3O96A

Crystal structure of human akt1 with an allosteric inhibitor
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
428
structure length
367
Chain Sequence
SDVAIVKEGWLHKRGEYIKTWRPRYFLLKNDGTFIGYKERPQDVEAPLNNFSVAQCQLMKTERPRPNTFIIRCLQWTTVIERTFTPEEREEWTTAIQTVADGLKKQVTMNEFEYLKLLGKGTFGKVILVKEKATGRYYAMKILKKEVIVANRVLQNSRHPFLTALKYSFQTHDRLCFVMEYANGGELFFHLSRERVFSEDRARFYGAEIVSALDYLHSEKNVVYRDLKLENLMLDKDGHIKITDFGLCKEPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHEKLFELILMEEIRFPRTLGPEAKSLLSGLLKKDPKQRLGGGSEDAKEIMQHRFFAGIVWQHVYEKKLSPPFKPQV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of human AKT1 with an allosteric inhibitor reveals a new mode of kinase inhibition.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords RAC-alpha serine/threonine-protein kinase
total genus 99
structure length 367
sequence length 428
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2010-08-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
A PF00169 PH PH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3o96A03
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 3o96A01
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3o96A02
1YXTA 3SG8A 3I1AA 4FV0A 2BAJA 2XNOA 1A06A 4U44A 4K33A 2QI8A 4OAVB 4B8MA 5L3AA 4H39A 3ZDTA 4BZDA 4LL5A 1V0BA 3D7TB 3UJGA 3NRMA 1V61A 2O2UA 3COMA 4FZ6A 2CGUA 4NJDA 4YR8A 2I0HA 4ITIA 4XP0A 4FT9A 1TQIA 3R9OA 3D7ZA 3DKFA 2YVCA 4KA3A 5J5TA 3TG1A 4NT4A 5M56A 1V0PA 3H9OA 4N0SA 3WA0A 1JLUE 1JKSA 4FT7A 5CS6A 5ANKA 4FV2A 4D0WA 4HB4B 1PHKA 3NNXA 5HD4A 2PMNX 2RL5A 2YJSA 3JY9A 4M69B 1KE5A 3Q9XA 4FV1A 4RIYB 4UEUA 5HU9A 3A8QA 4KIPA 4M69A 3CP9A 4RIYA 2FB8A 2XJ0A 4XG7A 5J1VA 2B7AA 4GK4A 4QMUA 5J1WA 1IG1A 4RMZA 1P14A 3ZRLA 4BDBA 3PIZA 3FQHA 3VHEA 4CMTA 1PFJA 2PE2A 3I60A 1ZOHA 2QOCA 2WELA 4QPAA 1OIRA 3MTLA 4K2OA 4JQEA 4IJPA 2AL6A 1O9UA 4C59A 2OXDA 3PTGA 1OGUA 4X2NA 1RJBA 3RZFA 4ZIMA 5AR7A 1OL6A 2Q83A 2VTIA 4MEDA 1OKVA 4GU9A 3HRFA 4O7RA 3RTPA 4NYEA 3OEZA 2P4IA 4DH3A 1LP4A 4IX3A 4KNBA 3COIA 3DY7A 4JNWA 4U3YA 3KMUA 4EYJA 5KHWA 3TNHA 1UU3A 4CYEA 4BBMA 5CU4A 2WTKB 5H9BA 4KHAA 2E9OA 5EDRA 4HNFA 1FQ1B 3DBEA 4M12A 4X6RA 3FXZA 2YIQA 5LVOA 3ACJA 4G34A 4XV1A 4D55A 2R3PA 3A61A 3B2TA 2C6EA 3ZMMA 4L52A 4IACA 2UZTA 3KMWA 4AUAA 2I6LA 4A4OA 4APPA 3W18A 4AS0A 5IDNA 4B8LA 5DNRA 2LAVA 3E62A 2ITWA 1XBBA 4RIWA 4NY0A 2Y9QA 5DEWA 4FKRA 4BWKA 5M55A 5JT2A 4X7QA 4TYHA 2IZTA 4FTNA 2CGWA 2FA2A 4F09A 3ODWA 5J8IA 3NUPA 3DZOA 1APME 3HKOA 3E5AA 5LVNA 4ZS4A 3MESA 4KSPA 2W1ZA 1RQQA 2IVVA 3UBDA 5GIPE 4O1OA 3CBLA 4TYIA 3RK7A 4GKIA 2KUPA 1AGWA 4FVQA 2PWLA 3G9LX 5KMMA 5ETIA 3BEGA 5BUEA 3CXWA 4MXZA 4FL3A 3CR0A 3PZEA 4F7SA 4ZY5A 1TJ6A 2JKMA 3RHXA 3KRRA 4DG0E 1OQNA 5HLNA 1J7UA 1IR3A 4BDCA 3WIGA 2ZMDA 4WNKA 2X0GA 4G1WA 3AQVA 4HNIA 4OTPA 5T3QA 3SX9A 3VWAA 2CGVA 3HECA 3MFTA 4YMJA 2YT1A 3FLNC 2C0IA 3OCBA 4TWNA 3D0EA 4PMTA 2HIWA 4WO5A 4FKJA 2XEYA 3QGYA 4M15A 4XMOA 5CF8A 3R8PA 4OAUC 1UPQA 3H9RA 4PUZA 5JGAA 5JLJB 2JDRA 1JAMA 3FZRA 3KZ1A 4F9WA 3JUHA 5FTOA 5IEVA 1E5WA 3EQPA 3FMHA 3BU3A 3KRWA 4L53A 4FEQA 4MWIA 3VS4A 2C0OA 3WILA 3ZO3A 1MQ4A 1YDSE 3R1SA 5ETCA 5HOAA 3IDCA 4QMLA 3UOHA 5J3QA 5AP7A 4U43A 3VAPA 4KRCA 2WTVA 3EYGA 4YJVA 3HAMA 2JD5A 4H58A 4YZ9A 3V8WA 4KIKB 3ZEPA 5DI9B 3V5JA 3E7OA 4Y8DA 1G5SA 3FC1X 4RJ8A 2LYDA 2M38A 2DN6A 3QX4A 5AM7A 4F7NA 4RIXB 2DKPA 3QD2B 3SVVA 5F94A 2WTWA 2YJRA 4CFWA 3ZCLA 4IADA 3EQIA 3VIAA 4FSUA 1JVPP 3PIYA 4RPVA 4NKAA 3U8ZA 1LUFA 3NW6A 4KIKA 3DFAA 1JSVA 2BRMA 3MS9A 1GOLA 5HCYA 3KMMA 4CFXA 4OTWA 4E8AA 4LRKA 2ESMA 2WQMA 4P4CA 3GCVA 4HYSA 2AEHA 1JNKA 3WZDA 2R0DA 2FH9A 1S9JA 2VTLA 3GU7A 5K5NA 3PVLA 3DB8A 4BCIA 1JKTA 2C5OA 2RGPA 3RHKA 4B6LA 4U79A 3EQRA 3AMAA 4G5JA 5HG9A 2C6KA 4FTRA 3ROCA 4BICA 2DHJA 2RUKB 3QIJA 5LWMA 2REIA 5L81A 4BCJA 4YSMA 3CD8A 5HHWA 5JKGA 1OBDA 3A60A 4L68A 5HBEA 2Z7QA 1P5TA 1FVRA 4I0RA 3PPJA 2O3PA 3GC0A 3ITZA 4JIKA 4BCGA 1W1DA 4YTCA 4HB2B 3GQLA 4KBCA 4HYIA 2NRYA 3I7BA 5FDPA 1LR4A 2HWOA 3NX8A 3N4VA 3W16A 5I9YA 3QZFA 4HVHA 2PE1A 3U6IA 3SRVB 3W10A 3HX4A 4IFGA 4JDKA 3FQSA 4JG7A 3MA3A 4D2VA 5JP4A 2OH0E 2XKFA 4JR3A 4RGJA 1SHCA 4AOIA 3EH9A 2Y8FA 3T06A 3ZO1A 4ZSLA 5AP6A 5KBQA 2C5YA 5CX9A 3DJ5A 5ACKA 4B7TA 4ANSA 4L3JA 4FG9A 2AUHA 3ALOA 4C2VA 2IJMA 3KF7A 1NU2A 2DS1A 3UVPA 5AUUA 1ZLTA 3DOGA 4Z2MB 3R8UA 4QYEA 5CF6A 2YZLA 2C0TA 1R0EA 2X7GA 3QTWA 4LGDA 5HCZA 5D3YA 5K4IA 3H9FA 4QMWA 3GU4A 4FSMA 2C6LA 3KXGA 2F49A 2V62A 4NEUA 3OF0A 1U46A 1Z57A 3QRKA 4FT5A 1XWSA 4I6BA 4WSYA 1M7EA 2HTHB 4NK9A 4KHBB 2UZWE 4KS7A 4RIWB 3CTHA 5DR9A 3AXWA 2R7IA 4MK0A 2YDIA 3KXXA 2V55A 5DRBA 4DAWA 3H0YA 1U5EA 4MD9E 5BYLA 2Y4PA 1Q61A 2YLFA 4QT1A 4HYHA 5K3YA 3MJ1A 3G5DA 3ZEWA 3W55A 3OT8A 3ZS5A 3VOQA 5F4NA 4U41A 1ZZLA 3KSYA 1BKXA 1UNQA 2WTKC 3GCUA 3ZUUA 1JSTA 3MFSA 4LOPA 2W2XC 4FF8A 4E4XA 4F9BA 5CI6A 2JBPA 3W2SA 4EOKA 1OL1A 3ZM4A 2JP2A 5IH5A 4ZRIA 4YSJA 3OHTA 4A9SA 1PXKA 2QQ7A 3AJ4A 3EQFA 3GCSA 2ZMCA 4QYGA 5E1SA 4MBLA 3LXKA 4NZWB 5H8GA 1UWHA 3TNPC 4FTMA 2OW3A 3ZXTA 2QOIA 4BIDA 2ZV7A 4MF0A 4D2PA 3PXFA 1PY5A 4GFGA 1WFCA 2XH5A 4GJ2A 5CVFA 3TUBA 4QRCA 3IW6A 4EWQA 4FT0A 4ANLA 2FJLA 2HY0A 2W7XA 2IN6A 3HV5A 2YM6A 4L44A 2I40A 3EL8A 3DNEA 3ZRKA 4U42A 3DLSA 4L3PA 4EKUA 1UWJA 3Q04A 4G9CA 3OOGA 2DHIA 4WT6A 1KUTA 4FEUA 4FIEA 2ZV9A 4DGLC 4I94A 3UVQA 5AV3A 3LAUA 3E8DA 2XK8A 3T3VA 3ZZEA 2WAJA 3GENA 4BKZA 3BI6A 4HGEA 3G2FA 2LGCA 2PVFA 2X9EA 3GU8A 4K11A 5G1XA 2FSOX 3FZOA 5I9UA 4RLKA 4ERWA 3Q9YA 2CJMA 3QL8A 3VN9A 1OMWA 2WHBA 3E87A 1ZYJA 3II5A 3ORMA 3VS6A 1U5QA 2VTAA 3ZFMA 4DT9A 3BELA 4D28A 2V7OA 2YF0A 3OS3A 3QRIA 2ZJWA 4LMNA 4EJ7A 2ERKA 1WMKA 5B2KA 3U51A 4GMYA 3SA0A 5FI1A 5IA4A 5AX9A 4CZTA 3GI3A 4J98A 1KV1A 3K54A 4BWXA 5L2TA 3D7TA 4JBOA 5FG8A 2B54A 3EZRA 3VF9A 2L1CA 2OF4A 4AX8A 3R2BA 3SW7A 5D12A 2JDTA 3QZGA 2F2CB 5JMSA 1NTYA 2C5NA 4UYNA 1WBTA 4RQKA 5AAEA 5M57A 5JN2A 4D4RA 5L2SA 3G15A 2EUFB 2QD9A 4C2WA 2VWYA 3DDQA 4O22A 2VX0A 1UKIA 4RVLA 4NL0A 3CE3A 2YSZA 2X1NA 5HIBA 4GT4A 1LEZA 4J52A 4O91A 4NU1A 2YAKA 3EJ1A 5KO1A 2CNUA 4I23A 5C8KA 1PJKA 5GZ9A 4R78A 3RAIA 1SVHA 5IF1A 4FKWA 2ZYBA 5ANGA 3SD0A 3QKKA 1Z87A 4HAZB 4AA5A 2UVXA 3ACKA 3MV5A 4BTKA 4DTBA 4JT3A 3O51A 5BUJA 4XLIA 3PA4A 2QOBA 4CCUA 4A5KA 2P33A 3PJ3A 3SKCA 4FKVA 1WCCA 3FKLA 3FE3A 3G90X 4Y46A 5IMEA 1AQCA 4GL9A 4H3QA 5FI0A 3RAHA 3PRFA 5M4IA 3DFCB 4FTQA 5E8ZA 4DN5A 1UNRA 3LCDA 3GVUA 4LFIA 5C9CA 4AU8A 5J3YA 3ML4A 3RBWA 5CZHA 2RVBB 2QOFA 5GZ8A 3EOCA 4IWPA 4PRJA 2BCJA 4IC8A 2WIPA 3MY5A 1WAKA 3EHAA 3LXLA 4CTCA 2QOLA 4WG3A 1WZYA 4AT5A 4KINA 2ADZA 3I0OA 1XR1A 2PTKA 2UZDA 2UZBA 4DH7A 2BHEA 2UW9A 3AC2A 3WARA 1OKYA 4IVCA 4K0YA 3UMWA 4IM3A 2JBOA 4RZWA 3BHUA 4D4SA 3TVVA 4QP7A 5CANA 2W5HA 3ALNA 3BYVA 3F2AA 4I5MA 4FNXA 4EKKA 4HW7A 1H01A 5EDQA 3VNTA 1GC7A 5IQEA 4J1RA 5JZJA 4EH7A 3K5VA 5HBHA 4FA2A 4ZLZA 1MRYA 1P2AA 5KKRC 3HZTA 2Y6MA 3GNIB 3BWJA 5EHLA 1CDKA 4Q9ZA 5IEYA 2UZSA 2RG6A 3ZFXA 1V5PA 3SUZA 1P5EA 3R7YA 3PLAE 3BWFA 3CCNA 2KTYA 4XWXA 5JHGA 2B55A 4O7NA 5HVKA 2BAQA 4FUXA 4WSQA 3S0OA 4F7HA 2CHLA 4EH2A 3VIDA 2K2UA 3BJIA 5LOHA 2V0DA 5ANIA 3ATTA 3PWDA 2CRFA 1J7LA 4CFNA 2QHNA 1UKHA 4CQGA 3EFKA 2CGXA 2QO2A 3L8VA 4QMTA 4RVMA 4E6CA 4EONA 3UO5A 2PZPA 5HLWA 5B0XA 1UEFA 2C30A 2YCSA 3VUKA 4TRLA 3V8SA 2NRUA 4YPSA 4RWJA 1LPUA 4FOCA 2CN8A 3BV2A 4R1VA 3SW4A 4YUQA 2LULA 1OPLA 4I5HA 3CD3A 4CMUA 2X39A 3HV6A 4CD0A 4N6ZA 3UG2A 3ODYX 3OWKA 5HVJA 2EMTA 3BHHA 3V6SA 4FZDB 3LJ1A 5HVYA 1CKPA 3OTVA 5I9ZA 3CPBA 2X81A 3QD3A 3HMOA 3QQFA 3R73A 4UWYA 3KXHA 4YJPA 2WMVA 3CQUA 3FDNA 3EN9A 3R9NA 2VWIA 4RWLA 4XHKB 2O8YA 4BDFA 4R6VA 2BROA 4IQ6A 2HY81 1XO2B 4HGLA 5C8MA 3ATSA 3QX2A 4IB3A 2PY3A 4RFZA 4YHTA 3GYPA 3MPTA 4CT2A 5E8WA 2WMRA 3UVRA 4AA4A 4J8MA 3KY9A 5FEEA 1DDVA 3RCPA 4BDJA 4MWHA 5C01A 3PJ1A 3PIXA 3F69A 2DX1A 2QHMA 3BLHA 4RZVA 4BDHA 3PSDA 3QALE 3MVJA 4TY1A 3QC4A 4IWOA 5CI7A 5D11A 4BIEA 2CY4A 4XLVA 3UOJA 4Z7HA 3FLWA 5AV0A 1OVEA 5AA9A 4NFNA 1Q3DA 3QQGA 4K1BA 4PMPA 2EB3A 4BZNA 4BRXA 3FLYA 1WGUA 5EM6A 3R30A 4NW6A 2JLDA 2ITXA 2F2UA 3HV4A 2PHKA 3I7CA 3HMNA 3U9NA 3DXPA 4PMMA 3HEGA 3L9LA 4FNWA 4DFBA 3WYXA 4WVFB 1ZM0A 4LG4A 4JBPA 2XIYA 1F0QA 3CLYA 5CSHA 2GHLA 2I1JA 4Z55A 4MCVA 1R39A 3O8PA 3SOCA 3U4UA 4RFMA 4AACA 3A7GA 2ZVAA 5FEDA 4RRVA 4ANBA 4XEYA 3E8CA 3UE4A 4Z7GA 4IFCA 3UIUA 4AGCA 2P55A 5D41A 1XODA 1BAKA 5IQBA 4HB0B 2XNMA 1ZSQA 3F7WA 3H3CA 3VUIA 3HNGA 3AC8A 5L2QA 1VEBA 3ORPA 2PL0A 3RCJA 4ASXA 5ANEA 3F9NA 4MBJA 4WSFA 5GHVA 1H00A 3NCGA 4E5AX 5A4EA 4FTJA 4UMQA 4WOVA 3E8EA 4EHVA 3OROA 1X1FA 3CY3A 5EYCA 4X2GA 5LCKA 5DT3A 4A07A 5DHFB 1R1WA 5KQ1A 1GC6A 2XCKA 3Q6UA 4BR3A 2RGNB 1PKDA 1DDMA 4O81A 2W1HA 1OITA 2C6TA 3DGKA 4MYGA 3D94A 3PP1A 3UODA 4NM3A 3VO3A 2V7AA 2XB7A 3LFBA 3Q32A 4HZSA 4MXXA 4CV9A 3X23A 5CU6A 2FGIA 5FM3A 2QO9A 2CNQA 3R9DA 3DT1A 2OIBA 2E2XA 2OIDA 4FV7A 2GHGA 3NWWA 4ACHA 2OQBA 2HE7A 5M06A 1H0WA 4FSZA 3IGGA 1OL2A 3GBZA 3QHRA 2BPMA 2YIRA 3G6HA 4Q2AA 3FZTA 3KA0A 1JWHA 2BFXA 3QQKA 4CZUA 2L2IA 5DN3A 2OLCA 3FKNA 3TNQB 3PPZA 4DCEA 2F7ZE 3PWYA 4XV2A 1J3HA 5C5BB 4UB7A 2ZDTA 3Q3BA 4E7WA 3TEIA 3E3PA 1M14A 3LFSA 2X2MA 3O2MA 3PE2A 5GJFA 3R04A 4PQ0A 4GT3A 1YOLA 4AOTA 2UZOA 4W8DA 2GNHA 4FV6A 1H4RA 5HGIA 4NM7A 4EOQA 3Q2JA 3K2LA 1OPKA 1Z5MA 3EFLA 2VTMA 2VSZA 1EGXA 5CEMA 2GTNA 3CY2A 5F20A 2FO0A 3LXNA 3BHYA 3M1IB 4G17A 4BKYA 5J9YA 3QCYA 5KBRA 1U4DA 2HCKA 4UXLA 4AW5A 2E9NA 4FV3A 4E26A 4BBKA 3VW8A 2IYBA 1ZYSA 5BQ0A 2ITYA 4W9XA 3SAYA 1YWNA 5CEIA 2BRBA 4L6QA 3RPRA 3MI9A 3TIZA 3FMNA 2HOGA 4LGHA 3ZM9A 2C6DA 4X3FB 4FZ7A 2LG1A 5DH3A 3P7BA 1DBHA 2ZB1A 4IC7A 3CJFA 4L6EA 3AC4A 2OO8X 4PPCA 4QMXA 3TNIA 3BYSA 3SXSA 3F7ZA 1NVSA 2YAAA 3KRXA 3B8RA 3BKBA 5H3QA 3SGCA 4YZNA 3OUNB 3L8PA 4WJ7A 3LFAA 1G8AA 1Q24A 2Y4IB 2ITTA 5JGDA 1CKIA 4QTDA 1MIZB 2P0FA 4EK8A 3IDBA 1ND4A 3AD4A 1ZWSA 4LOQA 4AG8A 2COFA 3AU5A 5EHOA 1V0OA 4IH8A 2IZUA 5GIOE 2XM9A 5M4FA 4CTBA 3P1AA 5HO8A 3LJ2A 4DCAA 2XNEA 3W8QA 5EK7A 4G6LA 2YZAA 3EN5A 3QXOA 4FIFA 5DH9B 4O82A 4GVAA 4OT5A 3PXYA 2X2LA 4M68A 4M3QA 4D5HA 3R22A 4MT7A 4GFMA 2CLXA 2QG5A 4S2ZA 2UW3A 3ZZWA 5HTIA 4TYZA 4I21A 4QQJA 2QU6A 3BLRA 5B2MA 3NDMA 1REKA 2XIZA 3M2WA 4QTCA 4C35A 2VRWB 4IX6A 4HHVA 4ANOA 2B53A 2N0YA 3GC8A 4BGHA 4AAAA 3CEKA 3A62A 4LI5A 2VUWA 1XH6A 5GJGA 2QVSE 4TWPA 4O0UA 5HCXA 4EH4A 4ZTMA 2JFLA 2F7XE 2BIKB 5KMLA 4RJ3A 5KKRB 2E9VA 4ZJVA 3RINA 2Y7JA 1GZ8A 4F6SA 2QOOA 2WMTA 5I4NA 2OI4X 1B55A 3UIBA 5KMNA 1UV5A 2YM4A 1A48A 3UO6A 5CAUA 2IPXA 3RJCA 4H3PA 4EMOA 4E1ZA 4O0WA 1H27A 3F6XA 4QPMA 4C62A 3RPOA 3GUBA 2UZVA 5J9ZA 5LMBA 3QD0A 4KHOA 5ANOA 4OLIA 5M44A 2QOQA 4OBQA 3LFDA 1H07A 4H1JA 1K3AA 4OTDA 4V01A 3RCDA 2DA0A 1YI4A 2OFVA 3AD6A 4U6RA 3EQBA 5JQ8A 4ALVA 1M52A 4DGNA 3F5RA 4MXOA 4EOOA 4B99A 2GFSA 4EH8A 3FL4A 4CSVA 1PXPA 3QAME 3MY0A 2QU5A 1QQGA 3FKOA 3ULIA 4DG3E 3BV3A 4D58A 2XMYA 5J3TA 3UP7A 2XYUA 3MVMA 4BDGA 4UMPA 2MKRA 4BWPA 3IECA 1H1SA 4H3BA 1WJMA 3KK9A 5AP1A 1XX0A 3FLQA 2BDWA 3D5UA 2XNNA 2G2IA 2BVAA 4XOYA 4X6QC 3M42A 4FKPA 2OZAB 3RWQA 2JEDA 3VBQA 2YISA 2X9FA 4QYYA 3WF9A 3GC7A 4WA9A 4AZVA 4YGAA 4JVGA 1FVTA 3NR9A 2ZV8A 1NXKA 4PX6A 1BWNA 2UVZA 2W06A 2JKKA 2F4JA 2VX1A 1YI3A 2XQNM 3MY1A 3LM5A 3TL8A 3V51A 3PVBA 1P4OA 4HAUB 5L8JA 2JDVA 4TW9A 3R21A 1NY3A 2W2XD 4IZYA 2IW8A 1I2HA 4HAWB 5CWZA 2ITUA 4DT8A 2XA4A 1B6CB 3LCSA 4OTGA 4F99A 4C7TA 4FYNA 4AT4A 5EM8A 2XEZA 3PP2A 4HYUA 4HVIA 1Q8YA 5ITAA 3UQFA 2QNJA 3BE2A 4IVAA 3UPXA 3GCPA 5LWNA 3DAJA 2WOUA 5FBOA 4F7JA 3LJUX 5EH0A 3TZMA 1O6KA 3HRBA 5ICPA 2B9FA 1SVGA 4FT3A 3O0GA 3EFJA 5M53A 2XBJA 3EWHA 4PPAA 3BGQA 4GUEA 4YZDA 3CGFA 5IQGA 2PZYA 3TCAA 2PZRA 4V04A 3WZUA 4GZUA 4DF3A 3C4ZA 1J0WA 2KCJA 2W5AA 4IVDA 5BVOA 3R71A 2LOXA 3IK3A 2AYPA 5JZNA 4GIIA 2DHKA 5HE3A 2YS1A 3W33A 4HATB 5E8VA 5A4LA 4AZTA 3E64A 3LJ0A 3LFQA 2COCA 2XCHA 4IAAA 4EH5A 2D11A 2R3RA 5C16A 4GFOA 4F1MA 2GNFA 4FG7A 3TZ8A 4NCTA 1P3RA 3ORZA 3MWUA 2CN5A 2P3GX 5AR8A 4ENXA 2LOZA 1VYWA 4RG0A 5LMAA 4BI0A 4A6KA 1PXNA 3PEGA 3NYNA 4DFUA 2D2QA 1XCGA 1TQPA 3C51A 3D2KA 4L7FA 4ZMFA 4AGDA 4B4LA 3QRUA 2ROZB 3OTUA 3GP0A 3R8VA 2WEVA 4AXAA 5LJJA 3BGZA 1LW3A 3G9WA 2O65A 2WNTA 3O50A 4O21A 2GNGA 4RX9A 2ITPA 4BBFA 5KHXA 2X6EA 2B0QA 4JG8A 4I4EA 4HJOA 4TTHB 2GS7A 3ZFYA 4FVRA 1CMKE 3ZSIA 4F0IA 4UN0C 4U40A 5JFVA 2AC5A 5D27A 3SNHA 4G3GA 4UMTA 5IG1A 4O7LA 4JBQA 2P0HA 3DAKA 2EMSA 1ZXEA 4Z2NA 3RGFA 3PXKA 3E88A 4F65A 4WRSA 3RWPA 1V5MA 2P8VA 2W9FB 5C03A 3U87A 1H26A 2SRCA 3W1FA 4DFZE 5C79A 1BL6A 3DPKA 4I22A 4ZOGA 5H8EA 3I4BA 4BI2A 5M08A 3RKBA 5FDXA 2JKOA 3G0EA 4KUJA 5DYJA 4XP3A 5I9XA 3OXZA 3QWKA 3DKCA 3OMVA 2C6MA 3DBCA 3WF7A 1ZMUA 5ETFA 4XNEA 3ENMA 4NUSA 1IRKA 2J6MA 2OH4A 3TFMA 3V5LA 3OUKA 4JI9A 5A9UA 4P7IA 3HVCA 1Q97A 1SVEA 2X8DA 5IA3A 5DIFB 3DBFA 1BI8A 2BDJA 2WQEA 3QUPA 3R1YA 4C3PA 3ZTXA 3ANRA 5LVMA 3COKA 4RJ5A 5CXZA 3ULCA 1U29A 2Q0BA 4FKTA 5A6NA 2Y8GA 5C26A 1WBPA 3BPRA 3G33A 4C33A 3CQEA 3FMLA 5TKDA 4D2SA 1W84A 3BYUA 3ZXZA 1T46A 4TWCA 4XBUA 4ZSGA 1M17A 4KWPA 2W2WA 1Y5OA 3WOWA 1GZOA 3ULZA 2BZHB 4DFXE 2B1PA 2BIYA 3IDPA 4OTRA 4BCQA 4FKSA 1GZKA 3FHRA 3F61A 3GEQA 3EKNA 5A4CA 5GZAA 3QTIA 3UOKA 4XX9A 1XH8A 2WEIA 3PG1A 4FIJA 4J53A 5LOPB 1FB8A 4YZMA 4X21A 1W1HA 4HDQA 3A4OX 5AP5A 2A27A 3OZ6A 4EK5A 2YIWA 1Q41A 4KSQA 4AZEA 1XBCA 2UW6A 4D9UA 2YIXA 2COAA 5M07A 5IEXA 3UDBA 5TR6A 4TYHB 4Q5EA 2VWVA 5AAGA 2PMLX 1IA9A 3LW0A 3KK8A 1ZZ2A 3LHJA 4FC0A 4ZLYA 5C4LA 3T9IA 3WZJA 3AC5A 5IA0A 2WMXA 3QFVA 2PUPA 4JRVA 4KD1A 4EOPA 2VO6A 4FKIA 1H1RA 2XBAA 5CSVA 4UWBA 3BHTA 2C47A 3C4CA 5DT4A 3HDMA 4ZTNA 5DVRA 3VS1A 4YU2A 1U59A 2XK7A 5K0XA 4DINA 1XD4A 2OICA 4NFMA 3O71A 4L67A 4K2PA 3OG7A 3SDJA 4JAJA 1DROA 4RC4A 4KKHA 1ZYDA 1SGHA 2VO3A 2WFYA 4HPUE 4O2PA 4X3JA 5JFXA 2GNIA 4I92A 5G6VA 1UNGA 2BZKB 4YBJA 4UY9A 4CHMA 1JSUA 3FYJX 1V89A 1B39A 2Z60A 3OWPA 4HVSA 3KULA 5E4HA 2Z7RA 3QC9A 1YWRA 4IDVA 3R7IA 4KB8A 3GQIA 2I0VA 1ZOGA 1ZY4A 4FL1A 4K9YA 2GS6A 2HW7A 2GNJA 4D2RA 3DXDA 4BYIA 3IW8A 5FXQA 4GU6A 3EZVA 5AIKA 4CRSA 3GCQA 3R7EA 4X3FC 3JVRA 1MKEA 1UU7A 2EXMA 4CV8A 2CKPA 4R77A 1J91A 4FIIA 4FODA 2GPHA 2JAVA 4JXFA 5I0BA 3LIJA 4AW2A 3ZDUA 1XH9A 2QOHA 3U54A 5IQFA 3ETAA 1U5GA 4J96A 5HD7A 5DFPA 3R7UA 4ORKA 4WRGA 3FMMA 3W2RA 4NIFB 5AP0A 4CFVA 3ULBA 4IW0A 3MYGA 4IZ7A 4HCVA 3GXLA 3MH0A 4QMSA 3ZUTA 5J9LA 1LB1A 2C3JA 5DHJA 1NA7A 4O96A 5DI1A 4MKCA 2W1DA 5ANJA 3DS6A 4LOOA 5BVEA 2QC6A 3QWMA 4QP6A 5FXRA 3BZ3A 1YOJA 3QWJA 3SXRA 1RDQE 3OBJA 3QTZA 3GFWA 3W2CA 3ZDIA 1NI2A 4MD8E 2CKOA 4I93A 2CMWA 5DBXA 1QPDA 4BDEA 4FL2A 4GXBA 4PDOA 4HCUA 5BNJA 1EAZA 3VUGA 2YS3A 3EKKA 3C5UA 4O0SA 3FM8C 3S2PA 3E92A 1RJ2A 4QQCA 4JJRA 3C5IA 3PA5A 5KUPA 4DE4A 3QBNA 2IZRA 5HORA 3LQ3A 5EQEA 3MDYA 4FUYA 3KB7A 4YLLA 4UYAA 4CKJA 4OTHA 3MDBC 4I1ZA 3EN6A 3PFQA 3OEFX 1PMEA 4WNOA 4P5QA 4QYHA 4N6YA 5EW9A 4PY1A 5HX6A 2ETKA 3RPVA 4C3RA 3BGPA 2YCRA 4IJ9A 3F0WA 5M51A 1ISNA 4DH8A 3R01A 2OF2A 2XKDA 4EBVA 4U80A 5EYDA 5IDPA 4FNYA 5EHYA 2G2HA 4L3LA 3FMKA 5AUZA 5HU3A 4USEA 3RAKA 3MH2A 2FSMX 3W2QA 2EVAA 2VRXA 3TN8A 2WD1A 5FRIA 4E4NA 1ZYLA 5HO7A 4GSBA 3D15A 2QO7A 3M1SA 4FSRA 3TZ7A 3WF5A 4ASDA 5EDPA 3PVWA 4L45A 4CZYB 1FOEA 5AADA 4BCKA 2ACXA 2YT0A 4QMPA 4GUBA 2WB8A 2X4FA 1H24A 1K2PA 3OBGA 2HZ0A 5AUVA 4CFMA 3ZUVA 1OIYA 3MGYA 2I1MA 4S32A 4XG9A 1YDTE 1Q4LA 4O0RA 4ENYA 3T8OA 3BIZA 4W4YA 3POOA 2X6DA 2C3KA 2RFDA 1WVYA 4HCTA 4R7IA 3CS9A 4DA5A 4YNOA 2CCIA 4W4VA 4TNDA 1Y8YA 5CNNA 2GS2A 4U9AA 3JY0A 4GEOA 2VO7A 4E5WA 3ZLYA 3F3WA 4D0NB 3TZ9A 3FMDA 2WMSA 1S9IA 2VGOA 4IWDA 2ELBA 3COHA 3CJGA 4UZDA 1OI9A 2GDOA 4PTCA 4RVTA 4YO6A 4LV8A 3FY2A 2WOTA 4A7CA 4A6FB 3ZHPC 3SO6A 3KN5A 4CRLA 1H1PA 2P0CA 1CKJA 4YLKA 2W96B 4MH7A 3GGFA 3U55A 1I09A 5I9VA 5IU2A 3NAYA 2JIIA 1JKKA 2YCFA 2C3IB 3R1NA 4K77A 4MBIA 2RG5A 5E91A 1TKIA 4QNYA 3O96A 2X8EA 4B9DA 3O7LB 4EHGA 3BRBA 3MA6A 1MPHA 5T68A 5HG5A 3ZSHA 4AZFA 1NTVA 3FL5A 4X0MA 2XNPA 3A7HA 3DBQA 3PA3A 4IB1A 3DDPA 3LFCA 4G16A 1H25A 2C5XA 2YA9A 4BC6A 1ZYCA 3D9VA 3MPAA 3QQHA 3PZDA 2W05A 1M7QA 4GN1A 5CSXA 1UVRA 4TZRA 4FG8A 4DHFA 3Q4TA 2OXYA 2J0KA 3RVGA 4WUAA 2GCJA 4MNEB 2Y8OA 3D83A 4IX4A 3DQXA 1SMHA 2NZ8B 1YI6A 4CLIA 3JXWA 5EI8A 3RK5A 2RLOA 1QC6A 4C4GA 4ANNA 1K5DB 2VO0A 4FTAA 2Q13A 4IVBA 5HI2A 4TT7A 2VD5A 4FSNA 4FYOA 4L7SA 3NYXA 3DLZA 4A9TA 4EKLA 3VF8A 3NW5A 3WBLA 2PUIA 1A9UA 4PNKA 4FV5A 1Y19B 3TTIA 4EYMA 2BTRA 2W4OA 3HYHA 4RQVA 5GNKA 5GINE 3PJ2A 3FMJA 4BGQA 5AUTA 4YJOA 2JFMA 3R00A 2YWVA 4JL9A 5JGBA 1PF8A 3C4XA 2YWPA 3UPZA 1M7RA 4ERKA 2DFKA 2DQ7X 2WMUA 3PVGA 3IOKA 3MPMA 4R7HA 2OBJA 5FP6A 1YHWA 3ROYA 5CYIA 5D7AA 5CALA 1IAJA 3CQWA 2HZNA 3C0IA 4F6WA 4KS8A 3ZVRA 5C1QB 5JFSA 3FI3A 3R02A 5CF4A 4QMOA 4KVGB 1DS5A 2J5EA 5CAQA 1OUYA 4DTAA 2WMAA 3RK9A 3DJ6A 5HG7A 4FE2A 4J71A 3TM0A 4ANQA 2K00A 2DUVA 3FAAA 4DXAB 2UW7A 4TNBA 4YJTA 1CTPE 3UC4A 4P7EA 3D5XA 3FZSA 4M66A 4ZSJA 4QP4A 2CLQA 3BU5A 4I20A 5LVLA 4C02A 1ZY5A 1MRUA 4DEHA 4YZCA 3DKOA 5JEBA 2XIKA 2GU8A 4WBOA 5DIAA 4PL3A 3WF8A 5M09A 2GHMA 3RNYA 2ZAZA 4K8AA 3HGKA 4CEGA 4DYMA 4CT1A 3B2WA 4BTJA 1P4FA 5BPYA 4C38A 4JRNA 4W8EA 4F9AA 3HUCA 3IO7A 5FXSA 2F57A 3EL7A 1XKEA 4YJNA 3DKGA 1FVVA 4X2FA 2CODA 2HWPA 2R3OA 1NW1A 3TIYA 2Y0AA 3ZLWA 4K17A 5HBJA 1AD5A 2YCQA 3KXZA 3NNWA 5IZFA 1VJYA 4BB4A 3AMBA 4HGSA 3C9WA 1SNXA 2FSTX 4ACDA 4FZAB 2CAYA 2XKCA 4MNEA 2EJ8A 5D10A 2VX3A 4LRMA 2PZIA 3L9MA 4QMMA 1LEWA 4IAYA 1HOWA 5IMXA 2P2HA 1SYKA 3KGAA 4AN9A 3OVVA 3IS5A 2IFSA 2B4SB 5CNOA 4ACMA 2N23A 3KL8A 4FV8A 4CGAA 2Z0QA 2CNVA 2OJ9A 3PYYA 1YHSA 4PL5A 4FTKA 1M2PA 4PQNA 1SZMA 4GW8A 4UZHA 3VUDA 4TL0A 2WQNA 5CASA 2I7QA 4GG7A 3QD4A 3LPBA 5AV2A 3H0ZA 3ODZX 3ENHA 3TNWA 3ZO4A 1V88A 3HW2B 4JBVA 1R0PA 3TWJA 3EQGA 3IKAA 3Q96A 2NO3A 3DTWA 4ASEA 5ANDA 3DV3A 4O38A 3Q9WA 1EH4A 3LQ8A 3SV1A 4DBBA 1YXSA 2J5FA 2OJFE 4L01A 3V5PA 4YL8A 1WBNA 4QP9A 1X86A 3T3UA 3V5QA 5AWMA 5JH6A 4CYJA 4IMYA 4MHAA 4YZBA 4D1ZA 2WKMA 2ZDUA 5CU0A 3PE1A 2BALA 3SRVA 3V5TA 2OU7A 2VTPA 3UG1A 3C4EA 4FTCA 3H30A 5EG3A 3UGCA 2KULA 4ACGA 3QQJA 4QPSA 3RPSA 3WZKA 4BL1A 5GJDA 3ZONA 5A4TA 1E1XA 3AMYA 3EMGA 2D9ZA 4ZRKA 4UMRA 3DCVA 3MBLA 3QHWA 3R6XA 5KQ4A 2C6OA 3BU6A 1KSWA 3KRJA 4R8QA 1R78A 3OOMA 3HLLA 1YW2A 4DLIA 1JKLA 4PP7A 1H28A 5M4CA 1KOBA 2H34A 1BL7A 3VUTA 3WE4A 1YXUA 2JC6A 5FQDC 2VTNA 4H8SA 5D3WA 2I0EA 3BLQA 3K5UA 4FIGA 4WG4A 5EM7A 4QP1A 5AEPA 4EEVA 2GMXA 2F7EE 3VW6A 4KRDA 3FV8A 2EB2A 3QZIA 3SXFA 2GQRA 1MRVA 4IBMA 4EL9A 4TYGA 3DXQA 5BVKA 1H4LA 2PZ1A 2O64A 3D14A 3PY0A 3C7QA 1BUHA 2A4LA 4O6EA 4R3PA 4P5ZA 4U5JA 3TCPA 5C4KA 4ZTSA 4F1TA 1DAYA 3DNDA 5TE0A 1YRPA 2R2PA 2B9HA 5E8UA 5FEQA 1FOTA 3NVKI 4G3EA 4O86A 3KVWA 3OXTA 3VS0A 3F82A 4PTEA 4Y73A 5CQUA 1ATPE 2YEXA 5FLFA 4CMOA 4BCHA 4I24A 5AP3A 3W2OA 1PMSA 3HL7A 1XJDA 3FI2A 4DITA 5A14A 4L43A 4FKUA 3VBWA 1OL5A 4JG6A 4HB3B 2UZNA 1RW8A 2VTJA 4ITJA 4FGRA 3UYSA 3NGAA 1Q67A 4YHJA 1Z9XA 4UALA 4BCOA 3ZLXA 3S00A 4D5KA 4EOIA 5HX8A 4KAOA 5JRQA 4H1MA 4YC8A 4O7SA 5C6RA 4DX8A 5HNGA 4YJUA 4BYJA 2J51A 4EHZA 2R3NA 1UNPA 1PXJA 5FTGA 4FEVA 3MH1A 1OKZA 2UW0A 4AN3A 2J2IB 3HP2A 3IW5A 3ANQA 4BTMA 2Z7LA 1Q8TA 4PWNA 1OZ1A 3DK7A 4OTQA 4FKOA 4ZZNA 3R1QA 3A8PA 3NPCA 4X2KA 3Q2MA 2FUMA 2W1GA 3VUHA 2H7EA 4FOBA 2RSVA 3OWLA 5AA8A 2C4GA 3UMXA 3TT0A 3I6WA 2IZSA 3N4UA 4FSQA 2VTSA 5BVDA 2EC1A 4XUFA 1H08A 4XG2A 2YM7A 3OXIA 3EQHA 3UIXA 1GZNA 2ZV2A 3BINA 1GJOA 2YHVA 5KZIA 4MQ2A 2PUUA 4DBNA 3CC6A 3U7DA 3MSSA 5I3OA 2ZM4A 4IAFA 3AOXA 5FD2A 3V6RA 5KNJA 3NS9A 1XBAA 3QGWA 1U27A 1I44A 2W0JA 3FZPA 4QP8A 3VUMA 2Z0PA 3OW3A 3E8NA 4YJRA 2GNLA 5HEZA 5CEPA 2J59M 4ZP5A 1X11A 4DTKA 3PP0A 4RBLA 1BYGA 1CSNA 3QYZA 2UV2A 5AAFA 2HXLA 2VTRA 1DDWA 5LMKA 3C0HA 2J9MA 4F64A 2OGVA 3KFAA 4AFEA 1MUOA 2D9XA 2XNBA 3ZO2A 2DYQA 5K4JA 1H8FA 1PXLA 3QTXA 3ERKA 5L2WA 4ONAA 4CG8A 4I3ZA 4FKGA 1GY3A 4EQCA 4GYIA 2EXEA 1KV2A 4ZXTA 5CEOA 2Z0OA 4G3DA 2W1IA 4E6QA 2QG7A 3UZPA 3H4JA 3KEXA 3F5XA 3TXOA 4HAVB 5H2UA 2J4ZA 4YBKA 4EHEA 3R8MA 2VTHA 4FMQA 3PXZA 5CZIA 1XH4A 5EI2A 4USDA 1IAHA 1OIQA 1ZOEA 5HE2A 5IQIA 3QLFA 4W4XA 5DHAB 2C5VA 4E20A 5AR5A 4PL4A 1MAIA 1FMKA 4W4WA 5IUIA 3HMMA 3RI1A 5I5ZA 3E93A 4C57A 3DB6A 5CVHA 4BHNA 3PDTA 2IO6A 4M84A 4C0TA 4IXPA 4EZ5A 3QF9A 1ZMVA 5E9EA 1PMNA 3QKLA 4G9RA 2R64A 4F70A 2VZ6A 4A9YA 5BMSA 2QONA 4Q9SA 4K2RA 4R1YA 5IH4A 3Q60A 4RX5A 3EYHA 2YDKA 2VAGA 5AR3A 1BTNA 2VWBA 4BDAA 2ETRA 3ZBFA 2BILB 3NMUF 2R3MA 2YLEA 4GT5A 4LUDA 5EKOA 2YS5A 1U5FA 3VQHA 1NT2A 2VN9A 4Z16A 3D8DA 4TYJA 4ARKA 2UZLA 4AF3A 1M2RA 2RSGA 3KVXA 3HUBA 3ZBXA 2H7DA 2E9UA 4WG5A 5IISA 3UZTA 4KIOA 2QURA 2G9XA 5FBNC 4NSWA 5IH6A 3FSFA 4DFYA 3LLTA 4GS6A 4MF1A 4WUNA 3QYWA 5D3VA 2OJGA 2OXXA 3POZA 4FTIA 3NUAA 4XV9A 5C8NA 5JFWA 1HCLA 4DG2E 2D9VA 1O6YA 2BRHA 4WNPA 1QL6A 2IVUA 4PPBA 4GRBA 3IW4A 3R9HA 2GCLA 2J0MA 4EWHA 2XS0A 5AV1A 5DOSA 1IRSA 4G6NA 3EN4A 1OKWA 4GYGA 3DTCA 2O0UA 1WBOA 4IM2A 5DRDA 4ALUA 4D1XA 3KKVA 1ZC3B 3DAEA 4GMVA 3QBVB 4GPTB 1H0VA 3SHEA 3FZ1A 5IQDA 4R5SA 3OWJA 3FI4A 5T6KA 2UZEA 2FVDA 2BDFA 2BRNA 4I41A 4QOXA 4XG4A 5B7VA 3NEWA 1W0XC 4UBAA 5CSPA 1V5UA 4LM5A 1WVWA 5KX8A 1G8SA 4QMVA 4QTBA 1FHXA 2NPQA 3QCXA 5IA5A 4QO9A 3QA0A 4AA0A 2A1AB 2XRUA 4ZLOA 4EQMA 2MFQA 2O5KA 3A7JA 3KXNA 2WPAA 3R28A 4WIHA 2C3LA 5IQAA 4CFUA 5AUXA 3F3TA 3CTQA 1KE9A 2G35A 3VBYA 2PMOX 3O23A 4XP2A 5DT0A 4EH6A 2H6DA 4R7BA 4M67A 2R3QA 4GH2A 5FUTA 4HOKA 3IG7A 3OP5A 3UYTA 4PMSA 4KABA 4PP9A 2YRYA 4EC9A 5AUYA 1PXMA 2P2IA 1BX6A 3JPVA 4I0TA 1STCE 4NW5A 4BBEA 3L9PA 1DYNA 3QCSA 3KU2A 2HELA 3THBA 3TV7A 2PVJA 3ZLSA 1KZGA 2ZOQA 5K0KA 2CY5A 3QTQA 1Q99A 3GB2A 5D1JA 2W4JA 4AZWA 4FVPA 3R7OA 2R0IA 3LCKA 4MAOA 3P79A 3Q6WA 3S1HA 4DX90 3G6GA 4F7LA 5JQ5A 4GG5A 4LUEA 3TKHA 4G6OA 1UU9A 4RJ6A 5A3XA 4S33A 5K5XA 5C5BA 4CCBA 1PKGA 2X8IA 2ZM1A 4KBKA 5TO8A 5FP5A 1Y57A 3C4FA 4Y5HA 5FGKA 2OTXA 3BQRA 5IQHA 3FY0A 4C36A 3AC1A 2DWBA 3MVHA 4F4PA 4GMXB 2JIUA 2GSFA 5AIRA 4Y5QA 3TI1A 4DLJA 5DGZA 2H9VA 3NZ0A 3KC3A 3GOPA 3Q4ZA 2HZ4A 1J1CA 1YDRE 2PMIA 4FX3A 4CKIA 5CT7A 4DEDA 3BQCA 2UW4A 3OANA 3MIAA 4EOMA 3A4PA 3E3BX 4JX3A 3OCTA 3F2RA 5KZ0A 2ITNA 1X1GA 1VYZA 5D7VA 3VBXA 4C4JA 3FSKA 2YITA 3Q4CA 2Q0NA 4MNFA 2VTTA 4TPTA 5TOZA 1FAOA 5KCVA 5CU3A 2R3IA 3MPXA 2ZM3A 3P08A 4AFJA 3RNIA 1PMVA 4O6LA 3VHKA 5E8YA 4OTFA 1URWA 4GKHA 1GIJA 1IEPA 2WMBA 2X7FA 3QCQA 3S4QA 3D2IA 1TVOA 1XHAA 3OD6X 4GIHA 4RWKA 4CYIA 4DEEA 4QQTA 3TW1A 5HIEA 4H36A 2WU7A 2HK5A 4MXYA 5DEYA 1PXOA 4K6ZA 5LARA 5DMZA 3SOAA 2ITQA 4FV9A 3LMGA 2R3GA 3U9CA 4CNHA 4M0YA 4USFA 5DWRA 5L2IA 3CKWA 4RIXA 4PDPA 4R5YA 2IW9A 3I81A 5IUGA 4XYFA 2XIRA 3JVSA 1QCFA 2BUJA 4FGBA 3ODXA 3FLZA 4UWCA 3PPKA 2J0LA 2R9SA 4OUCA 1N3HA 4V0GB 3PUPA 4FNZA 4ZTHA 3FLSA 2XUUA 1WVXA 2EU9A 2WTCA 3ORTA 3NUYA 2ITZA 2OWBA 4GK3A 4AN2A 3BE9A 2W99B 1WBVA 2R0UA 3BYMA 4O84A 4WD5A 4U3ZA 4C4IA 3JS2A 3ORNA 4FEXA 1W8CA 1UNHA 2JDSA 3GC9A 3NUXA 5BUIA 2RFEA 2GS0A 4AWIA 4BGGA 3IPHA 1KWPA 4NM5A 3VVHA 2VKIA 4TKNA 1GAGA 1Y91A 3KQ7A 2CKEA 1Q8WA 3ORXA 4G31A 3QU0A 4TXCA 2QKWB 3V8TA 1W1GA 4CHJA 3PXRA 4O0YA 1BTKA 4NIFA 2MWNB 3KULB 4N70A 2ELAA 4ID7A 1YXXA 3O7LD 4O2ZA 1PYEA 3QRTA 1YKRA 2BKZA 3A8WA 3RAWA 4JX7A 5A46A 2I5FA 2XYNA 4EZ7A 2Z7SA 3FI8A 2DYNA 2OIQA 3P5KA 2P0DA 3PSBA 3EIDA 2R3HA 4O27B 5F95A 4PDYA 1OIUA 2IW6A 2UW5A 3N9XA 3VBVA 4A4XA 4GVJA 4IAIA 4QTAA 5LXMA 3U6HA 2NNWB 3LQ5A 3Q4UA 4YTIA 3LMIA 5HKMA 3GYOA 5JRSA 3PZHA 3HMPA 4A4LA 1PW2A 4HZRA 4MX9A 2WTJA 1K9AA 4FTUA 4QYFA 2BHHA 3F2NA 4PDSA 1SM2A 4RX7A 3VS3A 2KGXB 3C50A 3LLAA 5J87A 3PSCA 3UOLA 5KMJA 4ZEGA 2VTQA 3DK6A 4YJSA 2E9PA 3QTRA 4A9RA 5HIDA 2UZRA 3FXWA 3LOKA 3TJCA 3AT3A 3OY1A 4I6FA 1FGIA 1AQ1A 1E9HA 2B9JA 2QR7A 4Z9LA 3UC3A 4G3CA 4NJ3A 3NYVA 3S95A 2BMCA 4C3FA 2RKUA 2ERZE 4IWQA 3MH3A 3EQDA 1F5QA 3HA8A 5A54A 4CLJA 4D9TA 1WI1A 4M7IA 5HG8A 3SG9A 3DXCA 3LVPA 5FM2A 3NCZA 4APCA 4UX9A 5CEQA 5J7HA 4ITHA 4QP2A 3PG3A 5EI6A 5HO6A 5CVGA 5DR6A 4ZY6A 4EK3A 3V5WA 3P78A 4FKLA 4CQEA 3BCEA 3TTJA 3NW7A 3UNZA 4C4HA 3D8FA 2G01A 4XOZA 1FHOA 1L3RE 3G9NA 1TXDA 3VRZA 3GOKA 4FZFB 4M8TA 3MW1A 2ETMA 2D4QA 4FK3A 3R0TA 4I6HA 4ZJJA 4TN6A 4A6FA 2J7TA 4C37A 3CIKA 4XH6A 4TYEA 5CT0A 1KZ7A 3KCKA 5L4QA 1RE8A 3MB6A 1TQZA 5CY3A 5TT7A 4DEAA 2BKKA 3W8LA 1PXIA 1BMKA 3HV3A 3TV6A 1OUKA 3JYAA 3R8ZA 2PUNA 2PU8A 2YM8A 3A98B 3SLSA 2ONLA 3ZU7A 3ET7A 3ZC6A 4DGGA 1WBWA 2ONLC 3PJCA 2J50A 2QR8A 5DLSA 5AX3A 3REPA 5I3RA 2PULA 3ZRMA 1X8BA 3C4WA 4QMQA 3KCFA 3P7ZA 4J97A 2WXVA 4EOSA 2ITVA 2B52A 4LGGA 3LE6A 3CSVA 2D9YA 2X7OA 4EOLA 1REJA 5AMNA 4HVDA 3VS7A 2YABA 1MK7B 1TQMA 1FGYA 4FTTA 5EM5A 5CLQB 4BDDA 3R2YA 1T45A 3TO1A 3BX5A 3G51A 2XJ1A 2JDOA 2XVDA 3RM7A 3H10A 4D0XA 3P7CA 3F5PA 4AE9A 3TJDA 4QQ5A 4ZAUA 1UU8A 3P86A 3BBTB 4YJQA 1URCA 2XK4A 3SYXA 5D9HA 3C1XA 5CF5A 3AG9A 2YM3A 2G15A 3KY2A 2YDJA 2R3JA 1M7NA 4JLCA 4XJ0A 3IOPA 2DKQA 3M11A 4GCJA 5K9IA 4BCFA 5HQ0A 1W83A 4ZY4A 5LCJA 2PVYA 4E3CA 3DA6A 5AJQA 3V01A 3FC2A 2X4ZA 2IVTA 2YN8A 3Q52A 1Q8UA 4J95A 4WNMA 4O0XA 3KXMA 5F1ZA 2Y7BA 2H96A 3DXEA 1P6SA 5FTQA 3OCGA 1XKKA 5TF9A 2J0MB 4XG3A 4A06A 3ELJA 4GJ3A 3R7VA 1QPCA 2R5TA 3NUUA 4RT7A 4YPDA 4F9CA 2BRGA 3R83A 3OY3A 2OFUA 2BAKA 3QLGA 3HQCA 3QTSA 4IZAA 2JIVA 2C1AA 4IE9A 5AR4A 2CKQA 4L9IA 1U2BA 4ZRJA 4XG8A 2J0IA 5JSMA 3P23A 2OK1A 4EZ3A 3FPMA 3LCTA 5BVFA 3OT3A 4XRJA 5AFVA 1MK9B 4ACCA 4U8ZA 2VV9A 3NUSA 2MDXA 1QPJA 4AOJA 3K3JA 3K3IA 4OBPA 4XG6A 4XBRA 3T9TA 3U6JA 3ZOSA 1OY2A 2QLUA 4U0IA 4Y94A 3LKMA 3VRYA 4F08A 5I9WA 4O7ZA 4RWIA 3NAXA 4PNIA 4BVUA 4YLJA 4E4MA 2UW8A 2W1FA 1J7IA 4IFSA 2Y4IC 4YHFA 2Y6OA 2PVMA 3ORKA 4MTAA 1ZRZA 4FTLA 4F1OA 4ZS0A 3S3IA 3NNVA 1FHWA 3C13A 4EJNA 4U7ZA 3FPQA 1DM2A 5M4UA 2I0YA 4FSTA 3E63A 4DH5A 4ZSAA 4IAPA 2PK9A 4QNAA 5EQYA 2WMQA 4WBBB 4LV5A 4Y85A 5E7RA 5EYMA 5AV4A 1XR0B 2OZAA 2OKRA 4TKSA 4EORA 5EW8A 4FTOA 1H1WA 4IX5A 1KE7A 2XK9A 3VS2A 4RC2A 3VJNA 5HLPA 3C0GA 3AT2A 4O7YA 3NSUA 4QMZA 1WG7A 2YACA 3R63A 4BTFA 4ZSEA 3EB0A 4JS8A 4I5CA 4LMUA 4F0FA 2XNGA 4ANMA 3OCSA 3ID6C 3MB7A 5CLPA 4QD6A 3L1SA 1JQHA 3GFEA 4X2JA 4NM0A 4F63A 2Z8CA 2QODA 3MJ2A 3N51A 3NLBA 5KE0A 5CENA 4D4VA 4I0SA 1V1KA 2WQOA 3WF6A 5CQWA 1JPAA 3GU5A 4L42A 5B2LA 4V05A 5AP2A 4BZOA 4CKRA 3FQEA 5E1EA 5D3XA 2PE0A 4U81A 3I0QA 4CXAA 3Q53A 4ZTQA 4EH3A 2GTMA 3N4TA 4JQ7A 3G0FA 4QP3A 4N4SA 2QOKA 4Q5HA 4BHZA 2DYLA 2I1KA 4F7GA 2GQGA 4O7WA 3A7FA 2VU3A 4QTEA 5KMKA 2EXCX 1ZC4B 3KF4A 3JR1A 1MQBA 1OECA 2QKMA 4II5A 4UXQA 3P7AA 4P90A 2CSNA 4I4FA 4NSTA 2DX5A 5BMMA 3HV7A 2WIHA 2XJ2A 3SV0A 2OSCA 4ASZA 3CPCA 3P4KA 3QTUA 1OPJA 4HDOA 1AWEA 5DPVA 1PMUA 3BBWA 4FSWA 5AR2A 4YNEA 4KKEA 1WJ1A 1B38A 2GQSA 2XIXA 3O8TA 4RA5A 4XRLA 4BIBA 4JIAA 3NSZA 5L8KA 3TKIA 4W9WA 1U54A 3HRCA 1ERKA 3NYOA 1KE8A 4G3FA 2GFCA 4U97A 2R3KA 4LYNA 5EQPA 4BKJA 3RM6A 1QPEA 3TDVA 2PPQA 3QXPA 3L8SA 3UQGA 3FJQE 4JQ8A 3LZBA 3F5UA 1H10A 4OW8A 4EQUA 2K2JA 3BHVA 2R4BA 1PRYA 4C4EA 2UVYA 3DZQA 3HA6A 5BYZA 3SQQA 4A9UA 2CDZA 4F7UP 5BX0A 2XP2A 4FIHA 3CGOA 4M0ZA 4FV4A 5DG5A 3P6AA 4S31A 5BVWA 1XQZA 4EUUA 4IB0A 1J1BA 3FMEA 4R3CA 2J0JA 4O0VA 5DA3A 3UIMA 4DGMA 1FBNA 3FBVA 1PLSA 2R7BA 3KRLA 5E8SA 1CM8A 4UV0A 5HICA 3LMHA 3F66A 5CTPA 2AC3A 5HNBA 2DTCA 4IHPA 3P0MA 3I5NA 4LL0A 4FKQA 3VC4A 2M14A 3RZBA 4ALWA 3FXXA 4BN1A 3HP5A 5IA1A 3MVLA 2W4KA 4JOAA 3R7GA 2IG7A 3LCOA 5EKNA 4K81A 3AGLA 1YOMA 4UMUA 4P2KA 4JAIA 3W32A 5JK3A 1K5GB 2WTIA 3EN7A 3LFFA 4E93A 4ZK5A 2WO6A 3IW7A 2BZJA 3A7IA 4OT6A 3FWQA 1FGKA 2R3LA 4OBOA 1JOWB 4WKQA 4O0TA 4R3RA 3WE8A 2CPKE 2OJIA 2C69A 3WIKA 5L6WL 4YC3A 1HCKA 1Q3WA 1Q8ZA 2B9IA 3EQCA 4MVFA 4O1PA 5CAOA 2R09A 4EC8A 2Z2WA 2ZB0A 2YIYA 2R3FA 2WQBA 3IQ7A 4MD7E 3SC1A 4AT3A 2WU6A 1WVHA 4C0AA 4E6AA 2PYWA 2D9WA 1VZOA 3NIEA 2W17A 3ZSGA 3BEAA 1KE6A 4BCMA 1GNGA 2W5BA 4CVAA 2E2BA 4GV1A 3RALA 4BDIA 2PZ5A 4NWMA 3R8LA 4CG9A 2V22A 3TACA 1IASA 2C1BA 5IPJA 3RPYA 4ZTRA 1YVJA 3BYOA 4RJ4A 3I79A 4NH1A 1L8TA 3W2PA 1FPUA 3F3ZA 4DEBA 5L6PA 2JAMA 4IEBA 4IOYX 1YHVA 4MQ1A 5J79A 3Q5IA 1X05A 4L00A 3RP9A 4D2WA 4WHZA 2HYYA 1XH5A 2A19B 5HNIX 4BI1A 4Y83A 3HDNA 5EOLA 3ZYAA 4AP7A 1ZMWA 3D5WA 4PF4A 3U8WA 2XRWA 4I5PA 2XZSA 4ZTLA 2WGJA 4PTGA 5E8TA 4EOJA 4KIQA 3KREA 5BVNA 3PLSA 4LQMA 4E4LA 4RLLA 4FSYA 3ZH8A 4HVGA 3IONA 3RMFA 4QMNA 4DC2A 2GCDA 4BCNA 4YTHA 3KN6A 4O83A 2RIOA 4IAZA 4EUTA 4L8MA 4RX8A 5J95A 3TKUA 1M2QA 4RSSA 4AZSA 4D2TA 2OG8A 3TUCA 5E90A 4J7BA 4NKSA 4LRJA 4E5BA 1MIXA 3OW4A 3IVFA 4S30A 4AW1A 3FEGA 4IDTA 1Q62A 3I6UA 4XV3A 4C58A 3OC1A 3PRIA 1ZARA 1KOAA 2X2KA 4FICA 2X18A 2FYSA 4F0GA 5FWKK 2QLQA 5CEKA 1BI7A 4D1SA 2RNRB 5JHHA 2G2FA 3MTFA 3QA8A 3NNUA 2J90A 5HZNA 2Z02A 2W9ZB 4J99A 4FEWA 2HZIA 3VS5A 5EYKA 2PSQA 2RFNA 2VWWA 2HENA 2JKQA 2VWXA 4HPTE 4DEGA 4EBWA 2YERA 5ETAA 4B6HA 1PYXA 2BR1A 3QUDA 1DI8A 2HAKA 4MY6A 5HE0A 3TUDA 3A2CA 4M14A 4EK6A 3O17A 2GJYA 3L8XA 2UUEA 2RF9A 2O63A 3A99A 3A8XA 4NTSA 3QRJA 3HAVA 3CKXA 1G3NA 2VNWA 2XM8A 3B8QA 4MXCA 3ZC5A 3AT4A 4E6DA 2UVMA 3NIZA 2UZUE 4YP8A 4K18A 3QZHA 1WBSA 5LMKC 1XH7A 4M97A 1NVQA 2WZJA 3LFNA 2H8HA 4M13A 1DI9A 3EFWA 5DR2A 4DEIA 3PVUA 4YURA 5KMIA 3HK0A 1Y6AA 3Q9ZA 3OFMA 5IUHA 3MFUA 1OM1A 4HGTA 2JITA 5EW3A 3UP2A 4AGWA 1J19A 3LM0A 4Y95A 3WYFB 4ZMEA 5DE2A 5EOBA 2QCSA 1DAWA 3AGMA 3D5VA 3DJ7A 4BFMA 5A4QA 3VJOA 3GT8A 1VR2A 1R3CA 2VNYA 5AP4A 4TWOA 2XF0A 5CXHA 4BCPA 1I7AA 1EVHA 1RRPB 1OBGA 2HXQA 5CAVA 3E7VA 4KKGA 5IQCA 4HAXB 2YFXA 5J5SA 4F9YA 4FBXA 1U54B 2LKOA 3CTJA 4AQCA 2VGPA 3Q5ZA 5CLLB 3DK3A 3IGOA 4G2FA 3VBTA 4YC6A 4OR5A 3D8EA 4EK4A 2XKEA 4Z3VA 4ZZMA 3P9JA 4DFNA 4B0GA 3QKMA 2ITOA 1OB3A 3HMIA 1E1VA 3MFRA 5E8XA 4BDKA 3NVMB 3AC3A 3WYYA 3PXQA 4S34A 4IZ5A 3UNJA 1KI1B 3FEHA 3FSSA 3ORLA 4A6HA 3CXBB 1O6LA 2IVSA 4V0GA 4AE6A 2XK3A 2C68A 3L9NA 4YTFA 5AUWA 4AGUA 4NTTA 1FGZA 1YQJA 3O8UA 1U5DA 2QKLA 3PG7A 4KAXB 4G5PA 1JBPE 3AD5A 4N57A 1Y6BA 2WMWA 4DBXA 5EFXA 4BY9E 4GK2A 4XCUA 3R9RA 4O7VA 2A0CX 3QQUA 4DGOA 4EI4A 5CAPA 2NMBA 1GIIA 4J8NA 5EFQA 5H8BA 1H1QA 4NCTC 4EH9A 1WGQA 4FR4A 4ZZOA 1W82A 2EWAA 3MN3A 2XK6A 2F9GA 4DFLA 2I5CA 4OTIA 2PVRA 4C61A 3FHIA 4IANA 4X3FA 2PVKA 1FINA 2VWUA 5BYYA 1YXVA 4FK6A 4L46A 5IKWA 5L6OA 5L8LA 4D4YA 2NP8A 3AU4A 4BF2A 3N7CA 2BTSA 2V76A 3MIYA 5E92A 1EF1A 2VTOA 3TDWA 1MP8A 3F3VA 4I6QA 4JR7A 4C34A 2D10A 5CSWA 4YONA 2OZOA 5J7BA 1Q5KA 2G1TA 4RVKA 3QUEA 1YWVA 1SNUA 5AM6A 3U4WA 4IAKA 1BLXA 1U5RA 3UQCA 2PVHA 2W1EA 4U45A 2JGZA 5HE1A 4JDIA 3D4QA 3TV4A 3WZEA 5HTCA 3PY1A 1Y8GA 3VULA 4CFFA 2OJJA 5F9EA 5IA2A 5KMOA 4JDJA 4OGRA 1UNLA 3F88A 5ACBC 4RA4A 4IB5A 2PVNA 1QMZA 2VWZA 3GU6A 4ZJIA 4KBAA 4RFYA 4RJ7A 4C4FA 4C8BA 2DLWA 1W7HA 3LFEA 3F3UA 4E73A 1W98A 3ODOA 5GOWB 4AW0A 1UA2A 1FMOE 4O7TA 2BFYA 5LONB 3DXNA 2BZIB 3ORIA 2CCHA 1OL7A 2FSLX 4QMYA 4IIRA 3WI6A 3UTOA 3I5ZA 2A2AA 5HTBA 2WTDA 1UPRA 2W1CA 3DBDA 4YO4A 5C27A 4H05A 3NUNA 4XS2A 2IWIA 2RFSA 2YM5A 3FUPA 3VQUA 1IA8A 4HAYB 4IM0A 2QKRA 2C6IA 3F5GA 1NVRA 1ZVRA 2ZPYA 3UZRA 3LXPA 3DQWA 3V04A 4JDHA 4RIOA 4Y72A 1GG3A 2ROVA 3DU8A 4PV0A 5CU2A 1GIHA 3V3VA 5LVPA 2PVLA 5LQFA 4FI1A 3UO4A 2HW6A 5HESA 3PY3A 3UNKA 3FYKX 5A6OA 1ZAOA 1F3MC 4DH1A 3PJ8A 4RC3A 3QQLA 2V5QA 4F6UA 4MXAA
chains in the Genus database with same CATH superfamily
1YXTA 3SG8A 3I1AA 4QEBA 4FV0A 2BAJA 2XNOA 1A06A 4U44A 4K33A 2QI8A 4OAVB 4B8MA 5L3AA 4H39A 3ZDTA 4BZDA 4LL5A 1V0BA 3D7TB 3UJGA 3NRMA 1V61A 3TMOA 2O2UA 3COMA 2AEGA 1W2FA 4FZ6A 2CGUA 4NJDA 4YR8A 2I0HA 4ITIA 4XP0A 1G8KA 4FT9A 1TQIA 3R9OA 3D7ZA 3DKFA 2YVCA 4KA3A 5J5TA 3TG1A 4NT4A 5M56A 1V0PA 3H9OA 4N0SA 3WA0A 1JLUE 1JKSA 2X0QA 4FT7A 5CS6A 5ANKA 4FV2A 4D0WA 4HB4B 1PHKA 3NNXA 5HD4A 2PMNX 2RL5A 2YJSA 3JY9A 4M69B 1KE5A 3Q9XA 4FV1A 4RIYB 4UEUA 5HU9A 3A8QA 4KIPA 4M69A 3CP9A 4RIYA 3HIEA 2FB8A 2XJ0A 4XG7A 5J1VA 2B7AA 4GK4A 4QMUA 5J1WA 1IG1A 4RMZA 1P14A 3ZRLA 4BDBA 3PIZA 3FQHA 3VHEA 4CMTA 1PFJA 2PE2A 3I60A 1ZOHA 2QOCA 2WELA 4QPAA 1OIRA 3MTLA 4K2OA 4JQEA 4IJPA 2AL6A 1O9UA 4C59A 2OXDA 3PTGA 4O4CA 1OGUA 4X2NA 1RJBA 3RZFA 4ZIMA 5AR7A 1OL6A 2Q83A 2VTIA 4MEDA 1OKVA 4GU9A 3HRFA 4O7RA 3RTPA 4NYEA 3OEZA 2P4IA 4DH3A 1LP4A 4IX3A 4KNBA 3COIA 3DY7A 4JNWA 4U3YA 3KMUA 4EYJA 5KHWA 3TNHA 1UU3A 4CYEA 4BBMA 5CU4A 2WTKB 5H9BA 4KHAA 2E9OA 5EDRA 4HNFA 1FQ1B 3DBEA 4M12A 3AKLA 4X6RA 3FXZA 2YIQA 5LVOA 3ACJA 4G34A 4XV1A 4D55A 2R3PA 3A61A 3B2TA 2C6EA 3ZMMA 4L52A 4IACA 2UZTA 3KMWA 4AUAA 2XAMA 4BJJB 2I6LA 4A4OA 4APPA 3W18A 4AS0A 5IDNA 4B8LA 5DNRA 2LAVA 3E62A 2ITWA 1XBBA 4RIWA 4NY0A 2Y9QA 5DEWA 4FKRA 4BWKA 5M55A 5JT2A 4X7QA 4TYHA 4F78A 2IZTA 4FTNA 2CGWA 2FA2A 4F09A 3ODWA 1OGYA 5J8IA 3NUPA 3DZOA 1APME 3HKOA 3E5AA 5LVNA 4ZS4A 3MESA 4KSPA 2W1ZA 1RQQA 2IVVA 3UBDA 5GIPE 4O1OA 3CBLA 4TYIA 3RK7A 4GKIA 2KUPA 1AGWA 4FVQA 2PWLA 3G9LX 3KIOC 5KMMA 5ETIA 3BEGA 4AQKA 5BUEA 3CXWA 4MXZA 4FL3A 3CR0A 3PZEA 4F7SA 4ZY5A 1TJ6A 2JKMA 3RHXA 3KRRA 4DG0E 1OQNA 5HLNA 3TYKA 1J7UA 1IR3A 4BDCA 3WIGA 2ZMDA 4WNKA 2X0GA 4G1WA 3AQVA 4HNIA 4OTPA 5T3QA 3SX9A 3VWAA 2CGVA 3HECA 3MFTA 4YMJA 2YT1A 3FLNC 2C0IA 3OCBA 4TWNA 3D0EA 4PMTA 2HIWA 4WO5A 4FKJA 2XEYA 3QGYA 4M15A 4XMOA 5CF8A 3R8PA 4OAUC 1UPQA 3H9RA 4PUZA 5JGAA 5JLJB 2JDRA 1JAMA 3FZRA 3KZ1A 4F9WA 3JUHA 5FTOA 5IEVA 1E5WA 3EQPA 3FMHA 3BU3A 3KRWA 4L53A 4FEQA 4MWIA 3VS4A 2C0OA 3WILA 3ZO3A 1MQ4A 1YDSE 3R1SA 5ETCA 5HOAA 3IDCA 4QMLA 3UOHA 5J3QA 5AP7A 4U43A 3VAPA 4KRCA 2WTVA 5M4YB 3EYGA 4YJVA 4CSQA 3HAMA 2JD5A 4H58A 4YZ9A 3V8WA 4AXDA 4KIKB 3ZEPA 5DI9B 3V5JA 3E7OA 3HSAA 4Y8DA 1G5SA 3FC1X 4RJ8A 2LYDA 2M38A 2DN6A 3QX4A 5AM7A 4F7NA 4RIXB 2DKPA 3QD2B 3SVVA 5F94A 2WTWA 2YJRA 4CFWA 3ZCLA 4IADA 3EQIA 3VIAA 4FSUA 1JVPP 3PIYA 4RPVA 4NKAA 3U8ZA 1LUFA 3NW6A 4KIKA 3DFAA 1JSVA 2BRMA 3MS9A 1GOLA 5HCYA 3KMMA 4CFXA 4OTWA 4E8AA 4LRKA 2ESMA 2WQMA 4P4CA 3GCVA 4HYSA 2AEHA 1JNKA 3WZDA 2R0DA 2FH9A 1S9JA 2VTLA 3GU7A 5K5NA 3A58A 3PVLA 3DB8A 4BCIA 1JKTA 2C5OA 2RGPA 3RHKA 4B6LA 4U79A 3EQRA 3AMAA 4G5JA 5HG9A 2C6KA 4FTRA 3ROCA 4BICA 2DHJA 2RUKB 3QIJA 5LWMA 2REIA 5L81A 4BCJA 4YSMA 3CD8A 5HHWA 5JKGA 1OBDA 3A60A 4L68A 5HBEA 2Z7QA 1P5TA 1FVRA 4I0RA 3PPJA 2O3PA 3GC0A 3ITZA 4JIKA 4BCGA 1W1DA 4YTCA 4HB2B 3GQLA 4KBCA 4HYIA 2NRYA 3I7BA 5FDPA 1LR4A 2HWOA 3NX8A 3N4VA 3W16A 5I9YA 3NFFB 3QZFA 4HVHA 2PE1A 3U6IA 3SRVB 3W10A 3HX4A 4IFGA 4JDKA 3FQSA 4JG7A 3MA3A 4D2VA 5JP4A 2OH0E 2XKFA 4JR3A 4RGJA 1SHCA 4AOIA 3EH9A 2Y8FA 3T06A 3ZO1A 4ZSLA 4QJ3B 5AP6A 5KBQA 2C5YA 5CX9A 3DJ5A 5ACKA 4B7TA 4ANSA 4L3JA 2FJUB 4FG9A 2AUHA 3ALOA 4C2VA 2IJMA 3KF7A 1NU2A 2DS1A 3UVPA 5AUUA 1ZLTA 3DOGA 4Z2MB 3R8UA 4QYEA 5CF6A 2YZLA 2C0TA 1R0EA 2X7GA 3QTWA 4LGDA 5HCZA 5D3YA 5K4IA 3H9FA 4QMWA 3GU4A 4FSMA 2C6LA 3KXGA 2F49A 2V62A 4NEUA 3OF0A 1U46A 1Z57A 3QRKA 4FT5A 1XWSA 4I6BA 4WSYA 1M7EA 2HTHB 4NK9A 4KHBB 2UZWE 4KS7A 4RIWB 3CTHA 5DR9A 3AXWA 2R7IA 4MK0A 2YDIA 3KXXA 2V55A 5DRBA 4DAWA 3H0YA 1U5EA 4MD9E 5BYLA 2Y4PA 1Q61A 2YLFA 4QT1A 4HYHA 5K3YA 3MJ1A 2NYAA 3G5DA 3ZEWA 3W55A 3OT8A 3ZS5A 3VOQA 5F4NA 4U41A 1ZZLA 4AAYA 3KSYA 1BKXA 1UNQA 2WTKC 3GCUA 3ZUUA 1JSTA 3MFSA 4LOPA 4GNKB 2W2XC 4FF8A 4E4XA 4F9BA 5CI6A 2JBPA 3W2SA 4EOKA 1OL1A 3ZM4A 2JP2A 3UDTA 5IH5A 4ZRIA 4YSJA 3OHTA 4A9SA 1PXKA 2QQ7A 3AJ4A 3EQFA 3GCSA 2ZMCA 4QYGA 5E1SA 4MBLA 3LXKA 4NZWB 5H8GA 1UWHA 3TNPC 4FTMA 2OW3A 3ZXTA 2QOIA 4BIDA 2ZV7A 4MF0A 3P5JC 4D2PA 3PXFA 1PY5A 4GFGA 1WFCA 2XH5A 4GJ2A 5CVFA 3TUBA 4QRCA 3IW6A 4EWQA 4FT0A 4ANLA 2FJLA 2HY0A 2W7XA 2IN6A 3HV5A 2YM6A 4L44A 2I40A 3EL8A 3DNEA 3ZRKA 4U42A 3DLSA 4L3PA 4EKUA 2KIGA 1UWJA 3Q04A 4G9CA 3OOGA 2DHIA 4WT6A 1KUTA 4FEUA 4FIEA 2ZV9A 4DGLC 4I94A 3UVQA 5AV3A 3LAUA 3E8DA 2XK8A 3T3VA 3ZZEA 2WAJA 3GENA 4BKZA 3BI6A 4HGEA 3G2FA 2LGCA 2PVFA 2X9EA 3GU8A 4K11A 5G1XA 2FSOX 3FZOA 5I9UA 4RLKA 4ERWA 3Q9YA 2CJMA 3QL8A 3VN9A 1OMWA 2WHBA 3E87A 1ZYJA 3II5A 3ORMA 3VS6A 1U5QA 2VTAA 3ZFMA 4DT9A 3BELA 4D28A 2V7OA 2YF0A 3OS3A 3QRIA 2ZJWA 4LMNA 4EJ7A 2ERKA 1WMKA 5B2KA 3U51A 4GMYA 3SA0A 5FI1A 5IA4A 5AX9A 4CZTA 3GI3A 4J98A 1KV1A 3K54A 4BWXA 5L2TA 3UDZA 3D7TA 2PUPA 4JBOA 5FG8A 2B54A 3EZRA 3VF9A 2L1CA 2OF4A 4AX8A 3R2BA 3SW7A 5D12A 2JDTA 3QZGA 2F2CB 5JMSA 1NTYA 2C5NA 4UYNA 1WBTA 4RQKA 5AAEA 5M57A 5JN2A 4D4RA 5L2SA 3G15A 4QDEA 2EUFB 2QD9A 4C2WA 2VWYA 3W0SA 3DDQA 4O22A 2VX0A 1UKIA 4RVLA 4NL0A 3CE3A 2YSZA 2X1NA 5HIBA 4GT4A 1LEZA 4J52A 4O91A 4NU1A 2YAKA 3EJ1A 5KO1A 2CNUA 4I23A 5C8KA 1PJKA 5GZ9A 4R78A 3RAIA 1SVHA 5IF1A 4FKWA 2ZYBA 5ANGA 3SD0A 3QKKA 1Z87A 4HAZB 4AA5A 2UVXA 3ACKA 3MV5A 4BTKA 4DTBA 4JT3A 3O51A 5BUJA 4XLIA 3PA4A 2QOBA 4CCUA 4A5KA 2P33A 3PJ3A 3SKCA 4FKVA 1WCCA 3O5AA 3FKLA 3FE3A 3G90X 4Y46A 5IMEA 1AQCA 4GL9A 4H3QA 1MI1A 5FI0A 3RAHA 3PRFA 5M4IA 3DFCB 4FTQA 5E8ZA 4DN5A 1UNRA 3LCDA 3GVUA 4LFIA 5C9CA 4AU8A 5J3YA 3ML4A 3RBWA 5CZHA 2RVBB 2QOFA 5GZ8A 3EOCA 4IWPA 4PRJA 2BCJA 4IC8A 2WIPA 3MY5A 1WAKA 3EHAA 3LXLA 4CTCA 2QOLA 4WG3A 1WZYA 4AT5A 4KINA 2ADZA 3I0OA 1XR1A 2PTKA 2UZDA 2UZBA 4DH7A 2BHEA 3PUFC 2UW9A 3AC2A 3WARA 1OKYA 4IVCA 4K0YA 3UMWA 4IM3A 2JBOA 4RZWA 3BHUA 4D4SA 3TVVA 4QP7A 5CANA 2W5HA 3ALNA 3BYVA 3F2AA 4I5MA 4FNXA 4EKKA 4HW7A 1H01A 5EDQA 3VNTA 1GC7A 5IQEA 4J1RA 5JZJA 4EH7A 3K5VA 5HBHA 4FA2A 4ZLZA 1MRYA 1P2AA 5KKRC 3HZTA 2Y6MA 3GNIB 3BWJA 5EHLA 1CDKA 4Q9ZA 5IEYA 2UZSA 2RG6A 3ZFXA 1V5PA 3SUZA 1P5EA 3R7YA 3PLAE 3BWFA 3CCNA 2KTYA 4XWXA 2X0PA 5JHGA 2B55A 4O7NA 5HVKA 2BAQA 4FUXA 4WSQA 3S0OA 4F7HA 2CHLA 4EH2A 3VIDA 2K2UA 3BJIA 5LOHA 2V0DA 5ANIA 3ATTA 3PWDA 2CRFA 1J7LA 4CFNA 2QHNA 1UKHA 4CQGA 3EFKA 2CGXA 2QO2A 3L8VA 4QMTA 4RVMA 4E6CA 4EONA 3UO5A 2PZPA 5HLWA 5B0XA 1UEFA 2C30A 2YCSA 3VUKA 4TRLA 3V8SA 2NRUA 4YPSA 4RWJA 1LPUA 4FOCA 2CN8A 3BV2A 4R1VA 3SW4A 4YUQA 2LULA 1OPLA 4I5HA 3CD3A 4CMUA 2X39A 3HV6A 4CD0A 4N6ZA 3UG2A 3ODYX 3OWKA 5HVJA 2EMTA 3BHHA 3V6SA 4FZDB 3LJ1A 5HVYA 1CKPA 3OTVA 5I9ZA 3CPBA 2X81A 3QD3A 3HMOA 3QQFA 3R73A 4UWYA 3KXHA 4YJPA 2WMVA 2Z4DA 3CQUA 3FDNA 3EN9A 3R9NA 2VWIA 4RWLA 4XHKB 4FJVA 2O8YA 4BDFA 4R6VA 2BROA 4IQ6A 5BV3A 2HY81 1XO2B 4HGLA 5C8MA 3ATSA 3QX2A 4IB3A 2PY3A 4RFZA 4YHTA 3GYPA 3MPTA 4CT2A 5E8WA 2WMRA 3UVRA 4AA4A 4J8MA 3KY9A 5FEEA 1DDVA 3RCPA 4BDJA 4MWHA 5C01A 3PJ1A 3PIXA 3F69A 2DX1A 2QHMA 3BLHA 4RZVA 4BDHA 3PSDA 3QALE 3MVJA 4TY1A 3QC4A 4IWOA 5CI7A 5D11A 4BIEA 2CY4A 4XLVA 3UOJA 4Z7HA 3FLWA 5AV0A 1OVEA 5AA9A 4NFNA 1Q3DA 3QQGA 4K1BA 4PMPA 2EB3A 4BZNA 4BRXA 3FLYA 1WGUA 5EM6A 3R30A 4NW6A 2JLDA 2ITXA 2F2UA 3HV4A 2PHKA 3I7CA 3HMNA 3U9NA 3DXPA 4PMMA 3HEGA 3L9LA 4FNWA 2GUMA 3WYXA 4WVFB 1ZM0A 4LG4A 4JBPA 2XIYA 1F0QA 3CLYA 5CSHA 2GHLA 2I1JA 4Z55A 4MCVA 1R39A 3O8PA 3SOCA 3U4UA 4RFMA 4AACA 3A7GA 2ZVAA 5FEDA 4RRVA 4ANBA 4XEYA 3E8CA 3UE4A 4Z7GA 4IFCA 3UIUA 4AGCA 2P55A 5D41A 1XODA 3DCXA 1BAKA 5IQBA 4HB0B 2XNMA 1ZSQA 3F7WA 3H3CA 3VUIA 3HNGA 3AC8A 5L2QA 1VEBA 3ORPA 2PL0A 3RCJA 4ASXA 5ANEA 3F9NA 4MBJA 3ML1A 4WSFA 5GHVA 1H00A 3NCGA 4E5AX 5A4EA 4FTJA 4UMQA 4WOVA 3E8EA 4EHVA 3OROA 1X1FA 3CY3A 5EYCA 4X2GA 5LCKA 5DT3A 4A07A 5DHFB 1R1WA 5KQ1A 1GC6A 2XCKA 3Q6UA 4BR3A 2RGNB 1PKDA 1DDMA 4O81A 2W1HA 1OITA 2C6TA 3DGKA 4MYGA 3D94A 3PP1A 3UODA 4NM3A 3VO3A 2V7AA 2XB7A 3LFBA 3Q32A 4HZSA 4MXXA 4CV9A 3X23A 5CU6A 2FGIA 5FM3A 2QO9A 2CNQA 3R9DA 3DT1A 2OIBA 2E2XA 2OIDA 4FV7A 2GHGA 3NWWA 4ACHA 2OQBA 2HE7A 5M06A 1H0WA 4FSZA 3IGGA 1OL2A 3GBZA 3QHRA 2BPMA 2YIRA 3G6HA 4Q2AA 3FZTA 3KA0A 1JWHA 2BFXA 3QQKA 4CZUA 2L2IA 5DN3A 2OLCA 3FKNA 3TNQB 3PPZA 4DCEA 2F7ZE 3PWYA 4XV2A 1J3HA 5C5BB 4UB7A 2ZDTA 3Q3BA 4E7WA 3TEIA 3E3PA 1M14A 3LFSA 2X2MA 3O2MA 3PE2A 5GJFA 3R04A 4PQ0A 4GT3A 1YOLA 4AOTA 2UZOA 4W8DA 2GNHA 4FV6A 1H4RA 5HGIA 4NM7A 4EOQA 3NFGB 3Q2JA 3K2LA 1OPKA 1Z5MA 3EFLA 2VTMA 2VSZA 1EGXA 5CEMA 2GTNA 3CY2A 5F20A 2FO0A 3LXNA 3BHYA 3M1IB 4G17A 4BKYA 5J9YA 3QCYA 5KBRA 1U4DA 2HCKA 4UXLA 4AW5A 2E9NA 4FV3A 4E26A 4BBKA 3VW8A 2IYBA 1ZYSA 5BQ0A 2ITYA 4W9XA 3SAYA 1YWNA 5CEIA 2BRBA 4L6QA 3RPRA 3MI9A 3TIZA 3FMNA 2HOGA 4LGHA 3ZM9A 2C6DA 4X3FB 4FZ7A 2LG1A 5DH3A 3P7BA 1DBHA 2ZB1A 4IC7A 3CJFA 4L6EA 3AC4A 2OO8X 4PPCA 4QMXA 3TNIA 3BYSA 3SXSA 3F7ZA 4QJ4B 1NVSA 2YAAA 5IRSA 3KRXA 3B8RA 3BKBA 5H3QA 3SGCA 4D6WA 4YZNA 3OUNB 3L8PA 4WJ7A 3LFAA 1G8AA 1Q24A 2Y4IB 2ITTA 5JGDA 1CKIA 4QTDA 1MIZB 2P0FA 4EK8A 3IDBA 3W0NA 1ND4A 3AD4A 1ZWSA 4LOQA 4AG8A 2COFA 3AU5A 5EHOA 1V0OA 4IH8A 2IZUA 5GIOE 2XM9A 5M4FA 4CTBA 3P1AA 5HO8A 3LJ2A 4DCAA 2XNEA 3W8QA 5EK7A 4G6LA 2YZAA 3EN5A 3QXOA 4FIFA 5DH9B 4O82A 4GVAA 4OT5A 3PXYA 2X2LA 4M68A 4M3QA 4D5HA 3R22A 4MT7A 4GFMA 2CLXA 2QG5A 4S2ZA 2UW3A 3ZZWA 5HTIA 4TYZA 4I21A 4QQJA 4DDIA 2QU6A 3BLRA 5B2MA 3NDMA 2AQXA 1REKA 2XIZA 3M2WA 4QTCA 4C35A 2VRWB 4I6LA 4IX6A 4HHVA 4ANOA 2B53A 2N0YA 3GC8A 4BGHA 4AAAA 3CEKA 3A62A 4LI5A 2VUWA 1XH6A 5GJGA 2QVSE 4TWPA 4O0UA 5HCXA 4EH4A 4ZTMA 2JFLA 2F7XE 2BIKB 5KMLA 4RJ3A 5KKRB 2E9VA 4ZJVA 3RINA 2Y7JA 1GZ8A 4F6SA 2QOOA 2WMTA 5I4NA 2OI4X 1B55A 3NWDA 1TFFA 3UIBA 5KMNA 1UV5A 2YM4A 1A48A 3UO6A 5CAUA 2IPXA 3RJCA 4H3PA 4EMOA 4E1ZA 4O0WA 4HSIA 1H27A 3F6XA 4QPMA 4C62A 3RPOA 3GUBA 2UZVA 5J9ZA 5LMBA 3QD0A 4KHOA 5ANOA 4OLIA 5M44A 2QOQA 4OBQA 3LFDA 1H07A 4H1JA 1K3AA 4OTDA 4V01A 3RCDA 2DA0A 1YI4A 2OFVA 3AD6A 4U6RA 1ST4A 3EQBA 5JQ8A 4ALVA 1M52A 4DGNA 3F5RA 4MXOA 4EOOA 4B99A 2GFSA 4EH8A 3FL4A 4CSVA 1PXPA 3QAME 3MY0A 2QU5A 1QQGA 3FKOA 3ULIA 4DG3E 3BV3A 4D58A 2XMYA 5J3TA 3UP7A 2XYUA 3MVMA 4BDGA 4UMPA 2MKRA 4BWPA 3IECA 1H1SA 4H3BA 1WJMA 4DFBA 3KK9A 5AP1A 1XX0A 3FLQA 2BDWA 3D5UA 2XNNA 2G2IA 2BVAA 4XOYA 4X6QC 3M42A 4FKPA 2OZAB 3RWQA 2JEDA 3VBQA 2YISA 2X9FA 4QYYA 3WF9A 3GC7A 4WA9A 4AZVA 4YGAA 4JVGA 1FVTA 3NR9A 2ZV8A 1NXKA 4PX6A 1BWNA 2UVZA 2W06A 2JKKA 2F4JA 2VX1A 1YI3A 2XQNM 3MY1A 3LM5A 3TL8A 3V51A 3PVBA 1P4OA 4HAUB 5L8JA 2JDVA 4TW9A 3R21A 1NY3A 2W2XD 4IZYA 2IW8A 1I2HA 4HAWB 5CWZA 2ITUA 4DT8A 2XA4A 1B6CB 3LCSA 4OTGA 4F99A 4C7TA 4FYNA 4AT4A 5EM8A 2XEZA 3PP2A 4HYUA 4HVIA 1Q8YA 5ITAA 3UQFA 2QNJA 3BE2A 4IVAA 3UPXA 2K49A 3GCPA 5LWNA 3DAJA 2WOUA 5FBOA 4F7JA 3LJUX 5EH0A 3TZMA 1O6KA 3HRBA 5ICPA 2B9FA 1SVGA 4FT3A 3O0GA 3EFJA 5M53A 2XBJA 3EWHA 4PPAA 3BGQA 4GUEA 4YZDA 3CGFA 5IQGA 2PZYA 3TCAA 2PZRA 4V04A 3WZUA 4GZUA 4DF3A 3C4ZA 1J0WA 2KCJA 2W5AA 4IVDA 5BVOA 3R71A 2LOXA 3IK3A 2AYPA 5JZNA 4GIIA 2DHKA 5HE3A 2YS1A 3W33A 4HATB 5E8VA 5A4LA 2KUQA 4AZTA 3E64A 3LJ0A 3LFQA 2COCA 2XCHA 4IAAA 4EH5A 2D11A 2R3RA 5C16A 4GFOA 4F1MA 2GNFA 4FG7A 3TZ8A 4NCTA 1P3RA 3ORZA 3MWUA 2CN5A 2P3GX 5AR8A 4ENXA