A;  3LJU X;  3V5W A;  4KVG B;  1GC6 A;  2ELB A;  1DDV A;  2LOX A;  2D10 A;  1BTN A;  4HAX B;  2L2I A;  3KZ1 A;  2P0H A;  1I2H A;  3D8E A;  1NTY A;  2YT1 A;  5GOW B;  2QKL A;  4K2P A;  2DLW A;  3VOQ A;  3MPX A;  2VKI A;  1WGU A;  1RJ2 A;  1NU2 A;  4C0A A;  5CLL B;  4NY0 A;  1DDW A;  1X05 A;  2EMT A;  2Y8G A;  5CLQ B;  3BJI A;  4IOY X;  4MT7 A;  3PEG A;  1WI1 A;  2RNR B;  3U7D A;  3A8Q A;  2Z0P A;  3HW2 B;  2IYB A;  2YT0 A;  2YSZ A;  2K2J A;  2LOZ A;  3IVF A;  3NSU A;  3PVW A;  5FI0 A;  3O96 A;  1SHC A;  2DFK A;  3D8D A;  3OAN A;  2ELA A;  1PFJ A;  4GMX B;  4DXA B;  2Y7B A;  2COF A;  3PVL A;  2DKQ A;  4GXB A;  2DA0 A;  1MAI A;  3GYP A;  1MIZ B;  5DI9 B;  2H7E A;  4HB0 B;  2D11 A;  1V88 A;  2NZ8 B;  3WA0 A;  3HQC A;  4PQ0 A;  4A6H A;  5J3T A;  4HAT B;  1M7R A;  5EFX A;  1V89 A;  4CHJ A;  2LYD A;  5JHG A;  3PSC A;  1RRP B;  2RGN B;  4A6F A;  3ULB A;  1K5D B;  2COC A;  1LB1 A; 
#chains in the Genus database with same CATH topology
 1MI1 A;  2M14 A;  1AQC A;  1EGX A;  2DHK A;  5M4Y B;  2AEH A;  3OHM B;  2LG1 A;  1H10 A;  2J59 M;  1BWN A;  3QBV B;  3WYF B;  2KCJ A;  2D9W A;  4D6W A;  2Z4D A;  1P6S A;  2GCJ A;  4HAZ B;  4Y94 A;  1U5F A;  1W1D A;  1DYN A;  3PVU A;  4GN1 A;  2P0F A;  2VSZ A;  1FHX A;  2D4Q A;  3NWD A;  5DH9 B;  1SGH A;  2Z14 A;  2W2X C;  4GMV A;  4QJ4 B;  2EJ8 A;  2HTH B;  1GG3 A;  1H4R A;  1XX0 A;  2R09 A;  1LW3 A;  2PZ1 A;  1WJ1 A;  4HDQ A;  3A8P A;  4P7I A;  1Y19 B;  2CAY A;  1P3R A;  3SV1 A;  5D3V A;  3VIA A;  4HHV A;  4TKN A;  2D2Q A;  3NWF A;  2Z0Q A;  2QKM A;  3M1I B;  1UPQ A;  4GPT B;  4QXA B;  1FHW A;  3FM8 C;  2YS5 A;  5HE1 A;  2W2X D;  1ZC4 B;  5C5B A;  2KUP A;  4EKU A;  5LOP B;  2CY4 A;  3F0W A;  2L1C A;  2D9Z A;  2CY5 A;  3F5R A;  2K00 A;  1FHO A;  2M38 A;  2I5F A;  1NI2 A;  4HAY B;  5DHF B;  1BAK A;  2YT2 A;  2COD A;  1UNR A;  1DDM A;  1WGQ A;  2DHI A;  3U8Z A;  4TYZ A;  4QJ5 B;  1BTK A;  2CRF A;  1ZSQ A;  5KCV A;  4K17 A;  3ZVR A;  4MK0 A;  5L81 A;  1EVH A;  2YS3 A;  2UVM A;  3DXC A;  3ML4 A;  3P7Z A;  2GS0 A;  4GZU A;  3AU4 A;  5HE3 A;  1M7E A;  2P0D A;  4DX9 0;  5HE2 A;  1MPH A;  1FB8 A;  3D8F A;  4WJ7 A;  3PP2 A;  5JP4 A;  3TW1 A;  1PMS A;  5J3Y A;  5JHH A;  4XWX A;  1TJ6 A;  1OQN A;  1WVH A;  2J0K A;  4HB3 B;  3T06 A;  2VRW B;  2EMS A;  3SNH A;  2V76 A;  1XOD A;  4L1R A;  1UNP A;  3SUZ A;  2I1J A;  5LG4 B;  2LUL A;  2R0D A;  4F7H A;  2LKO A;  3CIK A;  2MKR A;  3HK0 A;  4Z2N A;  1ISN A;  1OY2 A;  4A6F B;  4L6E A;  3QWM A;  2D9X A;  4HAU B;  3PG7 A;  4ZRI A;  3UZT A;  3FEH A;  4GOU A;  5C6R A;  2YS1 A;  2K49 A;  2JP2 A;  2E2X A;  4OSN A;  2I1K A;  4K2O A;  1V5P A;  1UNQ A;  3QIJ A;  2DYN A;  3ODW A;  2MWN B;  3FVC A;  2K8E A;  2AL6 A;  4KHB A;  1UEF A;  1WG7 A;  2IFS A;  2GCL A;  4QJ3 B;  1XR0 B;  2KGX B;  4H8S A;  2GUM A;  5D3X A;  4WSF A;  2GJY A;  4KAX B;  5D3Y A;  1X1F A;  1EF1 A;  1V5U A;  1DRO A;  4YL8 A;  2DX1 A;  2RUK B;  1TXD A;  5LON B;  4EMO A;  1ZM0 A;  1V61 A;  2XQN M;  4EJN A;  1U27 A;  4KHO A;  1KI1 B;  4DBB A;  2D9Y A;  3HSA A;  4IAP A;  2YRY A;  4HB4 B;  3TO1 A;  4ZRK A;  2KIE A;  2ADZ A;  1U5G A;  1Q67 A;  1XD4 A;  3KSY A;  3G9W A;  5C5B B;  3GYO A;  4A5K A;  1U2B A;  4HSI A;  5C79 A;  1MK9 B;  2MFQ A;  1J0W A;  4IFS A;  1DBH A;  4PNK A;  4D0N B;  3ULC A;  3MDB C;  1Z87 A;  4HB2 B;  2YVC A;  4KHA A;  1X11 A;  3A98 B;  4HAW B;  2DYQ A;  2J0M A;  1W1G A;  4ZRJ A;  1EAZ A;  1Y5O A;  3KRX A;  5C16 A;  2MDX A;  3ODX A;  2ROZ B;  1W1H A;  2ZPY A;  3NW8 A;  2N0Y A;  2OQB A;  3U12 A;  2DHJ A;  2NMB A;  2Q13 A;  4WVF B;  5FI1 A;  4B6H A;  5I2S A;  1K5G B;  5IRS A;  1J19 A;  2DKP A;  1B55 A;  1E5W A;  2J0J A;  3TCA A;  4F7U P;  2K2U A;  3PZD A;  1MIX A;  3SO6 A;  3FSS A;  4BBK A;  4KHB B;  2Z13 A;  2FJU B;  2DX5 A;  3A58 A;  2I5C A;  1U5D A;  2RLO A;  4CSQ A;  1AWE A;  2RSG A;  5DHA B;  5J3Q A;  2HE7 A;  1FOE A;  2KR0 A;  2Z59 A;  3SYX A;  2COA A;  1QQG A;  3KY9 A;  3TVV A;  3TFM A;  2DN6 A;  2KUQ A;  3AJ4 A;  3AU5 A;  2EC1 A;  1NTV A;  5KQ1 A;  1I7A A;  5DIF B;  1TQZ A;  2NBV A;  1WJM A;  4HDO A;  1UPR A;  1U29 A;  3N7C A;  4CHM A;  2D9V A;  1FAO A;  2P8V A;  2ROV A;  5D3W A;  3X23 A;  1U5E A;  1IRS A;  2X18 A;  1PLS A;  4OT1 A;  3ZDT A;  1X1G A;  4CYE A;  4NSW A;  2Z0O A;  5HE0 A;  1FGZ A;  1ZVR A;  4YON A;  2H7D A;  3BIN A;  5JLJ B;  3DXD A;  1N3H A;  5D27 A;  2DTC A;  1FGY A;  2G35 A;  2UZS A;  2RVB B;  2W2W A;  4HAV B;  4F7G A;  3KRW A;  1KZG A;  1XCG A;  2FJL A;  2UZR A;  4MY6 A;  1XKE A;  4A6K A;  1OMW A;  2OTX A;  3P6A A;  3ODO A;  4Z2M B;  3CXB B;  1P5T A;  2BCJ A;  1ZC3 B;  1V5M A;  3DXE A;  1GC7 A;  2Y8F A;  2YF0 A;  2ZKM X;  1MKE A;  1T77 A;  4DX8 A;  1KZ7 A;  3DCX A;  2N23 A;  1MK7 B;  4K81 A;  1QC6 A;  1X86 A;  3HIE A;  3RCP A;  5KQ4 A;  3LJU X;  3V5W A;  4KVG B;  1GC6 A;  2ELB A;  2KIG A;  1DDV A;  2LOX A;  2D10 A;  1BTN A;  4HAX B;  2L2I A;  3KZ1 A;  2P0H A;  1I2H A;  3D8E A;  1NTY A;  2YT1 A;  5GOW B;  2QKL A;  4K2P A;  2DLW A;  4GNK B;  3VOQ A;  3MPX A;  2VKI A;  1WGU A;  1RJ2 A;  1NU2 A;  4C0A A;  5CLL B;  4NY0 A;  1DDW A;  1X05 A;  2EMT A;  2Y8G A;  5CLQ B;  3BJI A;  4IOY X;  4MT7 A;  3PEG A;  1WI1 A;  2RNR B;  3U7D A;  3A8Q A;  2Z0P A;  3HW2 B;  2IYB A;  2YT0 A;  2YSZ A;  2K2J A;  2LOZ A;  1ZYI A;  3IVF A;  3NSU A;  3NWA A;  3PVW A;  5FI0 A;  4DIX A;  3O96 A;  1SHC A;  2DFK A;  3D8D A;  3OAN A;  2ELA A;  1PFJ A;  4GMX B;  4DXA B;  2Y7B A;  2COF A;  3PVL A;  2DKQ A;  4GXB A;  2DA0 A;  1MAI A;  3GYP A;  1MIZ B;  5DI9 B;  2H7E A;  4HB0 B;  2D11 A;  1V88 A;  2NZ8 B;  3WA0 A;  5I2M A;  3HQC A;  4PQ0 A;  4A6H A;  5J3T A;  4HAT B;  2RRF A;  1M7R A;  5EFX A;  1V89 A;  4CHJ A;  2R2Y A;  2LYD A;  5JHG A;  3PSC A;  1RRP B;  3B77 A;  2RGN B;  4A6F A;  3ULB A;  1K5D B;  2COC A;  1LB1 A; 
#chains in the Genus database with same CATH homology
 2M14 A;  1AQC A;  1EGX A;  2DHK A;  2AEH A;  2LG1 A;  1H10 A;  2J59 M;  1BWN A;  3QBV B;  3WYF B;  2KCJ A;  2D9W A;  1P6S A;  2GCJ A;  4HAZ B;  4Y94 A;  1U5F A;  1W1D A;  1DYN A;  3PVU A;  4GN1 A;  2P0F A;  2VSZ A;  1FHX A;  2D4Q A;  5DH9 B;  1SGH A;  2W2X C;  4GMV A;  2EJ8 A;  2HTH B;  1GG3 A;  1H4R A;  1XX0 A;  2R09 A;  1LW3 A;  2PZ1 A;  1WJ1 A;  4HDQ A;  3A8P A;  4P7I A;  1Y19 B;  2CAY A;  1P3R A;  3SV1 A;  5D3V A;  3VIA A;  4HHV A;  4TKN A;  2D2Q A;  2Z0Q A;  2QKM A;  3M1I B;  1UPQ A;  4GPT B;  1FHW A;  3FM8 C;  2YS5 A;  5HE1 A;  2W2X D;  1ZC4 B;  5C5B A;  2KUP A;  4EKU A;  5LOP B;  2CY4 A;  3F0W A;  2L1C A;  2D9Z A;  2CY5 A;  3F5R A;  2K00 A;  1FHO A;  2M38 A;  2I5F A;  1NI2 A;  4HAY B;  5DHF B;  1BAK A;  2COD A;  1UNR A;  1DDM A;  1WGQ A;  2DHI A;  3U8Z A;  4TYZ A;  1BTK A;  2CRF A;  1ZSQ A;  5KCV A;  4K17 A;  3ZVR A;  4MK0 A;  5L81 A;  1EVH A;  2YS3 A;  2UVM A;  3DXC A;  3ML4 A;  3P7Z A;  2GS0 A;  4GZU A;  3AU4 A;  5HE3 A;  1M7E A;  2P0D A;  4DX9 0;  5HE2 A;  1MPH A;  1FB8 A;  3D8F A;  4WJ7 A;  3PP2 A;  5JP4 A;  3TW1 A;  1PMS A;  5J3Y A;  5JHH A;  4XWX A;  1TJ6 A;  1OQN A;  1WVH A;  2J0K A;  4HB3 B;  3T06 A;  2VRW B;  2EMS A;  3SNH A;  2V76 A;  1XOD A;  1UNP A;  3SUZ A;  2I1J A;  2LUL A;  2R0D A;  4F7H A;  2LKO A;  3CIK A;  2MKR A;  3HK0 A;  4Z2N A;  1ISN A;  1OY2 A;  4A6F B;  4L6E A;  3QWM A;  2D9X A;  4HAU B;  3PG7 A;  4ZRI A;  3UZT A;  3FEH A;  5C6R A;  2YS1 A;  2JP2 A;  2E2X A;  2I1K A;  4K2O A;  1V5P A;  1UNQ A;  3QIJ A;  2DYN A;  3ODW A;  2MWN B;  2AL6 A;  1UEF A;  1WG7 A;  2IFS A;  2GCL A;  1XR0 B;  2KGX B;  4H8S A;  5D3X A;  4WSF A;  2GJY A;  4KAX B;  5D3Y A;  1X1F A;  1EF1 A;  1V5U A;  1DRO A;  4YL8 A;  2DX1 A;  2RUK B;  1TXD A;  5LON B;  4EMO A;  1ZM0 A;  1V61 A;  2XQN M;  4EJN A;  1U27 A;  4KHO A;  1KI1 B;  4DBB A;  2D9Y A;  4IAP A;  2YRY A;  4HB4 B;  3TO1 A;  4ZRK A;  2ADZ A;  1U5G A;  1Q67 A;  1XD4 A;  3KSY A;  3G9W A;  5C5B B;  3GYO A;  4A5K A;  1U2B A;  5C79 A;  1MK9 B;  2MFQ A;  1J0W A;  4IFS A;  1DBH A;  4PNK A;  4D0N B;  3ULC A;  3MDB C;  1Z87 A;  4HB2 B;  2YVC A;  4KHA A;  1X11 A;  3A98 B;  4HAW B;  2DYQ A;  2J0M A;  1W1G A;  4ZRJ A;  1EAZ A;  1Y5O A;  3KRX A;  5C16 A;  2MDX A;  3ODX A;  2ROZ B;  1W1H A;  2ZPY A;  2N0Y A;  2OQB A;  2DHJ A;  2NMB A;  2Q13 A;  4WVF B;  5FI1 A;  4B6H A;  1K5G B;  1J19 A;  2DKP A;  1B55 A;  1E5W A;  2J0J A;  3TCA A;  4F7U P;  2K2U A;  3PZD A;  1MIX A;  3SO6 A;  3FSS A;  4BBK A;  4KHB B;  2DX5 A;  2I5C A;  1U5D A;  2RLO A;  1AWE A;  2RSG A;  5DHA B;  5J3Q A;  2HE7 A;  1FOE A;  3SYX A;  2COA A;  1QQG A;  3KY9 A;  3TVV A;  3TFM A;  2DN6 A;  3AJ4 A;  3AU5 A;  2EC1 A;  1NTV A;  5KQ1 A;  1I7A A;  5DIF B;  1TQZ A;  1WJM A;  4HDO A;  1UPR A;  1U29 A;  3N7C A;  4CHM A;  2D9V A;  1FAO A;  2P8V A;  2ROV A;  5D3W A;  3X23 A;  1U5E A;  1IRS A;  2X18 A;  1PLS A;  3ZDT A;  1X1G A;  4CYE A;  4NSW A;  2Z0O A;  5HE0 A;  1FGZ A;  1ZVR A;  4YON A;  2H7D A;  3BIN A;  5JLJ B;  3DXD A;  1N3H A;  5D27 A;  2DTC A;  1FGY A;  2G35 A;  2UZS A;  2RVB B;  2W2W A;  4HAV B;  4F7G A;  3KRW A;  1KZG A;  1XCG A;  2FJL A;  2UZR A;  4MY6 A;  1XKE A;  4A6K A;  1OMW A;  2OTX A;  3P6A A;  3ODO A;  4Z2M B;  3CXB B;  1P5T A;  2BCJ A;  1ZC3 B;  1V5M A;  3DXE A;  1GC7 A;  2Y8F A;  2YF0 A;  1MKE A;  4DX8 A;  1KZ7 A;  2N23 A;  1MK7 B;  4K81 A;  1QC6 A;  1X86 A;  3RCP A;  5KQ4 A;  3LJU X;  3V5W A;  4KVG B;  1GC6 A;  2ELB A;  1DDV A;  2LOX A;  2D10 A;  1BTN A;  4HAX B;  2L2I A;  3KZ1 A;  2P0H A;  1I2H A;  3D8E A;  1NTY A;  2YT1 A;  5GOW B;  2QKL A;  4K2P A;  2DLW A;  3VOQ A;  3MPX A;  2VKI A;  1WGU A;  1RJ2 A;  1NU2 A;  4C0A A;  5CLL B;  4NY0 A;  1DDW A;  1X05 A;  2EMT A;  2Y8G A;  5CLQ B;  3BJI A;  4IOY X;  4MT7 A;  3PEG A;  1WI1 A;  2RNR B;  3U7D A;  3A8Q A;  2Z0P A;  3HW2 B;  2IYB A;  2YT0 A;  2YSZ A;  2K2J A;  2LOZ A;  3IVF A;  3NSU A;  3PVW A;  5FI0 A;  3O96 A;  1SHC A;  2DFK A;  3D8D A;  3OAN A;  2ELA A;  1PFJ A;  4GMX B;  4DXA B;  2Y7B A;  2COF A;  3PVL A;  2DKQ A;  4GXB A;  2DA0 A;  1MAI A;  3GYP A;  1MIZ B;  5DI9 B;  2H7E A;  4HB0 B;  2D11 A;  1V88 A;  2NZ8 B;  3WA0 A;  3HQC A;  4PQ0 A;  4A6H A;  5J3T A;  4HAT B;  1M7R A;  5EFX A;  1V89 A;  4CHJ A;  2LYD A;  5JHG A;  3PSC A;  1RRP B;  2RGN B;  4A6F A;  3ULB A;  1K5D B;  2COC A;  1LB1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...