3DCXA

Crystal structure of a duf1696 family protein with a pleckstrin-homology domain (shew_0819) from shewanella loihica pv-4 at 2.00 a resolution
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
117
structure length
117
Chain Sequence
b'GGNAAEVNLDELAQELGPIMGDNEQLALAYRVIRDMFVFTNKRLILIDKQGVTGKKVSYHSVPYKAITHFEVETAGTFDMDAELKLWISGQKDPLVKELKKGTDVVGIQKTIANFSL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein of Unknown Function (DUF1696) with Pleckstrin-homolo
publication title Bacterial pleckstrin homology domains: a prokaryotic origin for the PH domain.
pubmed doi rcsb
source organism Shewanella loihica pv-4
molecule tags Unknown function
total genus 24
structure length 117
sequence length 117
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2008-06-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.50 Mainly Beta Roll PH-domain like Bacterial Pleckstrin homology domain 3dcxA00
3DCXA 3HSAA 3B77A
chains in the Genus database with same CATH superfamily
1P5TA 1W1GA 2ZPYA 2FJUB 3D8DA 2ADZA 4GXBA 3V5WA 3FSSA 5C16A 3A98B 4F7UP 2L1CA 2LKOA 4GNKB 1ZC3B 4YONA 1WGUA 4P7IA 1GC7A 2XQNM 2K8EA 2LULA 2M38A 2I5CA 2W2XC 1SHCA 2L2IA 3OANA 4HATB 1OY2A 1WG7A 5DIFB 2COCA 4KHBB 4GPTB 1MAIA 3DXDA 5C79A 1AWEA 3PEGA 3M1IB 5CLQB 1U5GA 2I1JA 2KUPA 2GJYA 2Y7BA 2DX1A 1OQNA 2V76A 1W1DA 2K49A 2DTCA 1BWNA 4A6FB 1KZGA 4KVGB 2RUKB 1U5DA 2D4QA 1FGZA 4XWXA 2YS5A 4IAPA 1J19A 3TFMA 2LYDA 2MDXA 3HW2B 3PVUA 5FI0A 1MI1A 3PP2A 1XODA 3KSYA 3ULBA 1B55A 1SGHA 4D0NB 4CHJA 5DHAB 2M14A 1X1GA 1EAZA 3X23A 2D2QA 1X05A 4A6KA 1XD4A 1UPQA 3MDBC 1Q67A 1FGYA 2H7EA 1T77A 2H7DA 3DCXA 4HAUB 2DHJA 2NZ8B 4CHMA 1Y5OA 2KGXB 1FOEA 4TKNA 4YL8A 4MY6A 4MT7A 2R2YA 1RRPB 4KHOA 4DXAB 3KRXA 5D3YA 1UPRA 2Z4DA 4BBKA 5KQ4A 2RVBB 3SNHA 4K2PA 2HE7A 4L1RA 5L81A 2AL6A 3BJIA 1NTYA 2MWNB 2YF0A 1PMSA 3NWFA 3QIJA 5JP4A 4IOYX 3GYPA 4HAVB 3UZTA 4K81A 2NBVA 1FAOA 3PZDA 1V5PA 3DXCA 2ROZB 2Z0OA 1DYNA 2BCJA 2Q13A 3HK0A 2FJLA 2ELBA 2YT0A 4EKUA 4K17A 2D9WA 1DDVA 2CY5A 2DN6A 5CLLB 2DHKA 1XKEA 3HIEA 2Z0PA 3AJ4A 4NY0A 3P7ZA 3SUZA 1V5MA 4GZUA 4ZRKA 5HE1A 1U5FA 5LOPB 4D6WA 2KUQA 4HB2B 4A5KA 1LW3A 3ML4A 2D11A 2MKRA 5J3TA 3GYOA 3PSCA 2D9XA 2I5FA 4OSNA 5I2MA 2VKIA 1UNPA 2EC1A 3PVLA 1WVHA 2Y8GA 5HE2A 4NSWA 1DBHA 2YVCA 2RRFA 4L6EA 5C6RA 2DFKA 4HB0B 4A6FA 1ZC4B 2VSZA 2CODA 3HQCA 3MPXA 3WYFB 5FI1A 3U12A 3CXBB 3WA0A 1BTNA 2P8VA 1FHOA 5D3VA 2EMTA 4HDQA 2DHIA 2K2UA 5J3YA 1TJ6A 1V89A 5C5BA 4C0AA 4HAYB 4F7HA 2CRFA 1K5DB 2J0JA 1MKEA 2D9ZA 4HAWB 1UNRA 4H8SA 2P0HA 2DYQA 4GMVA 4WVFB 2GUMA 2P0DA 2N23A 1UEFA 1DDMA 2DKQA 2GCLA 2ELAA 2J0MA 2RNRB 2YT1A 2VRWB 1LB1A 1ZM0A 4HB4B 2DX5A 1J0WA 5GOWB 3G9WA 2J59M 4Y94A 1WJMA 2YS3A 5KQ1A 1IRSA 3KZ1A 3SV1A 2DKPA 4DIXA 1ISNA 1RJ2A 1KI1B 2DA0A 1W1HA 4TYZA 4HB3B 1I2HA 2ROVA 2P0FA 4Z2MB 1AQCA 2NMBA 1P6SA 2QKMA 2OQBA 3ZDTA 3U8ZA 3NSUA 4OT1A 3D8FA 5HE3A 5M4YB 4HSIA 4DX90 4F7GA 2Z0QA 1V61A 5DH9B 1WI1A 3LJUX 4KHAA 2W2XD 1EF1A 3ZVRA 1P3RA 1XR0B 2YT2A 2YRYA 1OMWA 5LG4B 1X11A 2JP2A 2E2XA 2K00A 5IRSA 4KAXB 5D3XA 1X1FA 3B77A 4WSFA 1XCGA 3O96A 4QJ3B 4QJ4B 2GS0A 1BTKA 4QJ5B 5JHGA 1EVHA 1NI2A 3F5RA 4CYEA 2D9YA 2DYNA 2D10A 3RCPA 2YS1A 3A8PA 5JHHA 5LONB 2LG1A 2UVMA 2GCJA 3PG7A 5D3WA 2Y8FA 4MK0A 1V88A 1WGQA 3D8EA 4B6HA 3SO6A 3TCAA 1MIXA 1QQGA 4A6HA 5I2SA 2K2JA 1U29A 2PZ1A 1M7EA 3AU4A 4DBBA 3FM8C 3N7CA 1MK9B 4KHBA 2R0DA 1X86A 2G35A 2ZKMX 4QXAB 3SYXA 1U27A 2LOXA 1U2BA 2KR0A 2DLWA 3QBVB 1BAKA 1ZSQA 4GMXB 2EMSA 1I7AA 5DHFB 3VIAA 1MIZB 2D9VA 1ZVRA 3OHMB 5KCVA 2R09A 1GG3A 5D27A 1K5GB 4Z2NA 3ODWA 2EJ8A 3VOQA 4GN1A 1QC6A 3FEHA 4WJ7A 3ODOA 2LOZA 1U5EA 2QKLA 1WJ1A 4HHVA 1M7RA 3A58A 3CIKA 5C5BB 1KZ7A 5JLJB 2RSGA 3ODXA 2IYBA 5DI9B 3TVVA 2RGNB 2YSZA 3PVWA 3KRWA 1ZYIA 1TXDA 4HDOA 2Z14A 2UZRA 3AU5A 3BINA 3HSAA 1MK7B 3IVFA 1Z87A 4PNKA 2KIGA 2CAYA 2J0KA 1GC6A 1FHWA 4GOUA 3QWMA 4EJNA 2AEHA 3U7DA 4IFSA 1PFJA 2MFQA 1TQZA 3TO1A 2KCJA 3NW8A 2COFA 5EFXA 1DROA 1FB8A 1H10A 4ZRIA 1H4RA 1NU2A 4PQ0A 1FHXA 2UZSA 4HAZB 3F0WA 4ZRJA 4HAXB 3P6AA 2Z13A 1EGXA 1E5WA 2I1KA 5J3QA 3ULCA 2W2WA 3NWAA 4EMOA 2X18A 1NTVA 3FVCA 4CSQA 4K2OA 2IFSA 1UNQA 3T06A 2HTHB 1MPHA 2Z59A 1Y19B 3A8QA 3DXEA 3TW1A 1PLSA 2OTXA 2KIEA 2COAA 3NWDA 4DX8A 1DDWA 1XX0A 2CY4A 1V5UA 2RLOA 3KY9A 5HE0A 2N0YA 1N3HA
chains in the Genus database with same CATH topology
3DCXA 3HSAA 3B77A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DCX A;  3HSA A;  3B77 A; 
#chains in the Genus database with same CATH topology
 1P5T A;  1W1G A;  2ZPY A;  2FJU B;  3D8D A;  2ADZ A;  4GXB A;  3V5W A;  3FSS A;  5C16 A;  3A98 B;  4F7U P;  2L1C A;  2LKO A;  4GNK B;  1ZC3 B;  4YON A;  1WGU A;  4P7I A;  1GC7 A;  2XQN M;  2K8E A;  2LUL A;  2M38 A;  2I5C A;  2W2X C;  1SHC A;  2L2I A;  3OAN A;  4HAT B;  1OY2 A;  1WG7 A;  5DIF B;  2COC A;  4KHB B;  4GPT B;  1MAI A;  3DXD A;  5C79 A;  1AWE A;  3PEG A;  3M1I B;  5CLQ B;  1U5G A;  2I1J A;  2KUP A;  2GJY A;  2Y7B A;  2DX1 A;  1OQN A;  2V76 A;  1W1D A;  2K49 A;  2DTC A;  1BWN A;  4A6F B;  1KZG A;  4KVG B;  2RUK B;  1U5D A;  2D4Q A;  1FGZ A;  4XWX A;  2YS5 A;  4IAP A;  1J19 A;  3TFM A;  2LYD A;  2MDX A;  3HW2 B;  3PVU A;  5FI0 A;  1MI1 A;  3PP2 A;  1XOD A;  3KSY A;  3ULB A;  1B55 A;  1SGH A;  4D0N B;  4CHJ A;  5DHA B;  2M14 A;  1X1G A;  1EAZ A;  3X23 A;  2D2Q A;  1X05 A;  4A6K A;  1XD4 A;  1UPQ A;  3MDB C;  1Q67 A;  1FGY A;  2H7E A;  1T77 A;  2H7D A;  3DCX A;  4HAU B;  2DHJ A;  2NZ8 B;  4CHM A;  1Y5O A;  2KGX B;  1FOE A;  4TKN A;  4YL8 A;  4MY6 A;  4MT7 A;  2R2Y A;  1RRP B;  4KHO A;  4DXA B;  3KRX A;  5D3Y A;  1UPR A;  2Z4D A;  4BBK A;  5KQ4 A;  2RVB B;  3SNH A;  4K2P A;  2HE7 A;  4L1R A;  5L81 A;  2AL6 A;  3BJI A;  1NTY A;  2MWN B;  2YF0 A;  1PMS A;  3NWF A;  3QIJ A;  5JP4 A;  4IOY X;  3GYP A;  4HAV B;  3UZT A;  4K81 A;  2NBV A;  1FAO A;  3PZD A;  1V5P A;  3DXC A;  2ROZ B;  2Z0O A;  1DYN A;  2BCJ A;  2Q13 A;  3HK0 A;  2FJL A;  2ELB A;  2YT0 A;  4EKU A;  4K17 A;  2D9W A;  1DDV A;  2CY5 A;  2DN6 A;  5CLL B;  2DHK A;  1XKE A;  3HIE A;  2Z0P A;  3AJ4 A;  4NY0 A;  3P7Z A;  3SUZ A;  1V5M A;  4GZU A;  4ZRK A;  5HE1 A;  1U5F A;  5LOP B;  4D6W A;  2KUQ A;  4HB2 B;  4A5K A;  1LW3 A;  3ML4 A;  2D11 A;  2MKR A;  5J3T A;  3GYO A;  3PSC A;  2D9X A;  2I5F A;  4OSN A;  5I2M A;  2VKI A;  1UNP A;  2EC1 A;  3PVL A;  1WVH A;  2Y8G A;  5HE2 A;  4NSW A;  1DBH A;  2YVC A;  2RRF A;  4L6E A;  5C6R A;  2DFK A;  4HB0 B;  4A6F A;  1ZC4 B;  2VSZ A;  2COD A;  3HQC A;  3MPX A;  3WYF B;  5FI1 A;  3U12 A;  3CXB B;  3WA0 A;  1BTN A;  2P8V A;  1FHO A;  5D3V A;  2EMT A;  4HDQ A;  2DHI A;  2K2U A;  5J3Y A;  1TJ6 A;  1V89 A;  5C5B A;  4C0A A;  4HAY B;  4F7H A;  2CRF A;  1K5D B;  2J0J A;  1MKE A;  2D9Z A;  4HAW B;  1UNR A;  4H8S A;  2P0H A;  2DYQ A;  4GMV A;  4WVF B;  2GUM A;  2P0D A;  2N23 A;  1UEF A;  1DDM A;  2DKQ A;  2GCL A;  2ELA A;  2J0M A;  2RNR B;  2YT1 A;  2VRW B;  1LB1 A;  1ZM0 A;  4HB4 B;  2DX5 A;  1J0W A;  5GOW B;  3G9W A;  2J59 M;  4Y94 A;  1WJM A;  2YS3 A;  5KQ1 A;  1IRS A;  3KZ1 A;  3SV1 A;  2DKP A;  4DIX A;  1ISN A;  1RJ2 A;  1KI1 B;  2DA0 A;  1W1H A;  4TYZ A;  4HB3 B;  1I2H A;  2ROV A;  2P0F A;  4Z2M B;  1AQC A;  2NMB A;  1P6S A;  2QKM A;  2OQB A;  3ZDT A;  3U8Z A;  3NSU A;  4OT1 A;  3D8F A;  5HE3 A;  5M4Y B;  4HSI A;  4DX9 0;  4F7G A;  2Z0Q A;  1V61 A;  5DH9 B;  1WI1 A;  3LJU X;  4KHA A;  2W2X D;  1EF1 A;  3ZVR A;  1P3R A;  1XR0 B;  2YT2 A;  2YRY A;  1OMW A;  5LG4 B;  1X11 A;  2JP2 A;  2E2X A;  2K00 A;  5IRS A;  4KAX B;  5D3X A;  1X1F A;  3B77 A;  4WSF A;  1XCG A;  3O96 A;  4QJ3 B;  4QJ4 B;  2GS0 A;  1BTK A;  4QJ5 B;  5JHG A;  1EVH A;  1NI2 A;  3F5R A;  4CYE A;  2D9Y A;  2DYN A;  2D10 A;  3RCP A;  2YS1 A;  3A8P A;  5JHH A;  5LON B;  2LG1 A;  2UVM A;  2GCJ A;  3PG7 A;  5D3W A;  2Y8F A;  4MK0 A;  1V88 A;  1WGQ A;  3D8E A;  4B6H A;  3SO6 A;  3TCA A;  1MIX A;  1QQG A;  4A6H A;  5I2S A;  2K2J A;  1U29 A;  2PZ1 A;  1M7E A;  3AU4 A;  4DBB A;  3FM8 C;  3N7C A;  1MK9 B;  4KHB A;  2R0D A;  1X86 A;  2G35 A;  2ZKM X;  4QXA B;  3SYX A;  1U27 A;  2LOX A;  1U2B A;  2KR0 A;  2DLW A;  3QBV B;  1BAK A;  1ZSQ A;  4GMX B;  2EMS A;  1I7A A;  5DHF B;  3VIA A;  1MIZ B;  2D9V A;  1ZVR A;  3OHM B;  5KCV A;  2R09 A;  1GG3 A;  5D27 A;  1K5G B;  4Z2N A;  3ODW A;  2EJ8 A;  3VOQ A;  4GN1 A;  1QC6 A;  3FEH A;  4WJ7 A;  3ODO A;  2LOZ A;  1U5E A;  2QKL A;  1WJ1 A;  4HHV A;  1M7R A;  3A58 A;  3CIK A;  5C5B B;  1KZ7 A;  5JLJ B;  2RSG A;  3ODX A;  2IYB A;  5DI9 B;  3TVV A;  2RGN B;  2YSZ A;  3PVW A;  3KRW A;  1ZYI A;  1TXD A;  4HDO A;  2Z14 A;  2UZR A;  3AU5 A;  3BIN A;  3HSA A;  1MK7 B;  3IVF A;  1Z87 A;  4PNK A;  2KIG A;  2CAY A;  2J0K A;  1GC6 A;  1FHW A;  4GOU A;  3QWM A;  4EJN A;  2AEH A;  3U7D A;  4IFS A;  1PFJ A;  2MFQ A;  1TQZ A;  3TO1 A;  2KCJ A;  3NW8 A;  2COF A;  5EFX A;  1DRO A;  1FB8 A;  1H10 A;  4ZRI A;  1H4R A;  1NU2 A;  4PQ0 A;  1FHX A;  2UZS A;  4HAZ B;  3F0W A;  4ZRJ A;  4HAX B;  3P6A A;  2Z13 A;  1EGX A;  1E5W A;  2I1K A;  5J3Q A;  3ULC A;  2W2W A;  3NWA A;  4EMO A;  2X18 A;  1NTV A;  3FVC A;  4CSQ A;  4K2O A;  2IFS A;  1UNQ A;  3T06 A;  2HTH B;  1MPH A;  2Z59 A;  1Y19 B;  3A8Q A;  3DXE A;  3TW1 A;  1PLS A;  2OTX A;  2KIE A;  2COA A;  3NWD A;  4DX8 A;  1DDW A;  1XX0 A;  2CY4 A;  1V5U A;  2RLO A;  3KY9 A;  5HE0 A;  2N0Y A;  1N3H A; 
#chains in the Genus database with same CATH homology
 3DCX A;  3HSA A;  3B77 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...