3O96A

Crystal structure of human akt1 with an allosteric inhibitor
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
428
structure length
367
Chain Sequence
SDVAIVKEGWLHKRGEYIKTWRPRYFLLKNDGTFIGYKERPQDVEAPLNNFSVAQCQLMKTERPRPNTFIIRCLQWTTVIERTFTPEEREEWTTAIQTVADGLKKQVTMNEFEYLKLLGKGTFGKVILVKEKATGRYYAMKILKKEVIVANRVLQNSRHPFLTALKYSFQTHDRLCFVMEYANGGELFFHLSRERVFSEDRARFYGAEIVSALDYLHSEKNVVYRDLKLENLMLDKDGHIKITDFGLCKEPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHEKLFELILMEEIRFPRTLGPEAKSLLSGLLKKDPKQRLGGGSEDAKEIMQHRFFAGIVWQHVYEKKLSPPFKPQV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords RAC-alpha serine/threonine-protein kinase
publication title Crystal structure of human AKT1 with an allosteric inhibitor reveals a new mode of kinase inhibition.
pubmed doi rcsb
source organism Homo sapiens
total genus 99
structure length 367
sequence length 428
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2010-08-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
A PF00169 PH PH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3o96A03
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 3o96A01
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3o96A02
4ZS0A 2X7OA 3MH2A 5AV3A 3S95A 4CMTA 4X21A 2WMUA 2W99B 3NUNA 4FKJA 2V22A 2UZVA 4KBAA 3VWAA 2QVSE 3JPVA 4EKKA 3OEFX 3KXGA 3QTZA 3E63A 4I0SA 5LOPB 4RSSA 2D2QA 2VWWA 4GT4A 3ZH8A 1XH8A 2P2IA 3IQ7A 4HYUA 4EBVA 4Z2NA 3I4BA 4USEA 4L6QA 1W8CA 2JFMA 3FPMA 3ZXTA 4BCQA 5HD7A 1PKGA 1HCKA 3A62A 3F66A 4UXQA 2Y8OA 2YIYA 2YJRA 2X4FA 1KWPA 1M52A 2VGPA 3BI6A 3G51A 3BLRA 4FC0A 4FSNA 1DS5A 4H3BA 4L3LA 4OTGA 3VS2A 3TIZA 4K81A 4FBXA 3Q6WA 3T3VA 2NP8A 3FZSA 4ZP5A 3MIAA 2A19B 3R30A 4CMUA 2QD9A 5AR7A 1YVJA 3R1YA 2OZAA 2IN6A 3NUAA 2PE1A 3PFQA 1AQCA 1YQJA 4D1ZA 2JDRA 5E9EA 4HGSA 5BVOA 4EWQA 1MK7B 1TKIA 5AV0A 3FI3A 5H9BA 4EZ7A 2HE7A 2VZ6A 2WB8A 4GEOA 4WT6A 4M84A 4W8DA 3MA3A 3TV7A 5TKDA 2JBPA 1MPHA 3DLZA 3OWKA 4IM0A 2F2UA 4ZTNA 1LEZA 2H34A 3ZZEA 4ACCA 4JG6A 2YCRA 4ALVA 5FTOA 4EH6A 3REPA 4L42A 3VBVA 1U5QA 1R3CA 4LOQA 3UNKA 1KZGA 4MNFA 3GYOA 2IVSA 1RJ2A 4LRJA 4Q5HA 3WZEA 3JUHA 4XLIA 4AF3A 4IXPA 5TR6A 4AZFA 2B54A 1XH4A 2GCDA 2VX3A 5BVFA 3DDQA 4ANMA 4Z2MB 4GUBA 4L53A 5CI6A 3CP9A 2XK7A 4IE9A 2UZNA 4XRJA 4RWJA 2PL0A 4GVJA 5AUXA 4FMQA 4CXAA 4ASEA 5JRQA 1VEBA 1VJYA 3LJ1A 3KXHA 4QQ5A 4U41A 3QUDA 4WHZA 2H8HA 4AX8A 4O81A 1WGQA 4NSWA 1J91A 1OPLA 3SNHA 3PLAE 1RDQE 3D83A 3NUPA 2YITA 5BMMA 3A98B 1IR3A 3NZ0A 3K3IA 5FBNC 4FTJA 3O71A 3P5KA 3ZC5A 4DITA 3RNIA 1GC6A 2AL6A 4R5YA 3LKMA 3VBTA 1OMWA 4ZLZA 4TNDA 5H3QA 1H0VA 4NFMA 5M09A 3CC6A 2Z8CA 4C3RA 3VIDA 4PRJA 3LFNA 3KFAA 5CU0A 4GYIA 3F5GA 4MQ2A 2OWBA 3IOKA 2EU9A 1ZYDA 3BE2A 4WSFA 3MVJA 1UU7A 3ACJA 5D7VA 4BCKA 2JKOA 5CT7A 3TV6A 4IWPA 5CLLB 4ITIA 2V7AA 2XK9A 4IB1A 2VTHA 4OTPA 3D7ZA 4K6ZA 4IAZA 3NYXA 4EQCA 1FGZA 2B55A 4H05A 4QMTA 2WPAA 1DBHA 5HO6A 3W8QA 1WAKA 3QA0A 1E1VA 5DT3A 3W2CA 2IJMA 5J3YA 2C6IA 2B4SB 1ZXEA 2ITXA 2QR7A 3M42A 4PMSA 2BAJA 4RX9A 3RALA 3T9IA 4RIWA 2CODA 1IAJA 2QO9A 4RC3A 2IZSA 5C79A 4IMYA 2GHLA 3OXIA 3TXOA 3R1NA 3GCPA 2GNJA 3C13A 1IG1A 3EQBA 3ORMA 3QC4A 3F88A 1ZC4B 5EK7A 1SM2A 3V5WA 3Q4UA 4MBIA 4AN9A 3DDPA 4XMOA 2XJ2A 3LMIA 2QG7A 2FH9A 4FV5A 3DK3A 4BKYA 1GZ8A 3R1QA 4C2WA 1H26A 5A6NA 2GHMA 3A61A 3F3WA 2X8EA 1E9HA 2AC5A 3LFCA 4FKSA 4IQ6A 4CTCA 3ET7A 3K5VA 4FNXA 1DI9A 3E93A 3EN6A 4W4YA 3SG9A 3TUBA 5DBXA 4D4VA 1K5DB 3WIKA 3FMMA 3R9DA 2HY0A 4RVTA 5M07A 2J4ZA 4FNYA 4A5KA 2YZAA 3ZO2A 5CLQB 5J3QA 3VJOA 4QNAA 2AUHA 3R7YA 4A9SA 4JS8A 4X3FA 5AP1A 4ZS4A 1OQNA 5J9ZA 5JFVA 2PVYA 4FOBA 5BVDA 2R3HA 2XKFA 3DZQA 1BI8A 3LFAA 3QXOA 5JQ8A 4P7IA 4DCAA 2Z7SA 5FLFA 3FKNA 4WUAA 3V5TA 1R0PA 4XG8A 3UO4A 1OIUA 1SNUA 2NRYA 1OGUA 4TPTA 2E2XA 4WSQA 3CLYA 4JOAA 5HIBA 4TTHB 3RWPA 4KINA 1Z57A 3F0WA 5EM5A 4PL4A 4FSRA 3RAHA 3G9NA 1WVXA 4BCFA 2FGIA 1OM1A 4FKGA 4G5JA 4B6LA 5IQGA 2YAAA 3CXWA 3I7CA 2M14A 2OICA 3QXPA 2PPQA 3MI9A 2R3MA 4UMUA 4YJTA 2XCKA 5AA8A 3AT4A 4M66A 3BU3A 4AA0A 2GCJA 3RK7A 2I1MA 3CTQA 5BYYA 2C5OA 3D9VA 3QZIA 3FQSA 4LM5A 2YS3A 3U54A 3KL8A 2E9UA 3S00A 5CANA 2GPHA 3DLSA 5FUTA 5KMOA 3EQDA 4F7GA 5HCXA 3LLTA 4S33A 3ZLWA 1Y5OA 3FI2A 2RIOA 2XNEA 5C8KA 5HU3A 5B2KA 4IOYX 1Q8TA 3GGFA 5IH5A 1JKKA 2GS7A 2VO6A 2I0EA 4ENXA 3MFUA 4FZ6A 5FXSA 2PUIA 1O9UA 1FGIA 3IS5A 4IAYA 5A6OA 5EG3A 4O6EA 4BTKA 5AUWA 4BTMA 2W5HA 3ZUTA 4A7CA 3HDMA 2OF2A 3FXZA 2EJ8A 2G15A 4DT8A 1QMZA 4CG9A 2WU6A 3TCPA 4RC2A 2VWVA 3NAXA 2H7DA 3PYYA 2CNQA 1LP4A 2VTQA 3FSSA 2NRUA 2ROVA 1UU3A 3U6JA 2R3FA 4U3YA 3F2RA 5IQFA 5FGKA 4BCJA 4PQ0A 3MFSA 4D4SA 3VUDA 5CU3A 3ML4A 3ID6C 4GIIA 5M44A 2GDOA 3TIYA 3RWQA 3PPJA 1Q24A 5A54A 2Y6MA 2CGUA 3D2IA 3CBLA 3OWLA 2J0MB 4WBOA 4GK3A 3TNHA 3KRRA 3ORPA 3QTSA 4EONA 4ANSA 1PXIA 4ANNA 3QQGA 4EKUA 4YHFA 3B2WA 4F6UA 4F9AA 2Y4IC 2W2XC 3LJ0A 3DQXA 3MFRA 5L81A 5LOHA 1UKIA 3ZC6A 1W1DA 1W83A 3MY5A 3QKKA 2CN8A 4LL5A 1BTNA 2D9XA 1EAZA 2XIZA 2RFEA 2LG1A 3L8XA 4LGDA 4MNEB 2PVRA 4XBRA 2XF0A 3K3JA 3MB7A 5DWRA 1XODA 2Q13A 2JP2A 3ORLA 4HPUE 1XH7A 2W1EA 5IZFA 4OTQA 4BYIA 5L2TA 3PIZA 3Q2MA 3T8OA 2CY5A 2Z0PA 3HAVA 4NZWB 2CDZA 4KKEA 3NUSA 4QMYA 3OMVA 4IIRA 4QP4A 4C2VA 5C1QB 5IPJA 3IDBA 2OFUA 1M7EA 2EXMA 4GSBA 2WO6A 2VTSA 4AFJA 2CHLA 2K2JA 3DJ6A 5CVHA 2QLUA 4YC8A 2X2MA 5DG5A 2BUJA 3ZBFA 3PRIA 1IA9A 4MXYA 4Y85A 2WTCA 2Y4IB 2FUMA 3PZDA 5CAOA 5L8LA 2AYPA 3GCUA 3MTLA 5CSXA 2PVLA 5F4NA 3VUMA 3TJCA 2UW3A 3UZPA 2YCSA 4ERKA 1WCCA 3HEGA 1F3MC 2YVCA 2PTKA 3OWJA 3ULIA 1FHXA 3MA6A 3KXZA 3MFTA 3QU0A 1PXPA 4M15A 1OPKA 4E5WA 1NTYA 3HECA 5TF9A 3R7OA 4YJRA 2IZTA 2XIRA 4JBOA 4YLJA 3LQ8A 3TNIA 2LULA 4FGBA 4MXAA 2YDIA 3BPRA 2QHNA 5JFSA 3H30A 2OG8A 3UE4A 2P0DA 3NVKI 3T06A 1YHWA 2R3RA 3BHTA 4GFMA 1W7HA 4KWPA 5JRSA 1Y91A 3TACA 1L8TA 1UNGA 3W2SA 3R63A 4BDFA 4A6HA 4YNEA 1P5EA 4R1YA 4ZTMA 4EQMA 1BWNA 4C33A 2J0LA 2PUUA 5A14A 2HTHB 1EGXA 1QL6A 3HV4A 3HDNA 3I81A 4MYGA 2H7EA 4DX90 2J5EA 2BZJA 3TKIA 3EYGA 4EK4A 5KHWA 4BIBA 2YJSA 4I5HA 3PPZA 1KE6A 4BB4A 2J50A 5DRDA 3S1HA 4GFOA 3U6HA 5T6KA 5DFPA 2DYLA 2WMQA 3IDCA 5EM7A 4QMXA 2EUFB 2BFXA 3MBLA 3KZ1A 1GAGA 2XP2A 4QTAA 4HVHA 4BBMA 4BTJA 4KD1A 5J7BA 1QC6A 2X39A 4RA5A 2DN6A 5DEYA 4FEWA 2QOKA 3M2WA 3O50A 3SO6A 4AWIA 3V6RA 1QPEA 3BYVA 3S3IA 3BQRA 5F95A 1CKIA 4S34A 4Z55A 3MDBC 2N0YA 2ITZA 4GYGA 1T46A 4IM2A 4U43A 4OLIA 2XIYA 5HLNA 2QO7A 5KMNA 2C1AA 2J5FA 2R7IA 2YLFA 3EFWA 2J9MA 3P7AA 3DPKA 2GQGA 3PLSA 3CS9A 4ITJA 4BICA 3THBA 2ITOA 4USFA 5LQFA 1YWRA 1FOEA 4ZRIA 4BBKA 1PXLA 3G33A 1U5DA 3G0FA 2Q83A 3H3CA 1TQZA 2OH4A 4L01A 4DH1A 3TW1A 4OTDA 1SVHA 5KMKA 4GJ2A 5ETIA 3BYUA 3LZBA 1H1WA 4J7BA 4C4FA 5LVNA 4FSQA 2EC1A 2FVDA 2PZPA 3QTUA 4EJNA 4A9TA 5GNKA 5AAGA 1XCGA 1OY2A 1PMEA 4EJ7A 2ITWA 4RA4A 1ZAOA 3PXYA 3H4JA 4G6OA 4C34A 2Z7QA 4A9YA 1XKEA 4OTHA 1JOWB 3TZ9A 4B7TA 3QTRA 1SMHA 3DTWA 1FINA 4I6BA 4HYIA 3MB6A 2CJMA 5HD4A 1PKDA 4NY0A 2E9OA 5A4TA 4TYIA 2VV9A 3EFLA 5T68A 5CT0A 4X2KA 4ZSGA 1M14A 1OUYA 5I9YA 3Q53A 3WA0A 1PXOA 3L9MA 1GNGA 2FSOX 3MJ2A 3E8EA 4YTFA 4HB3B 3AC1A 3W16A 4BGQA 2G35A 1UKHA 5JK3A 3SOAA 4RVKA 3D7TB 2ZVAA 4FV6A 4IAFA 5CS6A 1RJBA 4HAZB 4C59A 4EYJA 1IASA 4W4WA 3A7IA 3ANRA 4FTCA 1JKTA 3EKKA 4EH8A 3BHVA 3C4WA 3HRBA 4IM3A 4I3ZA 4O0TA 3MV5A 4DTBA 4V0GA 4GN1A 2UVYA 2ERKA 4ACHA 2CGVA 4EZ3A 3LPBA 1H08A 3AT2A 3TO1A 1UVRA 5H8GA 2J90A 5LMKC 3W1FA 3ZUVA 4BGHA 5CASA 2YF0A 4G3GA 4I5CA 4EK5A 3VW6A 4FTNA 2C5XA 4KBCA 3ZU7A 2DKQA 4M14A 2OU7A 3SQQA 3ZLYA 2HZIA 4ALWA 2BILB 4J95A 4FT7A 3BYSA 1Y6BA 3G90X 2F7ZE 2XNNA 4C35A 5LXMA 1U54A 2X0GA 4DGMA 1NT2A 5FD2A 3R7IA 3Q4TA 3PPKA 3S2PA 3UQGA 3IGGA 3FAAA 4XNEA 3TEIA 1MRUA 2OJGA 4JIKA 3KY2A 2DX1A 2O8YA 2P0FA 2C0OA 4BWPA 4K9YA 1YI6A 4YJOA 5E4HA 5AX9A 5HCZA 3KULB 3KXNA 3QRIA 3GC0A 3GEQA 1A9UA 2WIHA 4FIEA 4U7ZA 3R9OA 3BBWA 5EKNA 2D10A 4HAXB 4NM5A 1ZYCA 3ZEWA 2R09A 3ULCA 3C4ZA 4OR5A 4ZSEA 1V0BA 3BGPA 3R28A 4QPSA 5HVKA 1W98A 4YZDA 3DBEA 4F99A 4E8AA 5DH9B 3RPOA 1J19A 3O96A 4JI9A 3G0EA 4QQCA 4HGTA 1XH6A 5J87A 3V01A 2WMVA 4FKIA 4AE9A 2B52A 3V8SA 2NMBA 5B0XA 1QCFA 4W9XA 4G31A 2I1KA 3FY2A 2J7TA 5ANEA 5HIEA 3BQCA 4WOVA 2RSVA 4YPDA 4JXFA 2FSTX 2V76A 3DXCA 1SHCA 4U5JA 3VULA 3NDMA 3ZOSA 4DX8A 3C9WA 4MBLA 3S0OA 3PVGA 4HB4B 5DYJA 4XV9A 2PHKA 3LM5A 4XS2A 3R7UA 4FSUA 3RK9A 4YU2A 5J9LA 3EWHA 2UZSA 4MWHA 4JDJA 2RNRB 1GIJA 5C03A 2ONLA 4QMUA 4MF1A 4D2VA 4IZYA 3UZTA 4FV0A 2ESMA 4JL9A 3TM0A 2WMTA 1EH4A 1J1CA 2BRGA 3MESA 2CGXA 3GFEA 5BVWA 4F0FA 3FLQA 2HZ4A 5F1ZA 4JAJA 3V51A 5J95A 4CZTA 4ZEGA 3RM7A 3VUHA 1FBNA 2NPQA 3CGFA 3FMKA 4RIYB 5KO1A 4A6KA 5AMNA 3FXXA 4Z7HA 4XG4A 3OCTA 5M4FA 4ZSAA 5AP7A 1JSTA 5AAFA 4EUTA 2WELA 5LVPA 1PMVA 3FY0A 3NW7A 4AS0A 4CD0A 3DKGA 5HG8A 3KSYA 3W33A 4DGOA 1I2HA 3U87A 3SC1A 5C6RA 4GUEA 3R83A 4HAUB 4X2GA 1BL7A 3VS0A 3FLZA 3Q9XA 3POZA 4KAXB 3OW3A 2G1TA 3ZSGA 3BCEA 5M53A 3FMHA 4XV3A 4LMNA 2E9NA 5EDQA 3ZYAA 4V05A 4DF3A 2GS6A 3CJFA 3FSKA 5FWKK 1J7UA 4BR3A 4EH2A 2WHBA 3ZXZA 3QBNA 1MRYA 4NH1A 2UV2A 4F64A 5D3WA 4CCUA 4WVFB 4ZRKA 4KS7A 4IZ7A 4UWCA 1JPAA 2KGXB 4MQ1A 2GHGA 4ZMEA 2R3PA 4IJPA 5CQWA 4YJSA 1WBVA 1J1BA 2BROA 3QZHA 2LAVA 4B8MA 1OBDA 2VNYA 4IX3A 4BBEA 3SGCA 4DTAA 2DTCA 4A07A 3S4QA 2R3IA 5KE0A 4FG9A 4IX4A 4UZDA 4FV3A 3LIJA 4YO4A 2HOGA 1YXUA 3PXKA 3QRKA 4BDCA 4B6HA 4O0UA 2PVFA 4MX9A 4PTGA 4F4PA 2JFLA 4HAWB 2GMXA 2WGJA 4HYHA 2G2IA 3UMXA 3OBGA 3TJDA 2DWBA 2IZUA 1Z5MA 2A2AA 5AA9A 1XR1A 2DA0A 2WXVA 4FKVA 3KC3A 3NW5A 4U79A 3P7BA 2C6LA 3P1AA 1NTVA 4QP1A 3GFWA 4IAKA 5K4IA 1PXKA 4IFCA 4FG7A 4AGWA 4E3CA 4F6WA 3QTIA 2XEYA 3AC3A 4I5MA 4I5PA 3PE1A 1VR2A 2BRHA 5LVMA 4F6SA 3KA0A 4S31A 4NW5A 1OL6A 3NUUA 1BMKA 4G6LA 3HW2B 2UZOA 4CKRA 4BL1A 3EQCA 5J5SA 2OBJA 4XH6A 1ZLTA 4PP7A 5C5BA 5HBEA 3GC9A 4GU9A 4ID7A 4IACA 4RJ3A 5K0KA 4C02A 2B0QA 4IVAA 3I79A 2OJFE 3QQUA 4ZY4A 3NAYA 4MCVA 3UVQA 3FZOA 3MPAA 4NW6A 3BV3A 4BI2A 5HE3A 2C5NA 3RI1A 3W2OA 4BN1A 2MDXA 3OTVA 2GTNA 3C0HA 4M69A 5L4QA 4GU6A 2CN5A 5A3XA 3AC8A 1WJMA 2VWZA 2XNPA 4ERWA 3HL7A 3HMMA 4F7JA 3D94A 3ROYA 4OGRA 4Y95A 3E8CA 4CHJA 2C6TA 3GU6A 4NIFA 4BIDA 2YISA 3HLLA 3EMGA 3UIBA 3WE4A 5CAUA 3EQPA 1F0QA 3AQVA 3BZ3A 2R3GA 3SV0A 4MH7A 2OI4X 4USDA 2ITYA 4DGGA 4E93A 2VWXA 4QP2A 4CGAA 4G34A 3KCKA 5JH6A 4A9RA 4XEYA 1GY3A 3Q60A 1OIQA 4DCEA 3U8ZA 5HEZA 2VRWB 4U44A 4O0XA 4P90A 2H96A 4LI5A 3SD0A 1SVGA 1PW2A 5KKRC 2W5BA 3WZUA 1ZVRA 2CKPA 4E6CA 5AUZA 2P55A 1JKLA 5TE0A 4AGCA 4O0YA 4D58A 3FL5A 3VW8A 2WU7A 3SVVA 3QYWA 3CPBA 5TT7A 5FDPA 3JXWA 3VUGA 4ASDA 1DDVA 3DQWA 4CLIA 3G5DA 5ANJA 2YM3A 2R0UA 3R04A 3SRVB 3C4EA 4TNBA 4IZAA 4AGUA 5EDRA 1ZMWA 1R78A 2OZOA 4PMMA 4FEQA 4EBWA 2A27A 3NIZA 4TRLA 3E8DA 4X6RA 4KIKA 1H4RA 4O22A 2CMWA 2ITVA 4IZ5A 2JD5A 2QHMA 4P7EA 1ZC3B 5CQUA 2ZJWA 1S9JA 2G9XA 5D3VA 2VRXA 4H36A 3BIZA 3V5PA 3KMUA 1H24A 1IRKA 4YURA 4KS8A 2ZYBA 4RJ5A 5E7RA 3VBWA 4RJ8A 3AC2A 1K5GB 2ITPA 2JEDA 5KKRB 3VBXA 4UALA 2COCA 3WYFB 4QP7A 5ETFA 3VF8A 2W05A 4XV2A 4F08A 5K4JA 3QD0A 1WG7A 3DXEA 4C3PA 4APCA 3E3BX 4AXAA 1ZWSA 2JIVA 4L3JA 2YEXA 1H1PA 3DBCA 5HIDA 3V3VA 5M06A 4PDYA 4YUQA 3COHA 2ROZB 3QHWA 5DNRA 3MDYA 3BRBA 2C6MA 4FG8A 4KIOA 3W55A 1P14A 3PXQA 3DB6A 2ITQA 5AR8A 1BX6A 2FO0A 1Q67A 2V7OA 3GI3A 3R6XA 2BPMA 4RMZA 5D11A 5C9CA 4QQJA 4I6HA 4FOCA 5HE0A 2IG7A 1DAWA 1PY5A 4IW0A 2GFCA 3FPQA 1U46A 2H6DA 4EQUA 3TKUA 3IKAA 5BQ0A 5FXQA 2YM7A 4GW8A 2PZ5A 1W0XC 1PXJA 2VTPA 4FYNA 2B7AA 1M17A 3C5UA 3LQ5A 3VBQA 2IWIA 1PJKA 3GU7A 3A8WA 1XKKA 4O0VA 5JGAA 5LCKA 5IEVA 2R0IA 3BLHA 2PUNA 3A4OX 4ZTSA 4K8AA 3UP2A 3FLWA 4H3QA 4ZTRA 2UW5A 2PMOX 3P6AA 4H8SA 4IX6A 3PY0A 4CG8A 5J8IA 2WD1A 4FNWA 4TYHB 3NNVA 3QA8A 3PUPA 3QKLA 5DA3A 4ARKA 3WF7A 3NEWA 4NWMA 4C3FA 1O6LA 2E9PA 2BCJA 3LW0A 3QQLA 5AADA 3WZKA 2XJ0A 3TUDA 4D28A 4XG7A 4FKWA 5ICPA 5IISA 2VNWA 2XZSA 1WBNA 4GV1A 5BX0A 3MH0A 5CXZA 3LCOA 1ZYLA 5LARA 4QOXA 4G2FA 4ITHA 4RX8A 4K2PA 4Y73A 4M13A 4BHZA 3MTFA 1CMKE 2O64A 3SLSA 2ADZA 3ORZA 3M1IB 3GYPA 1NVQA 2C3JA 3SX9A 2XNBA 3D14A 3VVHA 5KBRA 2KULA 4FL1A 1KZ7A 4K1BA 4TYEA 2Q0BA 2BALA 3PY1A 3UPZA 3WZJA 5C4LA 4FSTA 4JAIA 4ASZA 4RRVA 2IYBA 5IH6A 2ZV7A 2Z02A 4YZCA 5GJFA 3NCZA 5JSMA 3HUBA 2GSFA 3OP5A 3U9NA 3RAKA 3FC1X 4CT2A 4ZJVA 3RKBA 2QKRA 4G3FA 5HCYA 3ZBXA 3LXLA 4PL5A 2IZRA 4U97A 4A6FB 5HESA 4O2PA 1UU9A 2YIRA 2PZRA 4LOPA 4NK9A 5CTPA 5HI2A 1M7NA 3RMFA 5IQIA 3D8DA 3QCYA 3HRCA 4OT5A 4K2OA 2B9JA 4NU1A 3ZUUA 5CSPA 4ASXA 3JYAA 4C0AA 4NJ3A 5I9UA 4AA5A 2NZ8B 2CPKE 3ZO3A 1K9AA 5LONB 1XO2B 2R64A 4UN0C 4QYGA 4L68A 4JLCA 4D0WA 4YLLA 1RE8A 2VTAA 4R3CA 5CAPA 4GG5A 2QCSA 5EFXA 5J79A 1BUHA 2CSNA 4EEVA 4YO6A 2R3OA 4QPAA 5D7AA 4I0TA 1FB8A 2C0TA 4FK3A 4FV1A 1REKA 3BBTB 4Q9ZA 1GZKA 3KK9A 4MK0A 3HK0A 5EW3A 2BKZA 1CTPE 1YHSA 3UC3A 4MY6A 3F9NA 3NW6A 2OZAB 1X86A 4EOPA 3R8PA 3RTPA 4I41A 4IEBA 3KXXA 4FV4A 1UA2A 5EFQA 2PZIA 3RZBA 4I6FA 3IVFA 4AG8A 3O51A 3I0QA 3EQHA 4OBQA 4EOMA 5A4QA 1JKSA 1TQMA 3ZHPC 3AU4A 3EZRA 3KN5A 1RW8A 1JSUA 2O5KA 4AN3A 4QQTA 2Z7LA 3DFCB 3I60A 1X1FA 3C4CA 4GS6A 2P2HA 4D2SA 1V5UA 3LFEA 4XV1A 2WQBA 3LXKA 4QYYA 2VTOA 3ALOA 2RFSA 4FIHA 4BHNA 4ZLOA 2YRYA 4NYEA 5EW8A 4DFBA 1OI9A 2VAGA 2Z7RA 3CQEA 4RQVA 4C0TA 2VTIA 1YDSE 1AD5A 3OZ6A 4FTUA 4H1JA 3LJ2A 4YJVA 1XBAA 2UZWE 4ZXTA 1JSVA 4IB5A 2W5AA 3FKOA 5CY3A 4BDDA 5L3AA 2G2HA 3EL8A 4ZTHA 4MWIA 4RZWA 1SVEA 5KBQA 3DCVA 4BKZA 4DGLC 1I7AA 1UV5A 4BCOA 1OL7A 2K2UA 4AT4A 3P08A 4JIAA 3NNXA 1BKXA 4FKLA 4U81A 1P5TA 2YLEA 2V62A 4FI1A 2GQSA 4E6AA 1PYXA 3I6UA 1NXKA 3COIA 4JG7A 3ZCLA 3IPHA 1SGHA 1YHVA 4GL9A 2KTYA 2D9ZA 4DEIA 4BWXA 4HJOA 1PMUA 4O0RA 4TWCA 1MP8A 4K0YA 1BL6A 1IAHA 4BCPA 4G3DA 5EH0A 4RIXA 4AQCA 1PXMA 4ZZNA 2PZYA 3OWPA 2PMLX 3ZFYA 2NO3A 2VWYA 3RM6A 1W84A 1ZMUA 4HPTE 2OQBA 3QWMA 2QG5A 3DU8A 4Z16A 1AQ1A 2C3LA 2Y0AA 5AP0A 2YIQA 4RZVA 3P86A 3PDTA 5AR3A 3L9NA 4P5QA 4ZAUA 4ZMFA 2VWIA 4D4RA 5E91A 1H1QA 4AP7A 4QMNA 5HG9A 1OIYA 2UW9A 4C4EA 3PRFA 4YZNA 2W17A 4I4FA 3O8PA 3WF8A 4JVGA 5FXRA 2R0DA 1ZMVA 2QC6A 5B2MA 3E3PA 2QOIA 3BYOA 4O6LA 4BZNA 3F5RA 5EYMA 4GVAA 1ZOGA 4N70A 5FI1A 3W32A 3CCNA 4O21A 4CHMA 4AAAA 3TUCA 4UX9A 2RUKB 4U0IA 4MXZA 2A0CX 3KU2A 5DIAA 3VF9A 3QLGA 2W1CA 3DOGA 2B9IA 2DYNA 2ZM4A 4L44A 2JLDA 3QWKA 4GRBA 5CWZA 1NVRA 2DHJA 2CY4A 2WQMA 1P2AA 3COKA 4ZOGA 4C4HA 4B9DA 3QQFA 4G9RA 4TWNA 3VQUA 4EL9A 4X0MA 4MVFA 2JBOA 2B53A 2IO6A 3FXWA 3QZGA 4FX3A 4FIIA 3E88A 3K5UA 1H00A 3NNWA 5KZ0A 3D8EA 1YOJA 2DFKA 1UWHA 3D5WA 2JDSA 4K11A 4CV9A 5BVNA 2MWNB 3EL7A 2JAVA 3HV6A 2X6EA 4G3EA 1G5SA 2RG6A 4QP6A 1TJ6A 2W2XD 3ODXA 3OEZA 1XR0B 4I21A 3RBWA 3VHKA 2I0HA 3BGZA 3P78A 5AR5A 4GFGA 5DN3A 3ZRMA 3FEGA 2UZUE 2COAA 1J7LA 4HCVA 1M2PA 5C4KA 2O65A 3P23A 1HCLA 1MQ4A 4JQEA 1TVOA 1UNLA 4WBBB 1V0PA 4XOYA 1JWHA 1ZY5A 4XP2A 3NYVA 3MJ1A 2BTRA 4U80A 5K0XA 3FQEA 5ANDA 5DHJA 3SUZA 1MQBA 5CF5A 4TZRA 3PG3A 1WFCA 5FG8A 2ZDUA 4WG5A 5A4CA 1V5PA 3PEGA 3DA6A 5G1XA 3RPRA 2HY81 4UMPA 2PU8A 2SRCA 4HB0B 2ERZE 5HVJA 3LM0A 4RC4A 5LVLA 4AU8A 5EM6A 2WZJA 2D4QA 2R3LA 4DEEA 4O7RA 5J3TA 3MPMA 3AGLA 3P79A 4Q2AA 3ZO1A 3G15A 5FQDC 5AUUA 3PE2A 2J0KA 4H58A 5HLPA 4UMQA 2XBJA 4K17A 3CQWA 2E2BA 5GJDA 3QBVB 2UVZA 4KIPA 4LYNA 4RQKA 3D5UA 3DGKA 4I92A 3ZZWA 1XJDA 4IANA 5C01A 3FMEA 4P2KA 4YJPA 3Q9YA 4EORA 4BI1A 2IW9A 4O0WA 2W1DA 3EOCA 4RLLA 3FJQE 5HTCA 3ZSHA 5E1SA 4KRCA 4FV8A 4EWHA 2I0VA 4B0GA 4K33A 4W8EA 5EHLA 4BDBA 3Q5ZA 3TN8A 4JG8A 4U45A 1WJ1A 3EYHA 2QOHA 5IG1A 3CY2A 2F57A 4DINA 2B9FA 2ZV9A 2UW6A 3WI6A 5AUTA 4L6EA 3ODWA 3DKCA 4RVLA 5DT4A 4DE4A 4BCMA 3GOKA 5DEWA 3GVUA 3RINA 2GNFA 2KCJA 4F0IA 4H1MA 2BIKB 4X2FA 3N4VA 1V1KA 3DXPA 4EK3A 3KF7A 3L8PA 4G5PA 1X11A 2ELBA 3PIXA 3LCDA 3RCPA 4CRSA 4KAOA 2UW7A 3KY9A 5CSVA 3POOA 2COFA 4J8NA 3PA5A 5E8YA 3VUTA 5HTBA 3TDWA 3FKLA 3MYGA 2BIYA 2WMWA 4YPSA 2PVHA 3MVMA 2J2IB 3EIDA 3F3VA 1FOTA 3JY9A 3PG7A 3OXTA 2BFYA 5E1EA 5JLJB 3NVMB 3UO6A 4FE2A 2WTWA 3OS3A 5AP6A 2C4GA 2YS5A 4HNIA 3OCGA 3VQHA 4GZUA 3SV1A 2GNHA 3O2MA 5KMMA 1OITA 3U8WA 4DEGA 4HAYB 1DAYA 4LFIA 3H0YA 4DFYA 4QO9A 3UO5A 3UOJA 2QKWB 2VU3A 3LFFA 3HA8A 3C0GA 4M67A 4O83A 2YM4A 2VD5A 1H07A 3IO7A 3TNPC 1LB1A 1ISNA 3ZDTA 4DG2E 5M4CA 1FPUA 2WTVA 3NGAA 5L8JA 4D2WA 4PF4A 2BKKA 2FB8A 1MIZB 1WVHA 4EOIA 3NUXA 2IPXA 3CPCA 3I5ZA 5CAQA 3KXMA 3VNTA 4NM7A 4F70A 5FP6A 4EOQA 2BRBA 3HNGA 5AEPA 5D10A 2HXQA 4YJNA 5C27A 2YABA 2JIUA 1Y8YA 4RX7A 3MSSA 5E8ZA 5DR6A 4UMTA 4AW5A 3LVPA 4KSPA 4M0ZA 4XP3A 4S30A 5HQ0A 4I4EA 3QTWA 1OIRA 3PVBA 4GT5A 5IA1A 5HBHA 4BCNA 3CKWA 1YWVA 2I6LA 2PY3A 4ZJJA 3UG1A 2BMCA 3HV3A 2K00A 2BZHB 4JR3A 4GCJA 5D12A 2OTXA 1MRVA 5AR4A 3WF6A 3N9XA 4O1OA 2CNVA 3TVVA 2J0JA 5GZ8A 1DM2A 3O7LB 5EYDA 3R7GA 4FYOA 1H4LA 5GJGA 3NYOA 3KF4A 4FKUA 3F61A 4MD8E 5KNJA 5BUEA 4U9AA 2P33A 3UQFA 5EDPA 4EH4A 1M2RA 4GJ3A 2ELAA 5AV4A 5IA0A 5K5NA 4F1MA 4I24A 5HKMA 5GINE 3UIUA 4C57A 4CRLA 1XX0A 3MWUA 4ZIMA 3GC8A 5EW9A 2XQNM 3WYXA 3NSZA 5DI1A 2C5VA 4M3QA 4CKIA 1Y57A 2BRNA 4DBXA 4N4SA 4L67A 4PMTA 4PTEA 4E20A 3OD6X 3IW5A 3VUKA 3EB0A 4F63A 4KNBA 4L7SA 5FEEA 3ZEPA 5JFWA 3N7CA 2W9ZB 3ORTA 3R02A 1KI1B 2WMXA 1CKJA 2X2KA 3QX2A 5JHHA 5EOLA 3B8RA 3R8MA 3SKCA 1UEFA 3LMGA 4GXBA 3LCTA 4HYSA 4MBJA 1Q8YA 1Q5KA 3W10A 2PULA 4NCTA 1FMOE 3V5JA 3WBLA 3G6GA 3CQUA 1YDTE 4DAWA 2AEHA 4PPAA 2O3PA 5CI7A 4YZ9A 4EK6A 3L1SA 5IKWA 4F9CA 4O84A 3A2CA 4XUFA 3VRYA 3P7ZA 4FT9A 5DMZA 3EFJA 5FRIA 3ORKA 2O63A 3EN7A 4MD7E 4QP9A 5CX9A 1Q8UA 3ROCA 3A7HA 1XH9A 5F94A 3G9WA 4K18A 3F7WA 4R7HA 3BYMA 4FV2A 3QX4A 5BUJA 2HELA 1GZNA 3D4QA 4F7UP 3BEAA 4IWOA 4DLIA 3ZONA 5C8MA 2YSZA 2Q0NA 3KRLA 5M56A 2LKOA 3T9TA 4FIGA 4RJ4A 3KVXA 2R2PA 3BWJA 4D55A 5EOBA 4C38A 3PP0A 2HAKA 4DH7A 3SG8A 3R73A 1W82A 3UZRA 4R1VA 4GK2A 5HU9A 5CALA 3PZHA 1WBTA 4YSMA 3FYKX 4B8LA 1WBSA 4NUSA 5J7HA 4CFNA 2OIDA 3V04A 1M7RA 5IUIA 4OT6A 1DI8A 3DT1A 3FQHA 1B39A 4Z9LA 4KHAA 2YHVA 2YM5A 2D11A 4Y46A 2QKMA 1FGYA 2CNUA 2YCFA 1G8SA 3DS6A 3C0IA 4IJ9A 2BVAA 3SXSA 3KMMA 2OIQA 4G6NA 1V89A 5CZHA 1V5MA 4M12A 3U4UA 3FLSA 2JITA 1KE9A 3O8TA 4FT5A 4AOJA 4BCGA 4Z3VA 1Q41A 4HB2B 3PSBA 4FIJA 3MH3A 4U3ZA 1PRYA 3R9RA 4ZRJA 4BRXA 3HQCA 4J99A 1URWA 5GHVA 3DNDA 3NPCA 5CEQA 1FGKA 3AGMA 5EM8A 4AZTA 4DFZE 4FEVA 3F3UA 5AJQA 3VS5A 1YXVA 3PWYA 4V0GB 3UIMA 4D5HA 3TL8A 4DTKA 2DYQA 4IFSA 4XHKB 4X2NA 2GCLA 3LJUX 3ZO4A 2Z60A 4AZEA 5IQEA 2PWLA 2UZEA 2W06A 3TNWA 1R0EA 2JGZA 3NR9A 3UGCA 3TNQB 4AW0A 4FEUA 5LWMA 4A4XA 3FM8C 3ACKA 3FSFA 2F7EE 4D9UA 4BKJA 1DROA 3Q9WA 4IFGA 5EI6A 2VO7A 4EKLA 4FKTA 4DFNA 1U54B 4LMUA 4LUDA 2LGCA 2XM9A 3OBJA 5HVYA 3KKVA 5I4NA 3DAEA 2Z2WA 4OBPA 3SDJA 4UXLA 3R9HA 4O0SA 4QTDA 2PVKA 3QFVA 1J7IA 3FYJX 3OXZA 4O1PA 4ZJIA 1S9IA 2UVXA 2XB7A 3QRJA 5HG7A 1VZOA 3FLNC 3QD3A 2VWUA 4HVSA 4AW2A 4FT3A 3FZRA 2W9FB 2VSZA 3KB7A 2ONLC 2X6DA 2GNLA 3FMDA 5HX6A 1MUOA 4IVCA 2XKEA 4CQEA 3RAIA 3BLQA 3W2QA 4R5SA 5IMEA 3KK8A 3IG7A 3B8QA 5JEBA 3CE3A 4MD9E 1APME 3HV5A 1ZSQA 3AU5A 5CEKA 1BTKA 3GP0A 2R4BA 2BHHA 4AFEA 3PJ2A 4Z7GA 2XKCA 4CTBA 3R2BA 4IADA 3PZEA 3W18A 5M4UA 4I23A 1XH5A 2H9VA 3KRJA 2OSCA 4AOIA 4E4NA 3UVPA 4TWPA 4ZTQA 3EQRA 1Y6AA 2PMNX 5E8XA 1JAMA 1YXSA 2XRWA 1ZOHA 3ERKA 4IB0A 3FE3A 5K9IA 5HO7A 1V0OA 3DBDA 3LOKA 4G1WA 3Q4CA 3PY3A 5CVGA 3UTOA 4WUNA 3DBFA 3E8NA 3ETAA 2DQ7X 5IMXA 5IUHA 3HUCA 1J0WA 1Q62A 5DR2A 5DRBA 4LRKA 4ZZOA 5CAVA 2CKOA 3OY3A 3ORIA 4ANBA 5EYKA 2DS1A 2YFXA 1U5RA 2I1JA 5J9YA 3M11A 3HYHA 3IW8A 2L2IA 5IA2A 1YDRE 3O17A 4N6ZA 4EOKA 2HYYA 4O7SA 3SRVA 3SXFA 4ZZMA 2VUWA 2UUEA 4TN6A 4AT5A 3I0OA 1YRPA 4PDSA 4MXCA 2EMSA 5DOSA 4YBJA 3DBQA 2UW0A 4ZSLA 3V8TA 3NS9A 2FA2A 3FC2A 4HVGA 5LVOA 5JQ5A 2GNGA 2BTSA 2W1ZA 4RVMA 3QAME 5CF4A 3R7VA 4WG4A 4DXAB 4IWQA 5DPVA 4IC8A 1REJA 4O7WA 3D15A 5HTIA 4AA4A 2ZV2A 4W4VA 4JDIA 4QRCA 5KUPA 3TCAA 4DBBA 3EQIA 1URCA 1NA7A 3K54A 4O2ZA 2NNWB 2QOOA 5ANKA 2VTLA 3EKNA 1XBCA 4EOSA 4Q5EA 4YJQA 2QKLA 5JHGA 3ODYX 1U59A 4FUXA 5L8KA 4V01A 1Q8WA 1Q4LA 5AIKA 4B4LA 5GIOE 4BFMA 5LMBA 3LFQA 4UBAA 4M8TA 4C36A 5IH4A 2RKUA 4GMVA 2YS1A 3PJ8A 5HNGA 4F7LA 3MVLA 4JX3A 2WTDA 3AD4A 5AP3A 3UVRA 2XK4A 3HV7A 4M7IA 4FR4A 3HP2A 4J8MA 5L2SA 3OHTA 4CLJA 1FHWA 4M68A 1Q99A 2QOQA 2LOZA 3PP1A 1X05A 3BEGA 2V55A 4ZLYA 4R7BA 3FV8A 4ACMA 2PE2A 4RPVA 3QD2B 4O7TA 3C50A 4PDOA 1OL1A 3QGWA 5BYLA 3CTHA 5AM6A 1MAIA 2JKQA 2CLXA 3ENMA 4FV9A 3A7GA 3MY1A 3EFKA 3OROA 4O96A 1TXDA 2R3JA 3KRWA 4GPTB 3ZRLA 3A7FA 5A46A 2DKPA 3TFMA 2YIXA 5EHOA 3DAJA 4NM3A 2GFSA 4YHJA 2C0IA 2XMYA 3VC4A 2VKIA 4EMOA 3UG2A 5DI9B 4KUJA 2FYSA 4BC6A 3T3UA 1WMKA 3QIJA 4WNMA 3K2LA 3A8XA 3DK6A 3GNIB 4CFMA 2IW6A 1VYZA 2WTJA 3CGOA 4FNZA 4G9CA 3PJ3A 3OTUA 2XEZA 3AXWA 4FSZA 3R8ZA 4KKHA 1A06A 5C5BB 4D0XA 1BLXA 3R22A 4XJ0A 3U55A 5CSHA 1LEWA 4V04A 3F2NA 4E4MA 3H9RA 4HCUA 4M97A 4KHBB 3F6XA 1E1XA 3GENA 2DLWA 1U4DA 5AIRA 1H01A 4M69B 4D5KA 2MKRA 3QLFA 3LAUA 5HHWA 4FZ7A 4AACA 3OCBA 2P0HA 2RGNB 4PL3A 3HMNA 2YDKA 4L43A 5CU2A 1P6SA 3FZPA 3F7ZA 4L8MA 3M1SA 4LV5A 4NIFB 3ZDUA 1PF8A 3UQCA 2I0YA 5ACBC 1KOAA 1TQPA 5FM2A 4BDAA 2HENA 3GT8A 3F69A 3ORNA 2UZRA 1XD4A 2ETKA 3EN5A 5CLPA 4HW7A 4F0GA 4UEUA 5F20A 3VAPA 4O7ZA 1WVYA 4AW1A 3NX8A 2EMTA 5KX8A 5E8SA 2W4JA 4PDPA 4CKJA 4A6FA 3MVHA 2IW8A 2RG5A 4O86A 1NW1A 2EB2A 1W1HA 4WD5A 2X4ZA 2YT1A 3GB2A 1U5FA 2X8IA 3EH9A 5CENA 3IW4A 4D2RA 4ALUA 4KVGB 5ETCA 3VOQA 4IVBA 3TWJA 4E7WA 2W1HA 3BV2A 4PMPA 4GKHA 3LE6A 5L2WA 3R7EA 3KCFA 4BTFA 5I9WA 5AUVA 4U40A 2BDWA 3WZDA 2PYWA 4D2TA 4FZAB 2IVVA 3Q9ZA 4G17A 3MS9A 4MTAA 4R3RA 4UWYA 4DBNA 2R7BA 5L2QA 3BJIA 4CV8A 5KCVA 3PP2A 1NI2A 4MHAA 4MXOA 5ITAA 2D9YA 1P4OA 4LG4A 3UPXA 5IQAA 4OUCA 3CSVA 4Y5HA 2R5TA 4XLVA 5FBOA 1PLSA 4J52A 2P3GX 3E7VA 4KIKB 5AWMA 4BZDA 4YGAA 5FEDA 3FL4A 3DXNA 4LL0A 4R6VA 3UBDA 4CZYB 2GNIA 3HGKA 4FKQA 3QQJA 2I5CA 2GS2A 2C6OA 4H3PA 5D1JA 1F5QA 4F1TA 1YOLA 5I9ZA 3GCQA 3TV4A 3AC4A 5CU4A 3ZS5A 1E5WA 2YN8A 1ZZLA 1N3HA 4LGGA 4QMSA 2C3IB 4CFUA 1MK9B 3RZFA 3F82A 4L46A 2CKQA 4QTBA 2VTMA 1DDMA 3RAWA 2WTIA 4QPMA 3FLYA 2Y9QA 3W8LA 3VN9A 3DXDA 3RPVA 3CKXA 5JGDA 5LMAA 1H27A 1H0WA 3PA4A 4AN2A 2W7XA 4OAVB 1IRSA 3HKOA 4GG7A 2DX5A 3AJ4A 2XIKA 2QOLA 1UNHA 3R2YA 3U51A 3AT3A 1SZMA 4KA3A 5GOWB 5H8BA 5IDNA 5KQ1A 1ZOEA 2WMAA 3RCDA 3VO3A 4RWLA 3ZSIA 2D9VA 4ANQA 3RJCA 1ZM0A 3CIKA 2OFVA 4PTCA 2CRFA 2OH0E 4JT3A 4CMOA 4DGNA 5FEQA 2YERA 4D2PA 2QOBA 3ZFXA 3BKBA 3NSUA 3FHRA 1T45A 5HNBA 4EHEA 5EYCA 5L2IA 1YI3A 2ZDTA 5F9EA 5GZ9A 4TW9A 5AP5A 3MGYA 4QTCA 2YAKA 2OXDA 1OVEA 3A7JA 4FUYA 4G16A 4E1ZA 2WTKC 3MPTA 5KMJA 2G01A 4BF2A 5CZIA 3NUYA 1H28A 3EQGA 4D0NB 3QRUA 5B2LA 4JBVA 1Z9XA 5DLSA 1Y19B 5CF8A 5IQCA 2G2FA 4FTAA 3OVVA 3ALNA 3FBVA 4MEDA 4YJUA 3TZ7A 4H39A 3C5IA 3D5VA 2WFYA 4LGHA 4QYFA 2R3QA 3BHHA 5JZJA 4W4XA 2GQRA 2X81A 4KABA 5EQPA 2J59M 2WQOA 2XBAA 4TYGA 1UNRA 3ZVRA 3SHEA 3GU4A 2YIWA 3AD5A 2WOTA 3NLBA 3QL8A 2I5FA 3NNUA 2CAYA 3PXZA 1PXNA 4CQGA 3OANA 1QPDA 4J71A 4OTIA 2KUPA 4CCBA 3V5QA 3JY0A 4JQ7A 3UOLA 2HCKA 4FTQA 3GU8A 4L9IA 5AR2A 1H1RA 3RNYA 4N57A 4BDIA 4EI4A 4I94A 3QC9A 2WTKB 3WYYA 1Q3WA 5I9VA 3PVUA 1WBPA 5TO8A 1SYKA 5JN2A 4EHVA 2UZBA 4J96A 4BZOA 3QYZA 4OW8A 1WBWA 3QCXA 4FIFA 1WVWA 2PMIA 4F7NA 1GZOA 4NEUA 3DTCA 4PP9A 1ZYJA 3C51A 4EH9A 2PZ1A 4UY9A 3U7DA 3NYNA 3MH1A 4I0RA 4IAPA 4NJDA 4GMXB 3Q5IA 2OGVA 3H9FA 4AZWA 4E4LA 3R0TA 4WJ7A 2RVBB 5IQDA 1B6CB 3P9JA 1OB3A 4WIHA 3VS1A 1MKEA 4YZMA 1FAOA 3IOPA 4OAUC 1OL2A 1OUKA 2UW8A 2YACA 3NRMA 4YNOA 3TI1A 3TG1A 4UYAA 3VS6A 4FZDB 4F9WA 1CDKA 2J0MA 2ACXA 1CSNA 4QMZA 5M57A 5HORA 3HMIA 4CYEA 1DDWA 4JR7A 4MAOA 5EQYA 2BR1A 3F5XA 4OTFA 3BU5A 4JRNA 1VYWA 2WKMA 2WOUA 4JJRA 4PQNA 4NT4A 3L8SA 2FSLX 3BX5A 4IX5A 1STCE 5HGIA 5CYIA 3U4WA 4AE6A 3RPSA 3VIAA 1UPQA 4S2ZA 1K3AA 3RPYA 2WQNA 2ZAZA 5CNOA 3EZVA 5HOAA 5JT2A 3UNJA 1R1WA 1LUFA 4O7VA 4ZY5A 4MNEA 4XRLA 3GQIA 3Q04A 2PK9A 4RIWB 2OXXA 2V5QA 1I44A 3BHUA 4X3FC 4XYFA 5I9XA 3PSDA 5IA5A 5IQBA 3BE9A 2J6MA 4QMMA 4C4IA 1OBGA 2B9HA 3DAKA 5BVKA 4YONA 2YWVA 3OOGA 4TYJA 1ND4A 4L3PA 4X3JA 1YWNA 4TKSA 1B38A 4NTTA 3LQ3A 4MT7A 2ETMA 3E62A 5C8NA 3UJGA 3ZLSA 4CEGA 1JNKA 4EUUA 2ZB1A 4CZUA 2RF9A 3F3ZA 4QMVA 3TT0A 4QTEA 4YTIA 4CFXA 2OJIA 5JKGA 4PPCA 4K2RA 3HVCA 5DVRA 1V61A 1NY3A 4RFMA 1PMSA 3I5NA 3IGOA 4BVUA 3E87A 4XG2A 5K5XA 1G8AA 2JAMA 2W96B 4HZRA 4A06A 2V0DA 3H10A 2F2CB 4G3CA 1FQ1B 2ITTA 4X3FB 5CNNA 5IEYA 5ANGA 3UYSA 3I7BA 5IUGA 3QF9A 2X7GA 3LLAA 4YTCA 1FMKA 4QP8A 4BBFA 4F09A 1U5GA 4A4OA 3SAYA 3PSCA 4QMLA 1OL5A 4XG6A 5L6OA 1EF1A 4NSTA 3GOPA 5M08A 3ZRKA 4NKSA 4YP8A 4F7SA 2W4OA 1DYNA 5EQEA 2GJYA 3ATTA 4C37A 5LCJA 4RIXB 5BYZA 3RHKA 5E8TA 4CYIA 3KQ7A 1Q3DA 4PNKA 4AZSA 3AOXA 4UWBA 4C7TA 3ZDIA 4EOLA 4DA5A 4FTLA 3PIYA 4RX5A 1K2PA 2C5YA 4Q9SA 4BDKA 4EHGA 5IF1A 3BELA 3D5XA 3QQHA 4YL8A 2VN9A 3ENHA 3PJCA 3I6WA 3E92A 4FICA 5J1WA 4O82A 3ZMMA 4PPBA 3A60A 3QUPA 2ZPYA 4DG0E 2P8VA 3OUKA 2HWOA 3PA3A 4RFYA 5H2UA 3BWFA 3DY7A 2JDVA 4RIOA 3TTJA 3ULZA 4RG0A 1KOBA 1ZZ2A 1OKYA 4RBLA 5D9HA 2HZNA 2PVMA 3CD8A 4ACGA 4TWOA 5BUIA 3ANQA 1X1GA 3SA0A 3WF9A 2UZDA 5DHFB 2XNOA 2OJ9A 2EB3A 3N4TA 2AC3A 1W1GA 4AGDA 4WKQA 1H10A 2HK5A 5L6WL 2XK3A 4BDHA 4WRSA 2OO8X 2WMSA 5DR9A 5FTGA 2X9EA 2W1IA 3NIEA 2GTMA 3NWWA 4UYNA 4FV7A 3ZTXA 4EK8A 4HOKA 4N6YA 3TKHA 4DC2A 4X2JA 2ETRA 3ULBA 1H25A 2QQ7A 3FUPA 3BHYA 4ZY6A 4JDKA 4DEBA 2MFQA 3SYXA 2X2LA 4MXXA 4TXCA 2F4JA 3HMPA 2UZTA 1GC7A 1GIIA 4U8ZA 4FVPA 2WEVA 4I1ZA 3D0EA 4HVDA 4HAVB 2UZLA 4PV0A 4QMPA 4BDJA 2YM6A 2X8DA 5I0BA 4EZ5A 3PG1A 2XK6A 4O27B 2QI8A 5DE2A 3HX4A 3L9PA 3O7LD 1FVVA 3TTIA 2B1PA 4BY9E 2BAKA 4UV0A 5C26A 2R9SA 2RGPA 4EHZA 5I5ZA 2ZMCA 4NTSA 4DN5A 4QYHA 5CSWA 3EN4A 5CEIA 5B7VA 3V6SA 4FEXA 3KREA 2QLQA 4FKRA 5H8EA 2I7QA 3D7TA 1H8FA 4XX9A 3II5A 3GUBA 4WNOA 5ANIA 2YA9A 3UC4A 3Q52A 1ATPE 3CJGA 3FEHA 4J1RA 5LJJA 4FTTA 3FZ1A 2W2WA 3OOMA 2OW3A 3H0ZA 1IEPA 1KE8A 2FSMX 1Q97A 2Y7JA 1Q61A 4Y83A 4OBOA 4EH3A 4CFWA 5A4EA 5JP4A 4C61A 3N4UA 4TKNA 2O2UA 2X18A 5FI0A 4AT3A 2LOXA 5IEXA 3IONA 4IAAA 5HNIX 5L6PA 5AX3A 5AFVA 5EHYA 2XM8A 2XVDA 2BHEA 2J51A 3DJ5A 5AV1A 1U29A 2R3NA 5AP2A 4BGGA 4FKOA 5DIFB 3ZM9A 2FJLA 3P0MA 2C3KA 4KKGA 4FSWA 3UNZA 3VHEA 4OTRA 4R7IA 4YLKA 4KB8A 4CVAA 5HBJA 2JIIA 2XRUA 1CKPA 3LFBA 4O7NA 2WMBA 4WSYA 3FDNA 3O0GA 3R8VA 4JRVA 2VGOA 4APPA 4AUAA 4CFFA 2PSQA 2WQEA 4E6QA 4E4XA 5E8UA 2C30A 5DT0A 3GC7A 5CEPA 5HE1A 1XBBA 3RCJA 3C7QA 3GCVA 2CGWA 2P0CA 3L9LA 4PNIA 3WIGA 1OZ1A 4C58A 3QCQA 1UNPA 3KULA 4KIQA 3UIXA 4EC8A 2YWPA 5E92A 1PYEA 5HE2A 5IA3A 3HA6A 3F3TA 5T3QA 1AGWA 4LUEA 4FTIA 4IAIA 5C16A 4HDOA 2DHKA 1BYGA 2YT0A 1KV2A 3SW4A 1Z87A 3OUNB 5BMSA 2HW6A 2WNTA 3AMBA 3QRTA 4HGLA 5LMKA 3BINA 3JVSA 4XBUA 2QNJA 5BNJA 4F7HA 2QODA 3Q6UA 3RP9A 4E5AX 2GU8A 2F9GA 3QD4A 3WILA 2EVAA 2IVTA 3E7OA 3P7CA 1WI1A 1A48A 4XCUA 1LW3A 2X7FA 2X1NA 2QONA 3PXRA 1RRPB 1NVSA 2A4LA 2OIBA 2OK1A 2Y7BA 4GMYA 4QMWA 3V5LA 1ZRZA 2QO2A 4FTOA 4C62A 2EWAA 2IFSA 4DLJA 4TL0A 2JDOA 2RFNA 2VO3A 5CXHA 4ZK5A 3O23A 1M2QA 5ACKA 4ZSJA 4DFLA 3FMLA 4YBKA 3P4KA 5M55A 3FHIA 5HX8A 2VWBA 3JS2A 3KN6A 1ZARA 4EOJA 4EYMA 5JMSA 2ITUA 3SW7A 3HAMA 5IQHA 5JFXA 4YC3A 4MKCA 3OG7A 1LPUA 5G6VA 2HW7A 5IA4A 1RQQA 3D8FA 3AG9A 1ZYSA 5AM7A 3ELJA 3QUEA 3FMJA 4C8BA 4M0YA 4GK4A 2D9WA 3Q32A 4DT9A 3I1AA 4IWDA 4L52A 5CVFA 2ZB0A 3TZMA 3DNEA 3CR0A 1I09A 2W1GA 5FM3A 4CSVA 4RIYA 2Y8GA 1KUTA 3OFMA 1WBOA 4HNFA 1U27A 2JKKA 2Z0QA 4CYJA 3G9LX 3HRFA 5M4IA 5M51A 4TYZA 1FVTA 3W2RA 3VUIA 4FTMA 4F9BA 3RVGA 3ZLXA 4YR8A 4MF0A 2YM8A 2RLOA 5I3OA 2QU6A 3IECA 5DH3A 1UWJA 2OXYA 4HDQA 4Y94A 5A9UA 1KE5A 2DUVA 4DG3E 1YW2A 1GOLA 2XYUA 3H9OA 2PVNA 3COMA 3GU5A 1YKRA 3KVWA 4IH8A 3DV3A 5AP4A 5IU2A 3FI8A 4Y8DA 5KZIA 2W4KA 3F5PA 4TT7A 1KV1A 2RL5A 2CLQA 4WA9A 1OKZA 4BCHA 1JQHA 4QYEA 4D9TA 5ETAA 1G3NA 2HWPA 3AC5A 4RFZA 4Y72A 4I93A 4ANLA 1V88A 2Y8FA 4C4JA 3FMNA 3V8WA 3TDVA 3OW4A 2E9VA 4YC6A 4FODA 4O91A 2CKEA 5A4LA 4UB7A 1XQZA 1Y8GA 3D2KA 2XKDA 1MIXA 3G6HA 5FDXA 3EQFA 3IW6A 4BYJA 4NCTC 4EH7A 1WGUA 4XWXA 4D1SA 4U42A 4II5A 5BPYA 4HCTA 3ZM4A 1KSWA 5KQ4A 4IDVA 3Q4ZA 3DK7A 5D41A 3VJNA 5J1VA 2YCQA 3LCKA 3OT3A 2PUPA 5JGBA 4J53A 4IVDA 2EXCX 4IBMA 3WOWA 3NMUF 4U6RA 3ODOA 4IC7A 4XG9A 3QTXA 4YSJA 4WRGA 1TQIA 4YHTA 2PE0A 4NFNA 1QPCA 3KEXA 4F9YA 5E8VA 2ITNA 1BI7A 3AD6A 4CT1A 2R3KA 3JVRA 4FTKA 5HLWA 4BWKA 3LXNA 2VTRA 5AV2A 2BDFA 4ACDA 2EXEA 4NKAA 4R8QA 5JZNA 2W1FA 3C4FA 3KGAA 4GH2A 4KRDA 5CU6A 4D4YA 4HVIA 4QD6A 2XUUA 1R39A 4DEHA 3MIYA 2YZLA 3CXBB 3OCSA 3JR1A 3OC1A 2WEIA 3GCSA 4WNKA 3EJ1A 3GQLA 4FF8A 2LYDA 3RK5A 3CEKA 1JVPP 4BIEA 1ERKA 3SXRA 3WF5A 3ITZA 2VTNA 4DFXE 4FA2A 4HHVA 4NL0A 3IDPA 3LFDA 2RSGA 1YI4A 3LMHA 2Z0OA 1HOWA 1ZY4A 2VO0A 3ODZX 5EI8A 3U9CA 3DXQA 4FSMA 3X23A 2C6KA 3QHRA 5LWNA 3GBZA 5E90A 3VS7A 4X7QA 5D3XA 1FHOA 1L3RE 3R9NA 4FGRA 1BAKA 3CD3A 3PWDA 3QCSA 3B2TA 3VS3A 3A8QA 4O7YA 3TZ8A 4OTWA 5DGZA 4R78A 4QMOA 2QOFA 4IDTA 3UMWA 2HZ0A 3OT8A 3A4PA 2QU5A 5K3YA 3IW7A 3PJ1A 2VX0A 2XCHA 3NCGA 3C1XA 4DH8A 2M38A 2UW4A 4LRMA 4DHFA 2XIXA 3CY3A 3UYTA 1EVHA 2HIWA 3WE8A 4JDHA 1NU2A 2Y6OA 4XG3A 4BDGA 3G2FA 1JBPE 4BDEA 3E5AA 3QQKA 4AZVA 2O0UA 4LOOA 4O38A 2A1AB 1O6KA 2OKRA 3WARA 3QGYA 4EC9A 3IK3A 5AAEA 2XNGA 4I6QA 2WMRA 3HMOA 1B55A 2XS0A 4R77A 5TOZA 1O6YA 1YXTA 2C68A 2UVMA 3C4XA 3R01A 4F65A 3DKFA 4HGEA 3E64A 4TY1A 4NM0A 1UPRA 2YDJA 4FK6A 3R1SA 5FP5A 1OECA 2VTJA 3RGFA 3R8UA 3BU6A 3F2AA 3UOHA 3MY0A 5FTQA 2BZKB 4QNYA 1P4FA 2XK8A 3EHAA 4ORKA 3PXFA 4ENYA 5GZAA 3MPXA 3GXLA 4DFUA 2CCIA 4EOOA 3QWJA 2JC6A 3A99A 3FZTA 4FZFB 2XJ1A 3DZOA 4EH5A 4PY1A 3RHXA 5AUYA 1YOMA 3FI4A 3R21A 2BRMA 4CNHA 2REIA 4DH3A 4KHOA 3Q96A 1GG3A 5DHAB 2VTTA 4AOTA 4KBKA 1FVRA 2HXLA 4WO5A 4QT1A 3VS4A 5HO8A 4N0SA 3U6IA 1PFJA 4HZSA 1YXXA 2QOCA 3DFAA 4RWIA 4FL2A 4PUZA 3ORXA 3FWQA 4RJ6A 4ONAA 4P5ZA 4FTRA 3UODA 3MN3A 2N23A 2C6EA 2OJJA 3UDBA 3LXPA 3ZFMA 1QQGA 2WIPA 2XH5A 4D1XA 1H1SA 5D3YA 3R00A 4PWNA 2JKMA 1PMNA 5BVEA 4C4GA 5EKOA 4IB3A 5HZNA 1XWSA 5E8WA 2C47A 1WZYA 3UP7A 2ZOQA 4UMRA 4E73A 4FL3A 2P4IA 3DB8A 4JBPA 3DJ7A 1PHKA 2C6DA 1GJOA 3AMYA 2CCHA 5D27A 3ATSA 3HZTA 3L8VA 4YZBA 4HATB 1IA8A 2F7XE 4F1OA 2BZIB 3N51A 3VBYA 4ANOA 5KMLA 2C69A 1GIHA 4PX6A 4WG3A 2ZV8A 4DEDA 3LFSA 4JQ8A 3O8UA 1OKVA 3R71A 4IHPA 2L1CA 5GIPE 4XOZA 5ANOA 4BI0A 2ZM3A 2QURA 3F5UA 4DH5A 4I22A 1OPJA 3LCSA 1CM8A 2XNMA 4UZHA 4E5BA 4A4LA 2PVJA 5CF6A 2IVUA 4RWKA 4Y5QA 5HG5A 4A9UA 3AMAA 3Q2JA 1X8BA 4X6QC 2XA4A 4YTHA 3QZFA 4DEAA 4E26A 3Q3BA 2F49A 3MW1A 2BDJA 4FVRA 3VRZA 4JX7A 3PVLA 4TYHA 4GIHA 1OKWA 4K77A 4RJ7A 4WNPA 4B99A 4FT0A 2X9FA 1U2BA 1P3RA 4S32A 3KRXA 4LV8A 4FSYA 3R8LA 5KHXA 2VX1A 1SNXA 3SOCA 2ZM1A 1QPJA 3OF0A 4J97A 4O7LA 3EN9A 3QALE 2QR8A 3QKMA 4ZTLA 4W9WA 3W2PA 4L45A 1UU8A 1LR4A 2ZMDA 2XYNA 4YMJA 2OLCA 5IDPA 2OF4A 3CTJA 1J3HA 1JLUE 2RFDA 4JNWA 4KSQA 5HICA 4E6DA 4JBQA 2DHIA 4RLKA 1M7QA 4RT7A 4QMQA 2GS0A 3LHJA 1KE7A 5KMIA 4L7FA 2C1BA 2I40A 3A8PA 1XHAA 5EI2A 4LQMA 4RGJA 5CEOA 2J0IA 3BGQA 1Q8ZA 3DKOA 4GT3A 4QP3A 4FKPA 4GKIA 4I20A 2WAJA 5J5TA 3PVWA 4J98A 3PTGA 4R3PA 4DYMA 2BAQA 3QTQA 4L00A 3UOKA 3HP5A 2JDTA 1UNQA 4P4CA 2Y4PA 4FVQA 1U5EA 2W0JA 4XP0A 1AWEA 4CFVA 5I3RA 4BCIA 3KMWA 5CEMA 3OY1A
chains in the Genus database with same CATH superfamily
4ZS0A 2X7OA 3MH2A 5AV3A 3S95A 4CMTA 4X21A 2WMUA 2W99B 3NUNA 4FKJA 2V22A 2UZVA 4KBAA 3VWAA 2QVSE 3JPVA 4EKKA 3OEFX 3KXGA 3QTZA 3E63A 4I0SA 5LOPB 4RSSA 2D2QA 2VWWA 4GT4A 3ZH8A 3NFGB 1XH8A 2P2IA 3IQ7A 4HYUA 4EBVA 4Z2NA 3I4BA 4USEA 4L6QA 1W8CA 2JFMA 3FPMA 3ZXTA 4BCQA 5HD7A 1PKGA 1HCKA 3A62A 3F66A 4UXQA 2Y8OA 2YIYA 2YJRA 2X4FA 1KWPA 1M52A 2VGPA 3BI6A 3G51A 3BLRA 4FC0A 4FSNA 1DS5A 4H3BA 4L3LA 4OTGA 3VS2A 3TIZA 4K81A 4FBXA 3Q6WA 3T3VA 2NP8A 3FZSA 4ZP5A 3MIAA 2A19B 3R30A 4CMUA 2QD9A 5AR7A 1YVJA 3R1YA 2OZAA 2IN6A 3NUAA 2PE1A 3PFQA 1AQCA 1YQJA 2K49A 4D1ZA 2JDRA 5E9EA 4HGSA 5BVOA 4EWQA 1MK7B 1TKIA 5AV0A 3FI3A 5H9BA 4EZ7A 2HE7A 2VZ6A 2WB8A 4GEOA 4WT6A 4M84A 4W8DA 3MA3A 3TV7A 5TKDA 2JBPA 1MPHA 3DLZA 3OWKA 4IM0A 2F2UA 4ZTNA 1LEZA 2H34A 3ZZEA 4ACCA 4JG6A 2YCRA 4ALVA 5FTOA 4EH6A 3REPA 4L42A 3VBVA 1U5QA 1R3CA 4LOQA 3UNKA 1KZGA 4MNFA 3GYOA 2IVSA 1RJ2A 4LRJA 4Q5HA 3WZEA 3JUHA 4XLIA 4AF3A 4IXPA 4FRFA 5TR6A 4AZFA 2B54A 1XH4A 2GCDA 2VX3A 5BVFA 2IF8A 3DDQA 4ANMA 4Z2MB 4GUBA 4L53A 5CI6A 3CP9A 2XK7A 4IE9A 2UZNA 4XRJA 4RWJA 2PL0A 4GVJA 5AUXA 4FMQA 4CXAA 4ASEA 5JRQA 4LV7A 1VEBA 1VJYA 3LJ1A 3KXHA 4QQ5A 4U41A 3QUDA 4WHZA 2H8HA 4AX8A 4O81A 1WGQA 4NSWA 1J91A 1OPLA 3SNHA 3PLAE 1RDQE 3D83A 3NUPA 2YITA 5BMMA 3A98B 1IR3A 3NZ0A 3K3IA 5FBNC 4FTJA 3O71A 3P5KA 3ZC5A 4DITA 3RNIA 1GC6A 2AL6A 4R5YA 3LKMA 3VBTA 1OMWA 4ZLZA 4TNDA 5H3QA 1H0VA 4LDTA 4NFMA 5M09A 3CC6A 2Z8CA 4C3RA 3VIDA 4PRJA 3LFNA 3KFAA 5CU0A 4GYIA 3F5GA 4MQ2A 2OWBA 3IOKA 2EU9A 1ZYDA 3BE2A 4WSFA 3MVJA 1UU7A 3ACJA 5D7VA 4BCKA 2JKOA 5CT7A 3TV6A 4IWPA 5CLLB 4ITIA 2V7AA 2XK9A 4IB1A 2VTHA 4OTPA 3D7ZA 4K6ZA 4IAZA 3NYXA 4EQCA 1FGZA 2B55A 4H05A 4QMTA 2WPAA 1DBHA 5HO6A 3W8QA 1WAKA 3QA0A 1E1VA 5DT3A 3W2CA 2IJMA 5J3YA 2C6IA 2B4SB 1ZXEA 2ITXA 2QR7A 3M42A 4PMSA 2BAJA 4RX9A 3RALA 3T9IA 4RIWA 2CODA 1IAJA 2QO9A 4RC3A 2IZSA 5C79A 4IMYA 2GHLA 3OXIA 3TXOA 3R1NA 3GCPA 2GNJA 3C13A 1IG1A 3EQBA 3ORMA 3QC4A 3F88A 1ZC4B 5EK7A 1SM2A 3V5WA 3Q4UA 4MBIA 4AN9A 3DDPA 4XMOA 2XJ2A 3LMIA 2QG7A 2FH9A 4FV5A 3DK3A 4BKYA 1GZ8A 3R1QA 4C2WA 1H26A 5A6NA 2GHMA 3A61A 3F3WA 2X8EA 1E9HA 2AC5A 3LFCA 4FKSA 4IQ6A 4CTCA 3ET7A 3K5VA 4FNXA 1DI9A 3E93A 3EN6A 4W4YA 3SG9A 3TUBA 5DBXA 4D4VA 1K5DB 3WIKA 3FMMA 3R9DA 2HY0A 4RVTA 4BJJB 5M07A 2J4ZA 4FNYA 4A5KA 2YZAA 3ZO2A 5CLQB 5J3QA 3VJOA 4QNAA 2AUHA 3R7YA 4A9SA 4JS8A 4X3FA 5AP1A 4ZS4A 1OQNA 5J9ZA 5JFVA 2PVYA 4FOBA 5BVDA 2R3HA 2XKFA 3DZQA 1BI8A 3LFAA 3QXOA 5JQ8A 4P7IA 4DCAA 2Z7SA 5FLFA 3FKNA 4WUAA 3V5TA 1R0PA 4XG8A 3UO4A 1OIUA 1SNUA 2NRYA 1OGUA 4TPTA 2E2XA 4WSQA 2AEGA 3CLYA 4JOAA 5HIBA 4TTHB 3RWPA 2Z14A 4KINA 1Z57A 3F0WA 5EM5A 4PL4A 4I6LA 4FSRA 3RAHA 3G9NA 1WVXA 3PFYA 4AXCA 4BCFA 2FGIA 1OM1A 4FKGA 4G5JA 4B6LA 5IQGA 2YAAA 3CXWA 3I7CA 2M14A 2OICA 3QXPA 2PPQA 3MI9A 2R3MA 4UMUA 3VONA 4YJTA 2XCKA 5AA8A 3AT4A 4M66A 3BU3A 4AA0A 2GCJA 3RK7A 2I1MA 3CTQA 5BYYA 2C5OA 3D9VA 3QZIA 3FQSA 4LM5A 2YS3A 3U54A 3KL8A 2E9UA 3S00A 5CANA 2GPHA 3DLSA 5FUTA 5KMOA 3EQDA 4F7GA 5HCXA 3LLTA 4S33A 3ZLWA 1Y5OA 3W0NA 3FI2A 2RIOA 2XNEA 5C8KA 5HU3A 5B2KA 4IOYX 1Q8TA 3GGFA 5IH5A 1JKKA 2GS7A 2VO6A 2I0EA 4ENXA 3MFUA 4FZ6A 5FXSA 2PUIA 1O9UA 1ZYIA 1FGIA 3IS5A 4IAYA 5A6OA 5EG3A 4O6EA 4BTKA 5AUWA 4BTMA 2W5HA 3ZUTA 4A7CA 3HDMA 2OF2A 3FXZA 2EJ8A 2G15A 4DT8A 1QMZA 4CG9A 2WU6A 3TCPA 4RC2A 2VWVA 3NAXA 2H7DA 3PYYA 2CNQA 1LP4A 2VTQA 3FSSA 2NRUA 2ROVA 1UU3A 3U6JA 2R3FA 4U3YA 3F2RA 5IQFA 5FGKA 4BCJA 4PQ0A 3MFSA 4D4SA 3VUDA 5CU3A 3ML4A 3ID6C 4GIIA 5M44A 2GDOA 3TIYA 3RWQA 3PPJA 1Q24A 5A54A 2Y6MA 2CGUA 3D2IA 1XMMA 3CBLA 3OWLA 2J0MB 4WBOA 4GK3A 3TNHA 3KRRA 3ORPA 3QTSA 4EONA 4ANSA 1PXIA 4ANNA 3QQGA 4EKUA 4YHFA 1W2DA 3B2WA 4F6UA 4F9AA 2Y4IC 2W2XC 3LJ0A 3DQXA 3MFRA 5L81A 5LOHA 1UKIA 3ZC6A 1W1DA 1W83A 3MY5A 3QKKA 2CN8A 4LL5A 1BTNA 2D9XA 1EAZA 2XIZA 2RFEA 2LG1A 3TMOA 3L8XA 4LGDA 4MNEB 2PVRA 1W2FA 4XBRA 2XF0A 3K3JA 3MB7A 5DWRA 1XODA 2Q13A 2JP2A 3ORLA 4HPUE 1XH7A 2W1EA 5IZFA 4OTQA 4BYIA 5L2TA 3PIZA 3Q2MA 3T8OA 2CY5A 2Z0PA 3HAVA 4NZWB 2CDZA 4KKEA 3NUSA 4QMYA 3OMVA 4IIRA 4QP4A 4C2VA 5C1QB 5IPJA 3IDBA 2OFUA 1M7EA 2EXMA 4GSBA 2WO6A 2VTSA 4AFJA 2CHLA 2K2JA 3DJ6A 5CVHA 2QLUA 4YC8A 2X2MA 5DG5A 2BUJA 3ZBFA 3PRIA 1IA9A 4MXYA 4Y85A 2WTCA 2Y4IB 2FUMA 3PZDA 4O4EA 5CAOA 5L8LA 2AYPA 3GCUA 3MTLA 5CSXA 2PVLA 5F4NA 3VUMA 3TJCA 2UW3A 3UZPA 2YCSA 4ERKA 1WCCA 3HEGA 1F3MC 2YT2A 2YVCA 2PTKA 3OWJA 3ULIA 1FHXA 3MA6A 3KXZA 3MFTA 3QU0A 1PXPA 4M15A 1OPKA 4E5WA 1NTYA 3HECA 5TF9A 3R7OA 4YJRA 2IZTA 2XIRA 4JBOA 4YLJA 3LQ8A 3TNIA 2LULA 4FGBA 4MXAA 2YDIA 3BPRA 2QHNA 5JFSA 3H30A 4DHJA 2OG8A 3UE4A 2P0DA 3NVKI 3T06A 1YHWA 2R3RA 3BHTA 4GFMA 1W7HA 4KWPA 5JRSA 1Y91A 3TACA 1L8TA 3ML1A 1UNGA 3W2SA 3R63A 4BDFA 4A6HA 4YNEA 1P5EA 4R1YA 4ZTMA 4EQMA 1BWNA 4AXDA 4C33A 2J0LA 2PUUA 5A14A 2HTHB 1EGXA 1QL6A 3HV4A 3HDNA 3I81A 4MYGA 2H7EA 4DX90 2J5EA 2BZJA 3TKIA 3EYGA 4EK4A 5KHWA 4BIBA 2YJSA 4I5HA 3PPZA 1KE6A 4BB4A 2J50A 5DRDA 3S1HA 4GFOA 3U6HA 5T6KA 5DFPA 2DYLA 2WMQA 3IDCA 5EM7A 4QMXA 2EUFB 2BFXA 3MBLA 3KZ1A 1GAGA 2XP2A 4QTAA 4HVHA 2KIEA 4BBMA 4BTJA 4KD1A 5J7BA 1QC6A 2X39A 4RA5A 2DN6A 5DEYA 4FEWA 2QOKA 3M2WA 3O50A 3SO6A 4AWIA 3V6RA 1QPEA 3BYVA 3S3IA 3BQRA 5F95A 1CKIA 4S34A 4Z55A 4D6WA 3MDBC 2N0YA 2ITZA 4GYGA 1T46A 4IM2A 4U43A 4OLIA 2XIYA 5HLNA 2QO7A 5KMNA 2C1AA 2J5FA 2R7IA 2YLFA 3EFWA 2J9MA 3P7AA 3DPKA 2GQGA 3PLSA 3CS9A 4ITJA 4BICA 3THBA 2ITOA 4USFA 5LQFA 1YWRA 1FOEA 4ZRIA 4BBKA 1PXLA 3G33A 1U5DA 3G0FA 2Q83A 3H3CA 1TQZA 2OH4A 4L01A 4DH1A 3TW1A 4OTDA 1SVHA 5KMKA 4GJ2A 5ETIA 3BYUA 3LZBA 1H1WA 4J7BA 4C4FA 5LVNA 4FSQA 2EC1A 3NWFA 4L1RA 2FVDA 2PZPA 3QTUA 4EJNA 4A9TA 5GNKA 5AAGA 1XCGA 1OY2A 1PMEA 4EJ7A 2ITWA 4RA4A 1ZAOA 3PXYA 3H4JA 4G6OA 4C34A 2Z7QA 4A9YA 3W0SA 1XKEA 4OTHA 1JOWB 3TZ9A 4B7TA 3QTRA 1SMHA 3DTWA 1FINA 4I6BA 4HYIA 3MB6A 2CJMA 5HD4A 1PKDA 4NY0A 2E9OA 5A4TA 4TYIA 2VV9A 3EFLA 5T68A 5CT0A 4X2KA 4ZSGA 1M14A 1OUYA 5I9YA 3Q53A 3WA0A 1PXOA 3L9MA 1GNGA 2FSOX 3MJ2A 3E8EA 4YTFA 4HB3B 3AC1A 3W16A 4BGQA 2G35A 1UKHA 5JK3A 3SOAA 4RVKA 3D7TB 2ZVAA 4FV6A 4IAFA 5CS6A 1RJBA 4HAZB 4C59A 4EYJA 1IASA 4W4WA 3A7IA 3ANRA 4FTCA 3B77A 1JKTA 3EKKA 4EH8A 3BHVA 3C4WA 3HRBA 4IM3A 3TYKA 4I3ZA 4O0TA 3MV5A 4DTBA 4V0GA 4GN1A 2UVYA 2ERKA 4ACHA 2CGVA 4EZ3A 3LPBA 1H08A 3AT2A 3TO1A 1UVRA 5H8GA 2J90A 5LMKC 3W1FA 3ZUVA 4BGHA 5CASA 2YF0A 4G3GA 4I5CA 4EK5A 3VW6A 4FTNA 2C5XA 4KBCA 3ZU7A 2DKQA 2A98A 4M14A 2OU7A 3SQQA 3ZLYA 2HZIA 4ALWA 2BILB 4J95A 4FT7A 3BYSA 1Y6BA 3G90X 2F7ZE 2XNNA 4C35A 5LXMA 1U54A 2X0GA 4DGMA 1NT2A 5FD2A 3R7IA 3Q4TA 3PPKA 3S2PA 3UQGA 3IGGA 3FAAA 4XNEA 3TEIA 1MRUA 2OJGA 4JIKA 3KY2A 2DX1A 2O8YA 2P0FA 5I2MA 2C0OA 4BWPA 4K9YA 1YI6A 4YJOA 2XARA 5E4HA 5AX9A 5HCZA 3KULB 3KXNA 3QRIA 3GC0A 3GEQA 1A9UA 2WIHA 4FIEA 4U7ZA 3R9OA 3BBWA 5EKNA 2D10A 4HAXB 4NM5A 1ZYCA 3ZEWA 2R09A 3ULCA 3C4ZA 4OR5A 4ZSEA 1V0BA 3BGPA 3R28A 4QPSA 5HVKA 1W98A 4YZDA 3DBEA 4F99A 3HSAA 4E8AA 5DH9B 3RPOA 1J19A 3O96A 4JI9A 3G0EA 4QQCA 4HGTA 1XH6A 5J87A 3V01A 2WMVA 4FKIA 4AE9A 2B52A 3V8SA 2NMBA 5B0XA 1QCFA 4W9XA 4G31A 2I1KA 2Z59A 3FY2A 2J7TA 5ANEA 5HIEA 3BQCA 4WOVA 2RSVA 4YPDA 4JXFA 2FSTX 2V76A 3DXCA 1SHCA 4U5JA 3VULA 3NDMA 3ZOSA 4DX8A 3C9WA 4MBLA 3S0OA 3PVGA 4HB4B 5DYJA 4XV9A 2PHKA 3LM5A 4XS2A 3R7UA 4FSUA 3RK9A 4YU2A 5J9LA 3EWHA 2UZSA 4MWHA 4JDJA 2RNRB 1GIJA 5C03A 2ONLA 4QMUA 4MF1A 4D2VA 4IZYA 3UZTA 4FV0A 2ESMA 4JL9A 3TM0A 2WMTA 1EH4A 1J1CA 2BRGA 3MESA 2CGXA 3GFEA 5BVWA 4F0FA 3FLQA 2HZ4A 5F1ZA 4JAJA 3V51A 5J95A 4CZTA 4ZEGA 3RM7A 3VUHA 1FBNA 2ZFYA 2NPQA 3CGFA 3FMKA 4RIYB 5KO1A 3PUFC 4A6KA 5AMNA 3FXXA 4Z7HA 3OHMB 4XG4A 3OCTA 5M4FA 4ZSAA 5AP7A 1JSTA 5AAFA 4EUTA 2WELA 5LVPA 1PMVA 3FY0A 3NW7A 4AS0A 4CD0A 3DKGA 5HG8A 3KSYA 3W33A 4DGOA 2IEWA 3U87A 3SC1A 1I2HA 5C6RA 4GUEA 3R83A 4HAUB 4X2GA 1BL7A 3VS0A 3FLZA 3Q9XA 3POZA 2RRFA 4KAXB 3OW3A 2G1TA 3ZSGA 3HIEA 3BCEA 5M53A 3FMHA 4XV3A 4LMNA 2E9NA 5EDQA 3ZYAA 4V05A 4DF3A 2GS6A 3CJFA 3FSKA 5FWKK 4DIXA 1J7UA 4BR3A 4EH2A 2WHBA 3ZXZA 3QBNA 1MRYA 4NH1A 2UV2A 4F64A 5D3WA 4CCUA 4WVFB 4ZRKA 4KS7A 4IZ7A 4UWCA 1JPAA 2KGXB 4MQ1A 2GHGA 4ZMEA 2R3PA 4IJPA 5CQWA 4YJSA 1WBVA 1J1BA 2BROA 3QZHA 2LAVA 4B8MA 1OBDA 2VNYA 4IX3A 4BBEA 3SGCA 4DTAA 2DTCA 4A07A 3S4QA 2R3IA 5KE0A 4FG9A 4IX4A 4UZDA 4FV3A 3LIJA 4YO4A 2HOGA 1YXUA 3PXKA 3QRKA 4BDCA 4B6HA 4O0UA 2PVFA 4MX9A 4PTGA 4F4PA 2JFLA 4HAWB 2GMXA 2WGJA 4HYHA 2G2IA 3UMXA 3OBGA 3TJDA 2DWBA 2IZUA 1Z5MA 2A2AA 5AA9A 1XR1A 2DA0A 2WXVA 4FKVA 3KC3A 3NW5A 4U79A 3P7BA 2C6LA 3P1AA 1NTVA 4QP1A 3GFWA 4IAKA 5K4IA 1PXKA 4IFCA 4FG7A 4AGWA 4E3CA 4F6WA 3QTIA 2XEYA 3AC3A 4I5MA 4I5PA 3PE1A 1VR2A 2BRHA 5LVMA 4F6SA 3KA0A 4S31A 4NW5A 1OL6A 3NUUA 1BMKA 4G6LA 3HW2B 2UZOA 4CKRA 4BL1A 3EQCA 5J5SA 2OBJA 4XH6A 1ZLTA 4PP7A 5C5BA 5HBEA 3GC9A 4GU9A 4ID7A 4IACA 4RJ3A 5K0KA 4C02A 2B0QA 4IVAA 3I79A 2OJFE 3QQUA 4ZY4A 3NAYA 4MCVA 3UVQA 4KHBA 3FZOA 3MPAA 4NW6A 3BV3A 4BI2A 5HE3A 2C5NA 3RI1A 3W2OA 4BN1A 2MDXA 3OTVA 2GTNA 3C0HA 4M69A 5L4QA 4GU6A 2CN5A 5A3XA 3AC8A 1WJMA 2VWZA 2XNPA 4ERWA 3HL7A 3HMMA 4F7JA 3D94A 3ROYA 4OGRA 4Y95A 3E8CA 4CHJA 2C6TA 3GU6A 4NIFA 4BIDA 2YISA 3HLLA 3EMGA 3UIBA 3WE4A 5CAUA 3EQPA 1F0QA 3AQVA 3BZ3A 2R3GA 3SV0A 4MH7A 2OI4X 4USDA 2ITYA 4DGGA 4E93A 2VWXA 4QP2A 4CGAA 4G34A 3KCKA 5JH6A 4A9RA 4XEYA 1GY3A 3Q60A 1OIQA 4DCEA 3U8ZA 5HEZA 2VRWB 4U44A 4O0XA 4P90A 2H96A 4LI5A 3SD0A 1SVGA 1PW2A 5KKRC 2W5BA 3WZUA 1ZVRA 2CKPA 4E6CA 5AUZA 2P55A 1JKLA 5TE0A 4AGCA 4O0YA 4D58A 3FL5A 3VW8A 2WU7A 3SVVA 3QYWA 3CPBA 5TT7A 5FDPA 3JXWA 3VUGA 4ASDA 1DDVA 3DQWA 4CLIA 3G5DA 5ANJA 2YM3A 2R0UA 3R04A 3SRVB 3C4EA 4TNBA 4IZAA 4AGUA 5EDRA 1ZMWA 1R78A 2OZOA 4PMMA 4FEQA 4EBWA 2A27A 3NIZA 4TRLA 3E8DA 4X6RA 4KIKA 1H4RA 4O22A 2CMWA 2ITVA 4IZ5A 2JD5A 2QHMA 4P7EA 1ZC3B 5CQUA 2ZJWA 1S9JA 2G9XA 5D3VA 2VRXA 4H36A 3BIZA 3V5PA 3KMUA 1H24A 1IRKA 4YURA 4KS8A 2ZYBA 4RJ5A 5E7RA 3VBWA 4RJ8A 3AC2A 1K5GB 2ITPA 2JEDA 5KKRB 3VBXA 4UALA 2COCA 3WYFB 5BV3A 4QP7A 5ETFA 3VF8A 2W05A 4XV2A 4F08A 5K4JA 3QD0A 1WG7A 3DXEA 4C3PA 4APCA 3E3BX 4AXAA 1ZWSA 2JIVA 4L3JA 2YEXA 1H1PA 3DBCA 5HIDA 3V3VA 5M06A 4PDYA 4YUQA 3COHA 2ROZB 3BL9A 3QHWA 5DNRA 3MDYA 3BRBA 2C6MA 4FG8A 4KIOA 3W55A 1P14A 3PXQA 3DB6A 2ITQA 5AR8A 1BX6A 2FO0A 1Q67A 2V7OA 3GI3A 3R6XA 2BPMA 4RMZA 5D11A 5C9CA 4QQJA 4I6HA 4FOCA 5HE0A 2IG7A 1DAWA 1PY5A 4IW0A 2GFCA 3FPQA 1U46A 2H6DA 4EQUA 3TKUA 3IKAA 5BQ0A 5FXQA 2YM7A 4GW8A 2PZ5A 1W0XC 1PXJA 2VTPA 4FYNA 2B7AA 1M17A 3C5UA 3LQ5A 3VBQA 2IWIA 1PJKA 3GU7A 3A8WA 1XKKA 4O0VA 5JGAA 5LCKA 5IEVA 2R0IA 3BLHA 2PUNA 3A4OX 4ZTSA 4K8AA 3UP2A 3FLWA 4H3QA 4ZTRA 3KIOC 2UW5A 2PMOX 3P6AA 4H8SA 4IX6A 3PY0A 4CG8A 2KR0A 5J8IA 2WD1A 4FNWA 4TYHB 3NNVA 3QA8A 3PUPA 3QKLA 5DA3A 5I2SA 3PDTA 4ARKA 3WF7A 3NEWA 4NWMA 4C3FA 1O6LA 2E9PA 2BCJA 3LW0A 3QQLA 5AADA 3WZKA 2XJ0A 3TUDA 4D28A 4XG7A 4FKWA 5ICPA 5IISA 2VNWA 2XZSA 1WBNA 4GV1A 5BX0A 3MH0A 5CXZA 3LCOA 1ZYLA 5LARA 4QOXA 4G2FA 4ITHA 4RX8A 4K2PA 4Y73A 4M13A 4BHZA 3MTFA 1CMKE 2O64A 3SLSA 2ADZA 3ORZA 3M1IB 3GYPA 1NVQA 2C3JA 3SX9A 2XNBA 3D14A 3VVHA 5KBRA 2KULA <