3DCXA

Crystal structure of a duf1696 family protein with a pleckstrin-homology domain (shew_0819) from shewanella loihica pv-4 at 2.00 a resolution
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
117
structure length
117
Chain Sequence
GGNAAEVNLDELAQELGPIMGDNEQLALAYRVIRDMFVFTNKRLILIDKQGVTGKKVSYHSVPYKAITHFEVETAGTFDMDAELKLWISGQKDPLVKELKKGTDVVGIQKTIANFSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein of Unknown Function (DUF1696) with Pleckstrin-homolo
publication title Bacterial pleckstrin homology domains: a prokaryotic origin for the PH domain.
pubmed doi rcsb
source organism Shewanella loihica pv-4
molecule tags Unknown function
total genus 24
structure length 117
sequence length 117
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2008-06-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.50 Mainly Beta Roll PH-domain like Bacterial Pleckstrin homology domain 3dcxA00
3HSAA 3DCXA 3B77A
chains in the Genus database with same CATH superfamily
1PLSA 2Y8GA 1E5WA 3U8ZA 1P5TA 2DHKA 1X05A 2ZPYA 3HW2B 4WSFA 4HAWB 1GC7A 3QBVB 1MPHA 1EVHA 2YSZA 5EFXA 2NZ8B 2Z13A 2KCJA 3ZVRA 3HIEA 4Z2NA 2P0HA 2COFA 1W1DA 2D9ZA 1I2HA 1FGYA 4P7IA 1SGHA 2D10A 2ROZB 3BJIA 1LB1A 2EMSA 1MIZB 2J0JA 5M4YB 4F7UP 2E2XA 5J3TA 3KZ1A 1TXDA 1FHWA 4GPTB 1MAIA 3PEGA 2VKIA 1TJ6A 2H7DA 1K5DB 4F7HA 2XQNM 2Z0PA 1NTVA 2MWNB 1P6SA 2DN6A 5FI1A 1J19A 4WJ7A 3DXDA 4GNKB 1V5UA 5LG4B 4GMXB 2Y7BA 2DA0A 1ZYIA 4Z2MB 3SYXA 3B77A 3ULBA 1FHXA 2YT0A 1PMSA 1P3RA 4HSIA 2GCLA 2YVCA 1ZVRA 1N3HA 4Y94A 3CXBB 3PVWA 4HB2B 1EGXA 3HSAA 3PSCA 2GCJA 4GOUA 4HATB 2IFSA 2VRWB 1U5FA 2FJLA 1U5DA 2ROVA 3NWAA 1XODA 2GUMA 5J3YA 1Y19B 2P8VA 1WJ1A 2HE7A 3KSYA 4A6FA 1UEFA 2I5FA 3AU4A 3QIJA 4BBKA 3G9WA 2ELAA 3ODWA 2COCA 3SV1A 2BCJA 5GOWB 4HAVB 3X23A 2AEHA 5I2SA 3DXEA 2D9XA 5D3XA 1ZC4B 2LG1A 2P0DA 2PZ1A 3CIKA 4IOYX 1UNQA 1OMWA 2DYQA 2DTCA 1U2BA 2ADZA 2QKLA 5JHGA 4YONA 2CAYA 3SO6A 4QXAB 2IYBA 4EKUA 2LYDA 2YS3A 3PP2A 4CHJA 3HQCA 1NU2A 1W1GA 2QKMA 1EAZA 5FI0A 3KRXA 4MY6A 3D8DA 1FOEA 1KZGA 4HAUB 1GG3A 2DX1A 2Y8FA 4HB3B 1DDVA 3P6AA 3SUZA 5IRSA 1RJ2A 4QJ3B 1LW3A 1V88A 2EC1A 3D8EA 5CLLB 4D6WA 5J3QA 2P0FA 1XCGA 1U5GA 2NBVA 4PNKA 4TKNA 5L81A 2N0YA 1SHCA 2Z0QA 1B55A 2D9VA 4K17A 2I1KA 2YRYA 3WYFB 3ODXA 1Z87A 1WG7A 2KUPA 2HTHB 4C0AA 3FM8C 1W1HA 5D27A 5KQ1A 5D3VA 2KUQA 3DCXA 1QQGA 5KCVA 3RCPA 4K81A 5LONB 1UNRA 3HK0A 1FHOA 5DI9B 1BTKA 2YS5A 1MI1A 4L6EA 4B6HA 3UZTA 4ZRKA 4HAZB 5D3WA 4DIXA 1RRPB 4WVFB 4K2PA 2DHIA 1J0WA 3MDBC 2CRFA 3ML4A 4HDQA 1U29A 2K00A 3A8PA 4HAXB 3KY9A 1U27A 1AQCA 2Z4DA 1BWNA 2KIGA 2FJUB 2UVMA 4XWXA 2AL6A 3GYPA 2I1JA 2LOXA 5HE1A 2R2YA 1M7RA 4A5KA 2J0MA 2Z14A 1WI1A 2RNRB 2OTXA 1H10A 4KHOA 1AWEA 1H4RA 1MIXA 2DHJA 2K2UA 2L1CA 2RSGA 4DX8A 2ZKMX 1GC6A 3P7ZA 4GXBA 4EMOA 4NY0A 5D3YA 5C5BB 2K8EA 4QJ5B 3VIAA 2COAA 2YT2A 2EMTA 5CLQB 2L2IA 2MDXA 2D9YA 2R0DA 1NI2A 1DBHA 2Z0OA 4HDOA 1ZSQA 3SNHA 3GYOA 4HB4B 3U12A 3D8FA 3AU5A 4MK0A 5DIFB 2K49A 4YL8A 2DKPA 1EF1A 2RUKB 1UPQA 2ELBA 5C79A 4MT7A 2DKQA 2D11A 4EJNA 4KAXB 3M1IB 3PZDA 1T77A 3F0WA 5C6RA 2GS0A 2MKRA 2NMBA 2M38A 1MKEA 2DFKA 3AJ4A 4QJ4B 2W2XD 3TVVA 1X1GA 4KVGB 2Q13A 2UZRA 3PVUA 3TCAA 3VOQA 5JLJB 1XKEA 1BTNA 3PG7A 1ISNA 1KI1B 3N7CA 1OY2A 1FAOA 1X11A 2CY4A 3TW1A 2RLOA 4NSWA 2RVBB 4KHBB 1WVHA 4DBBA 1KZ7A 3OANA 1FB8A 2KR0A 2CODA 2EJ8A 3MPXA 2J59M 2RGNB 1Y5OA 4HB0B 4IFSA 1BAKA 4HHVA 3TFMA 1WGQA 3O96A 1U5EA 1DYNA 1V5MA 3NWDA 3T06A 3DXCA 3NSUA 3NWFA 3WA0A 2OQBA 3OHMB 3ULCA 5C5BA 2K2JA 1Q67A 2LOZA 4OSNA 3ODOA 2DYNA 4F7GA 5I2MA 4OT1A 2GJYA 3KRWA 2JP2A 1I7AA 4D0NB 1V89A 2X18A 2Z59A 4KHAA 1ZM0A 1TQZA 3FEHA 2M14A 1XX0A 3QWMA 1UPRA 1XR0B 2W2WA 4A6HA 5DH9B 4ZRJA 1DDWA 4L1RA 4CSQA 4K2OA 4TYZA 5DHFB 2RRFA 1WJMA 5C16A 2YS1A 2H7EA 2D2QA 1MK7B 2DLWA 1X1FA 1QC6A 2V76A 5JHHA 1UNPA 2DX5A 2YF0A 2N23A 2YT1A 2J0KA 1M7EA 4IAPA 2I5CA 1DROA 1ZC3B 5DHAB 4GZUA 1MK9B 3BINA 2CY5A 2VSZA 5KQ4A 3A58A 2UZSA 3FVCA 4KHBA 2LKOA 1NTYA 1DDMA 3V5WA 3FSSA 2D9WA 4DXAB 3A8QA 1K5GB 4GN1A 4H8SA 3TO1A 1FGZA 2LULA 2MFQA 3F5RA 1V5PA 1V61A 3NW8A 4DX90 2KGXB 2R09A 2D4QA 2W2XC 4PQ0A 4A6KA 2G35A 3ZDTA 5HE0A 3PVLA 5HE3A 4CHMA 2KIEA 1XD4A 4GMVA 1IRSA 1PFJA 4A6FB 3IVFA 3LJUX 5JP4A 5LOPB 5HE2A 4ZRIA 1WGUA 3A98B 3U7DA 4HAYB 1OQNA 1X86A 4CYEA
chains in the Genus database with same CATH topology
3HSAA 3DCXA 3B77A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HSA A;  3DCX A;  3B77 A; 
#chains in the Genus database with same CATH topology
 1PLS A;  2Y8G A;  1E5W A;  3U8Z A;  1P5T A;  2DHK A;  1X05 A;  2ZPY A;  3HW2 B;  4WSF A;  4HAW B;  1GC7 A;  3QBV B;  1MPH A;  1EVH A;  2YSZ A;  5EFX A;  2NZ8 B;  2Z13 A;  2KCJ A;  3ZVR A;  3HIE A;  4Z2N A;  2P0H A;  2COF A;  1W1D A;  2D9Z A;  1I2H A;  1FGY A;  4P7I A;  1SGH A;  2D10 A;  2ROZ B;  3BJI A;  1LB1 A;  2EMS A;  1MIZ B;  2J0J A;  5M4Y B;  4F7U P;  2E2X A;  5J3T A;  3KZ1 A;  1TXD A;  1FHW A;  4GPT B;  1MAI A;  3PEG A;  2VKI A;  1TJ6 A;  2H7D A;  1K5D B;  4F7H A;  2XQN M;  2Z0P A;  1NTV A;  2MWN B;  1P6S A;  2DN6 A;  5FI1 A;  1J19 A;  4WJ7 A;  3DXD A;  4GNK B;  1V5U A;  5LG4 B;  4GMX B;  2Y7B A;  2DA0 A;  1ZYI A;  4Z2M B;  3SYX A;  3B77 A;  3ULB A;  1FHX A;  2YT0 A;  1PMS A;  1P3R A;  4HSI A;  2GCL A;  2YVC A;  1ZVR A;  1N3H A;  4Y94 A;  3CXB B;  3PVW A;  4HB2 B;  1EGX A;  3HSA A;  3PSC A;  2GCJ A;  4GOU A;  4HAT B;  2IFS A;  2VRW B;  1U5F A;  2FJL A;  1U5D A;  2ROV A;  3NWA A;  1XOD A;  2GUM A;  5J3Y A;  1Y19 B;  2P8V A;  1WJ1 A;  2HE7 A;  3KSY A;  4A6F A;  1UEF A;  2I5F A;  3AU4 A;  3QIJ A;  4BBK A;  3G9W A;  2ELA A;  3ODW A;  2COC A;  3SV1 A;  2BCJ A;  5GOW B;  4HAV B;  3X23 A;  2AEH A;  5I2S A;  3DXE A;  2D9X A;  5D3X A;  1ZC4 B;  2LG1 A;  2P0D A;  2PZ1 A;  3CIK A;  4IOY X;  1UNQ A;  1OMW A;  2DYQ A;  2DTC A;  1U2B A;  2ADZ A;  2QKL A;  5JHG A;  4YON A;  2CAY A;  3SO6 A;  4QXA B;  2IYB A;  4EKU A;  2LYD A;  2YS3 A;  3PP2 A;  4CHJ A;  3HQC A;  1NU2 A;  1W1G A;  2QKM A;  1EAZ A;  5FI0 A;  3KRX A;  4MY6 A;  3D8D A;  1FOE A;  1KZG A;  4HAU B;  1GG3 A;  2DX1 A;  2Y8F A;  4HB3 B;  1DDV A;  3P6A A;  3SUZ A;  5IRS A;  1RJ2 A;  4QJ3 B;  1LW3 A;  1V88 A;  2EC1 A;  3D8E A;  5CLL B;  4D6W A;  5J3Q A;  2P0F A;  1XCG A;  1U5G A;  2NBV A;  4PNK A;  4TKN A;  5L81 A;  2N0Y A;  1SHC A;  2Z0Q A;  1B55 A;  2D9V A;  4K17 A;  2I1K A;  2YRY A;  3WYF B;  3ODX A;  1Z87 A;  1WG7 A;  2KUP A;  2HTH B;  4C0A A;  3FM8 C;  1W1H A;  5D27 A;  5KQ1 A;  5D3V A;  2KUQ A;  3DCX A;  1QQG A;  5KCV A;  3RCP A;  4K81 A;  5LON B;  1UNR A;  3HK0 A;  1FHO A;  5DI9 B;  1BTK A;  2YS5 A;  1MI1 A;  4L6E A;  4B6H A;  3UZT A;  4ZRK A;  4HAZ B;  5D3W A;  4DIX A;  1RRP B;  4WVF B;  4K2P A;  2DHI A;  1J0W A;  3MDB C;  2CRF A;  3ML4 A;  4HDQ A;  1U29 A;  2K00 A;  3A8P A;  4HAX B;  3KY9 A;  1U27 A;  1AQC A;  2Z4D A;  1BWN A;  2KIG A;  2FJU B;  2UVM A;  4XWX A;  2AL6 A;  3GYP A;  2I1J A;  2LOX A;  5HE1 A;  2R2Y A;  1M7R A;  4A5K A;  2J0M A;  2Z14 A;  1WI1 A;  2RNR B;  2OTX A;  1H10 A;  4KHO A;  1AWE A;  1H4R A;  1MIX A;  2DHJ A;  2K2U A;  2L1C A;  2RSG A;  4DX8 A;  2ZKM X;  1GC6 A;  3P7Z A;  4GXB A;  4EMO A;  4NY0 A;  5D3Y A;  5C5B B;  2K8E A;  4QJ5 B;  3VIA A;  2COA A;  2YT2 A;  2EMT A;  5CLQ B;  2L2I A;  2MDX A;  2D9Y A;  2R0D A;  1NI2 A;  1DBH A;  2Z0O A;  4HDO A;  1ZSQ A;  3SNH A;  3GYO A;  4HB4 B;  3U12 A;  3D8F A;  3AU5 A;  4MK0 A;  5DIF B;  2K49 A;  4YL8 A;  2DKP A;  1EF1 A;  2RUK B;  1UPQ A;  2ELB A;  5C79 A;  4MT7 A;  2DKQ A;  2D11 A;  4EJN A;  4KAX B;  3M1I B;  3PZD A;  1T77 A;  3F0W A;  5C6R A;  2GS0 A;  2MKR A;  2NMB A;  2M38 A;  1MKE A;  2DFK A;  3AJ4 A;  4QJ4 B;  2W2X D;  3TVV A;  1X1G A;  4KVG B;  2Q13 A;  2UZR A;  3PVU A;  3TCA A;  3VOQ A;  5JLJ B;  1XKE A;  1BTN A;  3PG7 A;  1ISN A;  1KI1 B;  3N7C A;  1OY2 A;  1FAO A;  1X11 A;  2CY4 A;  3TW1 A;  2RLO A;  4NSW A;  2RVB B;  4KHB B;  1WVH A;  4DBB A;  1KZ7 A;  3OAN A;  1FB8 A;  2KR0 A;  2COD A;  2EJ8 A;  3MPX A;  2J59 M;  2RGN B;  1Y5O A;  4HB0 B;  4IFS A;  1BAK A;  4HHV A;  3TFM A;  1WGQ A;  3O96 A;  1U5E A;  1DYN A;  1V5M A;  3NWD A;  3T06 A;  3DXC A;  3NSU A;  3NWF A;  3WA0 A;  2OQB A;  3OHM B;  3ULC A;  5C5B A;  2K2J A;  1Q67 A;  2LOZ A;  4OSN A;  3ODO A;  2DYN A;  4F7G A;  5I2M A;  4OT1 A;  2GJY A;  3KRW A;  2JP2 A;  1I7A A;  4D0N B;  1V89 A;  2X18 A;  2Z59 A;  4KHA A;  1ZM0 A;  1TQZ A;  3FEH A;  2M14 A;  1XX0 A;  3QWM A;  1UPR A;  1XR0 B;  2W2W A;  4A6H A;  5DH9 B;  4ZRJ A;  1DDW A;  4L1R A;  4CSQ A;  4K2O A;  4TYZ A;  5DHF B;  2RRF A;  1WJM A;  5C16 A;  2YS1 A;  2H7E A;  2D2Q A;  1MK7 B;  2DLW A;  1X1F A;  1QC6 A;  2V76 A;  5JHH A;  1UNP A;  2DX5 A;  2YF0 A;  2N23 A;  2YT1 A;  2J0K A;  1M7E A;  4IAP A;  2I5C A;  1DRO A;  1ZC3 B;  5DHA B;  4GZU A;  1MK9 B;  3BIN A;  2CY5 A;  2VSZ A;  5KQ4 A;  3A58 A;  2UZS A;  3FVC A;  4KHB A;  2LKO A;  1NTY A;  1DDM A;  3V5W A;  3FSS A;  2D9W A;  4DXA B;  3A8Q A;  1K5G B;  4GN1 A;  4H8S A;  3TO1 A;  1FGZ A;  2LUL A;  2MFQ A;  3F5R A;  1V5P A;  1V61 A;  3NW8 A;  4DX9 0;  2KGX B;  2R09 A;  2D4Q A;  2W2X C;  4PQ0 A;  4A6K A;  2G35 A;  3ZDT A;  5HE0 A;  3PVL A;  5HE3 A;  4CHM A;  2KIE A;  1XD4 A;  4GMV A;  1IRS A;  1PFJ A;  4A6F B;  3IVF A;  3LJU X;  5JP4 A;  5LOP B;  5HE2 A;  4ZRI A;  1WGU A;  3A98 B;  3U7D A;  4HAY B;  1OQN A;  1X86 A;  4CYE A; 
#chains in the Genus database with same CATH homology
 3HSA A;  3DCX A;  3B77 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...