3DCXA

Crystal structure of a duf1696 family protein with a pleckstrin-homology domain (shew_0819) from shewanella loihica pv-4 at 2.00 a resolution
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
117
structure length
117
Chain Sequence
GGNAAEVNLDELAQELGPIMGDNEQLALAYRVIRDMFVFTNKRLILIDKQGVTGKKVSYHSVPYKAITHFEVETAGTFDMDAELKLWISGQKDPLVKELKKGTDVVGIQKTIANFSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Unknown function
molecule keywords Protein of Unknown Function (DUF1696) with Pleckstrin-homolo
publication title Bacterial pleckstrin homology domains: a prokaryotic origin for the PH domain.
pubmed doi rcsb
source organism Shewanella loihica pv-4
total genus 24
structure length 117
sequence length 117
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2008-06-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.50 Mainly Beta Roll PH-domain like Bacterial Pleckstrin homology domain 3dcxA00
3HSAA 3B77A 3DCXA
chains in the Genus database with same CATH superfamily
1EVHA 1GC6A 2RLOA 3GYOA 1XKEA 2W2WA 1UPRA 3ULBA 1X1GA 2IFSA 3X23A 5JHGA 5L81A 1DDVA 5C5BA 4A6FA 2N0YA 5HE3A 3U7DA 4EJNA 1MI1A 2EC1A 4KHOA 4ZRIA 1DDMA 4XWXA 1ZC4B 4C0AA 5J3QA 4CHMA 5D3WA 4GZUA 3IVFA 1UEFA 2D9YA 2CY4A 2Z13A 1T77A 1UNRA 1WI1A 4HB2B 3NSUA 3NWDA 2VRWB 2OQBA 3KZ1A 1EF1A 3PZDA 2COFA 1Y5OA 2D2QA 3SYXA 4IFSA 2DHIA 3HW2B 1NI2A 3HIEA 2K2UA 2LOZA 1UNQA 2VKIA 2P0HA 1E5WA 1XR0B 1ZC3B 3KY9A 1WVHA 1U5EA 2H7DA 3TCAA 1H4RA 2Z14A 2M38A 4K2OA 2JP2A 4GXBA 2R09A 4K2PA 2DN6A 1DBHA 1P5TA 4OSNA 5C16A 3LJUX 2AL6A 2MWNB 4A6FB 4HAWB 4WVFB 1EAZA 4Z2NA 3PG7A 1P6SA 5J3TA 1ZM0A 2X18A 1ISNA 4TKNA 3KRXA 4DBBA 1LB1A 3NW8A 2RVBB 1KZ7A 2LOXA 1W1HA 2EMSA 3QIJA 3SO6A 3HQCA 1J19A 4D0NB 4QJ4B 1FAOA 1NTVA 1X11A 2DX1A 1XD4A 2DKQA 4Z2MB 2K8EA 4H8SA 2YS1A 2J0MA 3P6AA 4HB3B 2H7EA 4IAPA 4QXAB 3V5WA 4A6KA 2P0FA 3A8QA 3M1IB 1XODA 4NY0A 3D8DA 3ODOA 2N23A 2D4QA 1ZVRA 1M7EA 1AQCA 4K81A 3U12A 4DXAB 1FHWA 4HHVA 3FM8C 2D9VA 4MT7A 3PSCA 1K5DB 5I2SA 2KUPA 4MK0A 2EJ8A 4F7HA 5KCVA 3PVLA 3OHMB 2GS0A 5LOPB 1WJMA 1MIZB 3AU5A 3FVCA 1Y19B 4OT1A 4KAXB 3CIKA 2GCLA 4GOUA 3G9WA 1QC6A 3HSAA 3KRWA 2DTCA 1V88A 2Q13A 2DFKA 2ADZA 2COAA 2CAYA 1MKEA 5I2MA 2ROZB 1BWNA 5D3VA 1BTKA 5HE2A 2G35A 2Y8FA 4CSQA 5HE0A 4L1RA 3PP2A 2LG1A 1KI1B 3U8ZA 4KHBB 2DX5A 2YS5A 2QKMA 5KQ1A 3P7ZA 4PQ0A 1MK7B 4TYZA 3SV1A 2K2JA 2R2YA 1W1GA 3PEGA 1OMWA 1FB8A 4QJ3B 3ML4A 1MAIA 3SNHA 3NWFA 1H10A 3VOQA 1WJ1A 4HAXB 2YSZA 5HE1A 1DYNA 4HAYB 5JP4A 3GYPA 4HATB 3QWMA 5DHAB 3DXEA 3SUZA 2GUMA 4DIXA 4EKUA 2Z59A 1OY2A 4GMXB 4HDOA 2QKLA 2AEHA 2W2XD 5DI9B 2P8VA 3N7CA 1J0WA 1SGHA 2COCA 3O96A 2KUQA 1MK9B 2Z0OA 2DYQA 2YT1A 1EGXA 1XX0A 3FSSA 1FHXA 4WSFA 2RRFA 4GMVA 1QQGA 3D8EA 1B55A 1BTNA 5D3XA 2UVMA 2PZ1A 5J3YA 2P0DA 2LYDA 2DA0A 3OANA 4MY6A 4KHAA 2D9XA 2I5FA 1ZYIA 3TW1A 2M14A 1X1FA 1K5GB 2RSGA 1ZSQA 4KHBA 4GPTB 2FJLA 4BBKA 2DKPA 4QJ5B 5JLJB 3ODWA 2J0JA 1KZGA 1FGZA 1V89A 2KIEA 1M7RA 1NU2A 3TO1A 4PNKA 1DDWA 1UPQA 1Z87A 4F7UP 3MPXA 2K00A 2Z4DA 1V5UA 2D9ZA 1Q67A 2MFQA 4HB0B 2HTHB 1GG3A 3DXDA 2NMBA 1U27A 2L1CA 4HAUB 1PLSA 1WGQA 5LG4B 2UZSA 1TXDA 1DROA 2NBVA 2DHKA 2YRYA 4GNKB 1WGUA 3NWAA 4B6HA 4K17A 4CYEA 2RGNB 1V5MA 2OTXA 3FEHA 1OQNA 4Y94A 3A8PA 5GOWB 1UNPA 2Y7BA 3A98B 4YL8A 1SHCA 2UZRA 2Z0QA 1I2HA 2J59M 1TQZA 1LW3A 1IRSA 1PFJA 1XCGA 2MDXA 1I7AA 4WJ7A 1BAKA 5CLQB 5CLLB 3DCXA 5M4YB 3PVWA 2W2XC 4HB4B 3WA0A 2CRFA 2ZKMX 2EMTA 4CHJA 4NSWA 3MDBC 5FI0A 5EFXA 2XQNM 1NTYA 2V76A 4HAZB 4ZRJA 4ZRKA 1U5GA 2D11A 4DX90 2I1KA 1FGYA 2YVCA 2K49A 3QBVB 1U5DA 3F5RA 1TJ6A 1U29A 2CODA 2Z0PA 2NZ8B 5DHFB 3WYFB 2ZPYA 3F0WA 3ZVRA 3TVVA 2L2IA 3D8FA 2GJYA 1N3HA 2FJUB 1WG7A 2IYBA 2HE7A 1MIXA 5JHHA 2RUKB 5C79A 2MKRA 5D3YA 1X86A 2KR0A 4HSIA 2LULA 1P3RA 4YONA 3TFMA 5KQ4A 2I5CA 2BCJA 2J0KA 1V5PA 2I1JA 4A5KA 2KGXB 5C5BB 3VIAA 1W1DA 1FOEA 4HDQA 3DXCA 1RRPB 2CY5A 4F7GA 2YT2A 4D6WA 1RJ2A 2YS3A 2VSZA 5DH9B 2D10A 4GN1A 1FHOA 3RCPA 4A6HA 1U5FA 2R0DA 4HAVB 3KSYA 2YT0A 3B77A 2E2XA 5D27A 3AU4A 5FI1A 2Y8GA 5IRSA 2GCJA 2KIGA 5LONB 5DIFB 5C6RA 2ELAA 1PMSA 3UZTA 3BJIA 2ROVA 2DYNA 3BINA 2ELBA 3CXBB 1V61A 1MPHA 3AJ4A 4DX8A 1GC7A 2YF0A 3ZDTA 1X05A 3HK0A 3T06A 4L6EA 2RNRB 4EMOA 4KVGB 3PVUA 3A58A 3ULCA 2DHJA 1AWEA 1U2BA 2DLWA 4P7IA 4IOYX 2LKOA 2D9WA 3ODXA 2KCJA
chains in the Genus database with same CATH topology
3HSAA 3B77A 3DCXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HSA A;  3B77 A;  3DCX A; 
#chains in the Genus database with same CATH topology
 1EVH A;  1GC6 A;  2RLO A;  3GYO A;  1XKE A;  2W2W A;  1UPR A;  3ULB A;  1X1G A;  2IFS A;  3X23 A;  5JHG A;  5L81 A;  1DDV A;  5C5B A;  4A6F A;  2N0Y A;  5HE3 A;  3U7D A;  4EJN A;  1MI1 A;  2EC1 A;  4KHO A;  4ZRI A;  1DDM A;  4XWX A;  1ZC4 B;  4C0A A;  5J3Q A;  4CHM A;  5D3W A;  4GZU A;  3IVF A;  1UEF A;  2D9Y A;  2CY4 A;  2Z13 A;  1T77 A;  1UNR A;  1WI1 A;  4HB2 B;  3NSU A;  3NWD A;  2VRW B;  2OQB A;  3KZ1 A;  1EF1 A;  3PZD A;  2COF A;  1Y5O A;  2D2Q A;  3SYX A;  4IFS A;  2DHI A;  3HW2 B;  1NI2 A;  3HIE A;  2K2U A;  2LOZ A;  1UNQ A;  2VKI A;  2P0H A;  1E5W A;  1XR0 B;  1ZC3 B;  3KY9 A;  1WVH A;  1U5E A;  2H7D A;  3TCA A;  1H4R A;  2Z14 A;  2M38 A;  4K2O A;  2JP2 A;  4GXB A;  2R09 A;  4K2P A;  2DN6 A;  1DBH A;  1P5T A;  4OSN A;  5C16 A;  3LJU X;  2AL6 A;  2MWN B;  4A6F B;  4HAW B;  4WVF B;  1EAZ A;  4Z2N A;  3PG7 A;  1P6S A;  5J3T A;  1ZM0 A;  2X18 A;  1ISN A;  4TKN A;  3KRX A;  4DBB A;  1LB1 A;  3NW8 A;  2RVB B;  1KZ7 A;  2LOX A;  1W1H A;  2EMS A;  3QIJ A;  3SO6 A;  3HQC A;  1J19 A;  4D0N B;  4QJ4 B;  1FAO A;  1NTV A;  1X11 A;  2DX1 A;  1XD4 A;  2DKQ A;  4Z2M B;  2K8E A;  4H8S A;  2YS1 A;  2J0M A;  3P6A A;  4HB3 B;  2H7E A;  4IAP A;  4QXA B;  3V5W A;  4A6K A;  2P0F A;  3A8Q A;  3M1I B;  1XOD A;  4NY0 A;  3D8D A;  3ODO A;  2N23 A;  2D4Q A;  1ZVR A;  1M7E A;  1AQC A;  4K81 A;  3U12 A;  4DXA B;  1FHW A;  4HHV A;  3FM8 C;  2D9V A;  4MT7 A;  3PSC A;  1K5D B;  5I2S A;  2KUP A;  4MK0 A;  2EJ8 A;  4F7H A;  5KCV A;  3PVL A;  3OHM B;  2GS0 A;  5LOP B;  1WJM A;  1MIZ B;  3AU5 A;  3FVC A;  1Y19 B;  4OT1 A;  4KAX B;  3CIK A;  2GCL A;  4GOU A;  3G9W A;  1QC6 A;  3HSA A;  3KRW A;  2DTC A;  1V88 A;  2Q13 A;  2DFK A;  2ADZ A;  2COA A;  2CAY A;  1MKE A;  5I2M A;  2ROZ B;  1BWN A;  5D3V A;  1BTK A;  5HE2 A;  2G35 A;  2Y8F A;  4CSQ A;  5HE0 A;  4L1R A;  3PP2 A;  2LG1 A;  1KI1 B;  3U8Z A;  4KHB B;  2DX5 A;  2YS5 A;  2QKM A;  5KQ1 A;  3P7Z A;  4PQ0 A;  1MK7 B;  4TYZ A;  3SV1 A;  2K2J A;  2R2Y A;  1W1G A;  3PEG A;  1OMW A;  1FB8 A;  4QJ3 B;  3ML4 A;  1MAI A;  3SNH A;  3NWF A;  1H10 A;  3VOQ A;  1WJ1 A;  4HAX B;  2YSZ A;  5HE1 A;  1DYN A;  4HAY B;  5JP4 A;  3GYP A;  4HAT B;  3QWM A;  5DHA B;  3DXE A;  3SUZ A;  2GUM A;  4DIX A;  4EKU A;  2Z59 A;  1OY2 A;  4GMX B;  4HDO A;  2QKL A;  2AEH A;  2W2X D;  5DI9 B;  2P8V A;  3N7C A;  1J0W A;  1SGH A;  2COC A;  3O96 A;  2KUQ A;  1MK9 B;  2Z0O A;  2DYQ A;  2YT1 A;  1EGX A;  1XX0 A;  3FSS A;  1FHX A;  4WSF A;  2RRF A;  4GMV A;  1QQG A;  3D8E A;  1B55 A;  1BTN A;  5D3X A;  2UVM A;  2PZ1 A;  5J3Y A;  2P0D A;  2LYD A;  2DA0 A;  3OAN A;  4MY6 A;  4KHA A;  2D9X A;  2I5F A;  1ZYI A;  3TW1 A;  2M14 A;  1X1F A;  1K5G B;  2RSG A;  1ZSQ A;  4KHB A;  4GPT B;  2FJL A;  4BBK A;  2DKP A;  4QJ5 B;  5JLJ B;  3ODW A;  2J0J A;  1KZG A;  1FGZ A;  1V89 A;  2KIE A;  1M7R A;  1NU2 A;  3TO1 A;  4PNK A;  1DDW A;  1UPQ A;  1Z87 A;  4F7U P;  3MPX A;  2K00 A;  2Z4D A;  1V5U A;  2D9Z A;  1Q67 A;  2MFQ A;  4HB0 B;  2HTH B;  1GG3 A;  3DXD A;  2NMB A;  1U27 A;  2L1C A;  4HAU B;  1PLS A;  1WGQ A;  5LG4 B;  2UZS A;  1TXD A;  1DRO A;  2NBV A;  2DHK A;  2YRY A;  4GNK B;  1WGU A;  3NWA A;  4B6H A;  4K17 A;  4CYE A;  2RGN B;  1V5M A;  2OTX A;  3FEH A;  1OQN A;  4Y94 A;  3A8P A;  5GOW B;  1UNP A;  2Y7B A;  3A98 B;  4YL8 A;  1SHC A;  2UZR A;  2Z0Q A;  1I2H A;  2J59 M;  1TQZ A;  1LW3 A;  1IRS A;  1PFJ A;  1XCG A;  2MDX A;  1I7A A;  4WJ7 A;  1BAK A;  5CLQ B;  5CLL B;  3DCX A;  5M4Y B;  3PVW A;  2W2X C;  4HB4 B;  3WA0 A;  2CRF A;  2ZKM X;  2EMT A;  4CHJ A;  4NSW A;  3MDB C;  5FI0 A;  5EFX A;  2XQN M;  1NTY A;  2V76 A;  4HAZ B;  4ZRJ A;  4ZRK A;  1U5G A;  2D11 A;  4DX9 0;  2I1K A;  1FGY A;  2YVC A;  2K49 A;  3QBV B;  1U5D A;  3F5R A;  1TJ6 A;  1U29 A;  2COD A;  2Z0P A;  2NZ8 B;  5DHF B;  3WYF B;  2ZPY A;  3F0W A;  3ZVR A;  3TVV A;  2L2I A;  3D8F A;  2GJY A;  1N3H A;  2FJU B;  1WG7 A;  2IYB A;  2HE7 A;  1MIX A;  5JHH A;  2RUK B;  5C79 A;  2MKR A;  5D3Y A;  1X86 A;  2KR0 A;  4HSI A;  2LUL A;  1P3R A;  4YON A;  3TFM A;  5KQ4 A;  2I5C A;  2BCJ A;  2J0K A;  1V5P A;  2I1J A;  4A5K A;  2KGX B;  5C5B B;  3VIA A;  1W1D A;  1FOE A;  4HDQ A;  3DXC A;  1RRP B;  2CY5 A;  4F7G A;  2YT2 A;  4D6W A;  1RJ2 A;  2YS3 A;  2VSZ A;  5DH9 B;  2D10 A;  4GN1 A;  1FHO A;  3RCP A;  4A6H A;  1U5F A;  2R0D A;  4HAV B;  3KSY A;  2YT0 A;  3B77 A;  2E2X A;  5D27 A;  3AU4 A;  5FI1 A;  2Y8G A;  5IRS A;  2GCJ A;  2KIG A;  5LON B;  5DIF B;  5C6R A;  2ELA A;  1PMS A;  3UZT A;  3BJI A;  2ROV A;  2DYN A;  3BIN A;  2ELB A;  3CXB B;  1V61 A;  1MPH A;  3AJ4 A;  4DX8 A;  1GC7 A;  2YF0 A;  3ZDT A;  1X05 A;  3HK0 A;  3T06 A;  4L6E A;  2RNR B;  4EMO A;  4KVG B;  3PVU A;  3A58 A;  3ULC A;  2DHJ A;  1AWE A;  1U2B A;  2DLW A;  4P7I A;  4IOY X;  2LKO A;  2D9W A;  3ODX A;  2KCJ A; 
#chains in the Genus database with same CATH homology
 3HSA A;  3B77 A;  3DCX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...