3O96A

Crystal structure of human akt1 with an allosteric inhibitor
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
428
structure length
367
Chain Sequence
SDVAIVKEGWLHKRGEYIKTWRPRYFLLKNDGTFIGYKERPQDVEAPLNNFSVAQCQLMKTERPRPNTFIIRCLQWTTVIERTFTPEEREEWTTAIQTVADGLKKQVTMNEFEYLKLLGKGTFGKVILVKEKATGRYYAMKILKKEVIVANRVLQNSRHPFLTALKYSFQTHDRLCFVMEYANGGELFFHLSRERVFSEDRARFYGAEIVSALDYLHSEKNVVYRDLKLENLMLDKDGHIKITDFGLCKEPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHEKLFELILMEEIRFPRTLGPEAKSLLSGLLKKDPKQRLGGGSEDAKEIMQHRFFAGIVWQHVYEKKLSPPFKPQV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RAC-alpha serine/threonine-protein kinase
publication title Crystal structure of human AKT1 with an allosteric inhibitor reveals a new mode of kinase inhibition.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 99
structure length 367
sequence length 428
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2010-08-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
A PF00169 PH PH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3o96A03
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 3o96A01
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3o96A02
4MT7A 2HW7A 5DVRA 2QD9A 4FUYA 4D1ZA 4YR8A 4QP1A 4AA5A 2P0CA 4Z2MB 3BHVA 3W2QA 4L46A 4ASXA 4HCTA 4TYZA 4AT5A 2XNPA 2X9EA 4CQEA 2G35A 3BQRA 3ZZWA 3WZUA 2EC1A 2XKCA 3D5VA 4YZDA 5DH3A 4ZTHA 2B9HA 3UIMA 2VWWA 3HL7A 5CI7A 5BNJA 5HZNA 3N7CA 4GFGA 1KOAA 3Q3BA 4PV0A 1Q8WA 2EUFB 2PMLX 4QMMA 3CSVA 3FHIA 4L43A 1R78A 1UA2A 2C6DA 5BPYA 1Q5KA 5D3VA 4O86A 1Z57A 4Y5QA 3O23A 5CLPA 4YJTA 5BMSA 3O96A 4YL8A 3PXYA 3Q5IA 3R7VA 4WRGA 4ACDA 2Z0QA 2O64A 4MHAA 4XWXA 3ORLA 2L2IA 2XH5A 2WD1A 4W4VA 3RHKA 3LM0A 3RZBA 4F7HA 1O6LA 4LRJA 3GVUA 2W9ZB 1UU8A 5H2UA 1H4LA 5AP0A 5FWKK 2C1AA 4ZSGA 4ZY5A 3I5ZA 2PVFA 1BL7A 3HKOA 1U54B 4NIFA 1CDKA 4BYIA 5KMJA 4EH6A 2DHKA 2V55A 4GKIA 4AW1A 3ZO4A 4FF8A 4YBJA 4E6DA 1OIQA 4X0MA 1NW1A 4KKEA 2CN5A 1P2AA 1XWSA 4F99A 3SV1A 3KEXA 5DGZA 3WYYA 5CZHA 3HYHA 4HW7A 2NP8A 3R7EA 1EVHA 4PQ0A 4IH8A 4GVJA 4RLLA 1SHCA 4YJQA 3Q4TA 2Y4PA 4PUZA 4BIBA 4HAUB 3V01A 4EOIA 4BDJA 3HMIA 4KBKA 2UZSA 4F9AA 1PLSA 3BYSA 5ANDA 2VTSA 4L6EA 4KS8A 4O6LA 3AOXA 2VUWA 2V22A 1X86A 5DRDA 2PE2A 3O71A 4FA2A 3BWJA 4ASDA 2OZAB 4HPUE 3P7CA 4WNOA 3EN9A 4UWYA 2BRMA 4FTUA 5J3YA 3VS1A 4GJ2A 2DYQA 5C8NA 2BIKB 3R7OA 1U5FA 3RHXA 3CKXA 3O8UA 3OWPA 1RQQA 4YZBA 3RCPA 2XKFA 2B7AA 1RJBA 2W1HA 3OBGA 1GZNA 4XNEA 1XH9A 3VS5A 3H0YA 3F6XA 2IVTA 5CX9A 2J7TA 5FP5A 3PG7A 4KIPA 3DBDA 3OF0A 4D9UA 5TO8A 4WD5A 4I1ZA 4AZWA 4QYEA 4O7SA 5EM7A 1YQJA 4RLKA 3RM7A 4MEDA 5CAUA 4E4XA 3P86A 4EOSA 4FKJA 4R7IA 4YGAA 4IM2A 3TV6A 2OH0E 4I92A 2ZM3A 4D2PA 5GZAA 2PY3A 3RMFA 4MYGA 4DGOA 5ETFA 3RI1A 2ETRA 4JLCA 4CT1A 3AC8A 4IADA 1WZYA 3Q53A 4GJ3A 4C4IA 3CBLA 1OKWA 4JDIA 4KINA 1Q8YA 4MX9A 3LOKA 3DKGA 3M1SA 3VBQA 4MBJA 3BRBA 3PPJA 2EU9A 4FZAB 4AXAA 1FAOA 1YXTA 2IN6A 4BC6A 2GNJA 4K18A 3W8QA 4C34A 2X39A 3UNZA 1OPKA 3ZFXA 2C68A 2IZRA 3FY2A 3ORZA 2BDWA 3VBXA 4CG8A 4C8BA 3ZBFA 1NVQA 2VRXA 4RWJA 2BFXA 3DY7A 1VZOA 2UZVA 4FV7A 4IB0A 5AP5A 2GQGA 4LOOA 5HKMA 3RPSA 3TG1A 4BB4A 5IMEA 5KKRB 1NTVA 4WSFA 4FKSA 1GNGA 2C5YA 4I0SA 4BCMA 3EFKA 4L42A 4BKYA 2PZ1A 1KSWA 2LGCA 3L1SA 2JKKA 2RFEA 4GG7A 1H27A 2Z8CA 5AP2A 1MKEA 5GIPE 1R3CA 3O0GA 5ANKA 3BEGA 2HCKA 4MWIA 5E9EA 3GCQA 2WMBA 1URWA 4A9UA 4D0WA 4WUAA 5ETIA 2E2XA 4R7BA 2PVJA 3BBWA 3BHYA 2XNGA 1H01A 4J8MA 5IA4A 1XH7A 4IANA 3PLSA 3F7ZA 3O8TA 2W99B 4UMQA 4CMTA 3LFEA 4FV2A 4F9WA 2Z7RA 3NNXA 1QMZA 3QQLA 4XOZA 5CNNA 1W1GA 4RX9A 2D9XA 2P3GX 3PPZA 5HE0A 3KRJA 4PMTA 5DFPA 5CALA 4D0NB 2OXDA 3LCDA 4L01A 2K00A 4LM5A 3ORXA 4IEBA 3TCPA 2ZDUA 1JNKA 4QO9A 3V6RA 4XV9A 5JZJA 5FM2A 1PKGA 4YU2A 4C4EA 4M3QA 4RIXA 3NW7A 3HRFA 3R8ZA 4EH8A 3A8WA 3CEKA 4R77A 5FXRA 2UZOA 1KWPA 1NU2A 3SRVB 3PWYA 2YFXA 1B6CB 3QKLA 3OG7A 5IUHA 2Y6MA 3EQGA 3V8TA 2PUUA 3UOJA 4EKUA 4Y5HA 2W1FA 5BX0A 4FBXA 5LMBA 3COHA 2YM4A 2JITA 3HV4A 4XG4A 2BRHA 2XNEA 1U46A 3TXOA 3DOGA 4GL9A 4QP4A 4JIKA 4JQ8A 3KCFA 3U6JA 1MP8A 3S4QA 3PXZA 3CY2A 4FZDB 3UOLA 4BDBA 1P4OA 5LXMA 1JKSA 4H8SA 2XK6A 4HOKA 2I5CA 4FE2A 4FVPA 4PX6A 3OOGA 3HA6A 2F7ZE 2J0MA 3MESA 4HYUA 1G3NA 5EW3A 4EK8A 3LAUA 5KMLA 1GAGA 2YLFA 3D9VA 3UE4A 1MUOA 4M13A 5DPVA 3JY0A 2PUPA 4A4XA 3D7TA 2HZ0A 4EKLA 4NSWA 1OGUA 1G8SA 4IX5A 2R3KA 3WIGA 3ZDUA 3ZO2A 3WF8A 5CU3A 3FPQA 2DTCA 1QCFA 1Q41A 4DFYA 1UNRA 5FQDC 4HJOA 3R21A 5GNKA 4DE4A 3ZLXA 1YOLA 4YC3A 3R9RA 4ANSA 2BMCA 4R1YA 4P5ZA 4W9WA 2C3IB 5CS6A 5HG9A 4FNYA 3ZONA 1FHXA 3CR0A 5CSHA 2J5FA 2VWXA 3KVWA 4GH2A 4ZJJA 4USDA 4A9SA 5EFQA 5IPJA 3FM8C 4U0IA 3BGZA 1H07A 2I0EA 2YCSA 4M12A 4MCVA 4DCAA 4EHZA 2R3LA 3BGQA 5BYYA 4HB2B 4BZNA 4G16A 4FG8A 5JHGA 2XYUA 4RJ5A 3ZOSA 2OKRA 4OTDA 4G17A 3A62A 3HK0A 4RVTA 4DA5A 3VS2A 4AZEA 1M52A 4MNEA 3NCGA 4IMYA 3BYUA 3RAIA 3VVHA 3MPXA 4QMNA 4EK4A 3M2WA 3C4CA 3R22A 5D41A 3OTVA 4GFMA 3AT3A 5CY3A 5JRQA 4DH1A 1YHVA 3DAJA 2MWNB 2YM3A 3BV2A 3H10A 3OXIA 4YJOA 2J90A 2XKDA 2YN8A 3P1AA 2Z0OA 2JDOA 2YITA 3VBVA 3W55A 1K2PA 2PYWA 2ELAA 3U7DA 1UWJA 5CQWA 1OL6A 2ZV9A 4TNDA 3DQXA 1GJOA 3R9OA 1J7UA 4BR3A 4HGTA 4EQMA 4TL0A 1PMEA 2ZOQA 2R09A 1NVSA 2GNHA 2W17A 3PIYA 3WOWA 2EB3A 4BBKA 3LCKA 4EH5A 5BVFA 4YSMA 2OH4A 2FB8A 4YONA 3EQHA 4GMYA 3OHTA 1HCLA 3PXFA 4JRVA 1ISNA 1GC6A 2YZLA 3NVKI 3EZVA 3UYSA 5E7RA 2VTHA 3RPOA 4AF3A 4ACCA 5BUJA 4OBOA 2AC5A 5AX3A 4EH7A 4D28A 2OFVA 4U45A 3UC3A 2FYSA 1E1VA 4F9BA 3UTOA 3FZRA 3IOKA 4QMZA 3OY1A 3RPYA 3VBTA 2GU8A 2JBOA 4TN6A 2OZOA 4MD8E 5DG5A 3VULA 3NEWA 1K5DB 2IG7A 1U54A 3D5UA 5M51A 4EUUA 1P14A 4D58A 1FB8A 4GU9A 2N23A 2KULA 3U87A 4Q9ZA 4OTGA 4HVDA 5H8BA 5DN3A 4KBCA 3FQSA 1J7IA 2R3MA 3FXWA 2Z60A 4C36A 3I6WA 2FUMA 5CTPA 4HB3B 5DT4A 3IKAA 4TYHB 5D11A 4CD0A 1NVRA 5IKWA 4IQ6A 2B52A 1P3RA 5I3OA 4I0RA 4I3ZA 4QPSA 3BU3A 3VW6A 5FXSA 4FT7A 3IK3A 4JI9A 2UZUE 2X2KA 2DX1A 4Q9SA 4RX5A 3OTUA 3LJUX 2J50A 5HESA 3FMNA 3KF7A 3BJIA 5CVFA 3V8SA 1JOWB 3DJ5A 3PEGA 4FSQA 3UVPA 3WF6A 2OZAA 4U97A 2XYNA 3LJ2A 3DXCA 1SVGA 3G9NA 4NJDA 4U3ZA 5D1JA 3WIKA 3S0OA 4HB0B 3Q9ZA 2H96A 3H30A 2EWAA 4FT9A 4Z16A 4NTSA 2O3PA 5HI2A 2P2IA 2JGZA 3KXNA 4NH1A 4AA0A 1WBSA 1PXIA 4DEAA 3OCSA 4X3JA 2UZTA 5HVYA 3HLLA 4YTFA 4FK3A 4DTKA 3SYXA 5A4TA 3RAWA 2C0IA 4TRLA 3QL8A 3MFTA 3Q6WA 1T46A 5KZIA 5E92A 3L9LA 4H36A 1U27A 4DFLA 3F5GA 3R8LA 4Q5EA 2I1KA 3GENA 4FV0A 2YHVA 2YIWA 5AR5A 1BWNA 1KZGA 1R1WA 4RJ7A 5LVMA 5JGBA 4F1MA 4HYSA 2CCHA 1JSTA 3EJ1A 5K5XA 5JZNA 1LEWA 4CZUA 5FM3A 1OBDA 4L8MA 4G5JA 2AC3A 1LW3A 3MVMA 5KHXA 4FX3A 2EXEA 2B54A 3GCVA 4YTCA 2F7XE 2MDXA 1FBNA 3R71A 4CZTA 3U9CA 4ACMA 4BWPA 5JQ8A 4FTTA 3LQ5A 1BAKA 4ZLZA 1PY5A 2GFSA 3OROA 4L9IA 4IOYX 3OUNB 4G3EA 5CEIA 2JC6A 3UP7A 3TUDA 2PVRA 4AFEA 3AGLA 2VO3A 5LMAA 3UZTA 2UW7A 3ZHPC 3F5PA 4HGEA 5EHLA 3GQLA 3TTIA 5I9VA 4Z2NA 1SVEA 2GFCA 3BIZA 3R0TA 3BU5A 4PNKA 2D11A 3CKWA 1MQBA 1K9AA 3K54A 5A4CA 1YDRE 5AP1A 4IM3A 2R3JA 3PY3A 3LFSA 5HCXA 1SMHA 5BVOA 5C5BB 4QQTA 1ZYSA 3EIDA 4BCOA 4F7JA 2VV9A 4FTRA 3F3WA 4C38A 2HOGA 2JAVA 4NY0A 3AC3A 2Y8OA 2VX1A 3HV5A 4ALVA 1ZXEA 4DEHA 5J9ZA 5J9YA 2QLQA 4UN0C 3UG1A 2CNQA 2X81A 4Z3VA 3TFMA 4QYGA 2VWIA 3QKMA 3D5XA 5AR3A 3W2OA 4BDIA 4DN5A 1U5DA 4PNIA 2J6MA 2DQ7X 1VYZA 1YXVA 2W5BA 3QCYA 4LOQA 3ZUVA 4C33A 5E1EA 4JRNA 2VTLA 3F2NA 4PDSA 1G5SA 1NXKA 3PVBA 2DX5A 4JJRA 1V61A 2A4LA 2BAKA 3VUDA 1U5EA 1P5EA 1Y91A 2HK5A 1ZZ2A 4QMSA 2XJ2A 1RJ2A 3TDVA 5EDPA 3K3JA 4LGHA 2HYYA 3NNWA 2VO7A 4NWMA 2IW9A 3R9DA 5JMSA 2YM7A 3BU6A 3FQHA 3OMVA 1XCGA 3VN9A 1FINA 1VR2A 4AU8A 5M57A 4AGCA 4IAPA 1YI3A 5AX9A 4EH9A 1ZYDA 2RG6A 3EQPA 3F7WA 3PZEA 3SRVA 4GMVA 2W5HA 4CXAA 4EC9A 3Q4UA 4D2RA 3I0QA 2E9NA 5DR6A 4ANMA 2HZIA 4PP7A 5GOWB 2XNBA 2F2CB 5BVKA 2I0VA 1REKA 3D0EA 4E6QA 4D9TA 3UQCA 4M15A 2WOTA 3QYWA 3I7CA 5CSWA 5GZ9A 3S95A 3LCOA 4RPVA 4TWCA 4W4XA 4ZK5A 5AP7A 2LOZA 1U29A 5CXZA 4QP3A 3ODZX 5J9LA 4GZUA 5IEVA 1WBVA 1PXJA 3EQRA 2CN8A 2WMRA 3FKOA 3GXLA 3K5UA 4WSQA 2R2PA 5EI2A 3VQHA 1Q97A 4IW0A 1X8BA 4Z9LA 5EHYA 3ZLWA 2V5QA 3SXFA 2QOCA 3NIZA 1EH4A 3WZJA 4GIHA 2RKUA 4X2FA 4FIHA 1JAMA 3U9NA 5EM8A 4EHVA 1U5GA 2DLWA 3BELA 3PY1A 1OKZA 4FKPA 4U40A 3V6SA 3ORNA 1SYKA 3PA4A 3OC1A 5GJGA 4XJ0A 5HO6A 5C26A 4EOJA 1TXDA 4FVQA 3PP2A 3POOA 3FYJX 4ACHA 2EMTA 2CY5A 1PXPA 3BHTA 3FMLA 1XD4A 4JBPA 3RPVA 3PSDA 4LI5A 2R0IA 4FC0A 4QYFA 3A8QA 2BRGA 3NUPA 4NUSA 3QD3A 4YLLA 4B8MA 3I60A 5CNOA 3G0EA 1DYNA 3CTJA 1YXUA 4YZ9A 2GS7A 1DM2A 5EHOA 4E8AA 5J3QA 4K8AA 4CTBA 1WMKA 4J96A 4UEUA 5IISA 4OAUC 2PL0A 5E1SA 2Z7LA 4AP7A 3CY3A 4AUAA 5H8EA 3LVPA 3LMGA 4LFIA 4ALWA 4DH7A 5CU0A 3R28A 5K9IA 4FG7A 3PE2A 3RZFA 1J91A 4F0GA 4X3FC 4UZHA 4C4GA 5JH6A 4N4SA 1I44A 3UGCA 3W1FA 4RIOA 5HBHA 5CAQA 2HE7A 1IRKA 1DDVA 2C5NA 3GQIA 3FSSA 1BUHA 1XQZA 3EFWA 4AWIA 4DH3A 3HP5A 2LULA 4BDHA 3ETAA 3C5IA 2R3OA 4QRCA 4RRVA 2QOHA 3SC1A 2JDTA 2RIOA 2X4ZA 3DLZA 3LIJA 4G34A 3A4PA 3NPCA 2ONLA 2IZUA 3AT4A 5CENA 4TY1A 4FKIA 4R5SA 4YP8A 3KFAA 1H4RA 4JDJA 5DE2A 5L2QA 1JBPE 3C7QA 3R02A 2BHHA 3O50A 4DAWA 5CLLB 4IB1A 3V3VA 3WARA 1FHOA 3L8PA 3KXXA 3MVJA 4XEYA 5TR6A 1BX6A 2B0QA 4L3PA 5CEKA 2O8YA 5KMKA 2DHIA 2GCJA 2H6DA 3TW1A 2W2WA 4F7GA 3FMMA 3C4FA 2C6OA 1DROA 4I21A 4XUFA 5AUXA 2CMWA 5LARA 4UMUA 3FKNA 3H9FA 1OECA 1ZLTA 3OEZA 5FEQA 5I9WA 4H05A 4BY9E 3ZU7A 2FSLX 3NMUF 1GIIA 1YXSA 4KIQA 4AW2A 2GCDA 4EOOA 4PL3A 4DEBA 1O6YA 1OMWA 5IQAA 4YJRA 3QUPA 5HE1A 4DXAB 5HNGA 3SKCA 4RWLA 3ZZEA 3TUBA 5J7HA 3ERKA 4IAIA 3VIDA 1OL5A 1IA8A 3VUKA 4RIWB 4CV8A 3ALOA 3ORTA 2BZHB 4O2ZA 5JP4A 5M09A 2XVDA 4CFNA 3QD4A 2JIUA 4FNXA 2ITZA 3TACA 4MXYA 1YOMA 2WMSA 1Z9XA 2UZLA 4BBFA 4HDQA 4YC8A 1XKKA 5D3WA 1H8FA 4O0WA 4RQKA 3CXBB 2R3QA 2JKQA 2G9XA 3PIXA 2D4QA 3L9MA 4DEDA 1ZY4A 3D94A 5J1WA 3TUCA 2D9YA 3JY9A 2OBJA 2XCHA 3GU4A 1K5GB 1SVHA 3HMMA 3VUIA 3Q04A 4CFFA 4RT7A 2XCKA 3AD6A 4G9RA 1EAZA 2ESMA 2PZ5A 2YDKA 3LFBA 4AGDA 3QZGA 1GOLA 1V0OA 3FZTA 4BICA 5LMKA 4KHOA 3AD5A 3MBLA 4JR7A 2PVNA 4Y73A 5LOHA 2YCFA 5CZIA 1OIYA 3TJDA 3CC6A 4F7LA 2GNGA 2QO7A 4Z7GA 3COMA 1XBCA 5A6OA 4QTDA 4O7LA 3KN5A 3FEHA 3FI8A 3FJQE 4QMVA 5EW9A 4KIKB 4QP9A 2N0YA 5CF5A 3E63A 2BAJA 5IQBA 3LE6A 1OPJA 4FYOA 2XIZA 3CPCA 1TQMA 2QONA 3ACJA 2V0DA 3E93A 3HV6A 4GK4A 5FI1A 3V51A 1GZKA 4P2KA 5M4FA 4C3FA 4PTCA 2C4GA 5L2IA 5CSPA 2RUKB 2OLCA 5ANEA 4Z55A 2DKPA 2VO6A 4IJPA 3GEQA 4OBPA 3TZ8A 1M7RA 1KOBA 3DK3A 4NM0A 2VNYA 4WOVA 4XG6A 5FBNC 1WBWA 3M11A 3GNIB 4A7CA 3RALA 5IDNA 2G2FA 3KY9A 5GJFA 3CIKA 3NSZA 2IPXA 4I6QA 4LMNA 2X4FA 4PMMA 4UBAA 4JG8A 4FSWA 4NW6A 2QLUA 5BVNA 4IZ5A 2QOIA 5AUWA 5LOPB 3RTPA 2XA4A 4FOCA 3ZLYA 4BIEA 3MFRA 3R9NA 4GT3A 3V5JA 3NRMA 2H7EA 4QMYA 5E91A 1E9HA 2XP2A 5CU2A 3SHEA 4IHPA 3JYAA 5GHVA 3V8WA 5TKDA 5HE3A 4RC2A 3LFDA 3A98B 4JDHA 4FEXA 3ZBXA 5AUZA 3HRCA 4WNPA 5L8LA 3FSKA 2RSGA 3FHRA 3KB7A 3NUUA 2HXQA 5I9YA 4YO4A 2W5AA 3BE2A 4XX9A 2G15A 3ATSA 1REJA 1H1RA 3MGYA 5DH9B 2WTCA 1UNLA 2HY0A 5KMIA 1FPUA 1YKRA 4R3RA 1UNPA 4N57A 3PLAE 1WBNA 4MXAA 4XH6A 2GDOA 3WBLA 3W33A 3ID6C 2UZWE 4Y85A 2R3RA 4O27B 3N4VA 1M2PA 4GCJA 3FAAA 4RA5A 4YC6A 3BX5A 4RJ3A 4YHTA 5F94A 5H9BA 2QHNA 4PTEA 3TKUA 5CF4A 1F0QA 1PMUA 3G5DA 3QA8A 1PXOA 1ZVRA 5EFXA 2HAKA 4FSNA 5ANGA 5LVPA 4U81A 4O0XA 4GSBA 3R30A 5KQ1A 2YSZA 2F2UA 5HO8A 1VJYA 4KSPA 4CRSA 5IMXA 4G5PA 2GNLA 3CCNA 5FEDA 3F69A 3QLGA 3OBJA 5E90A 2VWYA 5L8KA 3JPVA 4C2WA 4KHAA 3IO7A 2OU7A 1QPDA 4RWIA 4HYHA 2AEHA 1V89A 3OXZA 3ULBA 4DFUA 2ZMCA 5EOLA 3Q9XA 5EW8A 4A06A 4NZWB 3PSCA 3SOCA 3AMAA 2WTVA 3FLWA 4DH5A 4FNWA 2VGOA 4XG2A 1PRYA 4BTMA 4M68A 4FL2A 3L9PA 4MF0A 5C27A 4DT8A 5BVEA 4IX4A 2NO3A 2CGVA 3HX4A 3ZS5A 3FMKA 2XNMA 2YM8A 2R3IA 3QQKA 4OGRA 2UVMA 1M14A 5GJDA 4F7NA 5J95A 4N6YA 4GKHA 1Q8TA 5KMMA 1HCKA 2XBAA 2RVBB 4X2NA 3QRKA 3C1XA 4O38A 5CVHA 4YHJA 2WEIA 1OITA 3VQUA 3S1HA 3ORPA 1PYEA 4RX8A 3TT0A 4XRJA 2CSNA 5JFWA 2NMBA 1H00A 1LB1A 2FSOX 3H4JA 2CKOA 4ORKA 2DWBA 3FBVA 3VRZA 2G1TA 3O17A 3QALE 1V5MA 4C0AA 3EQIA 3QTQA 1J7LA 3QGYA 4P7EA 5HCZA 4GW8A 3BGPA 2W06A 3QUEA 3V5PA 1KV1A 4CRLA 3WA0A 3A7HA 4M69B 4FTKA 4U41A 4V0GB 4W8EA 1OM1A 2XK4A 3BE9A 4AW0A 2I0YA 2YVCA 2BTRA 1Y6BA 3KRLA 4BDDA 4K2OA 3P7AA 3QZFA 4NTTA 2YZAA 3HUBA 2O65A 3R83A 4CFMA 4ENXA 3QHWA 1OKYA 4XG3A 4A6FB 4JDKA 3SQQA 3IONA 4EHEA 5HG7A 2ERKA 3CXWA 3VW8A 1WBTA 1P5TA 1XJDA 2XRUA 3FPMA 4L52A 3V04A 3PVLA 4ZLOA 3QBVB 5C16A 4TYJA 4EK6A 3SA0A 3MH2A 4JBQA 2COFA 4TYGA 4K11A 2F9GA 3K3IA 3OD6X 1Q4LA 2XIKA 3RPRA 5LVOA 1O6KA 5M56A 3HQCA 5HD7A 2B4SB 3TO1A 5CEMA 1WAKA 4F64A 1DI9A 4K0YA 5FDPA 3VIAA 4DYMA 3CD8A 3AT2A 5M44A 4TTHB 5ANOA 1HOWA 4CVAA 2ITXA 3C0GA 4EL9A 4LUEA 1QQGA 1PMVA 5IQIA 5D12A 3U4UA 1PXKA 2VTNA 3ZCLA 1B55A 4K81A 1OPLA 2ZB1A 1XX0A 4NEUA 3F2AA 3BWFA 5ICPA 4JVGA 1MQ4A 4RIYA 5KCVA 3F3TA 2C6MA 5D3YA 3QRJA 3U51A 4EJNA 5A4EA 3UNKA 2PE0A 4O0YA 3ANQA 3HDMA 4I20A 3PVWA 5DNRA 4BTFA 2B9FA 2MFQA 1UKHA 3FDNA 4J52A 3TIYA 1WVYA 3UVQA 3O51A 5AA8A 3R8VA 1U2BA 1XHAA 4QOXA 3VHEA 4E93A 1Z5MA 3X23A 3QF9A 2UVYA 4L3JA 2VTAA 5TF9A 3KXZA 2XB7A 5CT0A 4O7VA 4FTNA 4G2FA 4I5HA 5EG3A 4EKKA 3MDYA 4UMRA 2Z7SA 4TNBA 4R5YA 1BLXA 4I94A 4RMZA 2AYPA 2I1MA 5D9HA 3A60A 3VWAA 4DH8A 5I3RA 4GT4A 4FGBA 4I5PA 5D7AA 4QP2A 2UV2A 3PFQA 5IQEA 2JEDA 2PWLA 3EFJA 2V76A 4FKUA 4P90A 3I79A 1AGWA 4D2VA 2VN9A 2IWIA 3ROCA 3ZTXA 2YWVA 5AJQA 4BDAA 2QVSE 2QURA 4HCUA 4AE6A 4DGLC 4EK5A 1UNHA 1S9IA 3NYXA 3DAKA 5AUYA 5K4JA 3B8RA 3FL4A 3QWMA 1LR4A 3GFEA 3UG2A 1BI7A 1OVEA 3VAPA 2F57A 3LM5A 3F61A 2OF4A 2C6EA 3FWQA 5B0XA 4CV9A 2OJFE 2WMQA 1FHWA 3IG7A 3KRWA 4ZTLA 5AIKA 3SW4A 5AR4A 1TJ6A 3LCTA 4KIKA 4RG0A 5L2SA 4H1JA 4QD6A 3CTQA 3AMBA 3KULB 1IEPA 3GC9A 2ELBA 4MXCA 3I5NA 5IH5A 5AM6A 2CNVA 3D15A 3Q2MA 2OXYA 3NR9A 4DFBA 5ITAA 2QR8A 4FV5A 4EEVA 2QU6A 2CODA 5DEWA 5L8JA 1ZYJA 4LV8A 4G6OA 1WCCA 1PXNA 3HVCA 2L1CA 3IW7A 4EOPA 2ZMDA 3MY5A 4LL5A 4YTHA 4LRKA 5DYJA 4DT9A 3COKA 2C6KA 5D3XA 1GIJA 4JX3A 2HXLA 1XR1A 1CKIA 4IWDA 4BCFA 4V01A 1P6SA 2WTJA 3HDNA 3ZLSA 5IA2A 4BN1A 3ODOA 3PJ1A 4CTCA 4PMPA 3FC1X 3FI4A 4ZY6A 3P0MA 3FYKX 4ZSJA 5CEQA 4JX7A 2KGXB 5AUVA 4HVGA 4ANBA 1JWHA 3T9IA 4KSQA 3GU7A 4FTLA 4MNFA 2JIVA 5BMMA 4AZSA 1AWEA 4GT5A 2RGNB 3QFVA 4E5AX 2VTIA 3A7GA 4U79A 4WSYA 4GYGA 3BV3A 4ZOGA 3LCSA 4OTIA 1O9UA 2ITWA 2JD5A 4AG8A 3K2LA 5TE0A 4D5KA 4EOQA 3Q6UA 3ULIA 1M7NA 1V5UA 4KAOA 2UZNA 4NCTC 1U4DA 2GS2A 1KE5A 1J0WA 4HAZB 2O0UA 4Z7HA 4WA9A 4DEGA 5EQEA 4L7SA 3DK6A 2MKRA 4BBEA 4A07A 5HIEA 3F2RA 1LP4A 1GY3A 3FSFA 4ZSLA 5DHFB 4J7BA 1JKKA 4L6QA 3TZ7A 3NVMB 5IF1A 1H1WA 5HNIX 2ITUA 3PSBA 3L8VA 2XNOA 3DBFA 2XRWA 4FEQA 4XBUA 3WF5A 3HMPA 4HPTE 3IDCA 4ZZMA 2WMWA 3D8FA 3ITZA 3SD0A 2YAAA 2VRWB 4D5HA 4FKQA 4IZ7A 2W1ZA 1UEFA 5K5NA 2P8VA 4EBWA 4F7UP 3DFAA 3SO6A 4BDGA 4HAVB 4R7HA 4NK9A 4DC2A 2DUVA 2ZM1A 3OY3A 3QTXA 5DI1A 4UX9A 4ZMFA 3DXQA 4CQGA 2RG5A 3W2SA 2XZSA 5DHAB 3ZO3A 2YIQA 5IA0A 3SV0A 3KK9A 4CFUA 2G2IA 2QOKA 4BCHA 4X3FB 4PF4A 5DR2A 1UVRA 1TKIA 3PXKA 1FGIA 4F6UA 1J3HA 3BLHA 2P4IA 3ZC5A 3TNHA 2CDZA 2HY81 3QX2A 4S2ZA 5CAOA 3ODWA 3DKOA 5CT7A 1PXLA 4ERWA 3P79A 2DFKA 1ZRZA 3FLNC 3KXGA 3FUPA 4ONAA 3B8QA 2X6EA 1ZYLA 4I6HA 4M0YA 5AR2A 4BCNA 5LJJA 5BVWA 3LXPA 4FTIA 4CMUA 3ACKA 2LOXA 2ZVAA 4XOYA 5C8MA 4ZAUA 1T45A 3IW6A 3QRTA 4H3QA 4AN2A 1SGHA 5M4UA 4G3CA 4FG9A 1AD5A 3FXXA 4HCVA 4RVLA 1XH8A 4K1BA 4UALA 3WF9A 3QHRA 2AL6A 2XEZA 3NUYA 4QMPA 4IE9A 4I93A 5AWMA 4F70A 4GUBA 1ZC4B 3WZEA 3LMHA 4KA3A 1RRPB 3HP2A 4M69A 4X2KA 3BYMA 1UU7A 4ZTMA 3W32A 1WBPA 2CKPA 1ZYCA 3AC5A 1A48A 2YT0A 5LVLA 2PTKA 3E8NA 2UW3A 2VWVA 4FV4A 1NTYA 2BKKA 5AV4A 3OUKA 3IVFA 1OY2A 4YO6A 4AE9A 4U44A 3TI1A 3D83A 4FTCA 4C61A 4CLIA 4DGGA 4E1ZA 2COAA 4KRCA 3PUPA 1KE7A 2UW6A 4XHKB 3IPHA 4BHNA 5L2TA 3KXMA 4N70A 2PMIA 1JVPP 2QODA 3QLFA 1AQCA 1K3AA 4IB5A 3FMJA 3FLYA 3A8PA 3OCBA 4FSMA 3HMNA 3F5XA 3QCSA 3S3IA 5JHHA 2QOFA 4D1XA 2YIYA 4MD9E 5AAGA 3ML4A 1PJKA 4OUCA 4PPBA 3UMXA 2RLOA 5A6NA 4XP0A 2R7IA 1JKLA 3GUBA 2PK9A 1OZ1A 4IFGA 1KI1B 2R4BA 4C62A 5JQ5A 1V1KA 3QRIA 3FC2A 5LCJA 3UODA 2PVMA 1RW8A 1BL6A 3F3ZA 5DLSA 2QKWB 4IXPA 2J5EA 4XG9A 2C6LA 2CCIA 5LCKA 2I5FA 4UZDA 4XP3A 5CYIA 3T8OA 4FSRA 3D14A 3U8ZA 2ZYBA 3VHKA 4CKJA 3QU0A 3ZRKA 3MS9A 4DEIA 4WO5A 2I1JA 2GHGA 1WVXA 2BZKB 2WO6A 5HTBA 5EYMA 5HORA 1E1XA 4IWOA 5HX6A 5JFSA 3QZIA 1J19A 2CGWA 4C35A 5HD4A 1MK9B 4H3PA 4NT4A 2IFSA 4GK2A 3OWKA 4GYIA 3HZTA 2FJLA 2FSMX 4D4SA 5ANJA 3V5TA 3R7GA 5M53A 2OF2A 3TKHA 4C3RA 5LONB 2LAVA 4ARKA 4GUEA 4FZ7A 3RVGA 3FLSA 4FT0A 1JPAA 3SOAA 3VJOA 2A27A 2BILB 4HVSA 2REIA 5M06A 4XCUA 2CGUA 4ID7A 3VOQA 3OWLA 5J79A 5AEPA 2OJIA 4B7TA 1LUFA 4L3LA 3C4XA 2XK8A 4I22A 4MWHA 1QPEA 3IW8A 3TIZA 3VS3A 2C3LA 4EQUA 3FMDA 3KU2A 1I7AA 4MXZA 3I81A 2JIIA 4UYAA 3ZRLA 5FUTA 3ZXTA 3FQEA 4AGWA 3M1IB 4IFSA 1M7QA 1OB3A 2YCQA 4FIJA 5J87A 5T68A 1QPJA 3GFWA 2NPQA 3FI2A 4YJSA 1ZC3B 3PA5A 4BVUA 1MRYA 5CANA 2ZM4A 5EI6A 4E26A 2UW5A 1JLUE 3EQDA 3Q96A 3QTWA 5EYDA 3OANA 3ZRMA 5DHJA 4A4LA 5CQUA 2YIXA 3ULZA 4O82A 4MKCA 3UPXA 2I7QA 3FMHA 3E8CA 4KIOA 2OO8X 4A9RA 2QR7A 1XH6A 2CHLA 5HU9A 5K4IA 2PULA 3KF4A 5A4QA 2QOQA 3U8WA 4JBOA 4F0FA 1Y19B 2CNUA 5C9CA 2WMVA 3BI6A 5HHWA 4YJNA 3AQVA 3K5VA 2C5VA 5D7VA 4HZSA 4JAJA 3MWUA 4FODA 4A4OA 3LQ3A 3R7UA 2Y8FA 4ZTSA 3E62A 5CF6A 4Y94A 2ZB0A 3R2BA 3TEIA 3SUZA 3LFFA 3COIA 3NAXA 4OTRA 4QTAA 3NGAA 4FSZA 3EN6A 4H58A 5HX8A 5I5ZA 2PHKA 5M4CA 2CLQA 5EKNA 2UW0A 4Y46A 2ERZE 1JSUA 3II5A 4F1OA 1WGQA 2ROZB 5IUIA 4RZWA 1UNGA 4C0TA 4CHJA 3PVGA 1GC7A 2OGVA 1MAIA 5C79A 5FEEA 3ZC6A 5AR7A 5IA5A 2W2XC 5IH6A 1RDQE 3GP0A 2RFDA 3F5RA 4KB8A 4J99A 1W1DA 2GS6A 4EJ7A 4NKSA 5AA9A 4U42A 5HTCA 2P0HA 4P7IA 5DI9B 5HLNA 2X18A 3AXWA 4EQCA 3POZA 4LGGA 3I7BA 1MIZB 3MI9A 2IW6A 3I1AA 4J8NA 4L45A 4UYNA 2LKOA 3UO5A 1FVVA 3TV7A 4AQCA 4O0VA 3MH3A 4TWPA 3WE8A 2V62A 5HBEA 4WKQA 2VNWA 5CSVA 2CKEA 4FIIA 1JSVA 3KL8A 2JKOA 2Y9QA 4BCPA 4QMLA 5M55A 1KZ7A 3FL5A 5AV2A 4IAKA 5BUEA 4TYIA 3LFCA 4QMOA 4BKJA 2OJGA 2Y4IB 3GCPA 3PVUA 4FI1A 4K77A 4WG4A 2XK9A 3LJ0A 5HG5A 1FGKA 4PDPA 4PWNA 4U3YA 5HQ0A 1FGYA 1DDMA 3NUXA 2UZRA 4BIDA 4DG3E 3MTFA 4C4HA 2Y0AA 4JAIA 5BYZA 3L9NA 2F4JA 2EXCX 5BQ0A 3KREA 5HICA 4JT3A 3RK7A 2PVLA 2PMNX 3HGKA 3OT8A 3Q9WA 4I23A 5K0XA 2OW3A 3C51A 4YNEA 3ZXZA 5IU2A 5AAEA 3TVVA 4NIFB 4OW8A 2X0GA 2WKMA 3UJGA 2BROA 5ETCA 5FTGA 4Y95A 3NNUA 2PZRA 3MVHA 4EYJA 3P5KA 1W1HA 3KQ7A 3RAHA 4U8ZA 3DJ6A 3GT8A 3EN5A 3OT3A 4DTBA 2X8DA 3F9NA 3ZDIA 3PXQA 4PQNA 1IRSA 2XJ0A 1Q8ZA 2Q0BA 4FMQA 4IVDA 4YLJA 3WYFB 4XS2A 4MD7E 2Q83A 1XBAA 1B38A 4AOIA 4HYIA 3LW0A 3QWJA 3CS9A 4IC7A 3R2YA 3LXLA 3MY0A 1OBGA 1YWRA 2OIDA 3DS6A 1OKVA 1BYGA 2UW4A 3OP5A 4L67A 3SDJA 3ZEPA 4AN3A 4F65A 4APCA 2HIWA 3AC4A 4F9YA 5IEXA 2PUIA 4IIRA 3WF7A 2IZSA 4G6NA 4OTFA 4LGDA 4S34A 4W4YA 1JQHA 1QPCA 2IVSA 2UZEA 4X21A 3RNYA 3DFCB 4GXBA 4AA4A 4S30A 3T3UA 3W2PA 4FTAA 2CJMA 1W8CA 3E8EA 4ASZA 3EQCA 4FK6A 3MFUA 5IA3A 2WQBA 4CGAA 4X3FA 2WOUA 5KZ0A 3CQEA 3PTGA 4EOKA 3MV5A 4AFJA 3E7OA 2J2IB 2X7OA 2XIRA 2FVDA 3MFSA 4WVFB 1V5PA 2Z0PA 2VTPA 2HW6A 1ZMVA 5IQDA 1W84A 3C9WA 2Y8GA 3UO6A 3ELJA 3ZO1A 5HIDA 4QPMA 3HEGA 3QUDA 3DGKA 3QX4A 4L7FA 3LZBA 4CT2A 5F9EA 3GB2A 5TOZA 4S31A 4LYNA 4HVIA 1Z87A 2Z2WA 2M14A 4ANQA 4MXOA 2P55A 5G6VA 3ZUUA 3TCAA 3B2WA 2ZV7A 3KGAA 4QTBA 4BBMA 3SVVA 5HGIA 3G90X 4TYHA 5HIBA 3RNIA 4BGGA 4I4EA 2H9VA 3FZ1A 4IC8A 4MBLA 4XBRA 5E8VA 4KUJA 2XS0A 2A1AB 3U4WA 3RCJA 2NRUA 2XJ1A 2DA0A 3EN7A 4LRMA 5LMKC 3FZOA 3A8XA 1OIRA 3QAME 4BF2A 2QC6A 1OL7A 2A2AA 2GHMA 2ITVA 4RA4A 4EMOA 1MRUA 1PXMA 5KMOA 2Q13A 2OIQA 2YDJA 3FZSA 2JLDA 4EZ3A 3KRXA 3QQGA 3AC1A 2XKEA 3L8SA 3DKFA 4MH7A 1DDWA 2BAQA 3KRRA 4F08A 2GNFA 2JAMA 2UW8A 4J97A 4CSVA 2IW8A 4L00A 2W1IA 2QO2A 1XBBA 4JL9A 2QCSA 4F6SA 5HVKA 5AP6A 1XO2B 3JXWA 2WIHA 4C7TA 4DGNA 4BZOA 2YACA 5C4LA 4FEWA 3IQ7A 2PUNA 4X2GA 3FI3A 5AP3A 5CI6A 3PRFA 4H39A 4EH4A 5M08A 5CASA 4AOJA 2VAGA 4PMSA 3Q4ZA 4TWNA 1P4FA 5FGKA 3OOMA 3W10A 2BTSA 4FKTA 3U54A 3QIJA 4LOPA 3RBWA 1YDTE 4DINA 4AZTA 2W96B 3OS3A 4ZJIA 2W1CA 3P78A 3CPBA 3TDWA 2O5KA 3KVXA 4YLKA 4W8DA 5AAFA 3EQBA 4AGUA 4U43A 5E8XA 1H0WA 3G15A 5HNBA 2R3HA 3DDPA 2Y7JA 3EYHA 2BR1A 3G9LX 5KQ4A 4PRJA 3HECA 3E64A 4N0SA 5IG1A 3BQCA 3BLRA 3NIEA 2P2HA 5DIAA 2JKMA 3G2FA 3I4BA 4YBKA 1NT2A 2RGPA 1J1CA 2VTMA 3EKKA 2HZNA 2QKMA 2JDVA 2R3NA 3GU8A 4GFOA 5AMNA 3MPMA 1SNUA 3ODYX 4UY9A 4GV1A 3TWJA 4IAYA 4BYJA 4M14A 4OTHA 4RJ4A 4ZEGA 3BKBA 4O7RA 1M2RA 4FTJA 4UWCA 3DJ7A 5HOAA 3AU5A 3DB6A 3P4KA 4M8TA 4XRLA 4F09A 5HO7A 4M66A 4HAYB 2WTKC 4I6BA 2D10A 1Q8UA 3W16A 3LJ1A 1IA9A 4FV3A 5CXHA 4HNIA 4D0XA 3LHJA 4N6ZA 5FP6A 5C5BA 2X2MA 1AQ1A 3TNIA 3WZKA 4BTJA 2CAYA 2NZ8B 2J0MB 4FUXA 4AN9A 2OICA 4O81A 4XLVA 1E5WA 5GINE 4FKRA 3R04A 3VS6A 3PY0A 2LYDA 4FZFB 3D7TB 4IFCA 4NSTA 3THBA 2VX3A 3LFNA 2VWUA 2PVKA 3HMOA 2V7OA 3E92A 3R7IA 2Y7BA 2Q0NA 1U59A 4E4LA 4C3PA 4P5QA 1VEBA 3AJ4A 1ZMUA 1A06A 4D1SA 5B2KA 2JDSA 2WMTA 4R3PA 4CKRA 4Y8DA 1ZWSA 3D8DA 4K2RA 4G6LA 5KO1A 4DX8A 3UQGA 2VZ6A 4PL4A 3ENHA 1KV2A 1SNXA 3DCVA 3UIUA 4Q5HA 3TJCA 4TKSA 3CE3A 3GU5A 3DU8A 2OFUA 4LG4A 2ETKA 4MNEB 1YHWA 2QOBA 2Y4IC 3KSYA 1VYWA 4PPAA 3MA3A 2QNJA 4O96A 2C3KA 5HU3A 3CP9A 2GSFA 3RKBA 5A9UA 4EWHA 2BDJA 1H1SA 2CPKE 4HGLA 3DKCA 4LL0A 4ANOA 3O2MA 3R01A 4QNAA 5E8UA 4KD1A 5K0KA 4NKAA 4V04A 5TT7A 2YIRA 5LWNA 2JP2A 2JFLA 3GU6A 1XR0B 4GEOA 2GPHA 3QZHA 4QP7A 4ZTQA 4OTWA 3KMUA 2CRFA 1RE8A 5FG8A 4B8LA 2D2QA 5ETAA 4UMTA 5ANIA 3JUHA 4YMJA 3KMWA 4GPTB 2YS5A 3DXEA 1ZOEA 4S33A 3NUSA 3QCQA 5EDRA 3MA6A 4BCGA 2RNRB 3LLAA 4M7IA 3D4QA 3REPA 2E9OA 3C4EA 4DFNA 2EB2A 5KX8A 2YM6A 3UC4A 1WG7A 2CLXA 4TT7A 4MY6A 4WBBB 5EOBA 2J0KA 3C4ZA 3TNQB 2DYNA 2C47A 4C2VA 4BCIA 2QKLA 2YCRA 3D8EA 4QMXA 4DLIA 4FEUA 3R1YA 4U9AA 1UU9A 3EB0A 1WVHA 2GCLA 4KHBB 1PMNA 2QO9A 1PHKA 2H34A 4JG6A 2XUUA 3SXSA 1IASA 2I6LA 3A7FA 4FTQA 4UV0A 2C6IA 3ZSIA 2XM9A 2E2BA 5AV3A 2ITQA 3G33A 3F0WA 2WMXA 4QP8A 1PYXA 3QTRA 4E3CA 4QMWA 2ITOA 2V7AA 5DRBA 5J1VA 5HVJA 4CG9A 3JVSA 1TQIA 1Q62A 4DG2E 4IAZA 4BDKA 4E4NA 1H1QA 2XBJA 1X1FA 2D9ZA 2UVZA 3E5AA 3FZPA 3IW4A 1V88A 4NW5A 2WQOA 3SXRA 2OJJA 3P23A 3EL8A 4E7WA 4RFMA 5JKGA 4D2SA 2ITTA 4K9YA 2JBPA 3JS2A 2QG7A 3OCGA 2ETMA 4CHMA 4R3CA 3A61A 3QCXA 2IZTA 1U5RA 1YI6A 3QQUA 3R8PA 3KN6A 4FKGA 2R5TA 3GOPA 4TW9A 2XF0A 4DBBA 4W9XA 3GC7A 4C59A 1OI9A 1Q99A 3BBTB 1YWVA 2W1EA 3S2PA 3DK7A 3OZ6A 4XV1A 3DV3A 4M84A 4YUQA 2C0OA 3LXNA 3GBZA 1ATPE 3PZDA 4GG5A 3DLSA 4O84A 1H25A 3EYGA 4M97A 5CU4A 3PG1A 5D10A 3ZSGA 5HTIA 2DN6A 4H1MA 4UXLA 3LMIA 4ZS4A 1WFCA 3W18A 1CSNA 4IVCA 2ZAZA 2W1DA 4BI1A 3ORIA 1J1BA 2F7EE 4Y83A 1ZAOA 1ZOHA 4F63A 2I40A 4ZP5A 3RCDA 4GMXB 4HAXB 5DR9A 4APPA 2ROVA 2WIPA 3UZPA 2BRBA 3KKVA 2QHMA 5E8TA 3GCUA 4BDFA 5B7VA 5KMNA 2ZPYA 2B1PA 2FO0A 3QTUA 4LUDA 5FTQA 3RINA 4IBMA 4IM0A 5JRSA 2QI8A 3DXNA 3FKLA 1BKXA 3PJCA 4FZ6A 4EYMA 4NFMA 3H3CA 5JN2A 1MPHA 3R9HA 1YXXA 3KXHA 3OEFX 1KE6A 5AM7A 3ZEWA 3JR1A 3PJ2A 5AUTA 5E8YA 5FDXA 2X6DA 1R39A 2E9PA 5LWMA 3G51A 5IZFA 1EF1A 1H08A 4IZAA 3N4TA 4ITHA 3BPRA 4RIWA 1ERKA 4YHFA 3SW7A 2RF9A 4JQEA 5K3YA 3MH1A 4FVRA 4CZYB 4EHGA 4WJ7A 3MSSA 4ZS0A 1W83A 4EH3A 4NU1A 2OK1A 3DBEA 2WMAA 3EL7A 4Q2AA 2CKQA 3UO4A 4FTOA 4WG3A 2BRNA 4QPAA 4XG7A 4MQ1A 1H28A 2X2LA 2PE1A 4RJ8A 3ZFYA 5LVNA 2DS1A 3BYOA 3DQWA 1LEZA 2W0JA 2W2XD 4QMUA 5I9ZA 2A19B 3I6UA 5BVDA 3DDQA 5AV1A 2OSCA 5CSXA 2D9VA 4X7QA 3IECA 4DCEA 5JFXA 4F7SA 4QTCA 3C5UA 2RFSA 1IAJA 2QQ7A 3WZDA 2D9WA 3QQHA 2O63A 2YEXA 4MXXA 3QWKA 4E5WA 1Y8GA 4E6CA 3BYVA 3ALNA 3OW4A 1Q61A 5IUGA 1W7HA 5E8SA 4D4VA 4WUNA 3N4UA 4YZMA 4JQ7A 3MB6A 4CFWA 4ANNA 2X8IA 3EMGA 2SRCA 1TQPA 2BHEA 2J0IA 4MTAA 2WQNA 2OWBA 4QYYA 4XLIA 3PYYA 3TV4A 4YZCA 2BKZA 3MIAA 4RVKA 2WAJA 3ATTA 4E4MA 2YRYA 1Q67A 3FLQA 3AD4A 3CTHA 5AFVA 4AZVA 2BUJA 2R3GA 3VS0A 1M2QA 3EN4A 4OBQA 4M67A 3KC3A 3TNPC 2BCJA 4A9TA 5M07A 4HGSA 4QYHA 3VF8A 4AW5A 3GI3A 3LQ8A 4J1RA 3SAYA 3G9WA 1CM8A 3RP9A 3UYTA 2RL5A 5DBXA 4OTPA 5KNJA 3AC2A 4FT3A 3UOHA 1DAWA 5FI0A 3TZ9A 3UOKA 1YW2A 4O2PA 2YS1A 4GU6A 1IAHA 4LV5A 1UKIA 4UWBA 1NI2A 1M7EA 4FOBA 4RC4A 3PZHA 3SGCA 5E8WA 4UMPA 2C5XA 1BTKA 3R63A 4YSJA 4YZNA 1SZMA 4HNFA 4KBAA 4BCQA 4C58A 3QRUA 5AUUA 2YM5A 2YERA 1FMOE 1EGXA 5A14A 1GZOA 3PA3A 4E20A 1A9UA 4ZTNA 3UPZA 2BIYA 3PJ3A 4FYNA 2VTRA 2XIXA 2XK3A 2QKRA 4G3GA 4KKGA 3AU4A 2GTNA 4FSYA 3VS4A 3NLBA 4EOMA 5CVGA 2AUHA 4KVGB 2J0JA 1H24A 3OWJA 1G8AA 4CYIA 3ZMMA 2OJ9A 2BVAA 1FVTA 5J5SA 4FT5A 1YRPA 4NM7A 4XP2A 5F4NA 2JDRA 2VTTA 4B0GA 5F95A 2FA2A 3PDTA 1UU3A 2W05A 4RWKA 4DTAA 1YDSE 2PU8A 2W4KA 1I2HA 3Q4CA 3QTZA 5HLPA 3TM0A 4D2WA 3R1NA 3DXPA 3ZUTA 4QP6A 2WPAA 1WI1A 4DEEA 3SNHA 3EKNA 3P6AA 4WRSA 4FV8A 3HV7A 3V5LA 4GS6A 2PZPA 1QC6A 1L3RE 3M42A 1KUTA 2Z02A 2VX0A 4HZRA 4RZVA 2GJYA 2OXXA 4WIHA 2K2JA 2ITNA 4O0RA 1U5QA 4HATB 4KKHA 4AX8A 3ZVRA 2P33A 3EZRA 3IDBA 4NCTA 2XEYA 4JR3A 4QTEA 4F9CA 3QXPA 5CF8A 4TYEA 3U6IA 4V05A 4PPCA 1BMKA 4USEA 1H10A 3Q5ZA 2GMXA 3PP1A 2Y6OA 1W0XC 3OCTA 3UMWA 3ZH8A 3EHAA 2WFYA 2C30A 4G1WA 3RK9A 2NNWB 3BHHA 3F5UA 1M17A 3QGWA 4IWPA 4UXQA 5GIOE 3NNVA 2OG8A 2C0TA 4TZRA 3DXDA 3QD0A 5C03A 2E9VA 4FV6A 4C57A 4DX90 3MB7A 2HWOA 4IDTA 3G0FA 4PY1A 3SLSA 3ZFMA 4X6RA 2BZJA 4OTQA 4QQ5A 5HLWA 3CGFA 4AT4A 2WZJA 2ZV2A 1B39A 5A54A 4ZTRA 4G31A 2C5OA 3EFLA 3UNJA 3Q32A 2ADZA 2GTMA 4IAFA 5EYKA 4Y72A 4XG8A 4I4FA 3P08A 4XV3A 3QC9A 3C0IA 1STCE 1Q24A 3ET7A 4D2TA 4ERKA 5E4HA 5AP4A 3FV8A 4A5KA 2J59M 3CJGA 4QT1A 4FV9A 3DPKA 4B6LA 5F20A 5T6KA 3LKMA 3R1QA 2W4OA 4J71A 3CQUA 3UQFA 2H7DA 1MK7B 3LXKA 4D4RA 5JK3A 1ZARA 4V0GA 5HCYA 4KWPA 3DBQA 5IQHA 2EMSA 1CKJA 4F4PA 4YJVA 4K17A 1ZZLA 1MRVA 4C4FA 4EH2A 4HB4B 4KAXB 3E8DA 3LFAA 1YVJA 4J53A 3C13A 3C4WA 3G6GA 3I0OA 4PDYA 5IQGA 4A6FA 5FTOA 2WB8A 4K6ZA 3NZ0A 4RJ6A 3E87A 4O1PA 3TZMA 2CY4A 3NUNA 2GQSA 4FIGA 4JXFA 4I24A 4BCJA 3W8LA 1UNQA 4BRXA 5JFVA 2HZ4A 4JBVA 4XMOA 4F1TA 1Y57A 2C3JA 2ZV8A 3ORMA 2JFMA 2WU7A 4PDOA 4ZLYA 1CKPA 5L4QA 4UB7A 4RBLA 1UPRA 1DI8A 3KMMA 1OL1A 1DAYA 4BFMA 3FEGA 4J98A 3E88A 2GQRA 4FKOA 2GHLA 3PIZA 4QMQA 3AG9A 4ITJA 5EDQA 2G2HA 3RK5A 4EK3A 4K2PA 2ZDTA 5KE0A 3QXOA 5C1QB 3WE4A 4G3FA 3TTJA 2GNIA 3PE1A 4R1VA 1Y8YA 3HRBA 1X1GA 3A2CA 3NCZA 4O0UA 1JKTA 4DBNA 3MN3A 3VRYA 4EOLA 1WGUA 2C69A 1OQNA 3GC8A 3C0HA 4O6EA 1ZM0A 3H9RA 1PKDA 4MAOA 4R8QA 4TXCA 2VTOA 5CEOA 1MIXA 3CJFA 2H8HA 2ITYA 4BHZA 3S00A 2VSZA 3G6HA 4C02A 4O0TA 1PFJA 3FXZA 1DBHA 2Z7QA 3CLYA 5CAPA 3BLQA 3P7BA 4BWXA 4R78A 5A3XA 5I4NA 2PVYA 4FEVA 4FGRA 3BHUA 3UZRA 2A0CX 1CTPE 3D5WA 3NWWA 3UIXA 4EORA 2W1GA 2IVVA 2M38A 2BDFA 1WJMA 3IW5A 2VWZA 3A4OX 3R8MA 4A6HA 1UV5A 1ZSQA 2YWPA 5CWZA 5C4KA 5EI8A 1YI4A 5C6RA 3TL8A 2FH9A 5ACBC 3NYNA 2KCJA 3NDMA 3F3VA 3R73A 2UUEA 4AOTA 5KKRC 1SM2A 4DITA 2KUPA 2VKIA 3RWPA 4YJUA 4EBVA 2XK7A 3NW5A 3OFMA 4BL1A 4IACA 5EM6A 2X7FA 3FMEA 2BFYA 3MPAA 4CCUA 4BKZA 5E8ZA 4XYFA 2WQEA 4DGMA 5KBQA 3PPKA 2P0FA 2X8EA 2YLEA 3QQFA 2QG5A 4BZDA 1QL6A 3R00A 4E6AA 2X7GA 5C8KA 3AMYA 3DNDA 2VD5A 2XIYA 1Y6AA 4HHVA 3Q2JA 5G1XA 3ZYAA 5L2WA 3R7YA 2YABA 3ANRA 3SG8A 4DBXA 1FOEA 3RWQA 1BI8A 4CEGA 1YHSA 2XNNA 1Q3DA 3HNGA 3MTLA 3MW1A 3ORKA 3OW3A 4FKLA 4OR5A 5HE2A 4OLIA 4K33A 4ANLA 3RAKA 2PPQA 3QTSA 2WTKB 3RJCA 4J95A 3AGMA 4I0TA 3VBYA 3UP2A 4A9YA 2QU5A 4CMOA 4CKIA 5IH4A 4O7TA 2YDIA 4WT6A 4BDCA 3QYZA 4DG0E 4MF1A 2UW9A 4IJ9A 3Q52A 2YT1A 5J3TA 3FE3A 1OUKA 3SG9A 4BTKA 3KULA 5EK7A 3VC4A 3W2RA 4OAVB 3F82A 2LG1A 1H1PA 2EVAA 3HA8A 1R0EA 3PWDA 3IGOA 3UIBA 5JGAA 5IEYA 2FGIA 4HAWB 5D27A 3B2TA 4F6WA 4EWQA 2ZJWA 3A7JA 4AS0A 4IX6A 5CLQB 4OT5A 3V5QA 3GYPA 4BGQA 2F49A 4RGJA 1CMKE 4FL3A 3QD2B 3FY0A 3SX9A 3P7ZA 4ZRIA 2PVHA 3PXRA 4WBOA 4KS7A 2BZIB 5C01A 3VUHA 2IYBA 4ZZOA 4LQMA 4ACGA 1Q3WA 4JOAA 4C4JA 3O7LD 5FLFA 4O91A 4G9CA 2UVXA 4AAAA 5DT3A 5DMZA 4B4LA 3PRIA 5GZ8A 4AZFA 4ZRKA 4EZ7A 3R8UA 3TNWA 3F88A 3UDBA 4O7NA 5EQPA 3EH9A 2YAKA 3CD3A 4ZSEA 4PL5A 5EH0A 2R3FA 3UBDA 5A4LA 4EC8A 4TWOA 4O1OA 1KE8A 4U7ZA 2HTHB 1W82A 4QQJA 3KCKA 3R6XA 4IB3A 4B9DA 4NM3A 2DKQA 2EJ8A 4ASEA 3QC4A 4NL0A 5L6PA 3GCSA 2YJSA 5L81A 1X05A 3KZ1A 3QTIA 4M0ZA 3L8XA 1FMKA 5IDPA 4X6QC 3CGOA 5CU6A 1S9JA 2UZDA 2WEVA 2OTXA 3N51A 4JIAA 2J51A 4FL1A 4KNBA 4NFNA 3E7VA 5FD2A 2EXMA 4QNYA 4C37A 4ZSAA 2P0DA 5DIFB 4I5MA 3NS9A 5JEBA 4IX3A 1PMSA 3A7IA 2XMYA 1R0PA 3DAEA 3VNTA 4BI0A 4PTGA 3MIYA 4CLJA 4QMTA 3WI6A 3T06A 4MVFA 2KTYA 4LMUA 4BI2A 2VWBA 4X2JA 3NSUA 4FV1A 1YOJA 3RM6A 5HEZA 4L68A 3ODXA 4R6VA 1GZ8A 2WGJA 3KK8A 4OT6A 2IJMA 2YISA 3ULCA 2J9MA 4NM5A 5AV0A 5LQFA 5AIRA 4JNWA 4GVAA 2ONLC 5DOSA 5CAVA 1IG1A 1URCA 3BCEA 1XODA 2VO0A 4U5JA 5EYCA 3BINA 1FVRA 2C6TA 3NX8A 3O7LB 4YTIA 3A99A 1XH5A 2FSTX 3LPBA 4TPTA 5KUPA 4MBIA 4E73A 2E9UA 3MVLA 5DT0A 4IVAA 3VF9A 5L6OA 4II5A 2YA9A 2I0HA 2R0DA 5CEPA 3IGGA 2C1BA 4ZMEA 5A46A 3VUMA 1V0PA 3OVVA 1YWNA 5EM5A 3C50A 3VJNA 4RQVA 4EUTA 1FGZA 4AACA 4GK3A 2PMOX 1BTNA 3NAYA 3D2IA 3Q60A 2R3PA 5B2MA 4AT3A 3MJ2A 1TVOA 5FRIA 2UZBA 3DB8A 2PZIA 1KE9A 3QA0A 3U6HA 3V5WA 1X11A 3KY2A 4BGHA 1ZMWA 2B53A 3EOCA 3PJ8A 5JGDA 1IR3A 3EQFA 3Q9YA 4I41A 5H3QA 1ZY5A 3VBWA 4WHZA 5BUIA 4RIYB 1WVWA 4IWQA 5I9XA 3H9OA 3UVRA 1WJ1A 3IDPA 4KRDA 3E3BX 5JSMA 4O83A 4KABA 5EQYA 1Y5OA 3NUAA 3EWHA 4DFZE 2WELA 3DTWA 4O22A 4ITIA 3U55A 3FLZA 4BCKA 5KBRA 2RFNA 2WTWA 3LLTA 4L44A 4FKVA 3T3VA 3VO3A 3VS7A 3DTCA 4CFXA 2B9IA 2WNTA 3D7ZA 4ZXTA 4ZIMA 4D4YA 4YURA 3IOPA 4DF3A 5M4IA 5B2LA 2WTDA 4IDVA 3BEAA 3DZQA 4JG7A 5L6WL 4HDOA 3P9JA 2R9SA 3LFQA 3ZM4A 2W9FB 2NRYA 4G3DA 4L53A 1OL2A 2HENA 3HW2B 5EKOA 2DHJA 5I0BA 1W98A 4BDEA 2PSQA 4WNKA 2WQMA 1FOTA 2WXVA 2WMUA 2QOLA 2CGXA 3ROYA 3QQJA 4RSSA 1XH4A 5FXQA 1LPUA 3RGFA 1N3HA 4S32A 5H8GA 3OXTA 3GC0A 3GOKA 3MJ1A 1GIHA 1APME 3R1SA 4H3BA 4DHFA 4RC3A 2YF0A 2ACXA 4GN1A 3VUTA 4ENYA 3DT1A 3JVRA 1H0VA 3GGFA 1NY3A 3IS5A 5DA3A 3HAMA 4CYEA 3F66A 5IQCA 4FKWA 2R0UA 3ZSHA 3HUCA 4TKNA 2R7BA 3VUGA 2HWPA 2W7XA 3D2KA 3T9TA 3F3UA 2G01A 3HAVA 4E5BA 1F3MC 5KHWA 4IVBA 2R64A 5HG8A 4RFYA 1FQ1B 3DNEA 4IAAA 5T3QA 4B6HA 3ZDTA 5JT2A 5AR8A 3MY1A 4BWKA 2ITPA 2J0LA 3GYOA 4RIXB 4U80A 2RSVA 4GRBA 4FNZA 1OUYA 2BPMA 2B55A 4U6RA 5ACKA 5F1ZA 1OIUA 2O2UA 2GS0A 2XM8A 3MPTA 2X9FA 3DZOA 3KA0A 3E3PA 4YNOA 4EI4A 1PF8A 1V0BA 3O8PA 2COCA 3WYXA 3MDBC 2WTIA 1XKEA 4WG5A 2J4ZA 2WHBA 4CFVA 4ALUA 5L3AA 1UPQA 2PZYA 3MH0A 4FSUA 4YPSA 4O7WA 2B9JA 2IVUA 3W2CA 5BYLA 5JLJB 3CQWA 2YS3A 1I09A 1WBOA 3N9XA 1ND4A 2OI4X 4FIFA 2YJRA 4FTMA 1TQZA 4P4CA 1H26A 3ENMA 2X1NA 2VGPA 3DA6A 5AADA 3MYGA 4JS8A 5IA1A 4ZRJA 4FSTA 4FICA 4DFXE 4I6FA 2WU6A 3TN8A 4D55A 3BZ3A 3NW6A 1ZOGA 4QQCA 5HBJA 2VU3A 3QBNA 5DEYA 4W4WA 4GIIA 3H0ZA 4RFZA 3NYOA 4DLJA 1UWHA 2BALA 4WNMA 3HV3A 4O7YA 4O21A 1PW2A 4I5CA 4EZ5A 3QKKA 4RX7A 1GG3A 3ZM9A 4CCBA 4ZJVA 2OIBA 2HELA 4ZY4A 1DS5A 4CNHA 5FBOA 4YJPA 4USFA 2XQNM 1L8TA 4HVHA 5IQFA 4PP9A 4RVMA 3TKIA 2DYLA 4F0IA 3PG3A 5J7BA 2K2UA 2VTQA 4ZZNA 1NA7A 4MK0A 4IZYA 5J5TA 4FIEA 2W4JA 3WILA 4CYJA 5DWRA 4XV2A 4B99A 1F5QA 2OQBA 2VTJA 5J8IA 3NYVA 4EONA 4NYEA 4O7ZA 5I9UA 3PP0A 4FR4A 4NJ3A 4YPDA 2IO6A 4MQ2A 3DBCA 4O0SA 4A6KA 2QOOA
chains in the Genus database with same CATH superfamily
4MT7A 2HW7A 5DVRA 2QD9A 4FUYA 4D1ZA 4YR8A 4QP1A 4AA5A 2P0CA 4Z2MB 4LV7A 3BHVA 3W2QA 4L46A 4ASXA 4HCTA 4TYZA 4AT5A 2XNPA 2X9EA 4CQEA 2G35A 3BQRA 3ZZWA 3WZUA 2EC1A 2XKCA 3D5VA 4YZDA 5DH3A 4ZTHA 2B9HA 3UIMA 2VWWA 3HL7A 5CI7A 5BNJA 5HZNA 3N7CA 4GFGA 1KOAA 3Q3BA 4PV0A 1Q8WA 2EUFB 2PMLX 4QMMA 3CSVA 3FHIA 4L43A 1R78A 1UA2A 2C6DA 5BPYA 1Q5KA 5D3VA 4O86A 1Z57A 4Y5QA 3O23A 5CLPA 4YJTA 5BMSA 3O96A 4YL8A 3PXYA 3Q5IA 3R7VA 4WRGA 4ACDA 2Z0QA 2O64A 4MHAA 4XWXA 2X0QA 3ORLA 2L2IA 2XH5A 2WD1A 4W4VA 1W2FA 3LM0A 3RHKA 3RZBA 1O6LA 4F7HA 4LRJA 3GVUA 2W9ZB 1UU8A 5H2UA 1H4LA 5AP0A 5FWKK 2C1AA 4ZSGA 4ZY5A 3I5ZA 2PVFA 1BL7A 3HKOA 1U54B 4NIFA 1CDKA 4BYIA 5KMJA 4EH6A 2DHKA 2V55A 4GKIA 4AW1A 3ZO4A 4FF8A 4YBJA 4E6DA 1OIQA 4X0MA 1NW1A 4KKEA 2CN5A 1P2AA 1XWSA 4F99A 3SV1A 3KEXA 5DGZA 3WYYA 5CZHA 3HYHA 4HW7A 2NP8A 4O4EA 3R7EA 1EVHA 4PQ0A 4IH8A 4GVJA 4RLLA 1SHCA 4YJQA 3Q4TA 2Y4PA 4PUZA 4BIBA 4HAUB 3V01A 4EOIA 4BDJA 3HMIA 4KBKA 2UZSA 4F9AA 1PLSA 3BYSA 5ANDA 2VTSA 4L6EA 4KS8A 4O6LA 3AOXA 2VUWA 2V22A 1X86A 5DRDA 2PE2A 3O71A 4FA2A 3BWJA 4ASDA 2OZAB 4HPUE 3P7CA 4WNOA 3EN9A 4UWYA 2BRMA 4FTUA 5J3YA 3VS1A 4GJ2A 2DYQA 5C8NA 2BIKB 3R7OA 1U5FA 3RHXA 3CKXA 3O8UA 3OWPA 1RQQA 4YZBA 3RCPA 2XKFA 2B7AA 1RJBA 2W1HA 3OBGA 1GZNA 4XNEA 1XH9A 3VS5A 4JMQA 3H0YA 3F6XA 2IVTA 5CX9A 2J7TA 5FP5A 3PG7A 4KIPA 3DBDA 3OF0A 4D9UA 3BL7A 5TO8A 4WD5A 4I1ZA 4AZWA 4QYEA 4O7SA 5EM7A 1YQJA 4RLKA 3RM7A 4MEDA 5CAUA 4GOUA 4DHJA 4E4XA 3P86A 4EOSA 4FKJA 4R7IA 4YGAA 4IM2A 3TV6A 2OH0E 4I92A 2ZM3A 4D2PA 5GZAA 2PY3A 3RMFA 4MYGA 4DGOA 5ETFA 3RI1A 2ETRA 4JLCA 4CT1A 3AC8A 4IADA 1WZYA 3Q53A 4GJ3A 4C4IA 3CBLA 1OKWA 4JDIA 4KINA 1Q8YA 4MX9A 3LOKA 3DKGA 3M1SA 3VBQA 4MBJA 3BRBA 3PPJA 2EU9A 4FZAB 4AXAA 1FAOA 1YXTA 2IN6A 4BC6A 2GNJA 4K18A 3W8QA 4C34A 2X39A 3UNZA 1OPKA 3ZFXA 2C68A 2IZRA 3A58A 3FY2A 3ORZA 2BDWA 3VBXA 4CG8A 4C8BA 3ZBFA 1NVQA 2VRXA 4RWJA 2BFXA 3DY7A 1VZOA 2UZVA 4FV7A 4IB0A 5AP5A 2GQGA 4LOOA 5HKMA 3RPSA 3TG1A 4BB4A 5IMEA 5KKRB 1NTVA 4WSFA 4FKSA 4I6LA 1GNGA 2C5YA 4I0SA 4BCMA 3EFKA 4L42A 4BKYA 2PZ1A 1KSWA 2LGCA 3L1SA 2JKKA 2RFEA 4GG7A 1H27A 2Z8CA 4HSIA 5AP2A 1MKEA 5GIPE 1R3CA 3O0GA 5ANKA 3BEGA 2HCKA 4MWIA 1G8JA 5E9EA 3GCQA 2WMBA 1URWA 4A9UA 4D0WA 4WUAA 5ETIA 2E2XA 2AQXA 2PVJA 3BBWA 4R7BA 3BHYA 2XNGA 1H01A 4J8MA 5IA4A 3VONA 1XH7A 4IANA 3PLSA 3F7ZA 3O8TA 2W99B 4UMQA 4CMTA 3LFEA 4FV2A 4F9WA 2Z7RA 3NNXA 1QMZA 3QQLA 4XOZA 5CNNA 1W1GA 4RX9A 2D9XA 2P3GX 3PPZA 5HE0A 3KRJA 4PMTA 5DFPA 5CALA 4D0NB 2OXDA 3LCDA 4L01A 2K00A 4LM5A 3ORXA 4IEBA 3TCPA 2ZDUA 1JNKA 4QO9A 3V6RA 4XV9A 5JZJA 5FM2A 1PKGA 4YU2A 4C4EA 4M3QA 4RIXA 3NW7A 3HRFA 3R8ZA 4EH8A 3A8WA 3CEKA 4R77A 5FXRA 2UZOA 1KWPA 1NU2A 3SRVB 3PWYA 4DHZA 2YFXA 1B6CB 3QKLA 3OG7A 5IUHA 2XAMA 2Y6MA 3EQGA 3V8TA 2PUUA 3UOJA 4EKUA 4Y5HA 2W1FA 5BX0A 4FBXA 5LMBA 3COHA 2YM4A 2JITA 3HV4A 4XG4A 2BRHA 2XNEA 1U46A 3TXOA 3DOGA 4GL9A 4QP4A 4JIKA 4JQ8A 3KCFA 3U6JA 1MP8A 3S4QA 3PXZA 3CY2A 4FZDB 3UOLA 4BDBA 1P4OA 5LXMA 1JKSA 4H8SA 2XK6A 4HOKA 2I5CA 3P5JC 4FVPA 4PX6A 3OOGA 3HA6A 2F7ZE 2J0MA 3MESA 4FE2A 4HYUA 1G3NA 5EW3A 4EK8A 3LAUA 5KMLA 2Z13A 1GAGA 2YLFA 3D9VA 3UE4A 1MUOA 4M13A 5DPVA 1OGYA 3JY0A 2PUPA 4A4XA 3D7TA 2HZ0A 4EKLA 4NSWA 1OGUA 1G8SA 4IX5A 2R3KA 3WIGA 3ZDUA 3ZO2A 3WF8A 5CU3A 3FPQA 2DTCA 1QCFA 1Q41A 4DFYA 1UNRA 5FQDC 4HJOA 3R21A 5GNKA 4DE4A 3ZLXA 1YOLA 4YC3A 3R9RA 4ANSA 2BMCA 4AXDA 4R1YA 4P5ZA 4W9WA 2C3IB 5CS6A 5HG9A 4FNYA 3ZONA 1FHXA 3CR0A 5CSHA 2J5FA 2VWXA 3KVWA 4GH2A 4ZJJA 4USDA 4A9SA 5EFQA 5IPJA 3FM8C 4U0IA 3BGZA 1H07A 2I0EA 2YCSA 4M12A 4MCVA 4DCAA 4EHZA 2R3LA 3BGQA 5BYYA 4HB2B 4BZNA 4G16A 4AAYA 4FG8A 5JHGA 2XYUA 4RJ5A 3ZOSA 2OKRA 4OTDA 4G17A 3A62A 3HK0A 4RVTA 4DA5A 3VS2A 4AZEA 1M52A 4MNEA 3NCGA 4IMYA 2AEGA 3BYUA 3RAIA 3VVHA 3MPXA 4QMNA 4EK4A 3M2WA 3C4CA 3R22A 5D41A 3OTVA 4GFMA 3AT3A 5CY3A 5JRQA 4DH1A 1YHVA 3DAJA 2MWNB 2YM3A 3BV2A 3H10A 3OXIA 4YJOA 2J90A 2XKDA 2YN8A 3P1AA 2Z0OA 2JDOA 2YITA 3VBVA 3W55A 1K2PA 2PYWA 2ELAA 3U7DA 1UWJA 5CQWA 1OL6A 2ZV9A 4TNDA 3DQXA 1GJOA 3R9OA 1J7UA 4BR3A 4HGTA 4EQMA 4TL0A 1PMEA 2ZOQA 2R09A 1NVSA 2GNHA 2W17A 3PIYA 3WOWA 2EB3A 4BBKA 3LCKA 4EH5A 3U12A 5BVFA 4YSMA 2OH4A 2FB8A 4YONA 3EQHA 4GMYA 3OHTA 1HCLA 3PXFA 4JRVA 1ISNA 1GC6A 2YZLA 3NVKI 3EZVA 3UYSA 5E7RA 2VTHA 3RPOA 4AF3A 4ACCA 5BUJA 4OBOA 2AC5A 5AX3A 4EH7A 4KHBA 4D28A 2OFVA 4U45A 3UC3A 2FYSA 1E1VA 4F9BA 4DDIA 3UTOA 3FZRA 3IOKA 4QMZA 3OY1A 3RPYA 3VBTA 2GU8A 2JBOA 4TN6A 2OZOA 4MD8E 5DG5A 3VULA 3NEWA 1K5DB 2K49A 2IG7A 1U54A 3D5UA 5M51A 4EUUA 1P14A 4D58A 1FB8A 4GU9A 2N23A 2KULA 3U87A 4Q9ZA 4OTGA 4HVDA 5H8BA 5DN3A 4KBCA 3FQSA 1J7IA 2R3MA 3FXWA 2Z60A 4C36A 3I6WA 2FUMA 5CTPA 3NWAA 5DT4A 4HB3B 3IKAA 4TYHB 5D11A 4CD0A 1NVRA 5IKWA 4IQ6A 2B52A 1P3RA 5I3OA 4I0RA 4I3ZA 4QPSA 3BU3A 3VW6A 5FXSA 4FT7A 3IK3A 4JI9A 2UZUE 2X2KA 2DX1A 4Q9SA 4RX5A 3OTUA 3LJUX 2J50A 5HESA 3FMNA 3KF7A 3BJIA 5CVFA 3V8SA 1JOWB 3DJ5A 3PEGA 2RRFA 4FSQA 3UVPA 3WF6A 2OZAA 4U97A 2XYNA 3LJ2A 3DXCA 1SVGA 3G9NA 4NJDA 4U3ZA 5D1JA 3WIKA 3S0OA 4HB0B 3Q9ZA 2H96A 3H30A 5IRSA 2EWAA 4FT9A 4Z16A 4NTSA 2O3PA 5HI2A 2P2IA 2JGZA 3KXNA 4NH1A 4AA0A 1WBSA 1PXIA 4DEAA 3OCSA 4X3JA 2UZTA 5HVYA 3HLLA 4YTFA 4FK3A 4DTKA 3SYXA 5A4TA 3RAWA 2C0IA 4TRLA 3QL8A 3MFTA 3Q6WA 1T46A 5KZIA 5E92A 3L9LA 4H36A 1U27A 4DFLA 3F5GA 3R8LA 4Q5EA 2I1KA 3GENA 4FV0A 2YHVA 2YIWA 5AR5A 1BWNA 1KZGA 1R1WA 4RJ7A 5LVMA 5JGBA 4F1MA 4HYSA 2CCHA 1JSTA 3EJ1A 5K5XA 5JZNA 1LEWA 4CZUA 5FM3A 1OBDA 4L8MA 4G5JA 2AC3A 1LW3A 3MVMA 5KHXA 4FX3A 2EXEA 2B54A 3GCVA 4YTCA 2F7XE 2MDXA 1FBNA 3R71A 4CZTA 3U9CA 4ACMA 4BWPA 5JQ8A 4FTTA 3LQ5A 1BAKA 4ZLZA 1PY5A 2GFSA 3OROA 4L9IA 4IOYX 3OUNB 4G3EA 5CEIA 2JC6A 3UP7A 3TUDA 2PVRA 4AFEA 3AGLA 2VO3A 5LMAA 3UZTA 2UW7A 3ZHPC 3F5PA 4HGEA 5EHLA 3GQLA 3TTIA 5I9VA 4Z2NA 1SVEA 2GFCA 3BIZA 3R0TA 3BU5A 4PNKA 2D11A 3CKWA 1MQBA 1K9AA 3K54A 5A4CA 1YDRE 4QJ3B 5AP1A 4IM3A 2R3JA 3PY3A 3LFSA 3DCXA 5HCXA 1SMHA 5BVOA 5C5BB 4QQTA 1ZYSA 3EIDA 4BCOA 4F7JA 2VV9A 4FTRA 3F3WA 4C38A 2HOGA 2JAVA 4NY0A 3AC3A 2Y8OA 2VX1A 3HV5A 4ALVA 1ZXEA 4DEHA 5J9ZA 5J9YA 2QLQA 4UN0C 3UG1A 2CNQA 2X81A 4Z3VA 3TFMA 4QYGA 2VWIA 3QKMA 3D5XA 5AR3A 3W2OA 4BDIA 4DN5A 1U5DA 4PNIA 2J6MA 2DQ7X 1VYZA 1YXVA 2W5BA 3QCYA 4LOQA 3ZUVA 4C33A 5E1EA 4JRNA 2VTLA 3F2NA 4PDSA 1G5SA 1NXKA 3PVBA 2DX5A 4JJRA 1V61A 2A4LA 2BAKA 3VUDA 1U5EA 1P5EA 1Y91A 2HK5A 1ZZ2A 4QMSA 2XJ2A 1RJ2A 3TDVA 5EDPA 3K3JA 4LGHA 2XANA 2HYYA 3NNWA 2VO7A 4NWMA 2IW9A 3R9DA 5JMSA 2YM7A 3BU6A 3FQHA 3OMVA 1XCGA 3VN9A 1FINA 1VR2A 4AU8A 5M57A 4AGCA 4IAPA 1YI3A 5AX9A 4EH9A 1ZYDA 1MI1A 2RG6A 3EQPA 3F7WA 3PZEA 3SRVA 4GMVA 2W5HA 4CXAA 4EC9A 3Q4UA 4D2RA 3I0QA 2E9NA 5DR6A 4ANMA 2HZIA 4PP7A 5GOWB 2XNBA 2F2CB 5BVKA 2I0VA 1REKA 3D0EA 4E6QA 4D9TA 3UQCA 4M15A 2WOTA 3QYWA 3I7CA 5CSWA 5GZ9A 3S95A 3LCOA 4RPVA 4TWCA 4W4XA 4ZK5A 5AP7A 2LOZA 1U29A 5CXZA 4QP3A 3ODZX 5J9LA 4GZUA 5IEVA 1WBVA 1PXJA 3EQRA 2CN8A 2WMRA 3FKOA 3GXLA 3K5UA 4WSQA 2R2PA 5EI2A 3VQHA 1Q97A 4IW0A 1X8BA 4Z9LA 5EHYA 3ZLWA 2V5QA 3SXFA 2QOCA 3NIZA 1EH4A 3WZJA 4GIHA 2RKUA 4X2FA 4FIHA 1JAMA 3U9NA 5EM8A 4EHVA 1U5GA 2DLWA 3BELA 3PY1A 1OKZA 4FKPA 4U40A 3V6SA 3ORNA 1SYKA 3PA4A 3OC1A 5GJGA 4XJ0A 5HO6A 5C26A 4EOJA 1TXDA 4FVQA 3PP2A 3POOA 3FYJX 4ACHA 2EMTA 2CY5A 1PXPA 3BHTA 3FMLA 1XD4A 4JBPA 3RPVA 3PSDA 4LI5A 2R0IA 4FC0A 4QYFA 3A8QA 2BRGA 3NUPA 4NUSA 3QD3A 4YLLA 4B8MA 3I60A 5CNOA 3G0EA 1DYNA 3CTJA 1YXUA 4YZ9A 2GS7A 1DM2A 5EHOA 4E8AA 5J3QA 4K8AA 4CTBA 1WMKA 4J96A 4UEUA 5IISA 4OAUC 2PL0A 5E1SA 2Z7LA 4AP7A 3CY3A 4AUAA 5H8EA 3LVPA 3LMGA 4LFIA 4ALWA 4DH7A 5CU0A 3R28A 5K9IA 4FG7A 3HIEA 3PE2A 3RZFA 1J91A 4F0GA 4X3FC 4UZHA 2K8EA 4C4GA 5JH6A 4N4SA 1I44A 3UGCA 3W1FA 4RIOA 5HBHA 5CAQA 2HE7A 1IRKA 1DDVA 2C5NA 3GQIA 3FSSA 1BUHA 1XQZA 3EFWA 4AWIA 4DH3A 3HP5A 2LULA 4BDHA 3ETAA 3C5IA 2R3OA 4QRCA 4RRVA 2QOHA 3SC1A 2JDTA 2RIOA 2X4ZA 3DLZA 3LIJA 4G34A 3A4PA 3NPCA 2ONLA 2IZUA 3AT4A 5CENA 4TY1A 4FKIA 4R5SA 4YP8A 3KFAA 1H4RA 4JDJA 5DE2A 5L2QA 1JBPE 3C7QA 3R02A 2BHHA 3O50A 4DAWA 5CLLB 4IB1A 3V3VA 3WARA 1FHOA 3L8PA 3KXXA 3MVJA 4XEYA 5TR6A 1BX6A 2B0QA 4L3PA 5CEKA 2O8YA 5KMKA 2DHIA 2GCJA 2H6DA 3TW1A 2W2WA 4F7GA 3FMMA 3C4FA 2C6OA 1DROA 4I21A 4XUFA 5AUXA 2CMWA 5LARA 4UMUA 3FKNA 3H9FA 1OECA 1ZLTA 3OEZA 5FEQA 5I9WA 4H05A 4BY9E 3ZU7A 2FSLX 3NMUF 1GIIA 1YXSA 3B77A 4KIQA 4AW2A 2GCDA 4EOOA 4PL3A 4DEBA 1O6YA 1OMWA 5IQAA 4YJRA 3QUPA 5HE1A 4DXAB 5HNGA 3SKCA 4RWLA 3ZZEA 3TUBA 5J7HA 3ERKA 4IAIA 3VIDA 1OL5A 1IA8A 3VUKA 4RIWB 4CV8A 3ALOA 3ORTA 2BZHB 4O2ZA 4QXAB 5JP4A 2XVDA 4CFNA 5M09A 3QD4A 2JIUA 4FNXA 2ITZA 3TACA 4MXYA 1YOMA 2WMSA 1Z9XA 2UZLA 4BBFA 4HDQA 4YC8A 1XKKA 5D3WA 1H8FA 4O0WA 4RQKA 3CXBB 2R3QA 2JKQA 2G9XA 3PIXA 2D4QA 3L9MA 4DEDA 1ZY4A 3D94A 5J1WA 3TUCA 2D9YA 3JY9A 2OBJA 2XCHA 3GU4A 1K5GB 1SVHA 3HMMA 3VUIA 3Q04A 4CFFA 4RT7A 2XCKA 3AD6A 4G9RA 1EAZA 2ESMA 2PZ5A 2YDKA 3LFBA 4AGDA 3QZGA 1GOLA 1V0OA 3FZTA 4BICA 5LMKA 4KHOA 3AD5A 3MBLA 4JR7A 2PVNA 4Y73A 5LOHA 2YCFA 5CZIA 1OIYA 3TJDA 3CC6A 4F7LA 2GNGA 2QO7A 4Z7GA 3COMA 1XBCA 5A6OA 2X0PA 4QTDA 4O7LA 3KN5A 3FEHA 3FI8A 3FJQE 4QMVA 5EW9A 4KIKB 4QP9A 2N0YA 5CF5A 3E63A 2BAJA 5IQBA 3LE6A 1OPJA 4FYOA 2XIZA 3CPCA 1TQMA 2QONA 3ACJA 2V0DA 3E93A 3HV6A 4GK4A 5FI1A 3V51A 1GZKA 4P2KA 5M4FA 4C3FA 2NBVA 4PTCA 2C4GA 5L2IA 5CSPA 2RUKB 2OLCA 5ANEA 4Z55A 3UDSA 2DKPA 2VO6A 4IJPA 3GEQA 4OBPA 3TZ8A 1M7RA 1KOBA 4BJJB 3DK3A 4NM0A 2VNYA 4WOVA 4O4BB 4XG6A 5FBNC 1WBWA 3M11A 3GNIB 4A7CA 3RALA 5IDNA 2G2FA 3KY9A 5GJFA 3CIKA 3NSZA 2IPXA 4I6QA 3TMOA 4LMNA 2X4FA 4PMMA 4UBAA 4JG8A 4FSWA 4NW6A 2QLUA 5BVNA 4IZ5A 2QOIA 5AUWA 3UDTA 5LOPB 3RTPA 2XA4A 4FOCA 3ZLYA 4BIEA 3MFRA 3R9NA 4GT3A 3V5JA 3NRMA 2H7EA 4QMYA 5E91A 1E9HA 2XP2A 5CU2A 3SHEA 4IHPA 3JYAA 5GHVA 3V8WA 5TKDA 5HE3A 4RC2A 3LFDA 3A98B 4JDHA 4FEXA 3ZBXA 5AUZA 3HRCA 4WNPA 5L8LA 3FSKA 2RSGA 4FJVA 3FHRA 3KB7A 3NUUA 2HXQA 5I9YA 4YO4A 2W5AA 3BE2A 4XX9A 2G15A 3ATSA 1REJA 1H1RA 3MGYA 5DH9B 2WTCA 1UNLA 2HY0A 5KMIA 1FPUA 1YKRA 4R3RA 1UNPA 4N57A 3PLAE 1WBNA 4MXAA 4XH6A 2GDOA 3WBLA 3W33A 3ID6C 2UZWE 4Y85A 2R3RA 4O27B 3N4VA 1M2PA 4GCJA 3FAAA 4RA5A 4YC6A 3BX5A 4RJ3A 4YHTA 5F94A 5H9BA 2QHNA 4PTEA 3TKUA 5CF4A 1F0QA 1PMUA 3G5DA 3QA8A 1PXOA 1ZVRA 5EFXA 2HAKA 4FSNA 5ANGA 5LVPA 4U81A 4O0XA 4GSBA 3R30A 5KQ1A 2YSZA 2F2UA 5HO8A 1VJYA 4KSPA 4CRSA 5IMXA 4G5PA 2GNLA 3CCNA 5FEDA 3F69A 3QLGA 3OBJA 5E90A 2VWYA 5L8KA 3JPVA 4C2WA 4KHAA 3IO7A 2OU7A 1QPDA 4RWIA 4HYHA 2AEHA 1V89A 3OXZA 3ULBA 4DFUA 2ZMCA 5EOLA 3Q9XA 5EW8A 4A06A 4NZWB 3PSCA 3SOCA 3AMAA 2WTVA 3FLWA 4DH5A 4FNWA 2VGOA 4XG2A 1PRYA 4BTMA 4M68A 4FL2A 3L9PA 4MF0A 5C27A 4DT8A 5BVEA 4IX4A 2NO3A 2CGVA 3HX4A 3ZS5A 3FMKA 2XNMA 2YM8A 2R3IA 3QQKA 4OGRA 2UVMA 1M14A 5GJDA 2Z4DA 4F7NA 5J95A 4N6YA 4GKHA 1Q8TA 5KMMA 1HCKA 2XBAA 2ZKMX 2RVBB 4X2NA 3QRKA 3C1XA 4O38A 5CVHA 4YHJA 2WEIA 1OITA 3VQUA 3S1HA 3ORPA 1PYEA 4RX8A 3TT0A 3HSAA 4XRJA 2CSNA 5M4YB 5JFWA 2NMBA 1H00A 1LB1A 2FSOX 3H4JA 2CKOA 4ORKA 2DWBA 3FBVA 3VRZA 2G1TA 3O17A 3QALE 1V5MA 4C0AA 3EQIA 3QTQA 1J7LA 3QGYA 4P7EA