3DCXA

Crystal structure of a duf1696 family protein with a pleckstrin-homology domain (shew_0819) from shewanella loihica pv-4 at 2.00 a resolution
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
117
structure length
117
Chain Sequence
GGNAAEVNLDELAQELGPIMGDNEQLALAYRVIRDMFVFTNKRLILIDKQGVTGKKVSYHSVPYKAITHFEVETAGTFDMDAELKLWISGQKDPLVKELKKGTDVVGIQKTIANFSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein of Unknown Function (DUF1696) with Pleckstrin-homolo
publication title Bacterial pleckstrin homology domains: a prokaryotic origin for the PH domain.
pubmed doi rcsb
source organism Shewanella loihica pv-4
molecule tags Unknown function
total genus 24
structure length 117
sequence length 117
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2008-06-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.50 Mainly Beta Roll PH-domain like Bacterial Pleckstrin homology domain 3dcxA00
3HSAA 3DCXA 3B77A
chains in the Genus database with same CATH superfamily
1M7RA 2L1CA 1RRPB 1TJ6A 2COAA 4B6HA 2ZKMX 3SV1A 4OT1A 4QJ5B 2DKPA 2KUPA 4MY6A 3D8DA 3KRWA 3AJ4A 2D2QA 3A8PA 2LG1A 3IVFA 5I2MA 1PLSA 4K2OA 3KRXA 1Q67A 1X05A 2AL6A 1KZ7A 2K2UA 2W2WA 1FB8A 4HB4B 2RVBB 3TFMA 4D0NB 2ELBA 3ULCA 2J59M 3NWAA 1V5MA 2VRWB 1XCGA 1V5UA 5DH9B 1FGYA 1FGZA 2YF0A 4KHBB 4A6FA 4HAUB 2GJYA 1W1GA 4YL8A 2N23A 1I7AA 5HE0A 2YVCA 3BJIA 3SNHA 1WG7A 3N7CA 1V5PA 4ZRJA 3WYFB 2Z14A 5C5BA 2VKIA 2EMTA 4F7HA 1ZM0A 1PFJA 1J0WA 2GUMA 1ZC4B 3CIKA 1ZVRA 1TQZA 1FHXA 4CSQA 2DA0A 3U7DA 4QXAB 1I2HA 1H10A 1WGQA 2I5CA 1K5GB 1P3RA 1GC7A 2CAYA 1MAIA 1U27A 3A98B 3VOQA 3M1IB 4A6FB 4CHJA 4DX90 4ZRKA 4OSNA 3SO6A 2D9VA 3NWDA 4HB2B 3D8EA 4KHOA 4HB0B 5DHAB 3P6AA 5D3YA 1U5GA 5HE2A 2EMSA 2P0DA 2DFKA 1GC6A 5EFXA 3HSAA 5I2SA 2DKQA 2NMBA 2YSZA 1EF1A 1ZC3B 3NWFA 3ODXA 4H8SA 5LG4B 4HAWB 2ADZA 4L1RA 2V76A 1W1HA 2Z0OA 3TVVA 2Z4DA 1XR0B 2I5FA 2J0MA 3ULBA 3F0WA 2Z0QA 3KY9A 2DYQA 1NTVA 1P6SA 1H4RA 2K49A 4GXBA 2DN6A 1K5DB 1MK7B 1DDVA 3PVUA 3LJUX 3P7ZA 2R09A 2YT0A 2VSZA 1EAZA 4YONA 2CY5A 2W2XD 1MIXA 4Z2NA 2DHKA 1RJ2A 2MDXA 2K2JA 3DXEA 4D6WA 3T06A 2NZ8B 2YT2A 1V88A 4IAPA 4Z2MB 3KSYA 3G9WA 2Y8FA 3A8QA 1OY2A 4L6EA 3KZ1A 4DXAB 1U29A 4WVFB 3QWMA 1UPQA 2DTCA 2P8VA 2KUQA 4C0AA 3V5WA 1WJMA 2CY4A 1LW3A 1NI2A 4IFSA 1XODA 2UZSA 4GMVA 2YS3A 2LKOA 1TXDA 1SGHA 4KHAA 5D3WA 1KI1B 1P5TA 4TKNA 2Y8GA 2Z59A 1U2BA 2CODA 3QBVB 2COFA 4QJ4B 4EMOA 2FJUB 1ZSQA 2QKMA 2JP2A 4NY0A 1ISNA 1ZYIA 2W2XC 2J0JA 1FHWA 3F5RA 5CLQB 1E5WA 2L2IA 3GYPA 1WJ1A 3DCXA 3OHMB 2YS5A 2QKLA 1XD4A 3PZDA 4DIXA 2I1JA 3SYXA 1BTNA 3U8ZA 3DXCA 3PEGA 1DROA 2MFQA 2ROZB 4HAXB 1BWNA 4NSWA 1PMSA 2RUKB 5CLLB 3TW1A 2DYNA 4DBBA 2R2YA 1Z87A 5FI0A 3PP2A 3FSSA 3WA0A 4HB3B 3BINA 3MDBC 1FHOA 2KCJA 1Y19B 3U12A 5C5BB 2COCA 2H7EA 5LOPB 5HE1A 2LULA 4HAZB 3D8FA 2RGNB 3NW8A 2RNRB 3X23A 5JHHA 3O96A 4F7UP 3AU4A 2M14A 3ZDTA 2P0FA 2KIEA 3ZVRA 1X86A 3FVCA 3SUZA 2E2XA 2N0YA 1DBHA 3DXDA 1B55A 1MKEA 2KGXB 2D9WA 1MK9B 1V89A 1U5EA 4MT7A 4WJ7A 3MPXA 1FAOA 5JP4A 1V61A 1UNRA 2DHIA 5HE3A 4Y94A 4KVGB 2D9XA 2AEHA 4ZRIA 4K17A 1MPHA 2UZRA 4EJNA 1W1DA 1X1FA 2MWNB 2MKRA 1M7EA 2G35A 1X11A 5DHFB 3A58A 4KHBA 5KQ1A 1UPRA 4MK0A 2J0KA 3ODWA 1LB1A 1XKEA 2LOZA 4HDOA 1AQCA 4KAXB 4CHMA 1NU2A 2H7DA 4HHVA 1BTKA 5J3TA 3HQCA 1UNPA 3B77A 2ZPYA 4PNKA 4A5KA 3PG7A 4GNKB 2OTXA 4HAVB 3FEHA 2UVMA 3FM8C 1XX0A 1UEFA 2RRFA 3TO1A 5JLJB 5KQ4A 5DIFB 1SHCA 5IRSA 2EJ8A 1FOEA 4HATB 1WVHA 3RCPA 2HE7A 5FI1A 5D27A 1BAKA 4GMXB 2D10A 2K00A 2Z0PA 3CXBB 1T77A 2KIGA 2D11A 1N3HA 5C79A 4TYZA 1EGXA 4HAYB 1WGUA 2IFSA 4DX8A 2XQNM 2YRYA 4PQ0A 2FJLA 3OANA 4K2PA 2CRFA 4GOUA 2D4QA 4A6HA 1U5FA 1IRSA 2I1KA 5C16A 2RLOA 4EKUA 2GCLA 3ML4A 5C6RA 4IOYX 3HK0A 1AWEA 2GCJA 1OQNA 3NSUA 1Y5OA 2K8EA 3AU5A 1GG3A 2ELAA 3HW2B 2M38A 1J19A 2Z13A 4GZUA 5J3YA 1EVHA 1NTYA 2LYDA 2PZ1A 4A6KA 2OQBA 4WSFA 4GPTB 1DDMA 2D9YA 2Q13A 2Y7BA 5D3XA 5JHGA 3ODOA 4HSIA 2EC1A 3HIEA 4HDQA 4P7IA 1U5DA 2NBVA 3TCAA 2DHJA 2X18A 2DLWA 1DYNA 2R0DA 1MIZB 3GYOA 2DX5A 5DI9B 4K81A 2BCJA 2HTHB 5L81A 2DX1A 2P0HA 4BBKA 1DDWA 2RSGA 5J3QA 1QC6A 3QIJA 3UZTA 5M4YB 5D3VA 4XWXA 2YS1A 1MI1A 3VIAA 3PVLA 1WI1A 1KZGA 1OMWA 5GOWB 2YT1A 3PSCA 4F7GA 2IYBA 4QJ3B 5LONB 2KR0A 5KCVA 4CYEA 2GS0A 1X1GA 4GN1A 3PVWA 1UNQA 2D9ZA 1QQGA 2LOXA 2ROVA
chains in the Genus database with same CATH topology
3HSAA 3DCXA 3B77A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HSA A;  3DCX A;  3B77 A; 
#chains in the Genus database with same CATH topology
 1M7R A;  2L1C A;  1RRP B;  1TJ6 A;  2COA A;  4B6H A;  2ZKM X;  3SV1 A;  4OT1 A;  4QJ5 B;  2DKP A;  2KUP A;  4MY6 A;  3D8D A;  3KRW A;  3AJ4 A;  2D2Q A;  3A8P A;  2LG1 A;  3IVF A;  5I2M A;  1PLS A;  4K2O A;  3KRX A;  1Q67 A;  1X05 A;  2AL6 A;  1KZ7 A;  2K2U A;  2W2W A;  1FB8 A;  4HB4 B;  2RVB B;  3TFM A;  4D0N B;  2ELB A;  3ULC A;  2J59 M;  3NWA A;  1V5M A;  2VRW B;  1XCG A;  1V5U A;  5DH9 B;  1FGY A;  1FGZ A;  2YF0 A;  4KHB B;  4A6F A;  4HAU B;  2GJY A;  1W1G A;  4YL8 A;  2N23 A;  1I7A A;  5HE0 A;  2YVC A;  3BJI A;  3SNH A;  1WG7 A;  3N7C A;  1V5P A;  4ZRJ A;  3WYF B;  2Z14 A;  5C5B A;  2VKI A;  2EMT A;  4F7H A;  1ZM0 A;  1PFJ A;  1J0W A;  2GUM A;  1ZC4 B;  3CIK A;  1ZVR A;  1TQZ A;  1FHX A;  4CSQ A;  2DA0 A;  3U7D A;  4QXA B;  1I2H A;  1H10 A;  1WGQ A;  2I5C A;  1K5G B;  1P3R A;  1GC7 A;  2CAY A;  1MAI A;  1U27 A;  3A98 B;  3VOQ A;  3M1I B;  4A6F B;  4CHJ A;  4DX9 0;  4ZRK A;  4OSN A;  3SO6 A;  2D9V A;  3NWD A;  4HB2 B;  3D8E A;  4KHO A;  4HB0 B;  5DHA B;  3P6A A;  5D3Y A;  1U5G A;  5HE2 A;  2EMS A;  2P0D A;  2DFK A;  1GC6 A;  5EFX A;  3HSA A;  5I2S A;  2DKQ A;  2NMB A;  2YSZ A;  1EF1 A;  1ZC3 B;  3NWF A;  3ODX A;  4H8S A;  5LG4 B;  4HAW B;  2ADZ A;  4L1R A;  2V76 A;  1W1H A;  2Z0O A;  3TVV A;  2Z4D A;  1XR0 B;  2I5F A;  2J0M A;  3ULB A;  3F0W A;  2Z0Q A;  3KY9 A;  2DYQ A;  1NTV A;  1P6S A;  1H4R A;  2K49 A;  4GXB A;  2DN6 A;  1K5D B;  1MK7 B;  1DDV A;  3PVU A;  3LJU X;  3P7Z A;  2R09 A;  2YT0 A;  2VSZ A;  1EAZ A;  4YON A;  2CY5 A;  2W2X D;  1MIX A;  4Z2N A;  2DHK A;  1RJ2 A;  2MDX A;  2K2J A;  3DXE A;  4D6W A;  3T06 A;  2NZ8 B;  2YT2 A;  1V88 A;  4IAP A;  4Z2M B;  3KSY A;  3G9W A;  2Y8F A;  3A8Q A;  1OY2 A;  4L6E A;  3KZ1 A;  4DXA B;  1U29 A;  4WVF B;  3QWM A;  1UPQ A;  2DTC A;  2P8V A;  2KUQ A;  4C0A A;  3V5W A;  1WJM A;  2CY4 A;  1LW3 A;  1NI2 A;  4IFS A;  1XOD A;  2UZS A;  4GMV A;  2YS3 A;  2LKO A;  1TXD A;  1SGH A;  4KHA A;  5D3W A;  1KI1 B;  1P5T A;  4TKN A;  2Y8G A;  2Z59 A;  1U2B A;  2COD A;  3QBV B;  2COF A;  4QJ4 B;  4EMO A;  2FJU B;  1ZSQ A;  2QKM A;  2JP2 A;  4NY0 A;  1ISN A;  1ZYI A;  2W2X C;  2J0J A;  1FHW A;  3F5R A;  5CLQ B;  1E5W A;  2L2I A;  3GYP A;  1WJ1 A;  3DCX A;  3OHM B;  2YS5 A;  2QKL A;  1XD4 A;  3PZD A;  4DIX A;  2I1J A;  3SYX A;  1BTN A;  3U8Z A;  3DXC A;  3PEG A;  1DRO A;  2MFQ A;  2ROZ B;  4HAX B;  1BWN A;  4NSW A;  1PMS A;  2RUK B;  5CLL B;  3TW1 A;  2DYN A;  4DBB A;  2R2Y A;  1Z87 A;  5FI0 A;  3PP2 A;  3FSS A;  3WA0 A;  4HB3 B;  3BIN A;  3MDB C;  1FHO A;  2KCJ A;  1Y19 B;  3U12 A;  5C5B B;  2COC A;  2H7E A;  5LOP B;  5HE1 A;  2LUL A;  4HAZ B;  3D8F A;  2RGN B;  3NW8 A;  2RNR B;  3X23 A;  5JHH A;  3O96 A;  4F7U P;  3AU4 A;  2M14 A;  3ZDT A;  2P0F A;  2KIE A;  3ZVR A;  1X86 A;  3FVC A;  3SUZ A;  2E2X A;  2N0Y A;  1DBH A;  3DXD A;  1B55 A;  1MKE A;  2KGX B;  2D9W A;  1MK9 B;  1V89 A;  1U5E A;  4MT7 A;  4WJ7 A;  3MPX A;  1FAO A;  5JP4 A;  1V61 A;  1UNR A;  2DHI A;  5HE3 A;  4Y94 A;  4KVG B;  2D9X A;  2AEH A;  4ZRI A;  4K17 A;  1MPH A;  2UZR A;  4EJN A;  1W1D A;  1X1F A;  2MWN B;  2MKR A;  1M7E A;  2G35 A;  1X11 A;  5DHF B;  3A58 A;  4KHB A;  5KQ1 A;  1UPR A;  4MK0 A;  2J0K A;  3ODW A;  1LB1 A;  1XKE A;  2LOZ A;  4HDO A;  1AQC A;  4KAX B;  4CHM A;  1NU2 A;  2H7D A;  4HHV A;  1BTK A;  5J3T A;  3HQC A;  1UNP A;  3B77 A;  2ZPY A;  4PNK A;  4A5K A;  3PG7 A;  4GNK B;  2OTX A;  4HAV B;  3FEH A;  2UVM A;  3FM8 C;  1XX0 A;  1UEF A;  2RRF A;  3TO1 A;  5JLJ B;  5KQ4 A;  5DIF B;  1SHC A;  5IRS A;  2EJ8 A;  1FOE A;  4HAT B;  1WVH A;  3RCP A;  2HE7 A;  5FI1 A;  5D27 A;  1BAK A;  4GMX B;  2D10 A;  2K00 A;  2Z0P A;  3CXB B;  1T77 A;  2KIG A;  2D11 A;  1N3H A;  5C79 A;  4TYZ A;  1EGX A;  4HAY B;  1WGU A;  2IFS A;  4DX8 A;  2XQN M;  2YRY A;  4PQ0 A;  2FJL A;  3OAN A;  4K2P A;  2CRF A;  4GOU A;  2D4Q A;  4A6H A;  1U5F A;  1IRS A;  2I1K A;  5C16 A;  2RLO A;  4EKU A;  2GCL A;  3ML4 A;  5C6R A;  4IOY X;  3HK0 A;  1AWE A;  2GCJ A;  1OQN A;  3NSU A;  1Y5O A;  2K8E A;  3AU5 A;  1GG3 A;  2ELA A;  3HW2 B;  2M38 A;  1J19 A;  2Z13 A;  4GZU A;  5J3Y A;  1EVH A;  1NTY A;  2LYD A;  2PZ1 A;  4A6K A;  2OQB A;  4WSF A;  4GPT B;  1DDM A;  2D9Y A;  2Q13 A;  2Y7B A;  5D3X A;  5JHG A;  3ODO A;  4HSI A;  2EC1 A;  3HIE A;  4HDQ A;  4P7I A;  1U5D A;  2NBV A;  3TCA A;  2DHJ A;  2X18 A;  2DLW A;  1DYN A;  2R0D A;  1MIZ B;  3GYO A;  2DX5 A;  5DI9 B;  4K81 A;  2BCJ A;  2HTH B;  5L81 A;  2DX1 A;  2P0H A;  4BBK A;  1DDW A;  2RSG A;  5J3Q A;  1QC6 A;  3QIJ A;  3UZT A;  5M4Y B;  5D3V A;  4XWX A;  2YS1 A;  1MI1 A;  3VIA A;  3PVL A;  1WI1 A;  1KZG A;  1OMW A;  5GOW B;  2YT1 A;  3PSC A;  4F7G A;  2IYB A;  4QJ3 B;  5LON B;  2KR0 A;  5KCV A;  4CYE A;  2GS0 A;  1X1G A;  4GN1 A;  3PVW A;  1UNQ A;  2D9Z A;  1QQG A;  2LOX A;  2ROV A; 
#chains in the Genus database with same CATH homology
 3HSA A;  3DCX A;  3B77 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...