3O96A

Crystal structure of human akt1 with an allosteric inhibitor
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
428
structure length
367
Chain Sequence
SDVAIVKEGWLHKRGEYIKTWRPRYFLLKNDGTFIGYKERPQDVEAPLNNFSVAQCQLMKTERPRPNTFIIRCLQWTTVIERTFTPEEREEWTTAIQTVADGLKKQVTMNEFEYLKLLGKGTFGKVILVKEKATGRYYAMKILKKEVIVANRVLQNSRHPFLTALKYSFQTHDRLCFVMEYANGGELFFHLSRERVFSEDRARFYGAEIVSALDYLHSEKNVVYRDLKLENLMLDKDGHIKITDFGLCKEPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHEKLFELILMEEIRFPRTLGPEAKSLLSGLLKKDPKQRLGGGSEDAKEIMQHRFFAGIVWQHVYEKKLSPPFKPQV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of human AKT1 with an allosteric inhibitor reveals a new mode of kinase inhibition.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords RAC-alpha serine/threonine-protein kinase
total genus 99
structure length 367
sequence length 428
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2010-08-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
A PF00169 PH PH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3o96A03
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 3o96A01
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3o96A02
4HGSA 5CZIA 3PTGA 1U27A 2F2CB 2XKDA 1AWEA 3ZH8A 3A8QA 1YXXA 4ZJVA 1YWVA 4FIIA 4XNEA 3E5AA 3WF8A 2C3JA 2R3MA 5C8NA 2W1FA 1Y8YA 3NNVA 2W9FB 4R1YA 4MAOA 4JAIA 3QXPA 4CKIA 2I6LA 4ZTNA 5IDNA 3IW7A 4GL9A 4BCPA 3ZRMA 3UO5A 3ODXA 4D0WA 4EUTA 4TYGA 4CNHA 3EFJA 4MXYA 2J0JA 4RA4A 2CNQA 2I5FA 4F7UP 1HOWA 1FMKA 4A6KA 3KY2A 4MNFA 2XVDA 2F57A 3GI3A 1W84A 2PVYA 4ACDA 3KN6A 1GOLA 3KFAA 5FP6A 1KE8A 2R3PA 4FV7A 2BZHB 1OL6A 4XG8A 2UZBA 3KY9A 3ZLSA 2HENA 4O27B 4XLIA 2OSCA 3IG7A 4M84A 4C34A 2ETKA 2YFXA 4LV8A 3HA8A 1LEZA 3QYWA 4JS8A 3LFEA 3LJ0A 4XBRA 4B6LA 4DH8A 4YURA 5KO1A 3V6SA 2VZ6A 4XUFA 3O23A 4JVGA 2GNLA 1M7NA 5C1QB 4F9BA 2CDZA 4K2OA 2R0UA 5E90A 3PWYA 4G6NA 4TTHB 3LLTA 4W9XA 5E8XA 5H8BA 3TJDA 4ZRKA 1UEFA 3NLBA 4FI1A 5LCKA 3NCGA 4CFVA 2I1KA 2FSLX 3PSCA 4MT7A 4JAJA 3FC2A 3ZU7A 1ZLTA 3TL8A 4G6OA 4KNBA 3B2TA 1SMHA 2C5XA 4JDIA 3QQHA 4IDTA 3OT3A 2YM4A 5ANIA 4OT6A 3RCJA 4KIPA 5TE0A 2NP8A 3R02A 5I3RA 4FTOA 1P5TA 1WBOA 5HVKA 3UVQA 4EOLA 1WCCA 4J52A 1U5QA 4FKOA 3D9VA 2O64A 2ZMDA 4WUAA 5IQBA 4Y83A 3QRTA 2O8YA 2IFSA 4DE4A 4H1JA 4OTIA 4KS7A 3KRRA 3TEIA 3IW4A 3IW6A 3BYUA 3IO7A 3N4TA 3VULA 3UYSA 1WFCA 2JKMA 3ZCLA 3DNDA 4EH6A 5AV4A 4O7VA 2PZ1A 2UZUE 3F2NA 3EH9A 5AP6A 1XODA 4PRJA 4ENYA 1XR0B 1WJ1A 4Z2MB 3HAMA 3TTJA 3PY1A 3EKKA 2OI4X 3GC9A 2WQOA 3I0OA 4IXPA 5HG9A 4FF8A 2QKLA 5EM8A 3RHKA 4IAKA 5K9IA 1ERKA 4U44A 3BJIA 4FT0A 3D15A 3LKMA 2QOFA 2WQMA 5DR9A 2WMBA 2O5KA 3QUEA 4KHOA 3KL8A 3F5UA 3TZ7A 5CY3A 3UO6A 1H00A 2BRHA 3VBWA 1Y6AA 4BKJA 4WNMA 3JVRA 3MSSA 2OFUA 2C6TA 4R3CA 4ZJJA 5C6RA 3POOA 3C5UA 2CRFA 2ITZA 5E92A 5FDPA 4DCAA 5J9ZA 2QHNA 2ETRA 2UZWE 4CCBA 1STCE 4RVKA 4TYIA 1V88A 4CD0A 3AGLA 2UUEA 4OTPA 3CEKA 4MCVA 2UZSA 2GTNA 2XMYA 2VWXA 3DAKA 5IH4A 4UWCA 5HU9A 3EQIA 3RINA 5E4HA 4L3LA 1W1DA 2CKEA 2KGXB 4A06A 4BZNA 3QGWA 2FA2A 2R7IA 4I21A 4ACHA 4A4LA 2C5OA 2QG5A 2X2MA 3QLGA 2VNYA 4NJDA 2C6KA 1P3RA 5HX6A 2WNTA 4FTRA 5EW9A 2YVCA 1E1XA 3ITZA 3K2LA 4HGEA 5E9EA 4DTBA 2B55A 1J7LA 3S95A 4G3FA 5T68A 5KBRA 2ELAA 3CLYA 3PRFA 3UYTA 5HZNA 2YA9A 3Q9WA 2JAVA 3UOKA 3S00A 1NW1A 2GNIA 3C0HA 3GEQA 4A4XA 4A9YA 4YGAA 3LMHA 2N0YA 4DX90 4EQMA 4LRMA 1PXOA 5JEBA 2BILB 4CFMA 2ZB0A 3CY3A 3SRVA 1FVRA 3FL5A 3F3WA 2IVTA 4GVAA 4MD7E 3KXXA 4HB3B 2PUPA 2WMXA 3VS0A 2QOHA 3HW2B 4C3PA 1OGUA 4RLLA 4RX5A 3N4VA 3FXZA 4RQVA 2DS1A 5FG8A 5A4CA 4WVFB 4RBLA 3FAAA 2RGPA 3LXNA 4WBOA 4M69A 3R8LA 4DFYA 2UVXA 4ALWA 2Y0AA 2CSNA 4OGRA 5J79A 4CKJA 3BWFA 3P86A 5GOWB 3GFEA 3FDNA 2FSTX 4RFZA 2D9WA 4EK6A 4EWHA 3UJGA 1QMZA 5JHHA 3BRBA 4KSQA 2RFEA 5DOSA 3LFNA 4QQCA 4F4PA 4LOOA 5BX0A 4AFEA 4FVQA 1VJYA 3Q5ZA 4IX6A 3MJ1A 3IPHA 5FM3A 3G33A 2Z02A 4AQCA 3DK7A 4PPBA 4RRVA 1QCFA 4C62A 4AW5A 5JGDA 5K4JA 2W2XD 5DN3A 3FI8A 3OFMA 4R5SA 1N3HA 3OANA 2CY4A 2F7ZE 4FX3A 2OO8X 4JDJA 2CKQA 2HAKA 4I94A 4XG6A 2WD1A 4RPVA 5CF8A 3OTUA 5CVGA 4X2KA 4ZRJA 4OT5A 2L1CA 5H8EA 1GZKA 3FQSA 4DH1A 4GK3A 1Q61A 3W8QA 2RKUA 2Z7RA 1FB8A 2HCKA 5GZ9A 4JDHA 1ZYJA 2XK6A 2PVNA 4ZLOA 5CNOA 2C3IB 2G1TA 3F66A 2P33A 3FLYA 3MN3A 4Y5HA 2ITTA 2B4SB 3C4WA 4JQ7A 4W8DA 3RNYA 1QPCA 2KTYA 1QPEA 3IW8A 3VQUA 2OQBA 2QNJA 4IADA 1REJA 4MK0A 4F0FA 1H1WA 2W1ZA 5F95A 5HIEA 3KULA 4Q9SA 1H01A 1KV2A 5M07A 2JDTA 2W4JA 1WAKA 3SNHA 1F5QA 3C0GA 4FBXA 3EZRA 3I81A 4ACMA 4UV0A 4Q9ZA 4HDQA 1OI9A 4HNFA 4H58A 2Q0BA 2V7AA 4J8NA 4E4LA 4FT5A 2DUVA 4CKRA 3OWPA 4B9DA 2YDKA 3LW0A 5FEQA 3ZUVA 5J7HA 4N0SA 4YZCA 1UV5A 5AP4A 4FKRA 4PP7A 3P4KA 1QC6A 1FHXA 2ELBA 3NCZA 3P79A 5FTGA 5DMZA 4APPA 2D4QA 2VX1A 3KXNA 3LCOA 3F69A 3F88A 3TN8A 4EBWA 4W8EA 2GS6A 4Z2NA 4HATB 4YLJA 3FXXA 3K3JA 3LCKA 3CXWA 5HBJA 4E6DA 5EHOA 2RNRB 2E9OA 4LMNA 1IEPA 4YSMA 2A2AA 2CCHA 2D9XA 5KMNA 3F3ZA 4IB3A 2GQGA 4R78A 1XR1A 4ASEA 3OC1A 5IPJA 3VS3A 3U54A 3UMXA 4DINA 4D9TA 3OT8A 4B0GA 2J6MA 5HCXA 2AUHA 4K33A 4P7IA 1U2BA 2PZRA 3PVGA 5HD4A 3M1SA 2X7GA 3P7AA 5CT7A 4ID7A 5AEPA 2R5TA 4BTFA 5CAQA 5CENA 4Y46A 4IFSA 3QCYA 4XCUA 2VTLA 2PMNX 2YIQA 3EFKA 4YO6A 1TQIA 3VUGA 3ODOA 2P55A 3QRKA 2X2LA 5FBOA 4E4MA 2PMOX 1QQGA 3KMWA 3MB7A 3OROA 5JZJA 4IJPA 4IM3A 4IEBA 3KGAA 5AM6A 5JRQA 3DLSA 4FIJA 1X11A 2FO0A 1OUKA 2Y4PA 1IRKA 3BYVA 2ADZA 4NTTA 3HRFA 3DQWA 3TT0A 3HMNA 4NUSA 3RVGA 3QA0A 3CPBA 3NUYA 3QL8A 3BE2A 4HCVA 1OY2A 4JQ8A 3IDBA 3BGQA 1H0WA 5TR6A 2B9FA 5F9EA 3SRVB 3FE3A 4MXZA 4B99A 4I24A 5AUYA 5GHVA 4BZDA 4Y73A 3LM0A 5H3QA 5BUJA 2CNVA 4CRSA 1U54A 3OWKA 3HV6A 4E26A 2Y8FA 4G1WA 4DYMA 4ANOA 3BYSA 5KQ1A 4FGRA 5EG3A 1J7IA 2FYSA 3B2WA 3IS5A 3ZBXA 2D2QA 4FEQA 1TQZA 4CRLA 3ZBFA 5IQIA 3DB6A 3R83A 5J5SA 2HE7A 4Z55A 3SDJA 4KSPA 2VTQA 4GFOA 1ZZLA 4JJRA 4YJTA 2YM8A 2Y7JA 4GJ2A 4M66A 4AGDA 4MNEB 5CSWA 3MV5A 4I6HA 1EH4A 5DRDA 3O2MA 3E7OA 3CE3A 3I6UA 5L8KA 3RZFA 3P7ZA 5HO8A 3AU5A 2XRWA 3CPCA 4OTGA 3K54A 4QYEA 3NVKI 5BUIA 2UZDA 1MUOA 4IFCA 4L45A 4NW5A 4U41A 3RWPA 4U9AA 4K11A 5C5BA 4FSRA 3QHWA 5IF1A 3UQCA 3FC1X 3MJ2A 2N23A 2P0FA 3MA3A 1OMWA 4BCMA 1Q3DA 1YWRA 3OEZA 3VC4A 4C4HA 1NI2A 3TACA 1PMUA 4M97A 2CODA 1SNUA 2G9XA 4PDSA 3BLRA 4OBOA 2F49A 4CV9A 4E6AA 1V0BA 3FZSA 4GVJA 2XJ0A 3PP0A 4U8ZA 4WOVA 5F20A 4UN0C 3G9NA 5HLPA 3VS6A 3QFVA 2ZV9A 2FB8A 3QZHA 4L01A 1X8BA 3Q53A 1W8CA 3R2YA 4OTHA 1ZZ2A 3BGPA 3R7IA 5HKMA 2ITOA 4HAZB 4AS0A 4J7BA 3NR9A 4ASDA 3U6IA 2JP2A 2EB3A 1Q8UA 4M0YA 4QMPA 5HTCA 1K5GB 3CSVA 2AC3A 4O21A 3KKVA 4U5JA 3CBLA 3QZIA 3RCDA 3PUPA 1OIYA 4DEBA 1K5DB 4IANA 5IA5A 4X3FA 1U59A 5IQEA 4FYOA 4WA9A 3T3VA 5ETCA 3F3UA 2D9ZA 2GNGA 5G6VA 1PXJA 2FSOX 4FKWA 5TO8A 4XV2A 3DGKA 3Q2MA 4O0XA 4DEHA 3ZXZA 3KCKA 2J7TA 4ZOGA 4ZAUA 1H8FA 1ZOHA 2XB7A 3L9PA 1NT2A 2XM9A 3D2IA 4LGGA 4I93A 4DHFA 3FMHA 4FTIA 4I0TA 5H9BA 1RRPB 3GENA 1PRYA 3HK0A 2C3KA 1P2AA 5M4FA 4MD9E 4IJ9A 4BY9E 4RIWA 5HE3A 3QWJA 3TKUA 5KMKA 2XNGA 3EYGA 2ZDUA 3WIKA 1JKLA 4S33A 3R7UA 4FTCA 4GUBA 1ND4A 4JLCA 1M17A 4UMQA 1U5RA 4C8BA 3PP2A 4ANBA 2CN5A 2F9GA 4DG2E 5M4CA 4TYJA 4MXAA 2OIBA 3AXWA 1XHAA 2CCIA 4J96A 3R7YA 3V8SA 4BGGA 2F2UA 3ODZX 4UXQA 3O71A 2RLOA 2V62A 4RVTA 5FTQA 2XNNA 4V01A 5DIAA 4ZXTA 4ZY6A 4BCOA 4CMUA 3MPAA 1V61A 1ZMVA 2OIDA 5DNRA 4JRVA 5IQDA 3ZDIA 3CCNA 2P0CA 5E8ZA 3U7DA 2WMSA 2ZB1A 4XRJA 4W9WA 2PVHA 2YCFA 3IK3A 5FM2A 3U8ZA 4C4GA 3R6XA 4V05A 2CPKE 3OCTA 2OZAB 5AA8A 5EHYA 5JFWA 1MAIA 3BGZA 1ZC4B 2GNHA 4C2VA 5LONB 2IWIA 2YCQA 3KQ7A 5EQPA 3D8EA 2J2IB 4CTBA 4HAUB 3EQFA 1T46A 3MS9A 3NUSA 4HGTA 2XEZA 3E64A 3V01A 2BALA 4WSYA 4OTDA 2PVKA 3NYVA 2YISA 1Y6BA 3CJFA 3VUHA 4TXCA 3D83A 3AC4A 4G5PA 4RZWA 2W4KA 2HYYA 4FTNA 3ATTA 4D0XA 1OKYA 4EOKA 3ET7A 3KXHA 5DI1A 4EJ7A 2RF9A 4I0SA 5DR2A 1TQMA 4G16A 3KK9A 1UNRA 5CAVA 4EWQA 2D11A 2OBJA 3G2FA 2GNFA 2CLXA 3D94A 4YC3A 4YTHA 4MXXA 2OJIA 4FEVA 3TNWA 3R21A 4TWOA 5EOLA 2FSMX 4PDPA 1OB3A 3ZO1A 3NYOA 4KAXB 4RIXA 2RUKB 4QTEA 4JG6A 3ZRLA 2C6EA 4K18A 4RC3A 3R7OA 3TV6A 3ZUTA 2A27A 2WTCA 2H8HA 2VGOA 3AJ4A 3DXQA 3P6AA 4CV8A 4D0NB 2V7OA 3FMLA 3Q60A 2W05A 4F9AA 1SHCA 3KA0A 3R7EA 2ONLA 3DFAA 5AJQA 3TW1A 3KXMA 1W0XC 2R2PA 2XBJA 3MH0A 4Y95A 3QXOA 3O51A 2JD5A 3HV5A 4CYJA 4HW7A 4GU9A 3RM6A 1SVGA 3GT8A 4CMTA 4FTKA 4EZ3A 4D4VA 5CYIA 5HBHA 2G01A 2QOOA 3PIYA 2YJRA 2R3RA 4OW8A 4L00A 1W1HA 2OH0E 1OIQA 2J0LA 1IAHA 3JR1A 4I5HA 5CSXA 5GIOE 2JIUA 3EMGA 4RVLA 4G5JA 4FL1A 4QPAA 5CU6A 3E8NA 1PMVA 2ITXA 2OJJA 4ZY5A 4PQNA 2QOBA 3ACKA 3AG9A 4UEUA 5BUEA 2YM6A 4DX8A 2OWBA 2YT1A 2PVLA 1PXLA 3FUPA 4KD1A 4I5MA 5G1XA 4ERWA 3SUZA 3EWHA 3U51A 3T9TA 4E5AX 3R7VA 4GMXB 1ZMWA 1JKTA 3OWLA 4IACA 4JR7A 4L46A 4ZSJA 5JFVA 4BFMA 2O3PA 1H10A 4U6RA 2XYUA 3ORKA 4J1RA 4WG4A 4G3GA 4WNOA 4YPSA 2X7FA 5BYZA 3C4CA 5HORA 3LMGA 4IMYA 3MH1A 4XRLA 3LFCA 4L7FA 5E8TA 5CAOA 2IZUA 5D11A 5I5ZA 1OPKA 2C0TA 1XH9A 2JFLA 4YZNA 1OECA 5A54A 1V5MA 1F0QA 1KV1A 4UMTA 4UZHA 5CI7A 2IYBA 3Q04A 3PVWA 4NK9A 4RJ6A 4BN1A 1EGXA 4FNYA 3LLAA 1M7QA 5DYJA 2YCRA 3Q2JA 4DA5A 1U5GA 4TKSA 4BYJA 3P7BA 5I3OA 1JVPP 4Q5EA 4BWKA 5AP7A 2CLQA 3U8WA 4FZ7A 4FUXA 2HW7A 3COHA 3QX2A 4I41A 4HPTE 4U81A 3DFCB 4ENXA 3TUBA 3BLHA 1MPHA 3N51A 1E9HA 3E8EA 2BAQA 3QCSA 3ETAA 2IZTA 2YIXA 4CLJA 1FHWA 3PLSA 1PXIA 5C9CA 2H6DA 5LMKC 5DHJA 3D8DA 4AW2A 4GRBA 3FQEA 4J53A 2W5BA 4HOKA 2YT0A 4ZJIA 4RX7A 1EAZA 2DN6A 4EL9A 4HZRA 3G51A 3KF7A 2W0JA 3FLWA 2UW3A 3HUCA 4K81A 3PSDA 4JG7A 3V5PA 5C26A 3ZRKA 2NMBA 5AR4A 2W2XC 4NW6A 2BR1A 3EFWA 3A62A 1LP4A 3UNJA 2AC5A 3HRBA 2RG6A 4IM2A 2GMXA 2VNWA 1FGKA 2Z7SA 3UE4A 4CYIA 3OG7A 3Q32A 4L42A 1WVXA 4II5A 2QD9A 5HG8A 2XZSA 4BIBA 3QTWA 1Q97A 4GJ3A 1SVEA 2OK1A 3FKLA 5CXZA 5KNJA 5H8GA 1BTKA 1X1GA 3PXFA 4FZFB 2FGIA 4AOJA 4UMUA 1Q8ZA 2B9IA 3JY9A 4D2RA 3W1FA 1NTVA 4O0SA 1OVEA 2X4FA 1YRPA 4XP0A 5DT3A 5EKOA 2MDXA 3POZA 1OBDA 4RWJA 1APME 3UVPA 3P5KA 1GNGA 4I4EA 3I4BA 2BAKA 4F9YA 5FXRA 5JFSA 5L3AA 4BCIA 3JUHA 2YITA 3TNPC 4DAWA 3SO6A 1PXPA 4YHJA 5HX8A 5LCJA 2CMWA 4C0AA 4O2ZA 1P4OA 3WZEA 3KZ1A 4X6QC 3DTCA 1GC7A 5AA9A 4FNWA 5FBNC 1JAMA 4BBMA 3QTXA 4TNBA 3DAJA 2W1DA 3OXIA 4PL5A 4XH6A 1U5EA 2OTXA 2I0HA 3JVSA 4IAYA 3VS1A 3A8PA 1GIIA 3ZM9A 3VRZA 2HY81 2XIXA 3R1SA 5AR2A 4BI2A 3MH2A 1R39A 3PRIA 4N6YA 4WHZA 2XCHA 4DH3A 3G6GA 1DAWA 3OWJA 3OUKA 4L44A 2WMWA 3BCEA 1M2QA 3HA6A 3A8WA 5EI2A 3GC8A 1ZY5A 3FMEA 4PDOA 4OUCA 1FOTA 2HZIA 4IVAA 4CQGA 3UPZA 5LARA 1DI9A 5CF4A 3T8OA 2CGVA 1P6SA 2X6EA 2RG5A 3QAME 5EYKA 4FV0A 5HI2A 4EHZA 4UMRA 2G2FA 5HO7A 5KHWA 3EN7A 4GXBA 4MXOA 5HVJA 5D27A 4MWHA 5AR7A 4L52A 2XCKA 4A9RA 4X2GA 4GV1A 2IG7A 4F70A 3CGFA 2UZVA 2BZJA 5CS6A 2NO3A 3AT4A 2G2IA 4YZMA 4DH7A 5CF5A 1Y8GA 2OFVA 4U3ZA 5ACBC 3D5VA 2BRMA 2PE0A 2ZYBA 5FWKK 4EEVA 2E2XA 4JDKA 1YHVA 4ALVA 1YVJA 3SLSA 3OZ6A 4UXLA 3KK8A 3MPMA 4FGBA 2F4JA 3R04A 4EHEA 2Q13A 4GFGA 1UPQA 1H1PA 1V5UA 5JGAA 5C01A 1A9UA 5DHFB 3U6JA 3L9MA 4L8MA 2YHVA 3NUXA 4NM7A 4XG9A 5TOZA 3RPVA 3PVBA 2P2HA 3TNHA 4EC9A 4EOQA 1Q67A 5ANGA 5IUIA 3EQDA 3MBLA 4NJ3A 1UA2A 1YQJA 3HGKA 1BLXA 2W96B 1ZY4A 2XNOA 3QA8A 3VS4A 5K5NA 1X1FA 4AWIA 4FYNA 2OXXA 4U45A 1T45A 2K00A 5EW8A 3DJ5A 1I09A 3OOGA 4LM5A 1BL7A 3BZ3A 2DYQA 4YC6A 3QRJA 2DFKA 1RE8A 2C0OA 4XG3A 5J3YA 1FVTA 2BTRA 4QQ5A 4EHVA 5LJJA 4U97A 4MXCA 4FV1A 2ITQA 4DT9A 3O50A 4EC8A 4E7WA 3W2RA 3PEGA 3NUAA 4HB2B 2PHKA 3F9NA 4BBKA 1ZSQA 4CG8A 1ZOEA 3KULB 2WTVA 3K5UA 2RFSA 4NU1A 2R4BA 2W7XA 4X3JA 4EKUA 4HAWB 3QBNA 3QQUA 4AFJA 4FKGA 3ALNA 2QOQA 4WD5A 2QQ7A 5DWRA 5IEVA 4JNWA 2EJ8A 2J4ZA 3PXRA 5TT7A 2GS2A 4LOPA 3WYYA 2VN9A 3F6XA 5BPYA 2JITA 2VWUA 4TWCA 2VTRA 2VKIA 2VX0A 3NUUA 3PE1A 4FV5A 1ZVRA 2R3HA 2WELA 3QUPA 5HE0A 3PLAE 5EDPA 1XBCA 1BI8A 3EL7A 2B0QA 2UW6A 4JIAA 2UVYA 2Z60A 4BIEA 3KRJA 3DAEA 1BTNA 1YOMA 2G15A 2JDOA 3O8UA 4KBKA 5IDPA 3FPMA 5CI6A 4DN5A 4I6BA 4XG4A 3DBCA 4AGUA 2W99B 1Q4LA 1GIHA 4XV1A 3PE2A 4IZYA 1CTPE 2B52A 2NPQA 3SXSA 1CKPA 5KMJA 1NVQA 4RIYA 3PA4A 3S0OA 5CU2A 2BRBA 2UW9A 1NTYA 3MVMA 3S3IA 2IVUA 3CD3A 4O1OA 5L81A 3UIUA 4FZ6A 3MESA 3DPKA 4BCKA 4Y72A 4X6RA 3Q9XA 4LUDA 4KUJA 2WMTA 3ZONA 3GOPA 4X21A 2WGJA 2XK3A 4AGCA 4K0YA 3UODA 1V0OA 5ANEA 5C79A 2VTSA 3FI3A 3LAUA 5J7BA 1PLSA 1W1GA 5D7AA 2OGVA 1SZMA 4OTRA 3GB2A 3ML4A 1PYXA 5EW3A 4LG4A 1YDTE 5HIBA 4YU2A 3LFAA 5AUTA 5EK7A 2UVMA 3BYOA 4DXAB 4AE9A 1UWHA 4IVBA 1H1RA 3QQFA 3TUCA 2X2KA 5CX9A 3VS5A 4ZSAA 3MVLA 5CANA 3LXPA 4TPTA 4OTQA 3VF9A 1XQZA 1JKSA 1XBAA 5GJDA 4EK4A 3M42A 3PA3A 1U54B 4WNPA 3ZLWA 3UZRA 5CQUA 2P4IA 1TVOA 4BCJA 1U29A 3MI9A 5JSMA 4P7EA 2Q0NA 4FG7A 2OKRA 2YCSA 4UYAA 4BI1A 1HCKA 4QMYA 4TYHA 5FI0A 2OJGA 4M8TA 4C58A 4QO9A 4BRXA 3KMMA 4RGJA 3FV8A 4F6UA 3QTQA 4A9SA 2VTIA 3UG2A 2A1AB 4XJ0A 1OUYA 3NVMB 4O38A 5CU0A 3TNIA 3PVLA 4YBJA 4AN9A 4HVSA 4A6HA 5HNBA 4CVAA 3O7LB 4ZLZA 2O65A 4IC7A 1YHWA 5F4NA 3BPRA 1H26A 5HIDA 5D3VA 5M57A 3UP2A 5A6OA 4O0TA 4DFUA 1IA8A 2R0IA 3MY5A 3AC8A 3KSYA 5BVNA 5CXHA 5ETAA 5D12A 4IFGA 1O6LA 2QKRA 2OZOA 2BUJA 5L6WL 3NW7A 4YL8A 2BDFA 2HTHB 2YAAA 1MQ4A 5IUGA 3E93A 3Q4UA 4UYNA 1YXVA 1Y57A 4ONAA 3IOKA 4HB4B 3H4JA 3FL4A 4AN2A 4RC2A 2KCJA 3FLZA 3BBTB 1AGWA 4YC8A 2L2IA 5EM7A 4BCHA 3LPBA 4A4OA 3HUBA 1JPAA 3C4EA 4O7ZA 2BAJA 3AU4A 2QU6A 4F9WA 3DXDA 3RTPA 4PMPA 4O7LA 1V1KA 2B54A 4LMUA 4OTFA 3ODYX 5FUTA 3CXBB 1ZMUA 5DH9B 4PUZA 3R0TA 4M0ZA 4NIFA 5AIRA 2OF4A 5AADA 1XH8A 1J0WA 5E8YA 3HQCA 4ZIMA 3A60A 3I6WA 1NVSA 3ALOA 3OF0A 5K0KA 2M14A 4K1BA 2GNJA 4JXFA 4RWKA 5ETFA 4QMVA 3MVJA 3I5NA 3PYYA 3O17A 2J0IA 2WQNA 4HCTA 4YTCA 2WFYA 2SRCA 1FVVA 2PZYA 4CG9A 3CC6A 4IWDA 4UWBA 5CVHA 1B39A 3QQLA 4IB5A 4XOZA 4QTAA 3PG7A 5HNGA 5AWMA 3QD2B 3BWJA 2VTAA 4EH8A 3B8QA 4FKJA 4JBVA 4IIRA 4D2PA 2WQEA 3NDMA 4I3ZA 4WT6A 3FYJX 5HTIA 5LQFA 5GZ8A 2DA0A 1OPJA 2BTSA 3LMIA 2JGZA 1GZ8A 3VN9A 2ZV2A 2CGXA 3DA6A 4GIIA 4MH7A 3FKOA 2IW8A 1MRYA 4GYGA 4K6ZA 5E7RA 1VEBA 3E3BX 2OH4A 3PPZA 1WVWA 3GP0A 5FDXA 3F5PA 4J71A 4HVHA 4FSQA 2MKRA 3QBVB 2PZ5A 1DS5A 3G9LX 4S30A 3N7CA 3NW6A 3GCUA 3F3TA 5ACKA 3ZYAA 5BMMA 2X4ZA 4OAVB 2EXCX 4LGDA 1Q41A 3NNUA 4F7JA 5EDRA 2OG8A 3ODWA 5DEWA 1UPRA 3HMOA 4X2JA 3GVUA 3ZM4A 3SKCA 1XH4A 3UOJA 2J5EA 5K4IA 5I9ZA 3FEGA 2ITVA 4MBJA 5AR8A 4AAAA 2C5NA 3C5IA 4Z7HA 1UU3A 4A7CA 4J97A 1M7EA 4I22A 2R3OA 3I0QA 4H8SA 1KI1B 2LGCA 2XA4A 2PMLX 1XCGA 5IUHA 4DEAA 4FEXA 4D2WA 2VSZA 3AC1A 3SG8A 3K5VA 3QQGA 4QYGA 5M56A 5DI9B 3U6HA 3DDQA 5JH6A 1GC6A 2Z7LA 2XNPA 1B6CB 3EN5A 5TKDA 3DKGA 3RPRA 3ZDUA 4GSBA 2OICA 3BELA 2UV2A 5T3QA 2Y7BA 2OXYA 2K2UA 2XIKA 2BKZA 3CTHA 2PWLA 3GNIB 3NRMA 4U43A 3KREA 2WEVA 4L6QA 5KKRC 2O0UA 5HHWA 3BINA 5CNNA 5CSHA 4J98A 4ZSGA 3BX5A 1H27A 3NSUA 3WE4A 4YP8A 3TVVA 4M12A 1DDVA 2W1HA 4RJ7A 3HEGA 4FK3A 3VUDA 4E1ZA 4ZZOA 5CWZA 2WIPA 5CEMA 1PY5A 3D7ZA 4BDHA 1OIRA 2ZOQA 3DBFA 3FLQA 3GU7A 5AV3A 3U4WA 4ERKA 5EDQA 3W8LA 4BTKA 5EFQA 3R8UA 2VWBA 4FG9A 2ONLC 2GFSA 3WYFB 4J99A 1YW2A 4O91A 4PMTA 2E9PA 3ZZEA 4USEA 3BU3A 2GHLA 2ZMCA 3HV4A 4JX3A 3FHIA 4KIOA 4F7NA 4TL0A 2XJ2A 3UP7A 4JBPA 5LMAA 3WF9A 3OY3A 1FPUA 1XKEA 3V5WA 4AGWA 4D2VA 3FLNC 2J5FA 2PL0A 3D7TB 5DHAB 4U0IA 4Y5QA 1RJ2A 4KWPA 1GJOA 2WMAA 1ZOGA 2VWYA 3GCQA 4FZDB 1YXSA 4GU6A 3RGFA 5A4LA 1H4RA 3H0ZA 4A6FB 4UB7A 1MP8A 1WBTA 4AACA 4L3JA 1J1CA 3AD6A 3GCVA 4UY9A 4D9UA 4F7LA 3QD3A 4IWQA 3R1NA 4XS2A 1WZYA 3C0IA 4WKQA 4FICA 2O2UA 2P8VA 2W5HA 3R22A 4KBAA 3RAWA 4C3FA 4E4NA 2R09A 3IDCA 3UMWA 3JPVA 3ZXTA 2Z0QA 2PUIA 3H9FA 4FKLA 2H9VA 4H3QA 2C6IA 4IWOA 4D2TA 3TO1A 2BPMA 5CALA 1Y91A 3F2RA 2VD5A 4I6FA 5IA3A 5AUXA 1KWPA 4BF2A 1H1QA 4M15A 3ZO3A 2RSGA 3G6HA 3PXZA 2YS3A 4X2FA 4M7IA 3ZVRA 4AN3A 4G9CA 4YR8A 2QURA 1MK7B 3I1AA 4EH3A 3EN4A 4GCJA 2RGNB 4O0RA 2XQNM 5D7VA 1XH5A 4F7SA 2E9VA 3MTLA 4L43A 5B0XA 2XF0A 3DLZA 2QOCA 2YLEA 3NIZA 4U42A 3RM7A 3UO4A 3BHTA 3EKNA 4CSVA 5AR5A 4P2KA 1H4LA 5CEPA 2GPHA 3R8PA 3GYPA 3I60A 1XKKA 1MK9B 1DROA 4QMOA 3C13A 4FE2A 4E5WA 3H10A 4QP9A 2EU9A 3WOWA 4D5KA 1DBHA 3ID6C 3W2SA 1U5FA 1KE5A 1Q5KA 3ULIA 5EQEA 5IA2A 4NZWB 2GS0A 3R71A 1NVRA 2CN8A 3E8DA 4C4IA 5A9UA 3PZEA 3ZSHA 1FQ1B 1P4FA 4JI9A 5ANOA 5GINE 4UWYA 2WEIA 4RJ4A 4BDGA 4IZ7A 1LPUA 1IG1A 3OCGA 3SW7A 5CT0A 2IJMA 3A7JA 3G5DA 3O96A 4M14A 2H34A 3DQXA 3DTWA 4BCQA 4ZY4A 4LYNA 5BVDA 4ANLA 2ROZB 4E6CA 4GG7A 2EMSA 2YS1A 5KMIA 2VTHA 4HVIA 5M53A 4DTAA 2Y6OA 3UDBA 4DH5A 1BAKA 4PNKA 4IAZA 1Q99A 2HWPA 3TV4A 1UU9A 4UX9A 3LFBA 4PY1A 3CD8A 2XNEA 5EFXA 3VBXA 4QP4A 5ANDA 2BDWA 5D9HA 5K5XA 4K2RA 2D9VA 2WKMA 3UNKA 2C1AA 3ENHA 1TKIA 4QQTA 4QMMA 3UGCA 1OL5A 4KRDA 1RW8A 4DG3E 1LUFA 4DLJA 4A9TA 3CQWA 5BYYA 3ORXA 3BEAA 5AV2A 2DQ7X 3TIZA 3ZLYA 1AQ1A 4G2FA 1NY3A 1AD5A 3W2CA 2XK4A 3RHXA 1ISNA 3AQVA 5C16A 4HVDA 3LIJA 1OBGA 1A06A 2X9FA 4EH5A 2WHBA 5M09A 1GY3A 4QP1A 5BMSA 4BBEA 5IQGA 5AIKA 3BV3A 5CASA 4AU8A 3ATSA 3LHJA 4ZEGA 3SV0A 3VUTA 2XIZA 5J3TA 3W2PA 4DEGA 2R3JA 5ICPA 4FKIA 5AM7A 4DGMA 2WZJA 5M55A 5BVOA 2WU7A 3R30A 1JSUA 3R8VA 4F99A 4FEUA 3MWUA 5HOAA 5JHGA 4AA5A 4CFWA 3JY0A 3MYGA 3F3VA 3NUNA 3NNWA 1I44A 4JBQA 3RPYA 5ETIA 2ITUA 3HV3A 4BIDA 4CEGA 1WVHA 3NGAA 1BX6A 3Q9ZA 4K9YA 4RJ3A 4DG0E 3H3CA 4P4CA 4DGGA 2XK7A 5FTOA 2XIYA 3BV2A 4IAAA 4DT8A 3V8TA 3GU6A 3CP9A 4W4VA 4DFNA 2D10A 4V0GA 4AF3A 2VTTA 3L9NA 3HZTA 5AUZA 2VU3A 1L3RE 2BFYA 3GGFA 5AFVA 4MYGA 3GFWA 4E6QA 4EZ7A 2XNMA 3CTJA 4H1MA 5E1EA 4EK8A 3EN9A 5AUWA 2W1IA 4DF3A 4FIHA 1JWHA 3BEGA 3T3UA 4FIEA 3V5LA 1ZARA 3DKCA 1OKVA 2IO6A 1ZRZA 3FPQA 4EZ5A 2QVSE 2JLDA 3EQHA 3AMBA 5LVNA 3BU6A 2J50A 4RC4A 1M2RA 3SQQA 1I7AA 4TKNA 2YIRA 1FINA 4M69B 3LQ3A 5LMBA 2C5VA 1PKDA 2FUMA 2XH5A 4X2NA 5K3YA 2QG7A 2JDVA 4FV3A 1TQPA 3AC3A 4GH2A 3EL8A 3ZFXA 5IA4A 1Y5OA 5IISA 4O7YA 5GIPE 3E7VA 4IZAA 3EQRA 5L4QA 3TFMA 2R3LA 4JIKA 4RX9A 2WTKB 5AMNA 3KXGA 4FSUA 5DRBA 5BNJA 3BHHA 5HU3A 4WG3A 3VBVA 2R64A 2WMUA 3VIDA 2EWAA 2OLCA 3MY0A 4MNEA 2DX5A 2GSFA 2Z2WA 3IGGA 2HWOA 4PV0A 1G3NA 3QQJA 2X0GA 3UNZA 1JSVA 3R01A 2ITYA 3VO3A 3QKKA 4TWPA 4F0GA 5EYMA 1PKGA 1B38A 4QP7A 1PF8A 3P23A 4FOCA 5EH0A 4CGAA 5LVLA 4D58A 5C5BB 5JQ5A 2EC1A 5DVRA 4P5ZA 4AP7A 4C35A 4C61A 5DFPA 5HD7A 4I20A 1OL2A 4B4LA 4O1PA 2J90A 2ZJWA 4YTIA 4C59A 3MIYA 3DDPA 4FT7A 1XH6A 3ANRA 2JKOA 2C30A 3FMJA 3R9HA 5L2IA 4RZVA 2J0MA 4LFIA 3TDWA 3EIDA 3LZBA 4QPMA 4XV3A 3FZTA 4X7QA 4KKEA 4NM0A 3UC3A 2WIHA 4FTUA 3FYKX 2C68A 3MB6A 2BKKA 5CEQA 4OTWA 4DTKA 4B8MA 2I1JA 4U3YA 3HMMA 2UW8A 4IBMA 4O0WA 5AUVA 3Q4ZA 4PQ0A 2BFXA 4GW8A 3ZS5A 5C4LA 4EH4A 1DYNA 4BGHA 4TYZA 3C1XA 3JS2A 3GUBA 2PU8A 1WBWA 4TRLA 4CZTA 1PYEA 1MIZB 2UW0A 3FMNA 4I4FA 5JGBA 1IRSA 2I0EA 4G17A 4E93A 2J0KA 4DCEA 4FKUA 5A4TA 4XLVA 3WBLA 3WYXA 3KVWA 3ROYA 3CJGA 3GC0A 1KZGA 5D3WA 2DX1A 3KRWA 5DGZA 5DR6A 5EQYA 2G2HA 4OBQA 4BB4A 2PPQA 4XOYA 4R6VA 5KX8A 2WTJA 3SC1A 3EYHA 3ZMMA 4PWNA 5IEXA 1KE6A 3D14A 1I2HA 3Q5IA 1O9UA 3VBTA 3W16A 4GYIA 1WGUA 3RAIA 4ANSA 3OBJA 4C02A 2GQRA 5FXQA 3NX8A 4FKQA 2JIVA 2I40A 3COMA 2Y8OA 1RJBA 3G0EA 3SAYA 4NL0A 5CU3A 4Q2AA 3KC3A 3TM0A 4GK4A 2YACA 3FY2A 3C4XA 4BCNA 4IDVA 4MWIA 1DI8A 2CKPA 4L68A 4C4FA 2XK9A 1S9IA 1XH7A 4F7HA 2A19B 3L8SA 4BWXA 4RIYB 5CQWA 4BCFA 1MKEA 2EMTA 4ZTMA 3PY3A 1SVHA 3D5WA 2EB2A 1JOWB 2QI8A 3UG1A 4R3PA 4QYFA 5LXMA 2PYWA 5I9YA 1CDKA 2IZSA 2XEYA 4FOBA 4PPCA 3O8TA 4E4XA 4EOOA 4NSWA 4YMJA 4J8MA 3R9NA 3KU2A 3LJ2A 5CSVA 5BVWA 1OQNA 1J7UA 2OJFE 2PVFA 4C3RA 4U79A 2XK8A 2E9NA 4DFLA 3IGOA 3GOKA 4XV9A 1M7RA 3Q4TA 5AAEA 2B7AA 2C47A 3HX4A 3IONA 3R7GA 1Q8WA 5EI8A 3P9JA 2C5YA 3KCFA 4GT3A 3OVVA 3OOMA 5KCVA 1QL6A 3F7WA 2WMQA 2E9UA 2W1EA 3D2KA 5IQHA 3EHAA 1Z9XA 4ZMFA 4QYHA 4ACGA 3UTOA 2GU8A 4H05A 4R5YA 2UW5A 4IQ6A 2OJ9A 2LKOA 3QLFA 3PSBA 3VJOA 3QYZA 3KEXA 4BTMA 1J19A 3QTSA 2VTMA 2MWNB 3E3PA 3I7BA 1GIJA 4R7IA 3RMFA 3UVRA 3LJ1A 4J95A 5M06A 1YI3A 2Z0PA 1VYWA 2HXLA 2X8DA 4BHZA 5CZHA 5JFXA 1YI4A 3L9LA 4DBBA 5I9XA 4TYHB 5AX9A 2JFMA 2YWPA 5KMMA 2FVDA 1O6YA 1R78A 4PP9A 3QRUA 2R3NA 4PMSA 4QMLA 3FZPA 4TWNA 4WIHA 4XBUA 2BCJA 1YDRE 4F1MA 3SA0A 2QLQA 3P7CA 2X1NA 2H96A 3N9XA 1EF1A 5J87A 4TYEA 2P0DA 2J51A 5L6PA 3AT3A 1PMEA 4MVFA 3WZJA 3PXQA 3MGYA 5EOBA 5T6KA 3RNIA 2NNWB 5AR3A 3VHEA 3D7TA 1ZXEA 3V6RA 3CKXA 4AZEA 4ZRIA 5HE2A 3FZ1A 3ZFMA 4GEOA 2BHEA 4NFMA 4KKGA 2BRGA 2JKQA 4BDBA 2DHKA 2HW6A 4NKAA 2HZ0A 2A0CX 4L3PA 3OUNB 5CTPA 4USFA 4L53A 4QRCA 5KKRB 3LVPA 5A46A 2CGUA 3CGOA 1VR2A 3LFSA 1UNPA 1P14A 4D28A 2X18A 4MY6A 3F5XA 4AX8A 2C0IA 1U4DA 2UW4A 4FV6A 1OZ1A 4QD6A 5DPVA 2PY3A 3DY7A 3EQCA 4NKSA 4RJ5A 5M4IA 2ZVAA 3IQ7A 2JBOA 5HG5A 3U4UA 2X6DA 5LWMA 3RCPA 3LOKA 4Z7GA 4IW0A 4BDJA 4ANQA 1GG3A 2LYDA 4AZTA 2QCSA 2ZV7A 3KVXA 3VS2A 4BC6A 5IA1A 2DYLA 4NIFB 4QTDA 5CAPA 2ERKA 3I7CA 2LAVA 4Q5HA 5A14A 2PUUA 3EQGA 4XX9A 5M44A 3II5A 4MBIA 5EM6A 4E8AA 1JSTA 1KE9A 3JXWA 4S31A 3TIYA 4DBNA 1H28A 3R1QA 1UWJA 2VGPA 3GU8A 4MQ2A 4WO5A 4XHKB 3HMIA 3ORPA 3NSZA 4XG2A 1HCLA 4I5PA 3MIAA 2DHJA 5ANKA 4HGLA 2EVAA 2BROA 2IW9A 3L1SA 3MFSA 4LI5A 4FA2A 4MD8E 3ULCA 3MTFA 3A7HA 3R8MA 2COCA 3NYNA 2VWWA 4GMYA 1Z5MA 2WMVA 3OBGA 4I6QA 2PVRA 3UQGA 3BQRA 2ZV8A 4ZTSA 3PVUA 3V3VA 3AMAA 4YHTA 3V51A 3BYMA 1PMSA 4QNAA 2JBPA 2REIA 4IWPA 2ZDTA 4UBAA 1SYKA 3V5TA 2JEDA 2IVVA 5EYDA 4D55A 3M2WA 5LVPA 4EYMA 1KOBA 3KB7A 3H30A 5HICA 4Z3VA 1B55A 3GU4A 2H7EA 3NEWA 5M08A 2GTMA 5L8LA 4GT5A 2C69A 5EYCA 4QP6A 4BDEA 3W55A 4EOMA 3PZDA 3A7IA 4CFNA 5AP5A 3HDMA 3NWWA 3CQUA 3ZSGA 4MF0A 2R7BA 2R3IA 4KS8A 4ZTQA 3ANQA 5D41A 4CFFA 5E8WA 5FEEA 3FMDA 4MX9A 4W4YA 4ZS0A 5IEYA 3W2QA 1WVYA 4WRGA 3RAKA 3P08A 5AV1A 5JRSA 4ZS4A 3SD0A 4NYEA 3ORMA 3QKMA 2JKKA 3LFQA 4H36A 3VIAA 4DGLC 4R7BA 3G15A 2XM8A 3ULBA 1DAYA 3DJ7A 3RBWA 3C4FA 4K17A 3T9IA 4CMOA 3QD4A 4GPTB 2NRYA 2Z0OA 3F61A 2GHGA 1WMKA 1XO2B 4I1ZA 2CNUA 2ZAZA 4YJOA 2V76A 4L9IA 5IQCA 4F65A 1YOLA 3A98B 2LULA 1JLUE 4QMUA 3MA6A 3COKA 4WG5A 5HVYA 3EOCA 2HXQA 3ELJA 5CVFA 3S2PA 3ENMA 5HQ0A 5J9YA 4BI0A 4D1ZA 4D4RA 4TY1A 2IN6A 2QO7A 4Z9LA 4FR4A 3OS3A 2ZM1A 5BQ0A 2ITWA 4U7ZA 3TZMA 2XUUA 4CXAA 2O63A 4QOXA 3Q3BA 3HL7A 3Q6UA 4DGNA 2VWVA 2F7XE 3PXYA 4O86A 4Y94A 3PJ2A 4PL4A 2Z7QA 5C27A 3FSKA 2QLUA 4IX3A 3L8VA 4YJNA 5AAGA 3WZDA 1PXMA 2GS7A 5AP0A 5FGKA 1J1BA 5AV0A 3UIBA 3R8ZA 3IDPA 3PA5A 3SXFA 1U46A 4RA5A 3CIKA 4QTBA 4LQMA 4FSZA 2YWVA 5KMLA 3A7GA 5GJGA 4QPSA 3RI1A 4DITA 4ITHA 3RWQA 2VUWA 1S9JA 1PMNA 5A3XA 5D10A 4PX6A 4EI4A 5E8UA 4BDIA 4X3FC 5C4KA 4HCUA 4LV5A 3UC4A 4M68A 3VHKA 2BMCA 3RPOA 2B9JA 4NY0A 2QU5A 5CLPA 3WILA 1XX0A 4O83A 4RFYA 4FL3A 2Q83A 4GKHA 3LXKA 3QTUA 3VJNA 1PXNA 2ZM3A 5A4EA 2XRUA 1BMKA 4EOJA 1XWSA 3PFQA 3U9NA 2YM3A 3FI2A 5L8JA 1QPDA 2NRUA 3EQBA 4RWIA 3DCVA 3W18A 4EH9A 2HY0A 4CCUA 3HV7A 3C50A 4WSQA 1PXKA 4F64A 2UZTA 4N57A 2UZLA 4G6LA 2VV9A 4B8LA 2YEXA 3BI6A 3ZTXA 3Q96A 5LOHA 3R73A 4RMZA 3NMUF 1IR3A 3WF5A 3LFFA 4EORA 5HLNA 3FM8C 3U87A 1LW3A 4EQCA 4Y85A 2NZ8B 5B7VA 4QNYA 2W1GA 5H2UA 2QODA 5J1VA 3E92A 4OAUC 4RFMA 4UALA 4F1TA 1WGQA 3BU5A 3D5XA 2BVAA 3HP2A 4IH8A 4YJQA 3OEFX 5L2SA 5J1WA 1G8AA 2WTIA 3E88A 3PJ1A 5KHXA 4FNXA 2OU7A 5J95A 2MFQA 4IOYX 3F5RA 3ZLXA 2GCLA 3Q52A 4FSMA 1H25A 3NYXA 2Y4IC 1DDWA 2RIOA 4QP3A 4GUEA 3LCSA 1FOEA 4YHFA 2PE2A 4HHVA 2W06A 4GK2A 2DHIA 4LL5A 5E91A 3D4QA 1OKWA 3F82A 4CTCA 2VTJA 4BICA 1AQCA 4S2ZA 3BHYA 2AL6A 2YF0A 2ZM4A 3OCSA 3TI1A 4C0TA 4YUQA 1ZWSA 3PG3A 2UZRA 4RIWB 3RK5A 3QTRA 4C38A 4CYEA 1J3HA 4LOQA 5CLLB 3QWKA 4HJOA 1URCA 2ERZE 4CT2A 4D1SA 1CKIA 4FTLA 4RLKA 3A7FA 3VUMA 5ANJA 4R8QA 4WSFA 2BZKB 3FMMA 2J59M 4AA0A 4U80A 3VF8A 3FY0A 2WTKC 1M14A 4ZZNA 4YLLA 5I4NA 2ZPYA 1SNXA 2WPAA 4NM3A 4BVUA 5CEKA 2YIWA 3W10A 2R3GA 3BHUA 3O8PA 4FC0A 4AZVA 3C4ZA 4BHNA 3KRLA 5D3YA 2YIYA 1WG7A 3NNXA 3VAPA 1VYZA 1NU2A 5JP4A 3FXWA 2C1BA 4X0MA 3UQFA 4KINA 4M13A 5HGIA 3TZ9A 4AT4A 3SXRA 4C4EA 3THBA 5DBXA 4ORKA 4NH1A 4GMVA 3D5UA 2C6OA 3C7QA 2OF2A 3IKAA 4TW9A 2D9YA 3VWAA 2GQSA 2DKQA 4TZRA 4EH2A 3G90X 4WRSA 3R2BA 3DBDA 3HDNA 3FZOA 3NIEA 2W9ZB 3P0MA 1BWNA 1FHOA 3FLSA 2FJLA 4QQJA 4FMQA 2BIKB 2XS0A 5C03A 4CFUA 5AUUA 3TXOA 2DYNA 3AD5A 2QKWB 1YOJA 4YJUA 3R28A 3DXEA 1XD4A 3F7ZA 4FSNA 2JAMA 4IVCA 4PMMA 2WOUA 4F6SA 5AX3A 4ARKA 1BKXA 3ZHPC 3QIJA 4FVPA 5BVKA 3I5ZA 4AT5A 4EKKA 1ZAOA 4JOAA 2C4GA 4BKYA 3OP5A 3PG1A 3AD4A 1PHKA 3BHVA 3OHTA 4NWMA 3V5QA 1DDMA 2PSQA 4GT4A 4IVDA 4YNEA 2QR7A 5IKWA 3DXNA 5BYLA 4KIKB 3RK9A 2BZIB 3PP1A 1X86A 4O7NA 1FGZA 4RIXB 1UNQA 3SVVA 4KIQA 3DS6A 4EH7A 3QWMA 3WI6A 1W82A 3NPCA 2YRYA 4XYFA 1ZYSA 4HDOA 3WARA 3L8PA 4ITIA 3VBYA 4O82A 5J8IA 5EI6A 3KN5A 4FV8A 4P5QA 2CAYA 2PULA 2CHLA 2QO2A 2W1CA 4FIGA 3TDVA 1W83A 3A99A 4YLKA 5TF9A 1E1VA 3E62A 5FLFA 2AEHA 5FQDC 2VO6A 4NCTC 2YSZA 2VO7A 2YM7A 4G3EA 5EM5A 4EKLA 4BDDA 4DEIA 5F1ZA 4MTAA 3QALE 4A07A 1Y19B 4QMNA 5HCYA 3MFUA 4AOIA 3VS7A 3MPXA 3QRIA 3GYOA 3AOXA 3MY1A 4FIFA 5IMXA 3FJQE 1UNHA 4GZUA 3LXLA 3VW8A 3C51A 4O0VA 2ITNA 2W5AA 4FTTA 2YDIA 4NTSA 4A5KA 2RFNA 1V89A 4AUAA 4O7TA 4OR5A 2YDJA 4AG8A 1ZC3B 4DBXA 3HAVA 1UVRA 2RSVA 4O0YA 3VVHA 4O7SA 5LMKA 2H7DA 3QF9A 4G31A 2I1MA 2VWIA 5C8KA 1V0PA 5FXSA 2GHMA 4LRJA 4FL2A 4BBFA 4BZOA 1WI1A 3I79A 4X3FB 2GCJA 4JG8A 3HKOA 3QKLA 4QMWA 4DFXE 3ZO2A 4MEDA 1KSWA 4G9RA 4DFZE 1A48A 5IQAA 4DEEA 4EK3A 1EVHA 1H1SA 2YZAA 5K0XA 5JZNA 4L67A 3O0GA 3V5JA 2ITPA 4QTCA 4F09A 4YNOA 3QUDA 1UNGA 4ZTRA 4NFNA 3OCBA 1CMKE 4XG7A 5KMOA 3WZKA 4QP8A 4D4YA 3LFDA 4AW1A 2DTCA 3MFRA 4AXAA 4QMTA 4RT7A 4EONA 1RDQE 2E2BA 3ZO4A 3BKBA 4EOPA 4FV4A 5E8SA 3DKFA 4AZSA 3PIXA 2P2IA 3TTIA 3V04A 2B9HA 4Z16A 1R3CA 3QZFA 3RAHA 2Y8GA 1PFJA 3FWQA 2COFA 2JIIA 3QU0A 3DU8A 4FODA 4RX8A 2ETMA 4D4SA 5L2TA 1LB1A 4NM5A 5AP2A 2VRXA 2QKMA 3REPA 3DK6A 3P1AA 5J5TA 4IC8A 2PZIA 3U9CA 4R7HA 2UZNA 2RL5A 4FNZA 2BIYA 5L6OA 5A4QA 3E87A 3NW5A 3AMYA 4FTMA 4YBKA 3TWJA 4HPUE 1ZYDA 1R0EA 3BIZA 2HOGA 3R9OA 2JDRA 3DJ6A 3RK7A 4AW0A 4BDKA 1PJKA 3EZVA 2B53A 4KHBB 4C2WA 3MDYA 4HVGA 1H24A 1W98A 3MVHA 2CY5A 4E73A 2DLWA 1G5SA 3LJUX 2QR8A 4HYIA 1MRVA 5IU2A 4KHAA 4WJ7A 2W4OA 3ZDTA 4PNIA 4EYJA 2LOZA 3KF4A 5B2KA 4G34A 3S4QA 2J9MA 4YJVA 4EHGA 5JLJB 5JKGA 1JBPE 4HNIA 4MHAA 5CEIA 3HECA 2UW7A 2VX3A 5DEYA 3GQIA 1Z57A 3BLQA 5FRIA 1KE7A 4D5HA 1IAJA 3TUDA 3ORZA 1Q3WA 4MQ1A 3RPSA 3TKHA 3MDBC 4DC2A 3A4PA 3ERKA 3RP9A 2V22A 1UU8A 3LCTA 2IPXA 3TKIA 5ITAA 3LE6A 2YZLA 4I92A 4GN1A 1K2PA 3ZC6A 3GXLA 4IAIA 1L8TA 2CJMA 3P78A 4FSWA 4JR3A 4R77A 4EQUA 3F2AA 4O96A 4FSYA 5DH3A 3M1IB 2W2WA 2X8IA 3F0WA 2WO6A 2VAGA 3WF6A 1REKA 1URWA 1OIUA 1U5DA 3TCPA 4IE9A 4FT9A 5DT4A 4IB1A 2FH9A 3QD0A 1YDSE 3EB0A 4LGHA 4CT1A 5I9VA 4O84A 5AP3A 1Q8TA 5KZ0A 2VTNA 2R3KA 1P5EA 4H3BA 3PY0A 4M3QA 1Q8YA 5JT2A 5J9LA 2LOXA 5HO6A 4D2SA 3N4UA 3HLLA 3QQKA 4QMSA 3UOHA 4AT3A 3D0EA 3QCQA 5EKNA 4IAPA 4LL0A 4DGOA 4YZBA 3PWDA 4S34A 4YJSA 2KUPA 3AT2A 2GDOA 3OXTA 4EOIA 4O81A 3U55A 1KOAA 4ITJA 3DKOA 2IW6A 3KMUA 1BUHA 2EXEA 1JNKA 3HRCA 3LCDA 3FMKA 4HYSA 3SG9A 4KABA 5IA0A 4PDYA 4QT1A 1YKRA 3DT1A 1UKHA 2UZEA 2OW3A 2OXDA 2XKFA 4BDAA 5D3XA 3PDTA 4BDCA 3OY1A 3SX9A 2WXVA 3S1HA 4FTJA 4TT7A 5FP5A 3HYHA 1R0PA 3HVCA 4A6FA 1ZYLA 4PF4A 3IECA 1NA7A 2C3LA 4QMXA 4AZFA 4MBLA 2EXMA 2VTPA 2R0DA 4KRCA 3R00A 3ZEPA 4FT3A 4C36A 4GIHA 3QTIA 3IVFA 1MQBA 2XKCA 5FD2A 3Q4CA 4H3PA 2R3QA 5KZIA 3QZGA 1OL1A 4O2PA 2B1PA 3JYAA 3R63A 4GFMA 4XP3A 5HLWA 4GKIA 3RKBA 3FI4A 3DOGA 2I0VA 4WBBB 1OKZA 4BR3A 4ZMEA 2WOTA 3WZUA 1CKJA 1IASA 3VBQA 3VW6A 4AA4A 4O22A 4ZTLA 4EOSA 4RJ8A 4FG8A 1FGIA 5HEZA 3GCPA 4MF1A 4ANNA 4C57A 5KUPA 3KXZA 4EUUA 5FI1A 4PTGA 5C8MA 2XP2A 3DV3A 2HELA 4YTFA 4APCA 4YZDA 2BRNA 4BKZA 3O7LD 3WF7A 2I7QA 4N4SA 5GZAA 3H0YA 2X7OA 5JK3A 3TZ8A 3A4OX 3GBZA 4DEDA 2HZNA 1UU7A 2V0DA 2VO3A 5CEOA 2X81A 4IX4A 4IAFA 1Q62A 3AC5A 3R9RA 2XYNA 1G8SA 4YJPA 3FBVA 4AOTA 2QC6A 4ZK5A 2X9EA 2GJYA 5BVEA 1RQQA 3OXZA 4EBVA 1LR4A 5B2LA 1BI7A 2EUFB 2QHMA 4BTJA 3SW4A 1YHSA 5JN2A 2VTOA 5LOPB 3VUKA 2RVBB 4R3RA 4QMQA 4I0RA 4FV2A 1PW2A 2JC6A 3A8XA 4YZ9A 3UIMA 4L6EA 4F7GA 1YI6A 4JT3A 4BL1A 4C33A 4EK5A 4K8AA 1YXUA 3W32A 3ZSIA 2HIWA 4HB0B 3EFLA 3DB8A 5BVFA 3WA0A 3DBEA 1GAGA 2I5CA 3CY2A 3K3IA 4FK6A 4H39A 3B8RA 3ROCA 2K2JA 2DWBA 5AP1A 2QOIA 3MFTA 4DLIA 5DE2A 3TNQB 2M38A 2VO0A 4OLIA 4I23A 5L2QA 2VRWB 2P0HA 4EMOA 3W33A 2C6DA 1MIXA 4JX7A 4W4WA 4BWPA 1WBNA 2PVJA 4E20A 1H0VA 4S32A 3OW3A 4TN6A 1TXDA 3FSSA 3PIZA 2WTWA 1DM2A 3Q9YA 3GU5A 1KUTA 5FEDA 4HYHA 4LUEA 2UVZA 5E8VA 3VUIA 5HNIX 1OITA 4YO4A 2ESMA 3F5GA 1MRUA 3OMVA 2IZRA 1WBPA 3FHRA 3PZHA 4FUYA 3WE8A 1IA9A 4FKTA 4N70A 1CM8A 3EQPA 1WBSA 1Z87A 3TV7A 3ZZWA 2GFCA 2WAJA 3CS9A 1CSNA 4GG5A 4FKVA 2JDSA 5GJFA 3OD6X 4IZ5A 2COAA 5DIFB 2V5QA 5IQFA 2KULA 2C6LA 2XJ1A 4USDA 1ZM0A 5EHLA 5IMEA 2XKEA 5HBEA 3LQ8A 2XIRA 3VRYA 3C9WA 3DBQA 4CFXA 1TJ6A 5KQ4A 2V55A 2YLFA 4NCTA 3ACJA 3AC2A 3CTQA 3L8XA 3DXCA 2G35A 2R3FA 4KA3A 5GNKA 4F08A 1SGHA 4HAXB 4FEWA 3NAXA 4AZWA 4EJNA 4B6HA 3GCSA 2PZPA 5I9UA 3UIXA 4JBOA 4ALUA 4F1OA 1YXTA 5HTBA 4Y8DA 3QGYA 5DG5A 4ZP5A 4AE6A 2PVMA 4V0GB 4F9CA 4WNKA 4K77A 3SOCA 3HP5A 3G0FA 5IG1A 4RWLA 3DZOA 3QHRA 3BE9A 3UZPA 3W2OA 4LRKA 4XMOA 3ZOSA 4YSJA 3NUPA 5D1JA 3TG1A 5DA3A 4O7WA 5F94A 5JMSA 3FZRA 4MKCA 4N6ZA 4HYUA 4JL9A 5KBQA 3QCXA 5L2WA 4E5BA 3E63A 2A4LA 3HMPA 4CHMA 3Q6WA 3G9WA 3SV1A 2R9SA 3MH3A 4G3CA 4YONA 2BDJA 5M4UA 4O0UA 4M67A 4HZSA 1JKKA 4O6LA 5CSPA 2XBAA 1UNLA 3VQHA 3H9RA 3PJ3A 3PPKA 2YM5A 3NAYA 4B7TA 4F6WA 4FV9A 1WBVA 2HK5A 4ZLYA 4WUNA 3CQEA 4C4JA 4K2PA 5B2MA 4PTEA 5CLQB 2QOKA 2WQBA 3CKWA 3R9DA 5IH5A 4GS6A 4RG0A 1M2PA 3HNGA 1M52A 2WTDA 2Y4IB 4NSTA 1FBNA 1K9AA 4I5CA 4PTCA 1E5WA 4ZSEA 2X8EA 4HAYB 4NT4A 4RQKA 2QOLA 2C6MA 2YABA 3NS9A 4IHPA 4IX5A 4NEUA 3DNEA 3SOAA 4CHJA 3CR0A 4V04A 3ORIA 5HE1A 4ZSLA 1W7HA 2Z8CA 3BBWA 2YN8A 1F3MC 1FMOE 4BYIA 3GQLA 2YJSA 3MPTA 3PPJA 5LVMA 3ORNA 3M11A 4QYYA 2X39A 4QMZA 5HESA 5IZFA 1J91A 4XEYA 2J0MB 3QC9A 1LEWA 4PL3A 2QONA 1H08A 3FKNA 4W4XA 2Y6MA 3R1YA 5E1SA 4ANMA 5CF6A 2YAKA 2PUNA 2VWZA 5I0BA 3IOPA 4UZDA 4U40A 3PXKA 3BQCA 1QPJA 1V5PA 5LVOA 3MW1A 2DKPA 4XP2A 4BDFA 4ZTHA 2I0YA 5AAFA 3ORTA 4FKPA 5DT0A 2QO9A 5I9WA 4FTAA 4HAVB 3SYXA 3UZTA 4P90A 3OTVA 1H07A 2YS5A 3E8CA 1WJMA 4YPDA 3ZUUA 4CZYB 3EJ1A 2LG1A 5A6NA 2CKOA 3V8WA 3RZBA 5HG7A 5IH6A 3H9OA 4CLIA 4BGQA 1BYGA 4KVGB 2HZ4A 3PJ8A 1ATPE 3SGCA 4XWXA 4F0IA 3AGMA 4A9UA 2W17A 3FEHA 3FQHA 4JQEA 4F63A 2XNBA 4BCGA 1UKIA 3A61A 4D1XA 4KAOA 1JQHA 1GZOA 3VNTA 1OPLA 4E3CA 1Q24A 1XJDA 3ZEWA 3TCAA 1O6KA 3ZC5A 3TJCA 3OW4A 4KB8A 4KBCA 4RVMA 4C37A 3UOLA 2F7EE 4FSTA 4FTQA 3SHEA 3EN6A 5JQ8A 4O7RA 1R1WA 3DXPA 1K3AA 2WB8A 1SM2A 2WMRA 3QTZA 2ROVA 3IW5A 3NZ0A 3UBDA 2AYPA 4OBPA 2OZAA 4FZAB 3RJCA 2PTKA 4ASXA 3ORLA 5J3QA 5M51A 2PK9A 2RFDA 4UMPA 4L7SA 3VOQA 1OL7A 4PPAA 3FSFA 2ACXA 3A2CA 3DK3A 4FVRA 1VZOA 2BHHA 3UPXA 1KZ7A 3KRXA 3WIGA 4IM0A 4TNDA 5LWNA 2UZOA 2Y9QA 3LM5A 1XBBA 3GC7A 3QX4A 4O6EA 1OM1A 2IVSA 4RIOA 5KE0A 3RALA 4ASZA 4R1VA 4YJRA 1NXKA 4ACCA 3T06A 4CZUA 1ZYCA 3ZFYA 2YERA 2CGWA 4CQEA 4FKSA 4JRNA 1X05A 2P3GX 3LQ5A 5HCZA 4C7TA 1BL6A 5CU4A 1GZNA 4KKHA 3D8FA 3COIA 2PMIA 4RSSA 2WU6A 2PE1A 4QP2A 3ULZA 1FAOA 4ZZMA 5DLSA 4IB0A 3DZQA 4G3DA 4DFBA 2GCDA 1FGYA 3X23A 4KIKA 2OIQA 3PJCA 3QC4A 5CAUA 1YWNA
chains in the Genus database with same CATH superfamily
4HGSA 5CZIA 3PTGA 1U27A 2F2CB 2XKDA 1AWEA 3ZH8A 3A8QA 1YXXA 4ZJVA 1YWVA 4FIIA 4XNEA 3E5AA 3WF8A 2C3JA 2R3MA 5C8NA 2W1FA 1Y8YA 3NNVA 2W9FB 4R1YA 4MAOA 4JAIA 3QXPA 4CKIA 2I6LA 4ZTNA 5IDNA 3IW7A 4GL9A 1T77A 4BCPA 3ZRMA 3UO5A 3ODXA 4D0WA 4EUTA 4TYGA 4CNHA 3EFJA 4MXYA 2J0JA 4RA4A 2CNQA 2I5FA 4F7UP 1HOWA 1FMKA 4A6KA 3KY2A 4MNFA 2XVDA 2F57A 3GI3A 1W84A 2PVYA 4ACDA 3KN6A 1GOLA 3KFAA 5FP6A 1KE8A 2R3PA 4FV7A 2BZHB 1OL6A 4XG8A 2UZBA 4O4DA 3KY9A 3ZLSA 2HENA 4O27B 4XLIA 2OSCA 3IG7A 4M84A 4C34A 2ETKA 2YFXA 4LV8A 3HA8A 1LEZA 3QYWA 4JS8A 3LFEA 3LJ0A 4XBRA 4B6LA 4DH8A 4YURA 5KO1A 3V6SA 2VZ6A 4XUFA 2XANA 3O23A 4JVGA 2GNLA 3NWDA 1M7NA 5C1QB 5M4YB 4F9BA 2CDZA 4K2OA 2R0UA 5E90A 3PWYA 4G6NA 4TTHB 3LLTA 4W9XA 5E8XA 5H8BA 3TJDA 4ZRKA 1UEFA 3NLBA 4FI1A 5LCKA 3NCGA 4CFVA 2I1KA 5LG4B 2FSLX 3PSCA 4MT7A 4JAJA 3FC2A 3ZU7A 2X0QA 1ZLTA 3TL8A 4G6OA 4KNBA 3B2TA 1SMHA 2C5XA 4JDIA 3QQHA 4IDTA 3OT3A 2YM4A 5ANIA 4OT6A 3RCJA 4KIPA 5TE0A 2NP8A 3R02A 5I3RA 4FTOA 1P5TA 1WBOA 5HVKA 3UVQA 4EOLA 1WCCA 4J52A 1U5QA 4FKOA 3D9VA 2O64A 2ZMDA 4WUAA 5IQBA 4Y83A 3QRTA 2O8YA 2IFSA 4DE4A 4H1JA 4OTIA 4KS7A 3KRRA 3TEIA 4CG9A 3IW4A 3IW6A 3BYUA 3IO7A 3N4TA 3VULA 3UYSA 1WFCA 2JKMA 3ZCLA 3DNDA 4EH6A 5AV4A 4O7VA 2PZ1A 2UZUE 3F2NA 3EH9A 5AP6A 1XODA 4PRJA 4ENYA 1XR0B 1WJ1A 4Z2MB 3HAMA 3TTJA 3PY1A 3EKKA 2OI4X 3GC9A 2WQOA 3I0OA 4IXPA 5HG9A 4FF8A 2QKLA 5EM8A 3RHKA 4IAKA 5K9IA 1ERKA 4U44A 3BJIA 4FT0A 3D15A 3LKMA 2QOFA 2WQMA 5DR9A 2WMBA 2O5KA 3QUEA 4KHOA 3KL8A 3F5UA 3TZ7A 5CY3A 3UO6A 1H00A 2BRHA 3VBWA 1Y6AA 4BKJA 4WNMA 3JVRA 3MSSA 2OFUA 2C6TA 4R3CA 4ZJJA 5C6RA 3POOA 3C5UA 2CRFA 2ITZA 5E92A 5FDPA 4DCAA 5J9ZA 2QHNA 2ETRA 2UZWE 4CCBA 1STCE 4RVKA 4TYIA 1V88A 4CD0A 3AGLA 2UUEA 4OTPA 3CEKA 4MCVA 2UZSA 2GTNA 2XMYA 2VWXA 3DAKA 5IH4A 4UWCA 5HU9A 3EQIA 3RINA 5E4HA 4L3LA 1W1DA 2CKEA 2KGXB 4A06A 3PUFC 4BZNA 3QGWA 2FA2A 2R7IA 4I21A 4ACHA 4A4LA 2C5OA 2QG5A 2X2MA 3QLGA 2VNYA 4NJDA 2C6KA 1P3RA 5HX6A 2WNTA 4FTRA 5EW9A 2YVCA 1E1XA 3ITZA 3K2LA 4HGEA 5E9EA 4DTBA 2B55A 2RRFA 1J7LA 3S95A 4G3FA 5T68A 5KBRA 2ELAA 3CLYA 3PRFA 3UYTA 5HZNA 2YA9A 3Q9WA 2JAVA 3UOKA 3S00A 1NW1A 2GNIA 3C0HA 3GEQA 4A4XA 4A9YA 4YGAA 3LMHA 2N0YA 4DX90 4EQMA 2IEWA 4LRMA 1PXOA 5JEBA 2BILB 2K8EA 4CFMA 2ZB0A 3CY3A 3SRVA 1FVRA 3FL5A 3F3WA 2IVTA 4GVAA 4MD7E 3KXXA 4HB3B 2PUPA 2WMXA 3VS0A 2QOHA 3HW2B 2Z59A 4QDEA 4C3PA 1OGUA 4RLLA 4RX5A 3N4VA 3FXZA 4RQVA 2DS1A 5FG8A 5A4CA 4WVFB 4RBLA 3FAAA 2RGPA 3LXNA 4WBOA 5I2SA 4M69A 3R8LA 4DFYA 2UVXA 4ALWA 2Y0AA 2CSNA 4OGRA 5J79A 4CKJA 3BWFA 3P86A 5GOWB 3GFEA 3FDNA 2FSTX 4RFZA 2D9WA 4EK6A 4EWHA 3UJGA 1QMZA 5JHHA 3BRBA 4KSQA 2RFEA 5DOSA 3LFNA 3W0QA 4QQCA 4F4PA 4LOOA 5BX0A 4AFEA 4FVQA 1OGYA 1VJYA 5LVNA 3Q5ZA 4IX6A 3MJ1A 3IPHA 5FM3A 4O4EA 3G33A 2Z02A 4AQCA 3DK7A 4PPBA 4RRVA 1QCFA 4C62A 4AW5A 5JGDA 5K4JA 2W2XD 5DN3A 3FI8A 3OFMA 4R5SA 1N3HA 3OANA 2CY4A 2F7ZE 1W2CA 2OO8X 4FX3A 4JDJA 2CKQA 2HAKA 4I94A 4XG6A 2WD1A 4RPVA 5CF8A 3OTUA 5CVGA 4X2KA 4ZRJA 4OT5A 2L1CA 5H8EA 1GZKA 3FQSA 4DH1A 4GK3A 1Q61A 3W8QA 2RKUA 2Z7RA 1FB8A 2HCKA 5GZ9A 4JDHA 1ZYJA 2XK6A 2PVNA 4ZLOA 5CNOA 2C3IB 2G1TA 3F66A 2P33A 3FLYA 3MN3A 4Y5HA 2ITTA 2B4SB 3C4WA 4JQ7A 4W8DA 3RNYA 3NWAA 1QPCA 2KTYA 1QPEA 3IW8A 3VQUA 2OQBA 2QNJA 4IADA 1REJA 4MK0A 4F0FA 1H1WA 2W1ZA 5F95A 5HIEA 3KULA 4Q9SA 1H01A 1KV2A 5M07A 2JDTA 2W4JA 1WAKA 3SNHA 1F5QA 4QDVA 3C0GA 4FBXA 3EZRA 3I81A 4ACMA 4UV0A 4Q9ZA 4HDQA 1OI9A 4HNFA 4H58A 2Q0BA 2V7AA 4J8NA 4E4LA 4FT5A 2DUVA 4CKRA 3OWPA 4B9DA 2YDKA 3LW0A 5FEQA 3ZUVA 5J7HA 4N0SA 4YZCA 1UV5A 5AP4A 4FKRA 4PP7A 3P4KA 1QC6A 1FHXA 2ELBA 3NCZA 3P79A 1TFFA 2ZKMX 5FTGA 5DMZA 4APPA 2D4QA 2VX1A 3KXNA 3LCOA 3F69A 3F88A 3TN8A 4EBWA 4W8EA 2GS6A 4Z2NA 3KIOC 4HATB 4YLJA 3FXXA 3K3JA 3LCKA 3CXWA 5HBJA 4E6DA 5EHOA 2RNRB 2E9OA 4LMNA 1IEPA 4YSMA 2A2AA 2CCHA 2D9XA 5KMNA 3F3ZA 1W2FA 4IB3A 2GQGA 4R78A 1XR1A 4ASEA 3OC1A 5IPJA 3VS3A 3U54A 3UMXA 4DINA 4D9TA 3OT8A 4B0GA 2J6MA 5HCXA 2AUHA 4K33A 4P7IA 1U2BA 2PZRA 3PVGA 5HD4A 3M1SA 2X7GA 3P7AA 5CT7A 4ID7A 5AEPA 2R5TA 4BTFA 5CAQA 5CENA 4Y46A 4IFSA 3QCYA 4XCUA 2VTLA 2PMNX 2YIQA 3EFKA 4YO6A 1TQIA 3VUGA 3ODOA 2P55A 3QRKA 2X2LA 5FBOA 4E4MA 2PMOX 1QQGA 3KMWA 3MB7A 3OROA 5JZJA 4IJPA 4IM3A 4IEBA 3KGAA 5AM6A 5JRQA 3DLSA 4FIJA 1X11A 2FO0A 1OUKA 2Y4PA 1IRKA 3BYVA 2ADZA 4NTTA 3HRFA 3DQWA 3TT0A 3HMNA 4NUSA 3RVGA 3QA0A 3CPBA 3NUYA 3QL8A 3BE2A 1ST0A 4HCVA 1OY2A 4JQ8A 4QJ5B 3IDBA 3BGQA 1H0WA 5TR6A 2B9FA 5F9EA 3SRVB 3FE3A 4MXZA 4B99A 4I24A 5AUYA 5GHVA 4BZDA 4Y73A 3LM0A 5H3QA 5BUJA 2CNVA 4CRSA 1U54A 3OWKA 3HV6A 4E26A 2Y8FA 4G1WA 4DYMA 4ANOA 3BYSA 5KQ1A 4FGRA 5EG3A 1J7IA 2FYSA 3B2WA 3IS5A 3ZBXA 2D2QA 4FEQA 1TQZA 4CRLA 3ZBFA 5IQIA 3DB6A 3R83A 5J5SA 2HE7A 4Z55A 3SDJA 4KSPA 2VTQA 4GFOA 1ZZLA 4JJRA 4YJTA 2YM8A 2Y7JA 4GJ2A 4M66A 4AGDA 4JMQA 4MNEB 5CSWA 3MV5A 4I6HA 1EH4A 4I6LA 5DRDA 3O2MA 3E7OA 3CE3A 3I6UA 5L8KA 3RZFA 3P7ZA 5HO8A 3AU5A 2XRWA 3CPCA 4OTGA 3HSAA 1MI1A 3K54A 4QYEA 3NVKI 5BUIA 2UZDA 1MUOA 4IFCA 4L45A 4NW5A 4U41A 3RWPA 4U9AA 4K11A 5C5BA 4FSRA 3QHWA 5IF1A 3UQCA 3FC1X 3MJ2A 2N23A 2P0FA 3MA3A 1OMWA 4BCMA 1Q3DA 1YWRA 3OEZA 3VC4A 4C4HA 1NI2A 3TACA 1PMUA 4M97A 2CODA 1SNUA 2G9XA 4PDSA 3BLRA 4OBOA 2F49A 4CV9A 4E6AA 1V0BA 3FZSA 4GVJA 2XJ0A 3PP0A 4U8ZA 4WOVA 5F20A 4UN0C 3G9NA 5HLPA 3VS6A 3QFVA 2ZV9A 2FB8A 3QZHA 4L01A 1X8BA 3Q53A 1W8CA 3R2YA 4OTHA 1ZZ2A 3BGPA 3R7IA 5HKMA 2ITOA 4HAZB 4AS0A 2X0OA 4J7BA 3NR9A 4ASDA 3U6IA 2JP2A 2EB3A 1Q8UA 4M0YA 4QMPA 5HTCA 1K5GB 3CSVA 2AC3A 4O21A 3KKVA 4U5JA 3CBLA 3QZIA 1G8KA 3RCDA 3PUPA 1OIYA 4DEBA 1K5DB 4IANA 5IA5A 4X3FA 1U59A 5IQEA 1TZDA 4FYOA 4WA9A 5ETCA 3T3VA 3F3UA 2D9ZA 2GNGA 5G6VA 1PXJA 2FSOX 4FKWA 5TO8A 4XV2A 3DGKA 3Q2MA 4O0XA 4DEHA 3ZXZA 3KCKA 2J7TA 4ZOGA 4ZAUA 1H8FA 1ZOHA 2XB7A 3L9PA 1NT2A 2XM9A 3D2IA 4LGGA 4I93A 4DHFA 3FMHA 4FTIA 4I0TA 5H9BA 1RRPB 3GENA 1PRYA 3HK0A 2C3KA 1P2AA 5M4FA 4MD9E 4IJ9A 4BY9E 4RIWA 5HE3A 3QWJA 3TKUA 5KMKA 2XNGA 3EYGA 2ZDUA 3WIKA 1JKLA 4S33A 2KR0A 3R7UA 4FTCA 4GUBA 1ND4A 4JLCA 1M17A 4UMQA 1U5RA 4C8BA 3PP2A 4ANBA 2CN5A 2F9GA 4DG2E 5M4CA 4TYJA 4MXAA 3UDZA 2OIBA 3AXWA 1XHAA 2CCIA 4J96A 3R7YA 3V8SA 4BGGA 2F2UA 3ODZX 4UXQA 2KIEA 3O71A 2RLOA 2V62A 4RVTA 5FTQA 2XNNA 4V01A 5DIAA 4ZXTA 4ZY6A 4BCOA 4CMUA 3MPAA 1V61A 1ZMVA 2OIDA 5DNRA 4JRVA 5IQDA 3ZDIA 3CCNA 2P0CA 5E8ZA 3U7DA 2WMSA 2ZB1A 4XRJA 3NFGB 4W9WA 2PVHA 2YCFA 3IK3A 5FM2A 3U8ZA 4C4GA 3R6XA 4V05A 2CPKE 3OCTA 2OZAB 5AA8A 5EHYA 5JFWA 1MAIA 3BGZA 1ZC4B 2GNHA 4C2VA 5LONB 2IWIA 2YCQA 3KQ7A 5EQPA 3D8EA 2J2IB 4CTBA 4HAUB 3EQFA 1T46A 3MS9A 3NUSA 4HGTA 2XEZA 3E64A 3V01A 2BALA 4WSYA 4OTDA 2XAOA 2PVKA 3NYVA 2YISA 1Y6BA 3CJFA 3VUHA 4TXCA 3D83A 3AC4A 4G5PA 4RZWA 2W4KA 2HYYA 4FTNA 3ATTA 4D0XA 1OKYA 4EOKA 3ET7A 3KXHA 5DI1A 4EJ7A 2RF9A 4I0SA 5DR2A 1TQMA 4G16A 3KK9A 1UNRA 5CAVA 4EWQA 2D11A 2OBJA 3G2FA 2GNFA 2CLXA 3D94A 4YC3A 4YTHA 4MXXA 2OJIA 4FEVA 3TNWA 3R21A 4TWOA 5EOLA 2FSMX 4PDPA 1OB3A 3ZO1A 3NYOA 4KAXB 4RIXA 2XAMA 2RUKB 4QTEA 4JG6A 3ZRLA 2C6EA 4K18A 4RC3A 3R7OA 3TV6A 3ZUTA 2A27A 2WTCA 2H8HA 2VGOA 3AJ4A 3DXQA 3P6AA 4CV8A 4D0NB 2V7OA 3FMLA 3Q60A 2W05A 4F9AA 1SHCA 3KA0A 3R7EA 2ONLA 3DFAA 5AJQA 3TW1A 3KXMA 1W0XC 2R2PA 2XBJA 3MH0A 4Y95A 3QXOA 3O51A 2JD5A 3HV5A 4CYJA 4HW7A 4GU9A 3RM6A 1SVGA 3GT8A 4CMTA 4FTKA 4EZ3A 4D4VA 5CYIA 5HBHA 2G01A 2QOOA 3PIYA 2YJRA 2R3RA 4OW8A 4L00A 1W1HA 2OH0E 1OIQA 2J0LA 1IAHA 3JR1A 4I5HA 5CSXA 5GIOE 2JIUA 3EMGA 4RVLA 4G5JA 4FL1A 4QPAA 5CU6A 3E8NA 1PMVA 2ITXA 2OJJA 4ZY5A 4PQNA 2QOBA 3ACKA 3AG9A 4UEUA 5BUEA 2YM6A 4DX8A 2OWBA 2YT1A 2PVLA 1PXLA 3FUPA 4KD1A 4I5MA 5G1XA 4ERWA 3SUZA 3EWHA 3U51A 3T9TA 4E5AX 3R7VA 4GMXB 1ZMWA 1JKTA 3OWLA 4IACA 4JR7A 4L46A 4ZSJA 5JFVA 4BFMA 2O3PA 1H10A 4U6RA 2XYUA 3ORKA 4J1RA 4WG4A 4G3GA 4WNOA 4YPSA 2X7FA 5BYZA 3C4CA 5HORA 3LMGA 4IMYA 3MH1A 4XRLA 3LFCA 4L7FA 5E8TA 5CAOA 2IZUA 5D11A 5I5ZA 1OPKA 2C0TA 1XH9A 2JFLA 4YZNA 1OECA 5A54A 1V5MA 1F0QA 1KV1A 4UMTA 4UZHA 5CI7A 2IYBA 3Q04A 3PVWA 4NK9A 4RJ6A 4BN1A 1EGXA 4FNYA 3LLAA 1M7QA 5DYJA 3UDTA 2YCRA 3Q2JA 4DA5A 1U5GA 4OSNA 4TKSA 4BYJA 3P7BA 5I3OA 1JVPP 4Q5EA 4BWKA 5AP7A 2CLQA 3U8WA 4FZ7A 4FUXA 2HW7A 3COHA 3QX2A 4I41A 4HPTE 4U81A 3DFCB 4ENXA 3TUBA 3BLHA 1MPHA 2KUQA 3N51A 1E9HA 3E8EA 2BAQA 3QCSA 3ETAA 2IZTA 2YIXA 4CLJA 1FHWA 3PLSA 1PXIA 5C9CA 2H6DA 5LMKC 5DHJA 3D8DA 4AW2A 4GRBA 3FQEA 4J53A 2W5BA 4HOKA 2YT0A 4ZJIA 4RX7A 1EAZA 2DN6A 4EL9A 4HZRA 3G51A 3KF7A 2W0JA 3FLWA 2UW3A 3HUCA 4K81A 3PSDA 4JG7A 3V5PA 5C26A 3ZRKA 2NMBA 5AR4A 2XARA 2W2XC 4NW6A 2BR1A 3EFWA 3A62A 1LP4A 3UNJA 1XMLA 2AC5A 3HRBA 2RG6A 4IM2A 2GMXA 2VNWA 1FGKA 2Z7SA 3NWFA 3UE4A 4CYIA 3OG7A 3Q32A 4L42A 1WVXA 4II5A 2QD9A 5HG8A 2XZSA 4BIBA 3QTWA 1Q97A 4GJ3A 1SVEA 2OK1A 3FKLA 5CXZA 5KNJA 5H8GA 1BTKA 1X1GA 3PXFA 4FZFB 2FGIA 4DDIA 4AOJA 4UMUA 1Q8ZA 2B9IA 3JY9A 4D2RA 3W1FA 1NTVA 4O0SA 1OVEA 2X4FA 1YRPA 4XP0A 5DT3A 5EKOA 2MDXA 3POZA 1OBDA 4RWJA 1APME 3UVPA 3P5KA 4FJVA 1GNGA 4I4EA 3I4BA 2BAKA 4F9YA 5FXRA 5JFSA 5L3AA 4BCIA 3JUHA 2YITA 3TNPC 4DAWA 3SO6A 1PXPA 4YHJA 5HX8A 5LCJA 2CMWA 4C0AA 4O2ZA 1P4OA 3WZEA 3KZ1A 4X6QC 3DTCA 1GC7A 5AA9A 4FNWA 5FBNC 1JAMA 4BBMA 3QTXA 4TNBA 3DAJA 2W1DA 3OXIA 4PL5A 4XH6A 1U5EA 2OTXA 2I0HA 3JVSA 4IAYA 3VS1A 3A8PA 1GIIA 3ZM9A 3VRZA 2HY81 2XIXA 3R1SA 5AR2A 4BI2A 3MH2A 1R39A 3PRIA 4N6YA 4O4CA 4WHZA 2XCHA 4DH3A 3G6GA 1DAWA 3OWJA 3OUKA 4L44A 2WMWA 3BCEA 1M2QA 3HA6A 3A8WA 5EI2A 3GC8A 1ZY5A 3FMEA 2Z14A 4PDOA 4OUCA 1FOTA 2HZIA 4IVAA 4CQGA 3UPZA 5LARA 1DI9A 5CF4A 3T8OA 2CGVA 1P6SA 2X6EA 2RG5A 3QAME 5EYKA 4FV0A 5HI2A 4EHZA 4UMRA 2G2FA 5HO7A 5KHWA 3EN7A 4GXBA 4MXOA 5HVJA 5D27A 4MWHA 5AR7A 4L52A 2XCKA 4A9RA 4X2GA 4GV1A 2IG7A 4F70A 3CGFA 2UZVA 3U12A 2BZJA 5CS6A 2NO3A 4QJ4B 3AT4A 2G2IA 4YZMA 4DH7A 5CF5A 1Y8GA 2OFVA 4U3ZA 5ACBC 3D5VA 2BRMA 2PE0A 2ZYBA 5FWKK 4EEVA 2E2XA 4JDKA 4DIXA 1YHVA 4ALVA 1YVJA 3SLSA 3OZ6A 4UXLA 3KK8A 3MPMA 4FGBA 2F4JA 3R04A 4EHEA 2Q13A 4GFGA 1UPQA 1ST4A 1H1PA 1V5UA 5JGAA 5C01A 1A9UA 5DHFB 3U6JA 3L9MA 4L8MA 2YHVA 3NUXA 4NM7A 4XG9A 5TOZA 3RPVA 3PVBA 2P2HA 3TNHA 4EC9A 4EOQA 1Q67A 5ANGA 4O4FA 5IUIA 3EQDA 3MBLA 4NJ3A 1UA2A 1YQJA 3HGKA 1BLXA 2W96B 1ZY4A 2XNOA 3QA8A 3VS4A 5K5NA 1X1FA 4AWIA 4FYNA 2OXXA 4U45A 2XALA 3VONA 1T45A 2K00A 5EW8A 3DJ5A 1I09A 3OOGA 4LM5A 1BL7A 3BZ3A 2DYQA 4YC6A 3QRJA 2DFKA 1RE8A 2C0OA 4XG3A 5J3YA 1FVTA 2BTRA 4QQ5A 4EHVA 5LJJA 4U97A 4MXCA 4FV1A 2ITQA 4DT9A 3O50A 4EC8A 4E7WA 3W2RA 3PEGA 3NUAA 4HB2B 2PHKA 3F9NA 4BBKA 1ZSQA 4CG8A 1ZOEA 3KULB 2WTVA 3K5UA 2RFSA 4NU1A 2R4BA 2W7XA 4X3JA 4EKUA 4HAWB 3QBNA 3QQUA 4AFJA 4FKGA 3ALNA 2QOQA 4WD5A 2QQ7A 5DWRA 5IEVA 4JNWA 2EJ8A 2J4ZA 3PXRA 5TT7A 2GS2A 4LOPA 3WYYA 2VN9A 3F6XA 5BPYA 2JITA 2VWUA 4TWCA 2VTRA 2VKIA 2VX0A 3NUUA 3PE1A 4FV5A 1ZVRA 2R3HA 4LDTA 2WELA 3QUPA 5HE0A 3PLAE 5EDPA 3PFYA 1XBCA 1BI8A 3EL7A 2B0QA 2UW6A 4JIAA 2UVYA 2Z60A 4BIEA 3KRJA 3DAEA 1BTNA 1YOMA 2G15A 2JDOA 3O8UA 4KBKA 5IDPA 3FPMA 5CI6A 4DN5A 4I6BA 4XG4A 3DBCA 4AGUA 2W99B 1Q4LA 1GIHA 4XV1A 3PE2A 4IZYA 1CTPE 2B52A 2NPQA 3SXSA 1CKPA 5KMJA 1NVQA