3O96A

Crystal structure of human akt1 with an allosteric inhibitor
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
428
structure length
367
Chain Sequence
b'SDVAIVKEGWLHKRGEYIKTWRPRYFLLKNDGTFIGYKERPQDVEAPLNNFSVAQCQLMKTERPRPNTFIIRCLQWTTVIERTFTPEEREEWTTAIQTVADGLKKQVTMNEFEYLKLLGKGTFGKVILVKEKATGRYYAMKILKKEVIVANRVLQNSRHPFLTALKYSFQTHDRLCFVMEYANGGELFFHLSRERVFSEDRARFYGAEIVSALDYLHSEKNVVYRDLKLENLMLDKDGHIKITDFGLCKEPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHEKLFELILMEEIRFPRTLGPEAKSLLSGLLKKDPKQRLGGGSEDAKEIMQHRFFAGIVWQHVYEKKLSPPFKPQV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RAC-alpha serine/threonine-protein kinase
publication title Crystal structure of human AKT1 with an allosteric inhibitor reveals a new mode of kinase inhibition.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 99
structure length 367
sequence length 428
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2010-08-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
A PF00169 PH PH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3o96A03
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 3o96A01
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3o96A02
2VNWA 2HZ4A 4G3EA 4BHZA 2UZEA 3ORLA 5DN3A 4L3JA 3F88A 2R7IA 3GCPA 4L7SA 4KKHA 5KKRC 1IA8A 2XM8A 4ZP5A 3CC6A 1B39A 3ORTA 3QC4A 4D2TA 5CASA 3E3PA 1VYWA 3ROYA 3TN8A 3E8NA 5GJDA 1ZYSA 2ONLC 4GFMA 1SVEA 4W4XA 5JZNA 4A07A 5AFVA 4QYGA 3V8SA 3IK3A 3DCVA 4W9WA 3NYXA 1ZWSA 3MVJA 4NFNA 5DI1A 3IGOA 5BNJA 2UW9A 4FKOA 2OJGA 4NTTA 3ZM9A 5AR5A 3HGKA 1JWHA 3FXXA 3T8OA 4D2WA 2YISA 5KHXA 3RPOA 4DH3A 5EM5A 3SDJA 2R9SA 2YZLA 1BYGA 3CS9A 3EZVA 4ANLA 4FICA 4KHOA 5E9EA 4IAPA 3TJCA 4R6VA 4CHJA 3TDVA 3QQKA 2RLOA 1G3NA 2JEDA 1PKGA 2XCHA 5BYZA 2ELAA 4A5KA 3O96A 4IAAA 2HZIA 1ZC3B 3LFAA 3KC3A 1U54A 4BI1A 4UZHA 4P2KA 5AX9A 4YTIA 5D12A 4EQCA 1DAYA 2CKEA 2JC6A 3Q6UA 5IQDA 1KI1B 4GH2A 4NJ3A 3BGPA 3OWKA 3BLQA 5KNJA 2YM3A 4PL4A 4S32A 2IW6A 4QQ5A 5HLNA 3A8QA 4S33A 5M07A 4UXLA 1CKIA 3TTIA 4F65A 5JKGA 4FKJA 1PMVA 2BFYA 4B8LA 3LE6A 3AC2A 1OKYA 1BUHA 4IDTA 4MF0A 3UQGA 3KL8A 2R3IA 2PZYA 2R0IA 1FB8A 2NP8A 2GNJA 4QO9A 2X7FA 4IJPA 2E9UA 4Y46A 4JVGA 4YUQA 2BIKB 1PLSA 4XHKB 3TXOA 5BX0A 5LONB 3IOKA 4OT5A 5D3VA 5FUTA 4QP7A 5T6KA 2EU9A 2PVYA 2QODA 4G5JA 3TKIA 1YHVA 2RGPA 3PWDA 4EOJA 4M0YA 3S2PA 4I0RA 5D3XA 3HNGA 1U5RA 4DFYA 2J51A 5DHFB 4XLVA 4BIDA 5D3YA 3QKLA 4K33A 5ETIA 2DTCA 2LOZA 2QOBA 3LXLA 3HW2B 3Q04A 4CXAA 1JPAA 3CTQA 3KKVA 3RZBA 3QKMA 3M1IB 2C4GA 2VX3A 3VOQA 2F9GA 4R8QA 4QYEA 4WNMA 4X3JA 2LKOA 3R9OA 2HOGA 1G5SA 3UIXA 4PMMA 1Q3DA 3H9OA 3JYAA 4TT7A 5F95A 4BTJA 4C0TA 3V3VA 4ZY5A 1FMOE 2QU6A 1TVOA 2C47A 4BZNA 4H1MA 3F0WA 5DIAA 4YP8A 3GVUA 3ID6C 4I1ZA 5HI2A 4A9TA 4D0WA 2IPXA 1Q24A 2F57A 4G6NA 4OUCA 4OT6A 4IX4A 3F61A 5CU0A 4K77A 1JSUA 4LMNA 5ANKA 4BKZA 1MK9B 2R5TA 2G2FA 3DB6A 4MT7A 3U4WA 5B2MA 3FSFA 1W0XC 4FSQA 1Y91A 3HQCA 3OEZA 4PDYA 4TYEA 4TYHA 4RWKA 5BMSA 4IX5A 4J8NA 5C1QB 1X11A 1YXTA 2YS3A 2W4JA 2OIBA 2CCHA 4BCHA 1H01A 4FIFA 2DS1A 2J2IB 2NRUA 1YHWA 5M56A 2D9VA 4Y5QA 5ACKA 1YHSA 2VTJA 2WHBA 3IDCA 3KN6A 5HNBA 3DDQA 4JG6A 3GBZA 1V0PA 1U54B 4FZAB 4QTAA 4WG5A 3ZLXA 2YT1A 2CNVA 4FV5A 3OS3A 5LWMA 3L9LA 2YA9A 3K5UA 4XCUA 4BFMA 1OL2A 4XG2A 5JFWA 3SYXA 3PSBA 5AX3A 3FE3A 4YJSA 1ZC4B 3VC4A 1UU7A 2R3LA 2YDKA 4E6AA 4NM0A 4APCA 4EH3A 2PYWA 4CVAA 4IDVA 5H8BA 3PXKA 4O0WA 3PFQA 4O0UA 5DVRA 2VTMA 5C9CA 3D5UA 4GG7A 2EB2A 5TO8A 3RGFA 3CQWA 3VUGA 1OBDA 4FOBA 4EKUA 3NUNA 4XG3A 3UG2A 3MJ1A 3LFBA 4X2JA 4IQ6A 4FSNA 5HICA 5IUGA 4GFOA 4I92A 3COHA 1WJ1A 3LMGA 4G6OA 4CZYB 2W9ZB 4X21A 1XBBA 1PJKA 2OG8A 4NW5A 3ANRA 4RWLA 3W1FA 4BDJA 4EK8A 5J9YA 2DX1A 2VN9A 4HNFA 5DE2A 3W33A 3ZSGA 3W2RA 2QO2A 4U41A 5LMBA 5EFQA 1CMKE 1SHCA 4LV8A 3Q2JA 4OR5A 4CQGA 3BKBA 2RNRB 2P2HA 2RFDA 2VTIA 2XNGA 5A46A 3F82A 2PE1A 5CSXA 3DKFA 2NZ8B 2X7OA 3ZONA 3OMVA 2FGIA 3RJCA 2ITZA 2L1CA 4DN5A 3GFEA 3V5WA 2X7GA 5DT3A 2C1AA 3PG7A 2YHVA 2F7EE 2R3HA 4AW2A 3EIDA 4F6SA 3DAKA 3R30A 4KAXB 3OCTA 4C4EA 3BBTB 5HIEA 2J5EA 4UMQA 5K5XA 5AV4A 4IAIA 4P5QA 2ZV7A 5G6VA 1QQGA 5HE1A 4BDHA 1P5EA 1PYXA 4GG5A 5HLPA 4GSBA 3DDPA 3VS5A 3EN4A 4TYHB 1ZARA 3E8EA 4JIKA 2Z60A 3TIZA 5HZNA 3U54A 5HOAA 2EJ8A 2XBAA 1KWPA 3G5DA 2L2IA 4BDIA 2VTQA 3ZO4A 5AUTA 5D1JA 4EOSA 3ATTA 2VNYA 3GP0A 3NCZA 4U5JA 4C38A 5M09A 5EM8A 4G17A 4J98A 1J7IA 4PL5A 1KV2A 5JRSA 2V62A 4PUZA 1YI6A 3H30A 4R5SA 3BV2A 4A6FB 1UWJA 3QRKA 3AMBA 5CYIA 1GC7A 5M57A 3OHTA 4DH7A 1M2RA 1H0WA 3VBVA 2DFKA 3R28A 3MESA 3EZRA 5ITAA 4DFLA 4HVHA 3U6JA 4MXOA 3QWMA 1WBSA 3CJFA 2XEYA 4AGDA 2XP2A 4RVTA 4J99A 3EQRA 1WVWA 4ZJIA 1X1FA 4P7EA 3WYXA 3BCEA 4WUNA 4QMPA 4G34A 2YEXA 2IW8A 3VS4A 4O0TA 1QPJA 2X39A 4I5HA 4TWNA 1Z5MA 4LOQA 4EZ5A 4YZBA 4AW1A 4FKVA 2J59M 2K2JA 3ZZEA 3HAMA 2B54A 4WBBB 2X2KA 2W1HA 3A2CA 5DEYA 5CVGA 3OFMA 1I2HA 4U7ZA 4YJQA 5M4CA 2IO6A 4HPUE 1AWEA 3WYYA 5TT7A 4ERWA 4H1JA 4W9XA 5K4JA 3CD3A 2UW3A 3MBLA 3H4JA 3MWUA 3Q4ZA 2V22A 4BCIA 5JQ5A 2Z02A 5KE0A 3BYMA 2COAA 5CXZA 4L44A 2XJ2A 1P4FA 4C3PA 5CF8A 4WBOA 2GNIA 2RG5A 5CF4A 5I9WA 4P7IA 1JSTA 2H6DA 4UV0A 3F6XA 3KCFA 3KY9A 3P7BA 5AWMA 3QCXA 4FT5A 3ZOSA 3CTHA 2J90A 4CRLA 4EBWA 5M4FA 2A2AA 1KOBA 2UZTA 3NAXA 5CF5A 4F70A 4Y73A 5LMAA 2LYDA 3CPCA 3E93A 3EQHA 4FVPA 3P78A 4BDEA 4GT3A 3H0YA 3AD6A 1U5FA 3O17A 4RQVA 4FV6A 2VX1A 2X81A 3DXCA 4FUXA 5HX6A 2HK5A 4KRCA 1V0OA 4Y5HA 5KMJA 3FHIA 3R7EA 2N0YA 3QALE 3CP9A 5HD7A 4K2PA 5DBXA 4KIOA 3IW5A 2VO3A 4Y83A 5EDRA 2GTMA 4A7CA 2WOTA 3Q4TA 2W0JA 3MW1A 4XOYA 3UYTA 3II5A 3QHRA 1NU2A 2ETRA 3ERKA 4B99A 3D5XA 5ICPA 3FMNA 1GJOA 3QX2A 4N4SA 3K5VA 2JBOA 2R3GA 4EJNA 2QKWB 4ASEA 3LJUX 2PE2A 1UNQA 4RZWA 2WXVA 2WQMA 3OWLA 3GCVA 4QMVA 3F5PA 4F9CA 3CD8A 3TL8A 1Q5KA 5JRQA 1O9UA 4PQ0A 5HNIX 2DN6A 1T45A 2IN6A 3CSVA 4X7QA 1HOWA 1R0PA 3QD0A 2W1IA 4AOTA 3R1NA 1M7EA 3NMUF 1ZZLA 3FMDA 4PP9A 3ENHA 3T9TA 3LCKA 4BKJA 5CTPA 4YURA 3GOPA 3L8XA 3Q5IA 1RE8A 4Z7HA 3SW7A 4HYHA 4BGQA 2C3KA 2XRUA 5DT0A 5KMNA 5CWZA 4AWIA 5H9BA 4O96A 4MCVA 3F2NA 4ZSGA 4DLJA 3DXPA 3BU5A 1RRPB 2JDOA 4V01A 5HEZA 2GHLA 2HZNA 4MQ1A 3IKAA 2XNNA 2Z7SA 4J7BA 2FSLX 5EW3A 3DU8A 1LEWA 3RTPA 4XG7A 4BCNA 1X1GA 3D9VA 1YDRE 2JLDA 3D83A 4D4YA 5DRDA 3OW4A 4L9IA 3ZXZA 4LQMA 3P23A 1R0EA 4OBPA 2DKQA 3ZUUA 3F3VA 3DXDA 3FY0A 3UOHA 1TQPA 4IB3A 4EORA 2W4KA 3HMOA 4R7IA 4FE2A 4U80A 4O21A 1EF1A 5FI1A 3Q9ZA 5IQCA 1IAHA 3D4QA 3GCQA 3ULBA 1W83A 2PY3A 4LUEA 1DDVA 3NVKI 1H08A 2Y6OA 1M7NA 3EB0A 4XBRA 3TM0A 3LOKA 3WF5A 3NUYA 3KXGA 4ZRJA 4X2NA 5LMKA 1E1XA 4U42A 4YZDA 4D2RA 4LM5A 3KMMA 5HIBA 1ZZ2A 3S1HA 2P0HA 4E6DA 4P5ZA 4E7WA 4E3CA 4MNEA 2P3GX 2JBPA 2QKRA 4H3BA 1PYEA 2PUNA 4S34A 3ZVRA 3ELJA 4OAVB 3SNHA 2XK9A 1H27A 4AOIA 3QYWA 3DJ7A 4IX6A 4IIRA 2AYPA 4MX9A 5CU6A 3LHJA 4B6HA 2VO6A 5C4LA 2W5AA 2ERKA 2FVDA 4B8MA 5A4QA 4IFGA 4JAJA 5BMMA 3SOCA 5HVJA 4AU8A 3F9NA 5C27A 2PL0A 2OZOA 4E26A 1BWNA 1H25A 4ENXA 4AGWA 3IECA 4NKSA 2GS6A 2GDOA 2G01A 5E1EA 3HMNA 2CGXA 4IBMA 2XYNA 4BDCA 3GU8A 1DROA 1Q62A 3MDYA 3IW4A 1TKIA 2BUJA 3VF8A 4EYJA 5EKOA 4CYIA 1WBPA 3HZTA 4FV0A 4LYNA 4JRNA 4YLKA 5FDXA 3UPXA 4NH1A 4F7GA 3U87A 4BR3A 3HA8A 4AS0A 4FUYA 4MNFA 4G3CA 1A48A 4KBKA 1FVVA 3AT2A 5HCYA 3B8QA 4M69A 2GHGA 4NUSA 2GNHA 3O23A 2DHKA 1B55A 2XKFA 4O7SA 2Y4PA 3EN5A 3HA6A 3C7QA 4C61A 3T3UA 3GQLA 4RWIA 4RIYA 2VWZA 3DNDA 3BHVA 1ZYJA 2H7DA 1YRPA 2OXXA 3O8PA 4HVIA 1QCFA 4X2GA 1GAGA 4DCAA 3FMHA 1WVXA 2B4SB 2C6LA 2VTPA 3H9RA 3F7ZA 2EXMA 3I60A 3FDNA 3R00A 4MQ2A 5IUIA 4AE6A 2VTHA 1OPKA 1GZOA 5FQDC 5A6OA 3TKHA 2H34A 4RC3A 4D9UA 1MRUA 3FAAA 4HAYB 3C13A 4RJ4A 2ERZE 5JHHA 2YABA 2EXCX 3JVRA 3LCSA 4CFXA 1M14A 3ZFYA 4L3PA 3ZS5A 3RINA 3QRJA 2JDRA 3VIDA 4TKSA 5IQBA 3TTJA 4ASXA 2PPQA 5DYJA 1R78A 4MYGA 4O83A 4UBAA 2AEHA 4I4EA 4K11A 3HV6A 3BELA 1J91A 3MY0A 4IZAA 1IAJA 5LOHA 4M67A 4EQUA 3LFFA 3R2YA 4MNEB 5A6NA 3LJ2A 1OIRA 3BYOA 2YACA 1OPLA 2YVCA 5CLQB 4O7RA 5AIRA 3QUEA 4FKSA 3COIA 3R01A 4IWOA 3ZMMA 3ZO1A 3GUBA 2H8HA 4F6UA 3SLSA 1SVHA 3EQCA 1H28A 3OXIA 4ZJJA 2F7XE 1M2PA 2WMAA 3WF7A 2XNPA 4CZTA 4QP4A 1TJ6A 1Y57A 1K5GB 4FV2A 4MD9E 5EM7A 4E6CA 3AC8A 3FEHA 5DH9B 3FC1X 4AQCA 3I5ZA 1DAWA 3R02A 4GPTB 4UALA 4AT3A 3M42A 3NUXA 4YLLA 5BVFA 3QQJA 4KAOA 2ESMA 3ZYAA 4WHZA 4FKIA 4FEVA 2PZ1A 4HZSA 2RF9A 3G6HA 3Q32A 2DUVA 2RFSA 3F66A 4Y8DA 5ANEA 2RL5A 2RUKB 3D8EA 5E92A 4JLCA 4EC8A 1WZYA 4RQKA 1UU9A 4YSJA 3FZTA 4XRJA 2UVXA 3TNHA 2E9OA 4HAWB 4IWDA 3V8WA 5M06A 3BRBA 3RK5A 3NIZA 4FV7A 1Q41A 2WTIA 2PTKA 3ET7A 4RJ5A 3TWJA 4EOKA 1MKEA 3PVLA 1OKZA 4C57A 2IVTA 3NYVA 4QTEA 3KY2A 4Z7GA 3IVFA 4F0IA 1OBGA 1H24A 3QCSA 5C8KA 4JDJA 3C5IA 3C9WA 2NPQA 4K9YA 5AP4A 4L6EA 3G33A 4I5CA 3FI8A 3BLHA 1BX6A 4HYUA 3B2TA 2JFLA 4R7HA 4JNWA 4F7NA 1G8AA 2ZV9A 4OTDA 1SGHA 1U29A 4IHPA 3HMPA 4IM2A 2XF0A 4HW7A 2R3RA 3BX5A 2W9FB 2Z0QA 3SO6A 3RVGA 1YW2A 2IVSA 5FRIA 4A9SA 5FTQA 5CT7A 3WE4A 2C5YA 4GL9A 5CU2A 5JZJA 4JQ7A 5A3XA 5DIFB 4PTCA 4F9YA 2CMWA 2DKPA 4FSTA 4EHEA 4JIAA 5EH0A 4F63A 1DYNA 4EOPA 3E8DA 2R7BA 2WMXA 5FWKK 2C5VA 2E2XA 2K00A 2IFSA 3PDTA 3ORXA 5E8UA 3LJ0A 1NI2A 2PULA 2WGJA 3UE4A 3V8TA 1MPHA 4E6QA 3DNEA 3DK3A 3G9LX 3ZSIA 4XJ0A 4PRJA 3UNJA 4ZZNA 3JR1A 4TKNA 4DG0E 1FQ1B 1PXJA 4FGBA 5FDPA 1ZOGA 4ANQA 4IH8A 3LCOA 3KVWA 5BVDA 4AN9A 4ZOGA 3FKLA 4FTNA 1KUTA 4EL9A 1WJMA 3EFKA 3EN7A 1VR2A 3PSCA 1LB1A 1P2AA 2XK7A 3KRJA 1FHXA 3ATSA 2CY4A 2J50A 4ALVA 5AIKA 4QYHA 2GS7A 5AJQA 2JIVA 2VU3A 2X8IA 3F3WA 3KXHA 3R0TA 5CS6A 5EM6A 4E4XA 2QHMA 3FLWA 5GOWB 3TG1A 4DEEA 2HENA 3VBQA 5F4NA 3OF0A 3I7CA 2YS5A 1UV5A 5ACBC 4NEUA 3R8UA 3UO5A 5CVHA 4IFCA 4FOCA 4RWJA 3EQPA 3ZEPA 4ASDA 3H9FA 4L53A 4L8MA 3EL7A 3LXKA 4YBKA 1EVHA 3SG8A 1K3AA 3FSSA 5HE3A 4HNIA 5BVOA 3TNWA 1O6KA 4WA9A 4I6BA 2C6KA 3GU4A 4JL9A 4S2ZA 3LW0A 1IRSA 3E64A 4DFNA 1UNGA 2AC3A 2UW5A 3E7VA 3AC5A 3KB7A 1S9IA 5K0XA 3NW6A 3VUTA 4YJOA 2X8EA 3UNKA 4DGGA 3HK0A 3HRFA 3PXZA 1NW1A 4S30A 1ZY4A 4K2RA 2XK6A 4C4GA 4BCOA 5JGDA 1P6SA 3KXXA 3ODZX 4ZTQA 3VJNA 2YF0A 3R9RA 2QOCA 4PMTA 3SVVA 2FSMX 2ZMCA 3BLRA 4C02A 1PFJA 2WMSA 5IG1A 4GK4A 4QQTA 1N3HA 4U8ZA 5FXQA 4BIEA 4EOLA 5IF1A 3RNIA 3EN9A 5KMMA 2YRYA 3AGMA 1U5DA 4HHVA 4BDBA 4EH8A 4WSYA 2GNFA 3R8LA 4GJ3A 4EC9A 5KMIA 2BKZA 5KBQA 2J0MB 4K81A 3V5QA 2C0TA 4HDOA 2EUFB 2ITYA 1ZMVA 3LAUA 1L8TA 5A4EA 3QWKA 2RG6A 4I23A 3F2AA 5TKDA 5KHWA 2ELBA 2GQRA 5I9VA 1MUOA 2D11A 2X9EA 2YM7A 3FMEA 4OTFA 5DPVA 2EMTA 5LCKA 2ROVA 3D8FA 4HVGA 2C3LA 4Y95A 2BZHB 4JXFA 1YDSE 4WNPA 4HB4B 3ZDUA 3RPYA 5AEPA 2E2BA 2ZMDA 4FSZA 3L1SA 4L68A 4KBCA 4O2ZA 3RP9A 3UZPA 2BPMA 4DGMA 3Q2MA 4UMPA 4YC3A 5L81A 1DDMA 3TUDA 2WB8A 2B9HA 4FVQA 5AR4A 3BBWA 2V76A 4U97A 3A99A 4XV1A 5HO6A 2KCJA 4ZTMA 4R7BA 5IEYA 1XODA 2OU7A 4YJUA 5EHLA 4L67A 2OQBA 3LJ1A 1Z57A 2W1EA 3BQCA 3PG3A 4ZZMA 1M2QA 1BI8A 4GK2A 3PPZA 4ANNA 4EYMA 2I1KA 2P0DA 5AP3A 4ANOA 5KUPA 1R1WA 5AV0A 5DLSA 3VRZA 2UZLA 3D2IA 4O7TA 5CI6A 3TNPC 5H2UA 1PXLA 2NRYA 3IO7A 4H3QA 3L8PA 2YCQA 3HECA 3NNXA 4FTTA 2IVUA 2QOHA 3IW8A 1WBWA 4U40A 5I9UA 5KQ4A 4EWHA 2R3MA 4IB1A 3A7HA 2NMBA 2UW4A 4MTAA 5L3AA 4DXAB 4ZTHA 3UGCA 2C3IB 5C26A 2PVMA 3FYKX 3QD2B 3VN9A 3ZTXA 4E4MA 1W82A 4BZDA 4C4JA 1TQIA 4JG7A 5EI2A 2WO6A 4XG8A 4YTCA 1M7RA 1UPRA 1MQ4A 3EFLA 4HAVB 5AP7A 1I7AA 4IZ5A 4LRMA 4UYNA 3QUDA 3BHHA 4NSWA 3FSKA 5IQIA 4ALUA 2Y0AA 4RVLA 4FV9A 2XYUA 4BGHA 3OG7A 2C1BA 3TZ8A 4O38A 4ENYA 2ITVA 4ZRKA 4NSTA 4E4NA 4FL3A 5BYLA 2WIPA 4KKGA 3Q53A 4MXXA 2WELA 4IVBA 4DLIA 4EKLA 5J79A 2R3NA 3LFCA 4R78A 3AU4A 1TXDA 3CGFA 4L46A 2XUUA 2GHMA 1JQHA 4Z55A 3F3TA 4OAUC 3DKGA 3QGWA 4D28A 5CEQA 4BWPA 2J0LA 4MBLA 3OD6X 3MFRA 4HYIA 2NO3A 3UQCA 1NVSA 2ZJWA 3KRRA 3G0EA 4BICA 1OITA 2FJLA 2J7TA 4CHMA 4F7JA 4ACGA 3BHUA 3UC3A 4UEUA 5HE0A 3CXWA 5KZ0A 3DT1A 5IDNA 4ZSAA 1H0VA 4ITIA 3GGFA 1U5QA 2OZAB 3FUPA 2BDJA 5AUXA 3ZFXA 4B0GA 3OTVA 4RX5A 2I5CA 5J8IA 2HYYA 3E7OA 4OTWA 1UKIA 4WIHA 5HO8A 1I44A 2YJSA 5FXSA 2CKPA 5M4UA 1OQNA 4D2SA 2QI8A 2ITOA 5DT4A 3ZM4A 2X0GA 2PVLA 5M53A 3C0IA 1VZOA 4UY9A 2VWVA 1PMEA 1OL6A 2WEVA 4MWHA 2VTRA 4OBOA 3FI4A 5BUIA 3F7WA 2VRXA 2XIYA 4UWYA 2O2UA 4BWXA 5H8GA 3MVHA 4FR4A 1XR0B 2BTSA 4X3FA 4RIWA 4EMOA 1ERKA 3PLAE 3PP2A 2I7QA 3NNWA 4DFBA 2BVAA 5C5BA 4O7VA 2OFVA 3T9IA 3ORIA 2R2PA 3R21A 2C0IA 4IADA 5KMLA 5LJJA 4KHBB 4MF1A 4QMWA 5CAUA 3QCQA 3EHAA 2XS0A 5M55A 2O8YA 2PWLA 5IH4A 4FEWA 3R7UA 1NA7A 2COFA 4V05A 5K3YA 1Q3WA 4YSMA 4R5YA 4HB0B 4GKIA 2OKRA 3FZRA 1FBNA 1Q4LA 5HTIA 2ZM3A 4FIGA 4O1PA 4DTBA 2I1JA 4Q5HA 4NIFA 4Q9SA 4TWPA 5DRBA 3E5AA 4DBXA 3COMA 2G35A 2JDSA 2V5QA 4EONA 4I6FA 2OGVA 4XRLA 3NAYA 1O6LA 3VUKA 4PMPA 2MDXA 3DPKA 3MVMA 4D1ZA 1ZOEA 1BTNA 1PW2A 4AW0A 3BI6A 3VNTA 3FPMA 2QOFA 5CZIA 2VTOA 4C35A 2ZV2A 4QQCA 3GU6A 4UZDA 1Q99A 3RBWA 3FKOA 2XK4A 3I6UA 3QTSA 3K3JA 4QYFA 2WFYA 2WMRA 3HRBA 3QGYA 3RKBA 4EK5A 5FEQA 5L6PA 1ZVRA 2QU5A 3RPSA 3U8WA 4TRLA 3VS1A 2A1AB 1YXXA 3QQHA 2WQBA 4D0XA 1WBVA 2OJ9A 4ZTNA 4JQEA 3A4PA 3O50A 3H0ZA 1AQCA 1U27A 2DLWA 5HCXA 5EFXA 1XCGA 5E8SA 4XH6A 4CYEA 3LKMA 1M52A 1V88A 3D15A 1Z87A 2YAKA 3RAHA 5JLJB 2WPAA 5JH6A 5IA5A 2BRBA 2A27A 4UYAA 3OROA 4NCTC 3QZGA 1NVRA 4JR7A 4Y85A 2HXQA 4HCVA 5AR7A 5D3WA 4ORKA 3ZFMA 4JRVA 4FKTA 4MXCA 4CCBA 4DHFA 4DEGA 3ENMA 4L7FA 5JQ8A 4YHFA 2BAKA 5FD2A 3CGOA 1P3RA 1BI7A 4QTDA 4XYFA 4BDGA 3DTCA 2P0CA 3NNVA 4FSWA 3F5GA 4ZMFA 3N51A 4EHGA 3HUBA 4RIWB 3RCJA 1QPDA 1YOJA 4PV0A 4RZVA 5EYDA 4PNKA 2DQ7X 3NSUA 3ZC6A 4Z3VA 3AD4A 3G15A 2W1DA 3PA3A 4G5PA 3R7OA 2RVBB 3ODXA 5FP5A 4D4RA 3U51A 3PA5A 1ZMWA 4E73A 3DQWA 3DQXA 3ZDIA 5E8VA 3KXNA 1A9UA 4U44A 3Q9YA 2IZUA 4JJRA 1BL6A 3HDMA 3DXQA 4PX6A 2VV9A 1PMSA 3QQLA 2OF4A 3SQQA 3OW3A 1YVJA 5H8EA 2OJIA 3THBA 3R7VA 5J5TA 4TYJA 3O8TA 1FVTA 4IVCA 1YOMA 4IXPA 3SC1A 4CFFA 5HIDA 2FUMA 4AZEA 3BHYA 4FZDB 4NKAA 4BYIA 3S4QA 1SNXA 5C79A 5CQWA 3UC4A 5AAEA 1B38A 4FYOA 5IA0A 4EH5A 3TW1A 1FGKA 3KQ7A 4QMXA 2ZM4A 2HAKA 1A06A 2QR7A 2UZUE 4YHJA 3DS6A 3LZBA 1UA2A 4FT7A 4UWBA 5E8ZA 3ULCA 5IQHA 3BYUA 4TYGA 4ZXTA 4QP2A 5JK3A 3TJDA 4HCUA 2MWNB 5LVPA 2DWBA 2BAJA 1KE8A 3FL5A 3KVXA 3OC1A 4HJOA 1OY2A 3MS9A 2XBJA 3EN6A 3PE1A 4D1XA 4IAZA 4XG9A 3DAEA 3PUPA 4FIIA 5C01A 4AAAA 3A7JA 2BZJA 2I6LA 5IUHA 4L42A 3FMKA 5BQ0A 4O0YA 5EHYA 4A9UA 1UNPA 5EW9A 2X9FA 4NL0A 4W4YA 3R7YA 3V6RA 1DI9A 3RHXA 2I0HA 2GJYA 2K2UA 3SV0A 1HCLA 2CDZA 4NK9A 4QTBA 1DI8A 4ONAA 3SXRA 4NFMA 5IEXA 2UZBA 1H1WA 3LVPA 2V7OA 4XV3A 4WD5A 3LQ5A 1MRYA 5J7BA 4RVMA 4F9WA 5E8WA 3ZCLA 5E8XA 2COCA 2BZIB 1W1DA 1CKJA 3PPKA 4ZTLA 2GQGA 3KN5A 4O7LA 1XJDA 5FTOA 4AFJA 3D7ZA 4DBBA 3D7TA 3QLFA 4L52A 1OGUA 4GV1A 5C16A 3PJ1A 3OCGA 2ONLA 3SHEA 4BCMA 2HIWA 2Z2WA 3OEFX 3QL8A 2ACXA 3ZLWA 3HV7A 3OY3A 4WSFA 2CY5A 3PZHA 3GC7A 2I0YA 1J19A 1PMUA 3GQIA 5T68A 3OOMA 5HHWA 4YMJA 5HCZA 2J0JA 3LMIA 1GZNA 3WILA 4BI2A 2V55A 4E5BA 3MB7A 2XRWA 3Q9WA 3UZTA 4EI4A 4AT4A 3W2CA 4AW5A 4MK0A 4KB8A 3CIKA 5DGZA 2E9VA 1GG3A 3ORPA 4QMUA 5FM2A 5L2TA 1FGZA 4QMNA 1XQZA 5E90A 1ZYLA 5E7RA 5EQPA 3BQRA 2YCFA 3MI9A 2WTKB 4M15A 4F7LA 3G90X 1VYZA 4IX3A 1UEFA 3MA3A 4CTCA 1MQBA 1BMKA 4FKGA 4RSSA 1P14A 2ZM1A 3MJ2A 3KULA 3GB2A 4G31A 5DR9A 3MDBC 3R8VA 1XBAA 4LI5A 5CANA 3R9DA 4KVGB 3TDWA 4CQEA 3BZ3A 3E88A 3NIEA 1J7UA 2FB8A 2GQSA 4ZK5A 3UTOA 3BHTA 1SYKA 2PVHA 5AUYA 2RFEA 2C5OA 4GVAA 3EH9A 1ZMUA 2W1GA 2JITA 3EJ1A 3HUCA 4J52A 4TPTA 5D7VA 3ORZA 3EMGA 4P4CA 3WYFB 1NY3A 1MK7B 3VRYA 4FTLA 4E5AX 3VQHA 4H8SA 2UZWE 3OT3A 3TVVA 3OUKA 4I94A 3ZU7A 4QMLA 4FEUA 3NSZA 5FM3A 3W2PA 3IPHA 5IU2A 4DYMA 2HCKA 2FSTX 2XIRA 3GI3A 2H9VA 1W1GA 3GNIB 4BTFA 5GZ8A 4E4LA 5HNGA 5I9XA 1LP4A 2XCKA 2PUUA 4GFGA 2DHJA 2PMOX 2IZTA 2XIZA 4RA4A 4E93A 4J95A 5HORA 4PNIA 1OVEA 3QA0A 3NEWA 4AZSA 4I93A 2IYBA 4FV8A 4ZMEA 3CCNA 3COKA 4QNAA 3U55A 4ASZA 1H1RA 3NZ0A 4CFWA 4A4OA 5L6OA 3UOKA 5KKRB 4BCGA 1MAIA 5CEOA 3OTUA 3DLZA 4D9TA 3D7TB 1FHWA 2AUHA 4V0GA 4TW9A 4DEIA 2W5HA 1GY3A 2GMXA 2WAJA 2FO0A 4CKIA 1OKVA 4O0SA 1PHKA 5AP1A 3C51A 3EQFA 2W2XD 1WGUA 3D5WA 3RM6A 4D2PA 5EQEA 3ZO3A 4LFIA 4O0VA 2Q0NA 3P9JA 4JT3A 4D2VA 3FZOA 4IOYX 4RLLA 2Y8GA 3NR9A 3MSSA 4L00A 4R3CA 1OIYA 2O0UA 5CSVA 4TN6A 4C36A 2E9PA 4L45A 2ZPYA 4O91A 4PDPA 4AE9A 4YO6A 5IQGA 2X2MA 4EHZA 5J3QA 2HE7A 2WTVA 4AACA 2ZDUA 3EL8A 3Q3BA 3NWWA 4OLIA 4NZWB 4XV2A 5DHJA 4FKRA 4AA0A 5JFXA 4FT0A 3WZKA 3R2BA 2YSZA 4FNXA 4USEA 1Z9XA 5EDQA 1LPUA 2WMQA 4ZLYA 3BV3A 4DH1A 2PZPA 3QQGA 1UWHA 5CSPA 2R3KA 1V89A 4CLIA 2DYQA 3FHRA 3KULB 1AD5A 4XG4A 3UDBA 2QOQA 4K18A 4EH2A 2Q0BA 2C69A 4KS8A 3D5VA 4QYYA 5ANIA 4AGCA 4AP7A 2BMCA 4MAOA 5J87A 4FIEA 2PVJA 5KX8A 3DXEA 2QKLA 2QOKA 3Q4CA 4H58A 5LVMA 4ANMA 4CFVA 4WSQA 4CKJA 5D41A 1KSWA 2M14A 3TZ7A 2HW7A 2C6DA 3IDBA 4YJRA 4AGUA 5A54A 1DBHA 2WMBA 2JKOA 3SV1A 4ZAUA 2ZOQA 3R04A 4OTPA 3TCAA 3MPAA 2YERA 5ANDA 3V5PA 4DFUA 4W4WA 2C5NA 4GYIA 4RVKA 3R63A 4O2PA 3R9NA 3VS3A 4BIBA 4CFNA 4FSMA 5L6WL 3FXWA 5BUJA 4D5HA 3MFUA 5HESA 4ZRIA 5B0XA 4EZ7A 1YOLA 4I0TA 1KE6A 3P1AA 2BFXA 2ZV8A 2X1NA 2UZDA 2DYLA 3V5LA 3UOLA 4IZYA 4ERKA 3HVCA 5J3YA 3QTUA 4JBPA 3V5JA 4YONA 5EKNA 2QLQA 3OUNB 1IASA 3PXQA 4CT1A 5FI0A 1CDKA 4XP0A 4JBVA 4ZSLA 1XKEA 4KSPA 5HVKA 2R09A 2X2LA 2W7XA 3QXPA 4V0GB 3VO3A 4DG3E 1QPEA 4YZMA 3VUDA 2WU7A 5D10A 4QP8A 2JAVA 1REJA 5HG8A 5KZIA 4M12A 4RBLA 5CAQA 4KIKA 4H3PA 4FBXA 3S0OA 5E1SA 3VIAA 3TCPA 3DFCB 4BB4A 4YGAA 1P5TA 2D9ZA 3N4UA 5DWRA 4FZ7A 4RJ7A 2R0DA 5HTBA 4LL5A 4C59A 4QMTA 3JY9A 4UWCA 2VAGA 4TXCA 4I41A 3GCSA 1Y6BA 5C6RA 4I6QA 4CMOA 1T46A 4RC2A 4FTMA 4L43A 3A8XA 3WARA 2DHIA 5IEVA 3UO6A 2OWBA 3GFWA 3I4BA 1OZ1A 2QO9A 5E4HA 2PMLX 5AAGA 1JKTA 4XX9A 4EJ7A 3FKNA 1U5EA 4YTHA 4FIHA 4WRSA 4HVDA 3GT8A 4GRBA 1YXVA 3FV8A 3VHEA 4DC2A 3DZOA 4RIXA 5HBJA 2N23A 2C6OA 3KF7A 4BTKA 5J5SA 3E62A 4IANA 4O22A 4QT1A 1K2PA 3KU2A 5AR3A 3KCKA 4JBOA 1URWA 4IB5A 4ACDA 4FEQA 1DDWA 4QP6A 4C34A 3TNQB 5BUEA 4WNKA 4KD1A 4IC7A 1UKHA 4PF4A 3PLSA 5DA3A 4CKRA 3PWYA 2ZYBA 1KE9A 4D55A 5EYMA 4NTSA 3QZFA 2JGZA 5DNRA 4A4XA 3W8QA 4IVAA 4E1ZA 3K54A 4FTAA 3ZBFA 1DS5A 3NYOA 4FF8A 4MH7A 1H10A 4MD8E 4FTQA 5L8KA 4HDQA 4A6KA 5CLLB 4O0RA 3R22A 2IVVA 1GZ8A 4U6RA 2OBJA 4DEBA 1KE5A 3NS9A 3OP5A 4DE4A 5GIOE 3OCBA 5LWNA 3PE2A 3UMXA 2GU8A 4H05A 4PPCA 4PTGA 3UZRA 3LCTA 4DEHA 4G9RA 4G9CA 3BYSA 4UN0C 1FAOA 3P4KA 1W84A 5LVLA 5TOZA 3ZRLA 4XLIA 4BN1A 5F9EA 5L4QA 4M69B 1O6YA 2OTXA 4WJ7A 3JUHA 3PJCA 1J0WA 4NWMA 3I0QA 3OWJA 4C4IA 1K5DB 3B8RA 3EKKA 3P7ZA 2QQ7A 4RIYB 3L8SA 3PEGA 4UB7A 4G3GA 1PY5A 5AM6A 1KZ7A 3V5TA 4OW8A 4Q5EA 4KIQA 4F08A 2UZSA 1MP8A 3DTWA 2YCSA 4RPVA 4F9AA 5CAOA 1NT2A 4G1WA 3ULZA 4AT5A 3SUZA 1YXSA 3ZUVA 4GMYA 1Y19B 1W1HA 3FMJA 2X18A 2O63A 3PIXA 1OIQA 1U4DA 4LRKA 4QPMA 1PMNA 5GJGA 3W8LA 2QOOA 4ZJVA 1BAKA 1M17A 2QOLA 1H26A 3TIYA 1OI9A 5CNOA 5CU4A 5HX8A 4F4PA 1REKA 5J95A 3VUIA 1H8FA 3AC4A 5AP2A 2G2HA 4U3YA 4YC8A 5DG5A 4NY0A 2ITTA 3X23A 2YZAA 2VWXA 5JT2A 3D2KA 4JX3A 5GJFA 1Q8WA 5JHGA 3NW7A 3VS7A 4CSVA 2XEZA 3UOJA 4JS8A 3KXMA 3FZ1A 2W4OA 3WE8A 1SM2A 3MH3A 3QTZA 4O27B 4KBAA 4QMMA 3W10A 3ZLSA 1IG1A 4EOOA 3M11A 5F1ZA 3PY3A 2UV2A 3WZUA 4CG9A 3MPXA 4QMSA 1XHAA 3QC9A 5HG7A 1YKRA 3AC1A 2CHLA 5EW8A 1VJYA 4OBQA 4EKKA 5AUVA 4OTIA 5I9ZA 2CRFA 2OH0E 3HV5A 3HP5A 4O1OA 2QVSE 2YAAA 4DF3A 2VX0A 5BVWA 4FKPA 4O86A 4C33A 3W32A 2VKIA 2R0UA 4DAWA 3LXNA 3W18A 1FGIA 2IZSA 1L3RE 4AXAA 4X2KA 3WZJA 4O82A 4TNBA 4QP9A 4DEDA 2YLEA 3O7LB 4F1TA 2JKMA 3CXBB 3WZEA 2VWIA 4WT6A 1Y8YA 4QMOA 4GMVA 3T3VA 1IRKA 2D9YA 3F5UA 3UVQA 5CENA 5J9LA 2W99B 1FHOA 2Y6MA 3R7IA 3ZBXA 2I1MA 2ITPA 3DK6A 3PVUA 1H1PA 2QHNA 1FOTA 2XH5A 4M13A 4YNEA 4AG8A 4YJTA 2X8DA 5CEMA 4GUBA 3Q5ZA 5B2LA 2GCDA 2P33A 1G8SA 1JKSA 1H00A 3PRIA 4W8DA 4IB0A 4WVFB 3AG9A 3SOAA 4TTHB 3N9XA 4RJ8A 4C4FA 4Q9ZA 4J71A 2UZRA 3C4WA 2R3JA 4J1RA 4F9BA 5JSMA 4DX8A 4M0ZA 4E20A 1XX0A 4C62A 2XA4A 3NGAA 2OXYA 2BHEA 3NX8A 4MKCA 4N0SA 4C7TA 5M4IA 2B55A 3I5NA 2MFQA 1U5GA 3KK8A 2C30A 2RIOA 3QTRA 2PUIA 2EC1A 4LGHA 5B7VA 3QHWA 4BCPA 3PXFA 5HTCA 1Q97A 2ITXA 3TKUA 4APPA 4ZSEA 3O7LD 3HDNA 4DT8A 1AGWA 4FA2A 3UMWA 4XEYA 4FKUA 4WNOA 3OOGA 3NPCA 3MIYA 4TZRA 2OXDA 5DFPA 3SKCA 3VUHA 5L2WA 5CVFA 1IEPA 2OFUA 5D11A 1Y8GA 3OZ6A 3IG7A 4RX7A 2ITQA 5CF6A 4GK3A 3SD0A 5JMSA 4ARKA 4CLJA 3KZ1A 3SW4A 2G9XA 2WTKC 2XNMA 5JFVA 3QBNA 3POOA 4C3FA 4KINA 1XWSA 2BRHA 2NNWB 4XS2A 1UU8A 4BDAA 5A14A 4IWQA 4BL1A 4JQ8A 1VEBA 4PPAA 5AA8A 4F7HA 4XBUA 3RK9A 3SA0A 3MA6A 1FGYA 3F2RA 1F0QA 4X2FA 1XH4A 2CNUA 3TACA 4GU9A 1CSNA 1PXMA 4AOJA 2HY0A 2F2UA 2VWWA 4QRCA 5AV3A 3QQUA 2O65A 2QLUA 4BY9E 1MRVA 3BE2A 3Q6WA 3QLGA 2BKKA 2YDJA 2XIXA 1YXUA 5M44A 3FBVA 4H36A 3ITZA 3PZDA 3ZXTA 4MVFA 4EOQA 3FJQE 2JAMA 3M2WA 3ALNA 4CNHA 3UNZA 2B1PA 3U7DA 3FQHA 4R3PA 5CX9A 3VBWA 4FTKA 1TQMA 4FZ6A 4CV8A 4LL0A 3HV3A 3NYNA 4M7IA 2XZSA 5C03A 5LXMA 4EH9A 2O5KA 2F7ZE 2PVNA 3CKWA 5AV2A 2F49A 3LFSA 3OVVA 1J1CA 3AXWA 3DK7A 3M1SA 3SX9A 1GNGA 1NXKA 4CT2A 3MIAA 3CPBA 2UUEA 5CSHA 4N6ZA 2GTNA 4AFEA 3F69A 1OL1A 3FZPA 3KF4A 3EQDA 3EYHA 5ETFA 3RZFA 2C68A 5FEDA 3VW8A 4BZOA 3R8ZA 5F20A 3QQFA 3AU5A 3V51A 3MVLA 3TV6A 4KRDA 4HOKA 4TWOA 4YLJA 5FBOA 3DGKA 5CU3A 2JKKA 3H10A 3IW7A 5ETCA 3CLYA 4MXAA 4OGRA 5EI6A 3DKCA 4A9YA 5FGKA 4UMTA 3ZH8A 5L8JA 2WTDA 2W06A 4KABA 5CAVA 1WGQA 2OH4A 4RC4A 2R3FA 2HY81 5G1XA 4D4VA 4PWNA 5GHVA 3PZEA 4FG9A 4LG4A 3WBLA 5I0BA 5M08A 3WOWA 2J0KA 2PVKA 2GSFA 3LMHA 4WKQA 5AUWA 4O84A 3PSDA 2VRWB 3W2OA 2H96A 4BDKA 4FNYA 4O6EA 1FPUA 4IACA 1IA9A 4XNEA 4BBMA 2HELA 1BLXA 1OUKA 1F5QA 2QOIA 4FTOA 1LEZA 2BILB 4I6HA 4JX7A 5DH3A 2REIA 3SXSA 4MXZA 3UP7A 3LQ3A 3MY5A 2XKEA 4DFXE 3VBYA 4MHAA 3ZDTA 3QRUA 3C1XA 2BALA 4QOXA 3KRLA 4C58A 1XH8A 4CV9A 1NTVA 2ZVAA 3QTIA 2PZIA 2QCSA 1DM2A 3NRMA 2GPHA 2VTSA 4RIOA 3U9NA 3OT8A 5L8LA 4C3RA 3VVHA 2B9IA 3ZRMA 5AAFA 3PG1A 4WO5A 4FTJA 2VWUA 3MH2A 1XH6A 2Z8CA 3R1QA 4HYSA 4QPAA 3AQVA 3QD3A 4AZVA 1R39A 4JAIA 1STCE 2FH9A 3C4CA 3O2MA 2QD9A 3PP0A 4GYGA 4BHNA 3RWQA 3BGQA 3FWQA 5IA3A 3PJ2A 2W5BA 2PMIA 3KSYA 4MBIA 2WKMA 3VW6A 2WMWA 4ACMA 4F09A 3EKNA 2ZB0A 3QCYA 3ULIA 4EH7A 3MYGA 2CJMA 4K1BA 2FYSA 1Q8TA 4RLKA 4GZUA 5D27A 3HMMA 1IR3A 2QONA 3GC8A 5LVNA 5CALA 4FEXA 1XO2B 3GU5A 4LOPA 3VS6A 4CFUA 4G16A 3A62A 5J1VA 1X05A 1OPJA 4O7WA 2X4ZA 2IJMA 4C2WA 1X86A 1ND4A 2F4JA 4FV3A 1R3CA 4DG2E 1J3HA 2ITWA 3DLSA 4TL0A 3QF9A 3QTWA 2CLXA 4BCQA 4PL3A 3CBLA 3UPZA 1OM1A 3RPVA 2J6MA 3V01A 4BCFA 4GJ2A 4USFA 2XM9A 1J1BA 1RJBA 4EOIA 5HU3A 4GMXB 5C8MA 2VO0A 5CZHA 5KBRA 1YI4A 4O7YA 3I1AA 1YWNA 3PIYA 2ITUA 3C0GA 5EI8A 1U46A 4L6QA 5ANOA 4AA4A 5KCVA 5KMOA 1UVRA 3GENA 2PVRA 3IGGA 3RCPA 5AM7A 4TYZA 1YWVA 3OY1A 4K6ZA 2WQEA 2W96B 3P86A 3UYSA 3P6AA 4DEAA 2J5FA 3HKOA 4LMUA 2Y9QA 5TF9A 4ZY4A 5HVYA 2XNBA 3LFEA 4I0SA 4OTHA 2W1ZA 4GN1A 4A4LA 4EBVA 1E1VA 3RAIA 3MB6A 4YPDA 4YPSA 4E5WA 3VBXA 4ZSJA 2QR8A 3E63A 3GU7A 3ZSHA 5D7AA 3DFAA 1V5UA 4F99A 3MH1A 4GVJA 3U9CA 3UIUA 2UVMA 3QAME 3TV7A 1ZYCA 2C0OA 3R73A 4X0MA 4FK6A 3CKXA 3DAJA 2QNJA 3T06A 2KTYA 3NUUA 4DTKA 4L3LA 5LMKC 5HBEA 4NU1A 2WTCA 1JKLA 3VS0A 3BIZA 2ITNA 5HKMA 3ODWA 1RW8A 4BVUA 4A6FA 2EB3A 5I3OA 2ZDTA 4GEOA 3R9HA 4BWKA 4FX3A 5AUUA 4HVSA 5JN2A 3RAKA 4NM5A 4ZLOA 2I5FA 3AJ4A 3NVMB 4X6RA 2YWVA 1XD4A 5IQAA 3C4XA 4H39A 3EQBA 4AZFA 3C50A 5B2KA 4HAUB 2QG7A 4X3FB 1ISNA 2BZKB 3RWPA 2XK8A 1CM8A 4F1OA 5CEPA 3QZHA 3PXRA 4U3ZA 3WA0A 4Z16A 3UBDA 4BTMA 5C5BB 2R3PA 3BPRA 3A8WA 2BRMA 5HG9A 3REPA 3D0EA 3AGLA 4DH8A 4QD6A 2P8VA 1XH7A 2RGNB 5IA4A 3D8DA 4DTAA 4DFZE 5M51A 3I79A 2WMUA 4FT9A 3Q60A 3FXZA 2Y4IB 4F0GA 2VGPA 3BINA 2UW8A 4NIFB 3EYGA 3HAVA 3HEGA 1M7QA 5KO1A 3ODOA 2PVFA 2QURA 4FTRA 2RSVA 3FPQA 2HZ0A 3QTQA 2CN5A 3QRTA 4IM0A 3GYPA 4WOVA 1WMKA 4U0IA 3ZLYA 3CE3A 3LM5A 2X4FA 4YZCA 1PXNA 3DKOA 3PY1A 5AR8A 4HGEA 3UJGA 4IFSA 2XNEA 4O6LA 3SG9A 3O0GA 1NVQA 4QP3A 3GC9A 1OUYA 1Q8YA 4EHVA 5C4KA 4I21A 4OTGA 4AZTA 1QC6A 4IW0A 4U79A 2BHHA 3P08A 1XKKA 2VTLA 2FA2A 1PXIA 5LQFA 2WEIA 4RFZA 5A4LA 2PMNX 3D94A 3HV4A 4OTRA 4QMYA 4QP1A 3IDPA 4CCUA 3D14A 5IMEA 4C0AA 2H7EA 3A60A 4NJDA 4DGOA 4GXBA 4AX8A 4O0XA 1WCCA 2CGVA 3R8PA 3VBTA 2GNLA 3WF8A 2WQNA 3ZZWA 5ETAA 5AR2A 4N70A 3WF9A 5I9YA 1ZYDA 5CQUA 2B0QA 2R3QA 4ID7A 4KA3A 3V6SA 5IA1A 4TWCA 3C5UA 2QKMA 4O7NA 5BVNA 5CEIA 5J7HA 2Q83A 2HTHB 5CNNA 2PUPA 3SGCA 2VO7A 1JLUE 4FNWA 3DZQA 4CEGA 5IISA 1WBTA 3OXTA 4JDHA 4FVRA 1ZAOA 2Z7LA 3TNIA 4FNZA 4ZS0A 3OCSA 3AT3A 3KK9A 4BRXA 2WIHA 3FLSA 2W17A 3FL4A 2LAVA 3VF9A 2HWOA 4PP7A 3UG1A 1W98A 4EH4A 3QXOA 4FKWA 3BU3A 3UP2A 4FL2A 3AMAA 2YFXA 4MWIA 3L9PA 4JBQA 1Y5OA 4I4FA 5EYKA 5FBNC 4FSRA 4GIHA 5JP4A 5E8TA 5T3QA 1LW3A 2D9WA 4LGGA 5CAPA 3BU6A 3FI2A 4HGLA 5AA9A 1JSVA 2W1FA 3R83A 3AC3A 3R7GA 1OL5A 1YWRA 1AQ1A 3P0MA 2I0EA 4HCTA 2BROA 4DCEA 4I24A 3TUCA 2CSNA 2BR1A 3PP1A 4U45A 4HPTE 4BI0A 2YDIA 3AT4A 3EOCA 4FK3A 5FLFA 2JIUA 1GOLA 4RFYA 2R3OA 2PK9A 1LUFA 2V0DA 2Z7RA 1XR1A 2YM5A 2OK1A 4RMZA 3DB8A 2G1TA 4FYNA 4GIIA 2WOUA 2VUWA 4M66A 2VD5A 1W7HA 4C2VA 5I5ZA 3QBVB 3DOGA 3QU0A 4A9RA 1ZLTA 5AP0A 2XMYA 3G0FA 3IW6A 3QZIA 2XQNM 3OANA 2P55A 3POZA 3MY1A 5L2IA 2GS2A 3UQFA 1KV1A 2OJJA 2UW7A 5EQYA 4W4VA 2W1CA 3KGAA 4IC8A 3NUPA 4IVDA 3VJOA 3ZEWA 3MPMA 4IM3A 3FLZA 4PY1A 3ZHPC 4WG3A 1SZMA 5IQFA 2EVAA 2LGCA 2AC5A 3GOKA 4EK3A 4GT4A 2WTJA 5AADA 4QPSA 5JGBA 4LGDA 4PPBA 3KREA 3LLTA 4AZWA 2JDVA 5L2QA 4ZLZA 4FG7A 3LIJA 3RK7A 4ALWA 5IH6A 4NM7A 4YBJA 1GC6A 1XH9A 3H3CA 3JY0A 1ZM0A 1JBPE 3GYOA 1JNKA 3WF6A 4CYJA 5HLWA 5GINE 3EWHA 2B9JA 3QYZA 3DBQA 3G9NA 3QRIA 2RKUA 2BIYA 1W8CA 4BDDA 4R77A 3G2FA 4F7SA 4D58A 3EQIA 2XK3A 3UIMA 3I81A 3KRWA 3Q9XA 4TYIA 5E8YA 1PXPA 3R8MA 2LOXA 4F7UP 3TZMA 5A4TA 3EQGA 3RAWA 4EQMA 5CI7A 2EMSA 5A9UA 4FL1A 3C0HA 3E8CA 1JAMA 4RGJA 4BF2A 2SRCA 3JXWA 4D5KA 2RSGA 2W2WA 4DA5A 4QMZA 3O8UA 3CY3A 1RJ2A 3KA0A 4KSQA 4W8EA 2X6DA 4ZTRA 5JEBA 4KHAA 1QPCA 3UODA 4HATB 3QWJA 2Z0PA 3N4TA 4FT3A 3ACJA 3FMLA 3ROCA 5GZAA 3FLYA 5AP5A 4NYEA 1BTKA 4F1MA 3F5XA 1JVPP 3G9WA 2PZ5A 1OB3A 2EWAA 3ETAA 3TT0A 3FI3A 5D9HA 4F64A 1NTYA 2Y8FA 3SRVA 2OW3A 4YNOA 2KGXB 3L8VA 1P4OA 4AUAA 1WVYA 5TE0A 5CSWA 3DJ5A 4GUEA 4JR3A 4FTCA 5EDPA 4CTBA 2QO7A 3LFNA 1EH4A 3UVPA 3FZSA 5K9IA 4N57A 4O7ZA 3NW5A 4IJ9A 3JPVA 1WI1A 2CNQA 3R6XA 1UNRA 4Y94A 2GFCA 2YLFA 4CG8A 2YIRA 5HGIA 1XH5A 4DT9A 4I20A 2C6TA 3ANQA 4RA5A 5EK7A 3VQUA 4ANSA 2WTWA 3LM0A 3PYYA 2X6EA 3MTFA 3O51A 5L2SA 2YS1A 3LXPA 3B2WA 2YIWA 1H1QA 3MN3A 2BDWA 3NLBA 4KNBA 5I3RA 3UO4A 2CN8A 3PVBA 4CGAA 4UXQA 3TV4A 3TZ9A 4B9DA 5KMKA 3F5RA 3KRXA 4FTUA 3LLAA 3CR0A 4FSUA 3RI1A 2A0CX 5DHAB 4FV1A 4M84A 3A8PA 5EOBA 3PA4A 2C3JA 4IWPA 2YM6A 1U59A 4NCTA 4MBJA 4AA5A 3A4OX 3WI6A 2R4BA 3FLNC 3CTJA 3HL7A 4RG0A 2B53A 2V7AA 2OJFE 3DXNA 3BEAA 4YJVA 3DBDA 2YCRA 2J4ZA 3I0OA 3OBGA 4YC6A 1FINA 4R1VA 4DH5A 3FQEA 1APME 2OIQA 3P7CA 3JVSA 4X6QC 2C6EA 5EYCA 3IOPA 4IAFA 4EK4A 3WZDA 1FOEA 3AMYA 3DJ6A 1FVRA 4YZNA 1OL7A 4P90A 4ZZOA 3CQEA 5DR6A 3A98B 4BBKA 1EGXA 5H3QA 1KE7A 5A4CA 2ZB1A 2KUPA 3RALA 1PRYA 3V04A 1V1KA 5IDPA 3Q52A 2D10A 4M8TA 5IKWA 4BDFA 1B6CB 4GT5A 3VS2A 3EFWA 4ITJA 4IEBA 3E92A 3S3IA 1WG7A 4K17A 1E9HA 4ZTSA 4JG8A 4I5PA 3PVWA 5GZ9A 4CFMA 4BGGA 1V61A 4FIJA 3AOXA 4FSYA 3NUSA 5ANJA 4UX9A 2BRNA 2YIQA 2GFSA 5E91A 2M38A 2O3PA 1UNLA 1U2BA 3RCDA 4DGNA 3MFTA 3PVGA 1XBCA 2CKQA 1OMWA 3PRFA 2CLQA 2PSQA 3ZRKA 2GNGA 4U43A 2JP2A 4D4SA 1TQZA 2PZRA 4L01A 4MEDA 5LVOA 3BWFA 3HRCA 1K9AA 2YITA 4Z2NA 4KUJA 2AL6A 3KFAA 3SRVB 3UVRA 4ACCA 2DA0A 3DV3A 4GS6A 5CEKA 4M3QA 5K5NA 5FXRA 3DBFA 2HXLA 2FSOX 4ZEGA 3VUMA 4YR8A 5DI9B 2ETMA 5K0KA 2WMVA 2DX5A 3QUPA 3R1SA 3MFSA 3CEKA 3A7FA 3TFMA 1OKWA 4R1YA 2CPKE 3G6GA 1QL6A 4RRVA 5C8NA 3N7CA 5K4IA 5J3TA 2ADZA 1Q61A 5EOLA 1ZRZA 2BDFA 2WMTA 3KXZA 2P4IA 3ALOA 4M68A 4FG8A 1PF8A 3LQ8A 3Q4UA 4NM3A 2BRGA 3FQSA 5AUZA 2Z0OA 4FZFB 2ZAZA 2YM8A 3FMMA 3CY2A 2BTRA 2YN8A 3BYVA 3EFJA 3LCDA 3W2QA 2Z7QA 4M97A 4CRSA 3A61A 4EEVA 4FMQA 2IW9A 2W05A 2WU6A 4I3ZA 4D0NB 3F3ZA 4JDIA 4RJ3A 1GIJA 1Y6AA 5DMZA 1MIXA 3FYJX 3NNUA 1ZSQA 3S95A 4ITHA 4C8BA 4USDA 2XJ0A 3OBJA 5FEEA 4YHTA 5ANGA 3O71A 3SXFA 4DBNA 4PQNA 5CY3A 2Y7BA 1RDQE 2WD1A 5J9ZA 3BGZA 1URCA 1SMHA 2C6MA 1YQJA 5EHOA 2WZJA 4XG6A 4BBEA 3ZUTA 1V5PA 2OI4X 2UVZA 4I22A 3OXZA 3BJIA 2JIIA 2BAQA 4QMQA 4FKQA 3ORMA 4HZRA 4NT4A 3ZO2A 3N4VA 1PKDA 3VAPA 1UNHA 4Q2AA 3NCGA 1JKKA 4EUUA 3CJGA 3Q96A 4B6LA 4CMUA 1LR4A 3HX4A 5JGAA 3FEGA 4IMYA 5I4NA 3S00A 3E87A 4RX8A 1H07A 4BYJA 2VTTA 4YU2A 4GKHA 4K2OA 2UVYA 4LRJA 3A7GA 3LFQA 2RFNA 5HQ0A 4C37A 3U6IA 1BL7A 4FTIA 4IAYA 4K0YA 5FP6A 4AN3A 2PE0A 3CQUA 5HO7A 3U8ZA 4IZ7A 3QX4A 3GC0A 3R1YA 4XV9A 4KIKB 4M14A 4YZ9A 4DX90 1HCKA 3AD5A 1Q8ZA 4NW6A 1WBOA 5GIPE 4FC0A 3P7AA 3TEIA 2J9MA 4BKYA 3GCUA 1X8BA 2G2IA 4X3FC 3ACKA 3SAYA 2VSZA 1EAZA 4HGSA 2D2QA 2YM4A 3G51A 4K8AA 1WFCA 1F3MC 2YIYA 1PXKA 4HB2B 2B52A 3ZC5A 2CAYA 4GU6A 3TO1A 2LG1A 2MKRA 2VWYA 4KIPA 3TI1A 4J96A 2OO8X 3PY0A 5LCJA 3LFDA 4YO4A 4IAKA 2I40A 3IONA 2YIXA 4HAXB 4CMTA 3KEXA 2XNOA 1KOAA 3BWJA 5FG8A 2XJ1A 3I6WA 4J8MA 1GZKA 2G15A 2Y4IC 1I09A 4ZS4A 3IQ7A 2IWIA 1JOWB 4RIXB 5CXHA 4IE9A 5BYYA 3C4ZA 4UMRA 5IQEA 4QNYA 4R3RA 5GNKA 4WG4A 3E3BX 2ETKA 4A6HA 1OIUA 5LOPB 4EH6A 5BVKA 4F6WA 1SVGA 5LARA 3DA6A 2J0MA 2IG7A 2QG5A 5CT0A 4YTFA 1J7LA 3PIZA 1UPQA 3KMWA 4Y72A 3TUBA 1Q67A 4PDSA 5AMNA 1MIZB 3U6HA 4G6LA 1WBNA 4HGTA 5CLPA 2XB7A 2LULA 5IPJA 1GIIA 4EZ3A 3PPJA 2XKCA 3MGYA 4AF3A 4RT7A 3VULA 2VTNA 2CGWA 1SNUA 3ORKA 4PMSA 5HBHA 3RNYA 4ACHA 4Z2MB 3VHKA 4J97A 2C5XA 2D9XA 4JI9A 2WQOA 1H4LA 2XVDA 3I7BA 2JKQA 5TR6A 1PXOA 3ML4A 4EOMA 4G3DA 3P79A 5IA2A 2KULA 3QTXA 2CODA 4XP3A 3L9NA 4U81A 2UZOA 2UZNA 4PTEA 4RJ6A 4ZIMA 4DITA 1H1SA 2J0IA 2O64A 3FLQA 4A06A 4EWQA 3HLLA 5HE2A 2GCJA 4MY6A 1ZOHA 3MTLA 2BCJA 3ORNA 5J1WA 2ROZB 3R71A 1ATPE 3ODYX 1GIHA 2OLCA 4V04A 2HW6A 4E8AA 4EK6A 3NUAA 2A4LA 2R64A 4FV4A 2Y8OA 1UU3A 2Q13A 3NDMA 4DINA 4WUAA 4LOOA 3HP2A 1OECA 4G3FA 4DGLC 4BC6A 1RQQA 1YDTE 2VGOA 4YJNA 3A7IA 2CGUA 2P2IA 2A19B 5DEWA 3DY7A 4CD0A 4EUTA 2D4QA 4HAZB 4O81A 2UZVA 5BVEA 2B9FA 3W2SA 2GS0A 2HWPA 1WAKA 3C4FA 4JOAA 4ZY6A 3WIGA 3LPBA 4N6YA 1V5MA 5HD4A 3GEQA 4RFMA 3K3IA 2QC6A 5HG5A 3BE9A 4Z9LA 3RPRA 1YI3A 3MV5A 2YJRA 3WIKA 4HB3B 3RMFA 2P0FA 2JFMA 4U9AA 4XP2A 2VTAA 3UIBA 3QKKA 1CKPA 2PHKA 3PJ3A 4J53A 4XMOA 5IMXA 3PXYA 2UW0A 3QD4A 4KWPA 4UMUA 4KKEA 5AV1A 4YL8A 2YWPA 4FGRA 4TY1A 4QQJA 4QTCA 1KZGA 5EG3A 3FY2A 3L9MA 5IH5A 1ZY5A 3KMUA 2DYNA 2VWBA 3QFVA 3F3UA 2EXEA 4MD7E 3RHKA 4B4LA 4CZUA 5BPYA 1H4RA 4G2FA 4GCJA 4II5A 4RX9A 2JDTA 4XUFA 1V0BA 4GW8A 2JD5A 4JDKA 4BBFA 5IZFA 3QIJA 3BEGA 3FM8C 4TNDA 4PDOA 2C6IA 3C4EA 3K2LA 5DR2A 4C4HA 2YT0A 3HYHA 3PTGA 1E5WA 4AN2A 2WNTA 4BCKA 3MPTA 2W2XC 1QMZA 3DBEA 2UW6A 2IZRA 4XOZA 3QA8A 3U4UA 4FI1A 5KQ1A 2E9NA 2XIKA 2B7AA 1CTPE 2OF2A 4LUDA 3HMIA 2CKOA 3JS2A 5F94A 5FTGA 2OZAA 1Q8UA 5AP6A 3VWAA 2F2CB 3P5KA 4ANBA 2OICA 3OWPA 3RM7A 5JFSA 4XWXA 4YJPA 3MH0A 5HU9A 1FMKA 2VZ6A 4KS7A 3W55A 3PJ8A 1S9JA 2OSCA 4FODA 3DBCA 3W16A 3GXLA 4FKLA 4F0FA 1WVHA 4MXYA 2PU8A 4D1SA 4OTQA 3FC2A 4LV5A 2I0VA 4BCJA 5DOSA 2GCLA 1BKXA 2CCIA 4S31A 2Y7JA 3IS5A 4I5MA 4B7TA 1ZXEA 2OIDA 2XKDA 4WRGA
chains in the Genus database with same CATH superfamily
2VNWA 2HZ4A 4G3EA 4BHZA 2UZEA 3ORLA 5DN3A 4L3JA 3F88A 2R7IA 3GCPA 4L7SA 4KKHA 5KKRC 1IA8A 2XM8A 4ZP5A 3CC6A 1B39A 3ORTA 3QC4A 4D2TA 5CASA 3E3PA 1VYWA 3ROYA 3TN8A 3E8NA 5GJDA 1ZYSA 2ONLC 4GFMA 1SVEA 4W4XA 5JZNA 4A07A 5AFVA 4QYGA 3V8SA 3IK3A 3DCVA 4W9WA 3NYXA 1ZWSA 3MVJA 4NFNA 5DI1A 3IGOA 5BNJA 2UW9A 4FKOA 2OJGA 4NTTA 3ZM9A 5AR5A 3HGKA 1JWHA 3FXXA 3T8OA 4D2WA 2YISA 2IF8A 5KHXA 3RPOA 4DH3A 5EM5A 3SDJA 2R9SA 2YZLA 1BYGA 3CS9A 3EZVA 4ANLA 4FICA 4KHOA 5E9EA 4IAPA 3TJCA 4R6VA 4CHJA 3TDVA 3QQKA 2RLOA 1G3NA 2JEDA 4F78A 1PKGA 2XCHA 5BYZA 2ELAA 4A5KA 3O96A 4IAAA 2HZIA 1ZC3B 3LFAA 3KC3A 1U54A 4BI1A 4UZHA 4P2KA 5AX9A 4YTIA 5D12A 3W0RA 4EQCA 1DAYA 2CKEA 2JC6A 3Q6UA 5IQDA 1KI1B 4GH2A 4NJ3A 3BGPA 3OWKA 3BLQA 5KNJA 2YM3A 4PL4A 4QJ5B 4S32A 2IW6A 4QQ5A 5HLNA 3A8QA 4S33A 5M07A 4UXLA 1CKIA 3TTIA 4F65A 5JKGA 4FKJA 1PMVA 2BFYA 4B8LA 3LE6A 3AC2A 1OKYA 1BUHA 3NWAA 4IDTA 4MF0A 3UQGA 3KL8A 2R3IA 2PZYA 2R0IA 1FB8A 2NP8A 2GNJA 4QO9A 2X7FA 4IJPA 2E9UA 4Y46A 4JVGA 4YUQA 2BIKB 1PLSA 5IRSA 4XHKB 3TXOA 5BX0A 5LONB 3IOKA 4OT5A 5D3VA 5FUTA 4QP7A 5T6KA 2EU9A 2PVYA 2QODA 4G5JA 3TKIA 1YHVA 2RGPA 3PWDA 4EOJA 4M0YA 3S2PA 4I0RA 5D3XA 3HNGA 1U5RA 4DFYA 4OSNA 2J51A 5DHFB 4XLVA 4BIDA 5D3YA 3QKLA 4K33A 5ETIA 2DTCA 2LOZA 2QOBA 3LXLA 3HW2B 3Q04A 4CXAA 1JPAA 3CTQA 3KKVA 3RZBA 3QKMA 3M1IB 2C4GA 2VX3A 3VOQA 2F9GA 4R8QA 4QYEA 4WNMA 4X3JA 2LKOA 3W0OA 3R9OA 2HOGA 1G5SA 3UIXA 4PMMA 1Q3DA 3H9OA 3JYAA 4TT7A 5F95A 4BTJA 4C0TA 3V3VA 4ZY5A 1FMOE 2QU6A 1TVOA 2C47A 4BZNA 4H1MA 3F0WA 5DIAA 4YP8A 3GVUA 3ID6C 4I1ZA 5HI2A 4A9TA 4D0WA 2IPXA 1Q24A 2F57A 4G6NA 4OUCA 4OT6A 4IX4A 3F61A 5CU0A 4K77A 1JSUA 4LMNA 5ANKA 4BKZA 1MK9B 4QEBA 2R5TA 2G2FA 3DB6A 4MT7A 3U4WA 3AKKA 5B2MA 3FSFA 1W0XC 4FSQA 1Y91A 3HQCA 3OEZA 4PDYA 4TYEA 4TYHA 4RWKA 5BMSA 4IX5A 4J8NA 5C1QB 1X11A 1YXTA 2YS3A 2W4JA 2OIBA 2CCHA 4BCHA 1H01A 4FIFA 2DS1A 2J2IB 2NRUA 1YHWA 5M56A 2D9VA 4Y5QA 5ACKA 1YHSA 2VTJA 2WHBA 3IDCA 3KN6A 5HNBA 3DDQA 4JG6A 3GBZA 1V0PA 1U54B 4FZAB 4QTAA 4WG5A 3ZLXA 2YT1A 2CNVA 4FV5A 3OS3A 5LWMA 3L9LA 2YA9A 3K5UA 4XCUA 4BFMA 1OL2A 4XG2A 5JFWA 3SYXA 3PSBA 5AX3A 3FE3A 4YJSA 1ZC4B 3VC4A 1UU7A 2R3LA 2YDKA 4E6AA 4NM0A 4APCA 4EH3A 2PYWA 4CVAA 4IDVA 5H8BA 3PXKA 4O0WA 3PFQA 4O0UA 5DVRA 2VTMA 5C9CA 3D5UA 4GG7A 2EB2A 5TO8A 3RGFA 3CQWA 3VUGA 1OBDA 4FOBA 4EKUA 3NUNA 4XG3A 3UG2A 3MJ1A 3LFBA 4X2JA 4IQ6A 4FSNA 5HICA 5IUGA 4GFOA 4I92A 3COHA 1WJ1A 3LMGA 4G6OA 4CZYB 2W9ZB 4X21A 1XBBA 1PJKA 2OG8A 4NW5A 3ANRA 4RWLA 3W1FA 4BDJA 4EK8A 5J9YA 2DX1A 2VN9A 4HNFA 5DE2A 3W33A 3ZSGA 3W2RA 2QO2A 4U41A 5LMBA 5EFQA 1CMKE 1SHCA 4LV8A 3Q2JA 4OR5A 4CQGA 3BKBA 2RNRB 2P2HA 2RFDA 2VTIA 2XNGA 5A46A 3F82A 2PE1A 5CSXA 3DKFA 2NZ8B 2X7OA 3ZONA 3OMVA 2FGIA 3RJCA 2ITZA 2L1CA 4DN5A 3GFEA 2AEGA 3V5WA 2X7GA 5DT3A 2C1AA 3PG7A 2YHVA 2F7EE 2R3HA 4AW2A 3EIDA 4F6SA 3DAKA 3R30A 4KAXB 3OCTA 4C4EA 3BBTB 5HIEA 2J5EA 4UMQA 5K5XA 5AV4A 4IAIA 4P5QA 2X0QA 2ZV7A 5G6VA 1QQGA 5HE1A 4BDHA 1P5EA 1PYXA 4GG5A 5HLPA 4GSBA 3BLAA 3DDPA 3VS5A 3EN4A 4TYHB 1ZARA 3E8EA 4JIKA 2Z60A 3TIZA 5HZNA 3U54A 5HOAA 2EJ8A 2XBAA 1KWPA 3G5DA 2L2IA 4BDIA 2VTQA 3ZO4A 5AUTA 5D1JA 4EOSA 3ATTA 2VNYA 3GP0A 3NCZA 4U5JA 4C38A 5M09A 5EM8A 4G17A 4J98A 1J7IA 4PL5A 1KV2A 5JRSA 2V62A 4PUZA 1YI6A 3H30A 4R5SA 3BV2A 4A6FB 1UWJA 3QRKA 3AMBA 5CYIA 1GC7A 5M57A 3OHTA 4DH7A 1M2RA 1H0WA 3VBVA 2DFKA 3R28A 3MESA 3EZRA 5ITAA 4DFLA 4HSIA 4HVHA 3U6JA 4MXOA 3QWMA 1WBSA 3CJFA 2XEYA 4AGDA 2XP2A 4RVTA 4J99A 5M4YB 3EQRA 3O5AA 1WVWA 4ZJIA 1X1FA 4P7EA 3WYXA 3BCEA 4WUNA 4QMPA 4G34A 2YEXA 2IW8A 3VS4A 4O0TA 1QPJA 2X39A 4I5HA 4LV7A 4TWNA 1Z5MA 4LOQA 4EZ5A 4YZBA 4AW1A 4FKVA 2J59M 2K2JA 3ZZEA 3HAMA 2B54A 4WBBB 2X2KA 2W1HA 3A2CA 5DEYA 5CVGA 3OFMA 1I2HA 4U7ZA 4YJQA 5M4CA 2IO6A 4HPUE 1AWEA 3WYYA 5TT7A 4ERWA 4H1JA 4W9XA 5K4JA 3CD3A 2UW3A 3MBLA 3H4JA 3MWUA 3Q4ZA 2V22A 4BCIA 5JQ5A 2Z02A 5KE0A 3BYMA 2COAA 5CXZA 4L44A 2XJ2A 1P4FA 4C3PA 5CF8A 4WBOA 2GNIA 2RG5A 5CF4A 5I9WA 4P7IA 1JSTA 2H6DA 4UV0A 3F6XA 3KCFA 3KY9A 3P7BA 5AWMA 3QCXA 4FT5A 3ZOSA 3CTHA 2J90A 4CRLA 4EBWA 5M4FA 2A2AA 1KOBA 2UZTA 3NAXA 5CF5A 4F70A 4Y73A 5LMAA 2LYDA 3CPCA 3E93A 3EQHA 4FVPA 3P78A 4BDEA 4GT3A 3H0YA 3AD6A 1U5FA 3O17A 4RQVA 4FV6A 2VX1A 2X81A 3DXCA 4FUXA 5HX6A 2HK5A 4KRCA 1V0OA 4Y5HA 5KMJA 3FHIA 3R7EA 2N0YA 3QALE 3CP9A 5HD7A 4K2PA 5DBXA 4KIOA 3IW5A 2VO3A 4Y83A 5EDRA 2GTMA 4A7CA 2WOTA 3Q4TA 2W0JA 3MW1A 4XOYA 3UYTA 3II5A 3QHRA 1NU2A 2ETRA 3ERKA 4B99A 3D5XA 5ICPA 3FMNA 1GJOA 3QX2A 4N4SA 3K5VA 2JBOA 2R3GA 4EJNA 2QKWB 4ASEA 3LJUX 2PE2A 1UNQA 4RZWA 2WXVA 2WQMA 3OWLA 3GCVA 4QMVA 3F5PA 4F9CA 3CD8A 3TL8A 1Q5KA 5JRQA 1O9UA 4PQ0A 5HNIX 2DN6A 1T45A 4D6WA 2IN6A 3CSVA 4X7QA 1HOWA 1R0PA 3QD0A 2W1IA 4AOTA 3R1NA 1M7EA 2NBVA 3NMUF 1ZZLA 3FMDA 4PP9A 3ENHA 3T9TA 3LCKA 4BKJA 5CTPA 4YURA 3GOPA 3L8XA 3Q5IA 1RE8A 4Z7HA 3SW7A 4HYHA 4BGQA 2C3KA 2XRUA 5DT0A 5KMNA 5CWZA 4AWIA 5H9BA 4O96A 4MCVA 3F2NA 4ZSGA 4DLJA 3DXPA 3BU5A 1RRPB 2JDOA 4V01A 5HEZA 2GHLA 2HZNA 4MQ1A 3IKAA 2XNNA 2Z7SA 4J7BA 2FSLX 5EW3A 3DU8A 1LEWA 3RTPA 4XG7A 4BCNA 1X1GA 3D9VA 1YDRE 2JLDA 3D83A 4D4YA 5DRDA 3OW4A 4L9IA 3ZXZA 4LQMA 3P23A 1R0EA 4OBPA 2DKQA 3ZUUA 3F3VA 3DXDA 3FY0A 3UOHA 4I6LA 1TQPA 4IB3A 4EORA 2W4KA 3HMOA 4R7IA 4FE2A 4U80A 4O21A 1EF1A 5FI1A 3Q9ZA 5IQCA 1IAHA 3B77A 3D4QA 3GCQA 3ULBA 1W83A 2PY3A 4LUEA 1DDVA 3NVKI 1H08A 2Y6OA 1M7NA 3EB0A 4XBRA 3TM0A 3LOKA 3WF5A 4JMQA 3NUYA 3KXGA 4ZRJA 4X2NA 5LMKA 1E1XA 4U42A 4YZDA 4D2RA 4LM5A 3KMMA 5HIBA 1ZZ2A 3S1HA 2P0HA 4E6DA 4P5ZA 4E7WA 4E3CA 4MNEA 2P3GX 2JBPA 2QKRA 4H3BA 1PYEA 2PUNA 4S34A 3ZVRA 3ELJA 4OAVB 3SNHA 2XK9A 1H27A 4AOIA 3QYWA 3DJ7A 4IX6A 4IIRA 2AYPA 4MX9A 5CU6A 3LHJA 4B6HA 2VO6A 2NYAA 5C4LA 2W5AA 2ERKA 2FVDA 4B8MA 5A4QA 4IFGA 4JAJA 5BMMA 3SOCA 5HVJA 4AU8A 3F9NA 5C27A 2PL0A 2OZOA 4E26A 1BWNA 1H25A 4ENXA 4AGWA 3IECA 4NKSA 2GS6A 2GDOA 2G01A 5E1EA 3HMNA 2CGXA 4IBMA 2XYNA 4BDCA 3GU8A 1DROA 1Q62A 3MDYA 3IW4A 1TKIA 2BUJA 3VF8A 4EYJA 5EKOA 4CYIA 1WBPA 3HZTA 4FV0A 4LYNA 4JRNA 4YLKA 5FDXA 3UPXA 3PFYA 4NH1A 4F7GA 3U87A 4BR3A 3HA8A 4AS0A 4FUYA 4MNFA 4G3CA 1A48A 4KBKA 1FVVA 3AT2A 5HCYA 3B8QA 4M69A 2GHGA 4NUSA 2GNHA 3O23A 2DHKA 1B55A 2XKFA 4O7SA 2Y4PA 3EN5A 3HA6A 3C7QA 4C61A 3T3UA 3GQLA 4RWIA 4RIYA 2VWZA 3DNDA 3BHVA 1ZYJA 2H7DA 1YRPA 2OXXA 3O8PA 4HVIA 1QCFA 4X2GA 1GAGA 4DCAA 3FMHA 1WVXA 2B4SB 2C6LA 2VTPA 3H9RA 3F7ZA 2EXMA 3I60A 3FDNA 3R00A 4MQ2A 5IUIA 4AE6A 2VTHA 1OPKA 1GZOA 5FQDC 5A6OA 1T77A 3TKHA 2H34A 4RC3A 4D9UA 4QDVA 1MRUA 3FAAA 4HAYB 3C13A 4RJ4A 2ERZE 5JHHA 2YABA 2EXCX 3JVRA 3LCSA 4CFXA 1M14A 3ZFYA 4L3PA 3ZS5A 3RINA 3QRJA 2JDRA 3VIDA 4TKSA 5IQBA 3TTJA 4ASXA 2PPQA 5DYJA 1R78A 4MYGA 4O83A 4UBAA 2AEHA 4I4EA 4K11A 3HV6A 3BELA 1J91A 3MY0A 4IZAA 1ZYIA 1IAJA 5LOHA 4M67A 4EQUA 3LFFA 3R2YA 4MNEB 5A6NA 3LJ2A 1OIRA 3BYOA 2YACA 1OPLA 2YVCA 5CLQB 4O7RA 5AIRA 3QUEA 4FKSA 3COIA 3R01A 4IWOA 3ZMMA 3ZO1A 3GUBA 2H8HA 4F6UA 3SLSA 1SVHA 3EQCA 1H28A 3OXIA 4ZJJA 2F7XE 1M2PA 2WMAA 3WF7A 2XNPA 4CZTA 4QP4A 1TJ6A 1Y57A 1K5GB 4FV2A 4MD9E 5EM7A 4E6CA 3AC8A 3FEHA 5DH9B 3FC1X 4AQCA 3I5ZA 1DAWA 3R02A 4GPTB 4UALA 4AT3A 3M42A 3NUXA 4YLLA 5BVFA 3QQJA 4KAOA 2ESMA 3ZYAA 4WHZA 4FKIA 4FEVA 2PZ1A 4HZSA 2RF9A 3G6HA 3Q32A 2DUVA 2RFSA 3F66A 4Y8DA 5ANEA 2RL5A 2RUKB 3D8EA 3TMOA 5E92A 4JLCA 4EC8A 1WZYA 4RQKA 1UU9A 4YSJA 3FZTA 4XRJA 2UVXA 3TNHA 2E9OA 4HAWB 4IWDA 3V8WA 5M06A 3BRBA 3RK5A 3NIZA 4FV7A 1Q41A 2WTIA 2PTKA 3ET7A 4RJ5A 3TWJA 4EOKA 1MKEA 3PVLA 1OKZA 4C57A 2IVTA 3NYVA 4QTEA 3KY2A 4Z7GA 3IVFA 4F0IA 1OBGA 1H24A 3QCSA 5C8KA 4JDJA 3C5IA 3C9WA 2NPQA 4K9YA 5AP4A 4L6EA 3G33A 4I5CA 3FI8A 3BLHA 1BX6A 4HYUA 3B2TA 2JFLA 4R7HA 4JNWA 4F7NA 1G8AA 2ZV9A 4OTDA 1SGHA 1U29A 3HSAA 4IHPA 3HMPA 4IM2A 2XF0A 4HW7A 2R3RA 3BX5A 2W9FB 2Z0QA 3SO6A 3RVGA 1YW2A 2IVSA 5FRIA 4A9SA 5FTQA 5CT7A 3WE4A 2C5YA 4GL9A 5CU2A 5JZJA 4JQ7A 5A3XA 5DIFB 4PTCA 4F9YA 2CMWA 2DKPA 4FSTA 4EHEA 4JIAA 5EH0A 4F63A 1DYNA 4EOPA 3E8DA 2R7BA 2WMXA 4L1RA 5FWKK 2C5VA 2E2XA 2K00A 2IFSA 3PDTA 3ORXA 5E8UA 3LJ0A 1NI2A 2PULA 2WGJA 3UE4A 3V8TA 1MPHA 4E6QA 3DNEA 3DK3A 3G9LX 3ZSIA 4XJ0A 4PRJA 3UNJA 4ZZNA 3JR1A 4TKNA 4DG0E 1FQ1B 1PXJA 4FGBA 5FDPA 1ZOGA 4ANQA 4IH8A 3LCOA 3KVWA 5BVDA 4AN9A 4ZOGA 3FKLA 4FTNA 1KUTA 4EL9A 1WJMA 3EFKA 3EN7A 1VR2A 1TFFA 3PSCA 1LB1A 1P2AA 2XK7A 3KRJA 1FHXA 3ATSA 2CY4A 2J50A 4ALVA 5AIKA 4QYHA 2GS7A 5AJQA 2JIVA 2VU3A 2X8IA 3F3WA 3KXHA 3R0TA 5CS6A 5EM6A 4E4XA 2QHMA 3FLWA 5GOWB 3TG1A 4DEEA 2HENA 3VBQA 5F4NA 3OF0A 3I7CA 2YS5A 5I2SA 1UV5A 5ACBC 4NEUA 3R8UA 3UO5A 5CVHA 4IFCA 4FOCA 4RWJA 3EQPA 3ZEPA 4ASDA 3H9FA 4L53A 4L8MA 3EL7A 3LXKA 4YBKA 1EVHA 3SG8A 1K3AA 3FSSA 5HE3A 4HNIA 5BVOA 3TNWA 1O6KA 4WA9A 4I6BA 2C6KA 3GU4A 4JL9A 4S2ZA 3LW0A 1IRSA 3E64A 4DFNA 1UNGA 2AC3A 2UW5A 3E7VA 3AC5A 3KB7A 1S9IA 5K0XA 3NW6A 3VUTA 4YJOA 2X8EA 3UNKA 4BJJA 4DGGA 3HK0A 3HRFA 3PXZA 1NW1A 4S30A 1ZY4A 4K2RA 2XK6A 4C4GA 4BCOA 5JGDA 1P6SA 3KXXA 3ODZX 4ZTQA 3VJNA 2YF0A 3R9RA 2QOCA 4PMTA 3SVVA 2FSMX 2ZMCA 3BLRA 4C02A 1PFJA 2YT2A 4QJ3B 2WMSA 5IG1A 4GK4A 4QQTA 1N3HA 4U8ZA 5FXQA 4BIEA 4EOLA 5IF1A 3RNIA 3EN9A 5KMMA 2YRYA 3AGMA 1U5DA 4HHVA 3UDZA 4BDBA 4EH8A 4WSYA 2GNFA 3R8LA 4GJ3A 4EC9A 5KMIA 2BKZA 5KBQA 2J0MB 4K81A 3V5QA 2C0TA 4HDOA 2EUFB 2ITYA 1ZMVA 3LAUA 1L8TA 5A4EA 3QWKA 2RG6A 4I23A 3F2AA 5TKDA 5KHWA 2ELBA 2GQRA 5I9VA 1MUOA 2D11A 2X9EA 2YM7A 3FMEA 4OTFA 5DPVA 2EMTA 5LCKA 2ROVA 3D8FA 4HVGA 2C3LA 4Y95A 2BZHB 4JXFA 1YDSE 4WNPA 4HB4B 3ZDUA 3RPYA 5AEPA 2E2BA 2ZMDA 4FSZA 3L1SA 4L68A 4KBCA 4O2ZA 3RP9A 3UZPA 2BPMA 4DGMA 3Q2MA 4UMPA 4YC3A 5L81A 1DDMA 3TUDA 4AXDA 2WB8A 2B9HA 4FVQA 5AR4A 3BBWA 2V76A 4U97A 3A99A 4XV1A 5HO6A 2KCJA 4ZTMA 3W0SA 4R7BA 5IEYA 1XODA 2OU7A 4YJUA 5EHLA 4L67A 2OQBA 3LJ1A 1Z57A 2W1EA 3BQCA 3PG3A 4O4FA 1M2QA 1BI8A 4GK2A 3PPZA 4ZZMA 4ANNA 4EYMA 2I1KA 2P0DA 5AP3A 4ANOA 5KUPA 1R1WA 3OHMB 5AV0A 5DLSA 3VRZA 2UZLA 3D2IA 4O7TA 5CI6A 3TNPC 5H2UA 1PXLA 2NRYA 3IO7A 4H3QA 3L8PA 2YCQA 3HECA 3NNXA 4FTTA 2IVUA 2QOHA 3IW8A 1WBWA 4U40A 5I9UA 4KHBA 5KQ4A 4EWHA 2R3MA 4IB1A 3A7HA 2NMBA 2UW4A 4MTAA 5L3AA 4DXAB 4ZTHA 3UGCA 2C3IB 2ZFYA 5C26A 2PVMA 3FYKX 3QD2B 3VN9A 3ZTXA 4E4MA 1W82A 4BZDA 4C4JA 1TQIA 4JG7A 5EI2A 2WO6A 4XG8A 4YTCA 1M7RA 1UPRA 1MQ4A 3EFLA 4HAVB 5AP7A 1I7AA 4IZ5A 4LRMA 4UYNA 3QUDA 3BHHA 4NSWA 3FSKA 5IQIA 4ALUA 2Y0AA 4RVLA 4FV9A 2XYUA 4BGHA 3OG7A 2C1BA 3TZ8A 4O38A 4ENYA 2ITVA 4ZRKA 4NSTA 4E4NA 4FL3A 5BYLA 2WIPA 4KKGA 3Q53A 4MXXA 2WELA 4IVBA 4DLIA 4EKLA 5J79A 2R3NA 3LFCA 4R78A 3AU4A 1TXDA 3CGFA 4L46A 2XUUA 2GHMA 1JQHA 4Z55A 3F3TA 4OAUC 3DKGA 3QGWA 4D28A 5CEQA 4BWPA 3VONA 2J0LA 4FRFA 4MBLA 3OD6X 3MFRA 4HYIA 2NO3A 3UQCA 1NVSA 2ZJWA 3KRRA 3G0EA 4BICA 1OITA 2FJLA 2J7TA 4CHMA 4F7JA 4ACGA 3BHUA 3UC3A 4UEUA 5HE0A 3CXWA 5KZ0A 3DT1A 5IDNA 4ZSAA 1H0VA 4ITIA 3GGFA 1U5QA 2OZAB 3FUPA 2BDJA 5AUXA 3ZFXA 4B0GA 3OTVA 4RX5A 2I5CA 5J8IA 2HYYA 3E7OA 4OTWA 1UKIA 4WIHA 5HO8A 1I44A 2YJSA 5FXSA 2CKPA 5M4UA 1OQNA 4D2SA 2QI8A 2ITOA 5DT4A 3ZM4A 2X0GA 2PVLA 5M53A 3C0IA 2A98A 1VZOA 4O4BB 4UY9A 2VWVA 1PMEA 1OL6A