1FAOA

Structure of the pleckstrin homology domain from dapp1/phish in complex with inositol 1,3,4,5-tetrakisphosphate
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
100
structure length
100
Chain Sequence
PSLGTKEGYLTKQGGLVKTWKTRWFTLHRNELKYFKDQMSPEPIRILDLTECSAVQFDYSQERVNCFCLVFPFRTFYLCAKTGVEADEWIKILRWKLSQI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords DUAL ADAPTOR OF PHOSPHOTYROSINE AND 3-PHOSPHOINOSITIDES
publication title Structural basis for discrimination of 3-phosphoinositides by pleckstrin homology domains.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 23
structure length 100
sequence length 100
ec nomenclature
pdb deposition date 2000-07-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00169 PH PH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 1faoA00
3D8DA 3TW1A 1U2BA 1ZC4B 3F5RA 2J0MA 4DX90 1OY2A 1P6SA 1KI1B 2DLWA 2GCJA 2D10A 4HAXB 1DYNA 5CLQB 4HAVB 4IOYX 1FAOA 2YSZA 3HK0A 3CXBB 4F7HA 1MK7B 3PP2A 5DH9B 4TKNA 2LKOA 4Z2MB 3WYFB 2W2XD 4MY6A 3ZVRA 1UEFA 1WG7A 1XR0B 3F0WA 2AEHA 2YVCA 2RVBB 4K81A 1TJ6A 1ZM0A 2RNRB 1TXDA 2DHJA 2DX1A 2EMSA 4ZRJA 3AJ4A 4MT7A 5KQ4A 1UNPA 2R09A 4GMXB 1V5PA 1GG3A 2GS0A 3A8PA 2J0JA 4TYZA 1WVHA 2D9VA 2K2JA 2D4QA 2W2WA 3MPXA 4DXAB 1J19A 1XODA 4EMOA 2DYNA 2DN6A 3AU5A 2D9ZA 2I5FA 5C5BB 1BTKA 1FOEA 5DHAB 1V88A 3ULBA 4CHMA 3DXEA 3U7DA 4A6KA 2NZ8B 5GOWB 2CY5A 4KHAA 5DIFB 5JHGA 1N3HA 2N23A 4EJNA 5D27A 1E5WA 1V5MA 5D3WA 1UNRA 1RRPB 1V89A 1GC7A 3NSUA 3TO1A 3PVWA 1KZ7A 4GZUA 4IFSA 1BAKA 3P7ZA 3TCAA 1LB1A 3IVFA 2Z0OA 3VOQA 2X18A 4B6HA 5LONB 2RGNB 2P0DA 3ODWA 1PFJA 2ROVA 5DHFB 1K5GB 4BBKA 1M7EA 3T06A 1AQCA 1Q67A 2CRFA 1XX0A 3KZ1A 1MK9B 2DHIA 2I5CA 5KCVA 4HB4B 4L6EA 1H10A 1X05A 2K2UA 2XQNM 1EF1A 3SV1A 4PNKA 3A8QA 3ODXA 3KSYA 2VSZA 4KAXB 5DI9B 2PZ1A 1V5UA 1P3RA 2R0DA 5C16A 1UPQA 3SYXA 3V5WA 1FHXA 1QQGA 4HDQA 2OQBA 5J3YA 3PSCA 1U27A 3PG7A 1U5GA 4A6HA 4GPTB 3AU4A 4HDOA 4ZRKA 1XCGA 1FGZA 3P6AA 1XKEA 5FI1A 4GMVA 1NTVA 1DDWA 2MKRA 2P8VA 4HB0B 2BCJA 1LW3A 4A6FA 2M14A 1NTYA 1WGUA 2D9XA 5JLJB 2ELAA 4H8SA 4K2OA 3SO6A 3CIKA 3QIJA 3U8ZA 1Y19B 1U5FA 2DFKA 5LOPB 2GJYA 4IAPA 3ML4A 1X1FA 1Y5OA 3D8FA 1SHCA 2QKLA 4HATB 1WJMA 2D11A 1I7AA 3FEHA 2Y8FA 1FHWA 2P0HA 4KVGB 5HE2A 2KCJA 1MIZB 3MDBC 2I1JA 1NI2A 5KQ1A 4K17A 4HB3B 2RLOA 2ELBA 5J3TA 4CYEA 3HW2B 2LYDA 2MDXA 2UZSA 1AWEA 2ADZA 2G35A 3FM8C 2CY4A 1EAZA 3PEGA 3BJIA 5JHHA 2DA0A 2LG1A 5EFXA 2V76A 2COFA 3HQCA 1ZSQA 4HAYB 5HE3A 2LOXA 3PVLA 2DKQA 2YT1A 4F7GA 1B55A 1PMSA 1PLSA 1U5EA 5C79A 1I2HA 2UZRA 1KZGA 4XWXA 4CHJA 1U5DA 1EGXA 4C0AA 1H4RA 2EJ8A 3OANA 1TQZA 3M1IB 2W2XC 3ULCA 2H7EA 2KUPA 3ZDTA 2OTXA 2NMBA 1MPHA 2D9WA 1J0WA 1FB8A 3D8EA 3KRWA 2EC1A 2HE7A 2CAYA 4Z2NA 2N0YA 4YL8A 3TVVA 1DDMA 1X1GA 1X86A 1Z87A 3A98B 2GCLA 1FGYA 2IYBA 2J0KA 4EKUA 4WSFA 2EMTA 2ZPYA 2K00A 4GN1A 3PVUA 1ISNA 1V61A 3N7CA 2H7DA 2YRYA 2DHKA 2ROZB 1DBHA 5L81A 3UZTA 4MK0A 2LOZA 1UNQA 2L2IA 4F7UP 1QC6A 1MAIA 2YF0A 2QKMA 2Z0QA 3SNHA 3WA0A 2KGXB 3RCPA 2YT0A 3SUZA 3TFMA 4NSWA 1W1DA 4D0NB 4ZRIA 2P0FA 4WJ7A 1UPRA 1MIXA 3KY9A 3DXCA 2Y7BA 2COCA 2E2XA 2Z0PA 4A6FB 2RUKB 2AL6A 2Y8GA 2COAA 4DX8A 5C5BA 4KHOA 4DBBA 1W1HA 2MFQA 3O96A 2L1CA 1GC6A 1M7RA 1OQNA 2J59M 1BWNA 3GYOA 4HAZB 2I1KA 5J3QA 4HAWB 5D3XA 2DTCA 3DXDA 4NY0A 5FI0A 4K2PA 1WGQA 4HB2B 5C6RA 1WI1A 4Y94A 2YS3A 3G9WA 1BTNA 2CODA 1U29A 1ZC3B 2IFSA 2YS1A 3QWMA 2YS5A 1SGHA 3QBVB 1XD4A 1DDVA 2UVMA 4HHVA 3PZDA 4YONA 1RJ2A 2DKPA 1K5DB 5JP4A 4WVFB 4A5KA 2HTHB 4KHBB 1OMWA 2MWNB 1ZVRA 2RSGA 3VIAA 2JP2A 2Q13A 2FJLA 1WJ1A 4PQ0A 2DYQA 3LJUX 1DROA 2M38A 2D9YA 5D3YA 5HE0A 1X11A 4P7IA 1NU2A 3FSSA 2VRWB 2VKIA 3BINA 4GXBA 2LULA 5CLLB 3KRXA 5HE1A 1P5TA 2D2QA 3X23A 1EVHA 1FHOA 1IRSA 3GYPA 5D3VA 1MKEA 3ODOA 4HAUB 1W1GA 2DX5A
chains in the Genus database with same CATH superfamily
3D8DA 3TW1A 1U2BA 1ZC4B 3F5RA 2J0MA 4DX90 1OY2A 1P6SA 1KI1B 2DLWA 2GCJA 2D10A 4HAXB 4D6WA 1DYNA 5CLQB 4HAVB 3OHMB 3B77A 4IOYX 3U12A 1FAOA 2YSZA 3A58A 3HK0A 3CXBB 2KR0A 1MK7B 4F7HA 3PP2A 5DH9B 4TKNA 2LKOA 4Z2MB 3WYFB 2W2XD 4MY6A 4OT1A 3ZVRA 5I2SA 1UEFA 1WG7A 1XR0B 3F0WA 2AEHA 2YVCA 2RVBB 4K81A 1TJ6A 1ZM0A 2RNRB 1TXDA 2DHJA 2DX1A 2EMSA 4ZRJA 3AJ4A 4MT7A 5KQ4A 1UNPA 2R09A 4GMXB 1ZYIA 1V5PA 1GG3A 5IRSA 2GS0A 3A8PA 2J0JA 4TYZA 1WVHA 2D9VA 2K2JA 2K8EA 2D4QA 2W2WA 3MPXA 4DXAB 1J19A 1XODA 4EMOA 2DYNA 2DN6A 3AU5A 2D9ZA 2I5FA 5C5BB 2GUMA 1BTKA 1FOEA 5DHAB 1V88A 3ULBA 4CHMA 3DXEA 4QXAB 3U7DA 4A6KA 2NZ8B 5GOWB 2CY5A 4KHAA 5DIFB 5JHGA 1N3HA 2N23A 4EJNA 5D27A 1E5WA 1V5MA 5D3WA 1UNRA 1RRPB 1V89A 1GC7A 3NSUA 3TO1A 3PVWA 1KZ7A 4GZUA 4IFSA 1BAKA 3P7ZA 3TCAA 1LB1A 3IVFA 2Z0OA 3VOQA 2X18A 4B6HA 5LONB 2RGNB 2P0DA 3ODWA 1PFJA 2ROVA 5DHFB 1K5GB 4BBKA 2YT2A 1M7EA 3T06A 1AQCA 1Q67A 2CRFA 1XX0A 3KZ1A 1MK9B 2DHIA 2I5CA 5KCVA 4HB4B 4L6EA 1H10A 5M4YB 1X05A 2Z13A 2K2UA 2XQNM 1EF1A 3SV1A 4PNKA 3A8QA 4QJ5B 3ODXA 3KSYA 2VSZA 4HSIA 4KAXB 4L1RA 5DI9B 2PZ1A 1V5UA 1P3RA 2R0DA 5C16A 1UPQA 3SYXA 3V5WA 1FHXA 2K49A 1QQGA 4HDQA 2OQBA 5J3YA 3PSCA 1U27A 3PG7A 1U5GA 4A6HA 4GPTB 3AU4A 4HDOA 4ZRKA 2FJUB 1XCGA 1FGZA 3P6AA 1XKEA 5FI1A 4GMVA 1NTVA 1DDWA 2MKRA 2P8VA 4HB0B 2BCJA 1LW3A 4A6FA 2M14A 1NTYA 1WGUA 2D9XA 5JLJB 2ELAA 4H8SA 4K2OA 3SO6A 3CIKA 3QIJA 3U8ZA 1Y19B 1U5FA 2DFKA 5LOPB 2GJYA 4IAPA 3ML4A 1X1FA 1Y5OA 3D8FA 1SHCA 2QKLA 4HATB 1WJMA 2D11A 1I7AA 3FEHA 2Y8FA 1FHWA 2P0HA 4KVGB 5HE2A 2Z14A 2KCJA 1MIZB 3MDBC 2I1JA 1NI2A 5KQ1A 4K17A 4HB3B 2RLOA 2ELBA 5J3TA 4CYEA 3HW2B 2LYDA 2MDXA 2UZSA 1AWEA 2ADZA 2G35A 3FM8C 2CY4A 1EAZA 3PEGA 3BJIA 2NBVA 4KHBA 5JHHA 2DA0A 2LG1A 5EFXA 2V76A 2COFA 5I2MA 3HQCA 1ZSQA 4HAYB 5HE3A 2R2YA 2LOXA 3PVLA 2DKQA 2YT1A 4F7GA 1B55A 1PMSA 1PLSA 1U5EA 2ZKMX 5C79A 1I2HA 2UZRA 2Z4DA 1KZGA 4XWXA 4CHJA 1U5DA 1EGXA 4C0AA 1H4RA 2EJ8A 3OANA 1TQZA 3M1IB 2W2XC 3ULCA 3NWFA 2H7EA 2KUPA 3ZDTA 3HSAA 2OTXA 2NMBA 1MPHA 2D9WA 1J0WA 1FB8A 3D8EA 3KRWA 2EC1A 2HE7A 2CAYA 4Z2NA 2N0YA 4YL8A 3TVVA 1DDMA 2RRFA 1X1GA 1X86A 1Z87A 3A98B 2GCLA 1FGYA 2IYBA 2J0KA 4EKUA 4WSFA 2EMTA 2ZPYA 2K00A 3NW8A 4GN1A 3PVUA 1ISNA 4GOUA 3HIEA 1T77A 1V61A 3N7CA 2H7DA 2YRYA 2DHKA 2ROZB 2KIGA 1DBHA 5L81A 3UZTA 4MK0A 5LG4B 2LOZA 1UNQA 4OSNA 2L2IA 4F7UP 1QC6A 1MAIA 2YF0A 3NWDA 2QKMA 2Z0QA 3SNHA 3WA0A 2KGXB 3RCPA 2YT0A 3SUZA 3TFMA 4NSWA 1W1DA 4D0NB 4ZRIA 2P0FA 4WJ7A 1UPRA 1MIXA 4GNKB 3KY9A 3DXCA 2Y7BA 2COCA 2E2XA 2Z0PA 4A6FB 2RUKB 2AL6A 2Y8GA 2COAA 4DX8A 5C5BA 4KHOA 4DBBA 1W1HA 2MFQA 3O96A 2KIEA 2L1CA 1GC6A 1M7RA 1OQNA 2J59M 1BWNA 3GYOA 4HAZB 2I1KA 5J3QA 4HAWB 5D3XA 2DTCA 3DXDA 4NY0A 5FI0A 4CSQA 4K2PA 1WGQA 4HB2B 5C6RA 1WI1A 4Y94A 4DIXA 2YS3A 3G9WA 1BTNA 2CODA 1U29A 1ZC3B 2IFSA 2YS1A 3QWMA 2YS5A 1SGHA 3QBVB 1XD4A 1DDVA 2UVMA 4HHVA 3PZDA 4YONA 1RJ2A 2DKPA 1K5DB 5JP4A 4WVFB 4A5KA 2HTHB 4KHBB 1OMWA 2MWNB 1ZVRA 2RSGA 3FVCA 3VIAA 4QJ3B 2JP2A 2Q13A 2KUQA 2FJLA 1WJ1A 4PQ0A 2DYQA 3LJUX 1DROA 2M38A 2D9YA 5D3YA 5HE0A 1X11A 4P7IA 1NU2A 3FSSA 2VRWB 2VKIA 3BINA 4GXBA 2LULA 3DCXA 3KRXA 5CLLB 5HE1A 1P5TA 2D2QA 3X23A 4QJ4B 1MI1A 1EVHA 1FHOA 1IRSA 3GYPA 5D3VA 1MKEA 2Z59A 3ODOA 4HAUB 1W1GA 2DX5A 3NWAA
chains in the Genus database with same CATH topology
3D8DA 3TW1A 1U2BA 1ZC4B 3F5RA 2J0MA 4DX90 1OY2A 1P6SA 1KI1B 2DLWA 2GCJA 2D10A 4HAXB 1DYNA 5CLQB 4HAVB 4IOYX 1FAOA 2YSZA 3HK0A 3CXBB 4F7HA 1MK7B 3PP2A 5DH9B 4TKNA 2LKOA 4Z2MB 3WYFB 2W2XD 4MY6A 3ZVRA 1UEFA 1WG7A 1XR0B 3F0WA 2AEHA 2YVCA 2RVBB 4K81A 1TJ6A 1ZM0A 2RNRB 1TXDA 2DHJA 2DX1A 2EMSA 4ZRJA 3AJ4A 4MT7A 5KQ4A 1UNPA 2R09A 4GMXB 1V5PA 1GG3A 2GS0A 3A8PA 2J0JA 4TYZA 1WVHA 2D9VA 2K2JA 2D4QA 2W2WA 3MPXA 4DXAB 1J19A 1XODA 4EMOA 2DYNA 2DN6A 3AU5A 2D9ZA 2I5FA 5C5BB 1BTKA 1FOEA 5DHAB 1V88A 3ULBA 4CHMA 3DXEA 3U7DA 4A6KA 2NZ8B 5GOWB 2CY5A 4KHAA 5DIFB 5JHGA 1N3HA 2N23A 4EJNA 5D27A 1E5WA 1V5MA 5D3WA 1UNRA 1RRPB 1V89A 1GC7A 3NSUA 3TO1A 3PVWA 1KZ7A 4GZUA 4IFSA 1BAKA 3P7ZA 3TCAA 1LB1A 3IVFA 2Z0OA 3VOQA 2X18A 4B6HA 5LONB 2RGNB 2P0DA 3ODWA 1PFJA 2ROVA 5DHFB 1K5GB 4BBKA 1M7EA 3T06A 1AQCA 1Q67A 2CRFA 1XX0A 3KZ1A 1MK9B 2DHIA 2I5CA 5KCVA 4HB4B 4L6EA 1H10A 1X05A 2K2UA 2XQNM 1EF1A 3SV1A 4PNKA 3A8QA 3ODXA 3KSYA 2VSZA 4KAXB 5DI9B 2PZ1A 1V5UA 1P3RA 2R0DA 5C16A 1UPQA 3SYXA 3V5WA 1FHXA 1QQGA 4HDQA 2OQBA 5J3YA 3PSCA 1U27A 3PG7A 1U5GA 4A6HA 4GPTB 3AU4A 4HDOA 4ZRKA 1XCGA 1FGZA 3P6AA 1XKEA 5FI1A 4GMVA 1NTVA 1DDWA 2MKRA 2P8VA 4HB0B 2BCJA 1LW3A 4A6FA 2M14A 1NTYA 1WGUA 2D9XA 5JLJB 2ELAA 4H8SA 4K2OA 3SO6A 3CIKA 3QIJA 3U8ZA 1Y19B 1U5FA 2DFKA 5LOPB 2GJYA 4IAPA 3ML4A 1X1FA 1Y5OA 3D8FA 1SHCA 2QKLA 4HATB 1WJMA 2D11A 1I7AA 3FEHA 2Y8FA 1FHWA 2P0HA 4KVGB 5HE2A 2KCJA 1MIZB 3MDBC 2I1JA 1NI2A 5KQ1A 4K17A 4HB3B 2RLOA 2ELBA 5J3TA 4CYEA 3HW2B 2LYDA 2MDXA 2UZSA 1AWEA 2ADZA 2G35A 3FM8C 2CY4A 1EAZA 3PEGA 3BJIA 5JHHA 2DA0A 2LG1A 5EFXA 2V76A 2COFA 3HQCA 1ZSQA 4HAYB 5HE3A 2LOXA 3PVLA 2DKQA 2YT1A 4F7GA 1B55A 1PMSA 1PLSA 1U5EA 5C79A 1I2HA 2UZRA 1KZGA 4XWXA 4CHJA 1U5DA 1EGXA 4C0AA 1H4RA 2EJ8A 3OANA 1TQZA 3M1IB 2W2XC 3ULCA 2H7EA 2KUPA 3ZDTA 2OTXA 2NMBA 1MPHA 2D9WA 1J0WA 1FB8A 3D8EA 3KRWA 2EC1A 2HE7A 2CAYA 4Z2NA 2N0YA 4YL8A 3TVVA 1DDMA 1X1GA 1X86A 1Z87A 3A98B 2GCLA 1FGYA 2IYBA 2J0KA 4EKUA 4WSFA 2EMTA 2ZPYA 2K00A 4GN1A 3PVUA 1ISNA 1V61A 3N7CA 2H7DA 2YRYA 2DHKA 2ROZB 1DBHA 5L81A 3UZTA 4MK0A 2LOZA 1UNQA 2L2IA 4F7UP 1QC6A 1MAIA 2YF0A 2QKMA 2Z0QA 3SNHA 3WA0A 2KGXB 3RCPA 2YT0A 3SUZA 3TFMA 4NSWA 1W1DA 4D0NB 4ZRIA 2P0FA 4WJ7A 1UPRA 1MIXA 3KY9A 3DXCA 2Y7BA 2COCA 2E2XA 2Z0PA 4A6FB 2RUKB 2AL6A 2Y8GA 2COAA 4DX8A 5C5BA 4KHOA 4DBBA 1W1HA 2MFQA 3O96A 2L1CA 1GC6A 1M7RA 1OQNA 2J59M 1BWNA 3GYOA 4HAZB 2I1KA 5J3QA 4HAWB 5D3XA 2DTCA 3DXDA 4NY0A 5FI0A 4K2PA 1WGQA 4HB2B 5C6RA 1WI1A 4Y94A 2YS3A 3G9WA 1BTNA 2CODA 1U29A 1ZC3B 2IFSA 2YS1A 3QWMA 2YS5A 1SGHA 3QBVB 1XD4A 1DDVA 2UVMA 4HHVA 3PZDA 4YONA 1RJ2A 2DKPA 1K5DB 5JP4A 4WVFB 4A5KA 2HTHB 4KHBB 1OMWA 2MWNB 1ZVRA 2RSGA 3VIAA 2JP2A 2Q13A 2FJLA 1WJ1A 4PQ0A 2DYQA 3LJUX 1DROA 2M38A 2D9YA 5D3YA 5HE0A 1X11A 4P7IA 1NU2A 3FSSA 2VRWB 2VKIA 3BINA 4GXBA 2LULA 5CLLB 3KRXA 5HE1A 1P5TA 2D2QA 3X23A 1EVHA 1FHOA 1IRSA 3GYPA 5D3VA 1MKEA 3ODOA 4HAUB 1W1GA 2DX5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3D8D A;  3TW1 A;  1U2B A;  1ZC4 B;  3F5R A;  2J0M A;  4DX9 0;  1OY2 A;  1P6S A;  1KI1 B;  2DLW A;  2GCJ A;  2D10 A;  4HAX B;  1DYN A;  5CLQ B;  4HAV B;  4IOY X;  1FAO A;  2YSZ A;  3HK0 A;  3CXB B;  4F7H A;  1MK7 B;  3PP2 A;  5DH9 B;  4TKN A;  2LKO A;  4Z2M B;  3WYF B;  2W2X D;  4MY6 A;  3ZVR A;  1UEF A;  1WG7 A;  1XR0 B;  3F0W A;  2AEH A;  2YVC A;  2RVB B;  4K81 A;  1TJ6 A;  1ZM0 A;  2RNR B;  1TXD A;  2DHJ A;  2DX1 A;  2EMS A;  4ZRJ A;  3AJ4 A;  4MT7 A;  5KQ4 A;  1UNP A;  2R09 A;  4GMX B;  1V5P A;  1GG3 A;  2GS0 A;  3A8P A;  2J0J A;  4TYZ A;  1WVH A;  2D9V A;  2K2J A;  2D4Q A;  2W2W A;  3MPX A;  4DXA B;  1J19 A;  1XOD A;  4EMO A;  2DYN A;  2DN6 A;  3AU5 A;  2D9Z A;  2I5F A;  5C5B B;  1BTK A;  1FOE A;  5DHA B;  1V88 A;  3ULB A;  4CHM A;  3DXE A;  3U7D A;  4A6K A;  2NZ8 B;  5GOW B;  2CY5 A;  4KHA A;  5DIF B;  5JHG A;  1N3H A;  2N23 A;  4EJN A;  5D27 A;  1E5W A;  1V5M A;  5D3W A;  1UNR A;  1RRP B;  1V89 A;  1GC7 A;  3NSU A;  3TO1 A;  3PVW A;  1KZ7 A;  4GZU A;  4IFS A;  1BAK A;  3P7Z A;  3TCA A;  1LB1 A;  3IVF A;  2Z0O A;  3VOQ A;  2X18 A;  4B6H A;  5LON B;  2RGN B;  2P0D A;  3ODW A;  1PFJ A;  2ROV A;  5DHF B;  1K5G B;  4BBK A;  1M7E A;  3T06 A;  1AQC A;  1Q67 A;  2CRF A;  1XX0 A;  3KZ1 A;  1MK9 B;  2DHI A;  2I5C A;  5KCV A;  4HB4 B;  4L6E A;  1H10 A;  1X05 A;  2K2U A;  2XQN M;  1EF1 A;  3SV1 A;  4PNK A;  3A8Q A;  3ODX A;  3KSY A;  2VSZ A;  4KAX B;  5DI9 B;  2PZ1 A;  1V5U A;  1P3R A;  2R0D A;  5C16 A;  1UPQ A;  3SYX A;  3V5W A;  1FHX A;  1QQG A;  4HDQ A;  2OQB A;  5J3Y A;  3PSC A;  1U27 A;  3PG7 A;  1U5G A;  4A6H A;  4GPT B;  3AU4 A;  4HDO A;  4ZRK A;  1XCG A;  1FGZ A;  3P6A A;  1XKE A;  5FI1 A;  4GMV A;  1NTV A;  1DDW A;  2MKR A;  2P8V A;  4HB0 B;  2BCJ A;  1LW3 A;  4A6F A;  2M14 A;  1NTY A;  1WGU A;  2D9X A;  5JLJ B;  2ELA A;  4H8S A;  4K2O A;  3SO6 A;  3CIK A;  3QIJ A;  3U8Z A;  1Y19 B;  1U5F A;  2DFK A;  5LOP B;  2GJY A;  4IAP A;  3ML4 A;  1X1F A;  1Y5O A;  3D8F A;  1SHC A;  2QKL A;  4HAT B;  1WJM A;  2D11 A;  1I7A A;  3FEH A;  2Y8F A;  1FHW A;  2P0H A;  4KVG B;  5HE2 A;  2KCJ A;  1MIZ B;  3MDB C;  2I1J A;  1NI2 A;  5KQ1 A;  4K17 A;  4HB3 B;  2RLO A;  2ELB A;  5J3T A;  4CYE A;  3HW2 B;  2LYD A;  2MDX A;  2UZS A;  1AWE A;  2ADZ A;  2G35 A;  3FM8 C;  2CY4 A;  1EAZ A;  3PEG A;  3BJI A;  5JHH A;  2DA0 A;  2LG1 A;  5EFX A;  2V76 A;  2COF A;  3HQC A;  1ZSQ A;  4HAY B;  5HE3 A;  2LOX A;  3PVL A;  2DKQ A;  2YT1 A;  4F7G A;  1B55 A;  1PMS A;  1PLS A;  1U5E A;  5C79 A;  1I2H A;  2UZR A;  1KZG A;  4XWX A;  4CHJ A;  1U5D A;  1EGX A;  4C0A A;  1H4R A;  2EJ8 A;  3OAN A;  1TQZ A;  3M1I B;  2W2X C;  3ULC A;  2H7E A;  2KUP A;  3ZDT A;  2OTX A;  2NMB A;  1MPH A;  2D9W A;  1J0W A;  1FB8 A;  3D8E A;  3KRW A;  2EC1 A;  2HE7 A;  2CAY A;  4Z2N A;  2N0Y A;  4YL8 A;  3TVV A;  1DDM A;  1X1G A;  1X86 A;  1Z87 A;  3A98 B;  2GCL A;  1FGY A;  2IYB A;  2J0K A;  4EKU A;  4WSF A;  2EMT A;  2ZPY A;  2K00 A;  4GN1 A;  3PVU A;  1ISN A;  1V61 A;  3N7C A;  2H7D A;  2YRY A;  2DHK A;  2ROZ B;  1DBH A;  5L81 A;  3UZT A;  4MK0 A;  2LOZ A;  1UNQ A;  2L2I A;  4F7U P;  1QC6 A;  1MAI A;  2YF0 A;  2QKM A;  2Z0Q A;  3SNH A;  3WA0 A;  2KGX B;  3RCP A;  2YT0 A;  3SUZ A;  3TFM A;  4NSW A;  1W1D A;  4D0N B;  4ZRI A;  2P0F A;  4WJ7 A;  1UPR A;  1MIX A;  3KY9 A;  3DXC A;  2Y7B A;  2COC A;  2E2X A;  2Z0P A;  4A6F B;  2RUK B;  2AL6 A;  2Y8G A;  2COA A;  4DX8 A;  5C5B A;  4KHO A;  4DBB A;  1W1H A;  2MFQ A;  3O96 A;  2L1C A;  1GC6 A;  1M7R A;  1OQN A;  2J59 M;  1BWN A;  3GYO A;  4HAZ B;  2I1K A;  5J3Q A;  4HAW B;  5D3X A;  2DTC A;  3DXD A;  4NY0 A;  5FI0 A;  4K2P A;  1WGQ A;  4HB2 B;  5C6R A;  1WI1 A;  4Y94 A;  2YS3 A;  3G9W A;  1BTN A;  2COD A;  1U29 A;  1ZC3 B;  2IFS A;  2YS1 A;  3QWM A;  2YS5 A;  1SGH A;  3QBV B;  1XD4 A;  1DDV A;  2UVM A;  4HHV A;  3PZD A;  4YON A;  1RJ2 A;  2DKP A;  1K5D B;  5JP4 A;  4WVF B;  4A5K A;  2HTH B;  4KHB B;  1OMW A;  2MWN B;  1ZVR A;  2RSG A;  3VIA A;  2JP2 A;  2Q13 A;  2FJL A;  1WJ1 A;  4PQ0 A;  2DYQ A;  3LJU X;  1DRO A;  2M38 A;  2D9Y A;  5D3Y A;  5HE0 A;  1X11 A;  4P7I A;  1NU2 A;  3FSS A;  2VRW B;  2VKI A;  3BIN A;  4GXB A;  2LUL A;  5CLL B;  3KRX A;  5HE1 A;  1P5T A;  2D2Q A;  3X23 A;  1EVH A;  1FHO A;  1IRS A;  3GYP A;  5D3V A;  1MKE A;  3ODO A;  4HAU B;  1W1G A;  2DX5 A; 
#chains in the Genus database with same CATH topology
 3D8D A;  3TW1 A;  1U2B A;  1ZC4 B;  3F5R A;  2J0M A;  4DX9 0;  1OY2 A;  1P6S A;  1KI1 B;  2DLW A;  2GCJ A;  2D10 A;  4HAX B;  4D6W A;  1DYN A;  5CLQ B;  4HAV B;  3OHM B;  3B77 A;  4IOY X;  3U12 A;  1FAO A;  2YSZ A;  3A58 A;  3HK0 A;  3CXB B;  2KR0 A;  1MK7 B;  4F7H A;  3PP2 A;  5DH9 B;  4TKN A;  2LKO A;  4Z2M B;  3WYF B;  2W2X D;  4MY6 A;  4OT1 A;  3ZVR A;  5I2S A;  1UEF A;  1WG7 A;  1XR0 B;  3F0W A;  2AEH A;  2YVC A;  2RVB B;  4K81 A;  1TJ6 A;  1ZM0 A;  2RNR B;  1TXD A;  2DHJ A;  2DX1 A;  2EMS A;  4ZRJ A;  3AJ4 A;  4MT7 A;  5KQ4 A;  1UNP A;  2R09 A;  4GMX B;  1ZYI A;  1V5P A;  1GG3 A;  5IRS A;  2GS0 A;  3A8P A;  2J0J A;  4TYZ A;  1WVH A;  2D9V A;  2K2J A;  2K8E A;  2D4Q A;  2W2W A;  3MPX A;  4DXA B;  1J19 A;  1XOD A;  4EMO A;  2DYN A;  2DN6 A;  3AU5 A;  2D9Z A;  2I5F A;  5C5B B;  2GUM A;  1BTK A;  1FOE A;  5DHA B;  1V88 A;  3ULB A;  4CHM A;  3DXE A;  4QXA B;  3U7D A;  4A6K A;  2NZ8 B;  5GOW B;  2CY5 A;  4KHA A;  5DIF B;  5JHG A;  1N3H A;  2N23 A;  4EJN A;  5D27 A;  1E5W A;  1V5M A;  5D3W A;  1UNR A;  1RRP B;  1V89 A;  1GC7 A;  3NSU A;  3TO1 A;  3PVW A;  1KZ7 A;  4GZU A;  4IFS A;  1BAK A;  3P7Z A;  3TCA A;  1LB1 A;  3IVF A;  2Z0O A;  3VOQ A;  2X18 A;  4B6H A;  5LON B;  2RGN B;  2P0D A;  3ODW A;  1PFJ A;  2ROV A;  5DHF B;  1K5G B;  4BBK A;  2YT2 A;  1M7E A;  3T06 A;  1AQC A;  1Q67 A;  2CRF A;  1XX0 A;  3KZ1 A;  1MK9 B;  2DHI A;  2I5C A;  5KCV A;  4HB4 B;  4L6E A;  1H10 A;  5M4Y B;  1X05 A;  2Z13 A;  2K2U A;  2XQN M;  1EF1 A;  3SV1 A;  4PNK A;  3A8Q A;  4QJ5 B;  3ODX A;  3KSY A;  2VSZ A;  4HSI A;  4KAX B;  4L1R A;  5DI9 B;  2PZ1 A;  1V5U A;  1P3R A;  2R0D A;  5C16 A;  1UPQ A;  3SYX A;  3V5W A;  1FHX A;  2K49 A;  1QQG A;  4HDQ A;  2OQB A;  5J3Y A;  3PSC A;  1U27 A;  3PG7 A;  1U5G A;  4A6H A;  4GPT B;  3AU4 A;  4HDO A;  4ZRK A;  2FJU B;  1XCG A;  1FGZ A;  3P6A A;  1XKE A;  5FI1 A;  4GMV A;  1NTV A;  1DDW A;  2MKR A;  2P8V A;  4HB0 B;  2BCJ A;  1LW3 A;  4A6F A;  2M14 A;  1NTY A;  1WGU A;  2D9X A;  5JLJ B;  2ELA A;  4H8S A;  4K2O A;  3SO6 A;  3CIK A;  3QIJ A;  3U8Z A;  1Y19 B;  1U5F A;  2DFK A;  5LOP B;  2GJY A;  4IAP A;  3ML4 A;  1X1F A;  1Y5O A;  3D8F A;  1SHC A;  2QKL A;  4HAT B;  1WJM A;  2D11 A;  1I7A A;  3FEH A;  2Y8F A;  1FHW A;  2P0H A;  4KVG B;  5HE2 A;  2Z14 A;  2KCJ A;  1MIZ B;  3MDB C;  2I1J A;  1NI2 A;  5KQ1 A;  4K17 A;  4HB3 B;  2RLO A;  2ELB A;  5J3T A;  4CYE A;  3HW2 B;  2LYD A;  2MDX A;  2UZS A;  1AWE A;  2ADZ A;  2G35 A;  3FM8 C;  2CY4 A;  1EAZ A;  3PEG A;  3BJI A;  2NBV A;  4KHB A;  5JHH A;  2DA0 A;  2LG1 A;  5EFX A;  2V76 A;  2COF A;  5I2M A;  3HQC A;  1ZSQ A;  4HAY B;  5HE3 A;  2R2Y A;  2LOX A;  3PVL A;  2DKQ A;  2YT1 A;  4F7G A;  1B55 A;  1PMS A;  1PLS A;  1U5E A;  2ZKM X;  5C79 A;  1I2H A;  2UZR A;  2Z4D A;  1KZG A;  4XWX A;  4CHJ A;  1U5D A;  1EGX A;  4C0A A;  1H4R A;  2EJ8 A;  3OAN A;  1TQZ A;  3M1I B;  2W2X C;  3ULC A;  3NWF A;  2H7E A;  2KUP A;  3ZDT A;  3HSA A;  2OTX A;  2NMB A;  1MPH A;  2D9W A;  1J0W A;  1FB8 A;  3D8E A;  3KRW A;  2EC1 A;  2HE7 A;  2CAY A;  4Z2N A;  2N0Y A;  4YL8 A;  3TVV A;  1DDM A;  2RRF A;  1X1G A;  1X86 A;  1Z87 A;  3A98 B;  2GCL A;  1FGY A;  2IYB A;  2J0K A;  4EKU A;  4WSF A;  2EMT A;  2ZPY A;  2K00 A;  3NW8 A;  4GN1 A;  3PVU A;  1ISN A;  4GOU A;  3HIE A;  1T77 A;  1V61 A;  3N7C A;  2H7D A;  2YRY A;  2DHK A;  2ROZ B;  2KIG A;  1DBH A;  5L81 A;  3UZT A;  4MK0 A;  5LG4 B;  2LOZ A;  1UNQ A;  4OSN A;  2L2I A;  4F7U P;  1QC6 A;  1MAI A;  2YF0 A;  3NWD A;  2QKM A;  2Z0Q A;  3SNH A;  3WA0 A;  2KGX B;  3RCP A;  2YT0 A;  3SUZ A;  3TFM A;  4NSW A;  1W1D A;  4D0N B;  4ZRI A;  2P0F A;  4WJ7 A;  1UPR A;  1MIX A;  4GNK B;  3KY9 A;  3DXC A;  2Y7B A;  2COC A;  2E2X A;  2Z0P A;  4A6F B;  2RUK B;  2AL6 A;  2Y8G A;  2COA A;  4DX8 A;  5C5B A;  4KHO A;  4DBB A;  1W1H A;  2MFQ A;  3O96 A;  2KIE A;  2L1C A;  1GC6 A;  1M7R A;  1OQN A;  2J59 M;  1BWN A;  3GYO A;  4HAZ B;  2I1K A;  5J3Q A;  4HAW B;  5D3X A;  2DTC A;  3DXD A;  4NY0 A;  5FI0 A;  4CSQ A;  4K2P A;  1WGQ A;  4HB2 B;  5C6R A;  1WI1 A;  4Y94 A;  4DIX A;  2YS3 A;  3G9W A;  1BTN A;  2COD A;  1U29 A;  1ZC3 B;  2IFS A;  2YS1 A;  3QWM A;  2YS5 A;  1SGH A;  3QBV B;  1XD4 A;  1DDV A;  2UVM A;  4HHV A;  3PZD A;  4YON A;  1RJ2 A;  2DKP A;  1K5D B;  5JP4 A;  4WVF B;  4A5K A;  2HTH B;  4KHB B;  1OMW A;  2MWN B;  1ZVR A;  2RSG A;  3FVC A;  3VIA A;  4QJ3 B;  2JP2 A;  2Q13 A;  2KUQ A;  2FJL A;  1WJ1 A;  4PQ0 A;  2DYQ A;  3LJU X;  1DRO A;  2M38 A;  2D9Y A;  5D3Y A;  5HE0 A;  1X11 A;  4P7I A;  1NU2 A;  3FSS A;  2VRW B;  2VKI A;  3BIN A;  4GXB A;  2LUL A;  3DCX A;  3KRX A;  5CLL B;  5HE1 A;  1P5T A;  2D2Q A;  3X23 A;  4QJ4 B;  1MI1 A;  1EVH A;  1FHO A;  1IRS A;  3GYP A;  5D3V A;  1MKE A;  2Z59 A;  3ODO A;  4HAU B;  1W1G A;  2DX5 A;  3NWA A; 
#chains in the Genus database with same CATH homology
 3D8D A;  3TW1 A;  1U2B A;  1ZC4 B;  3F5R A;  2J0M A;  4DX9 0;  1OY2 A;  1P6S A;  1KI1 B;  2DLW A;  2GCJ A;  2D10 A;  4HAX B;  1DYN A;  5CLQ B;  4HAV B;  4IOY X;  1FAO A;  2YSZ A;  3HK0 A;  3CXB B;  4F7H A;  1MK7 B;  3PP2 A;  5DH9 B;  4TKN A;  2LKO A;  4Z2M B;  3WYF B;  2W2X D;  4MY6 A;  3ZVR A;  1UEF A;  1WG7 A;  1XR0 B;  3F0W A;  2AEH A;  2YVC A;  2RVB B;  4K81 A;  1TJ6 A;  1ZM0 A;  2RNR B;  1TXD A;  2DHJ A;  2DX1 A;  2EMS A;  4ZRJ A;  3AJ4 A;  4MT7 A;  5KQ4 A;  1UNP A;  2R09 A;  4GMX B;  1V5P A;  1GG3 A;  2GS0 A;  3A8P A;  2J0J A;  4TYZ A;  1WVH A;  2D9V A;  2K2J A;  2D4Q A;  2W2W A;  3MPX A;  4DXA B;  1J19 A;  1XOD A;  4EMO A;  2DYN A;  2DN6 A;  3AU5 A;  2D9Z A;  2I5F A;  5C5B B;  1BTK A;  1FOE A;  5DHA B;  1V88 A;  3ULB A;  4CHM A;  3DXE A;  3U7D A;  4A6K A;  2NZ8 B;  5GOW B;  2CY5 A;  4KHA A;  5DIF B;  5JHG A;  1N3H A;  2N23 A;  4EJN A;  5D27 A;  1E5W A;  1V5M A;  5D3W A;  1UNR A;  1RRP B;  1V89 A;  1GC7 A;  3NSU A;  3TO1 A;  3PVW A;  1KZ7 A;  4GZU A;  4IFS A;  1BAK A;  3P7Z A;  3TCA A;  1LB1 A;  3IVF A;  2Z0O A;  3VOQ A;  2X18 A;  4B6H A;  5LON B;  2RGN B;  2P0D A;  3ODW A;  1PFJ A;  2ROV A;  5DHF B;  1K5G B;  4BBK A;  1M7E A;  3T06 A;  1AQC A;  1Q67 A;  2CRF A;  1XX0 A;  3KZ1 A;  1MK9 B;  2DHI A;  2I5C A;  5KCV A;  4HB4 B;  4L6E A;  1H10 A;  1X05 A;  2K2U A;  2XQN M;  1EF1 A;  3SV1 A;  4PNK A;  3A8Q A;  3ODX A;  3KSY A;  2VSZ A;  4KAX B;  5DI9 B;  2PZ1 A;  1V5U A;  1P3R A;  2R0D A;  5C16 A;  1UPQ A;  3SYX A;  3V5W A;  1FHX A;  1QQG A;  4HDQ A;  2OQB A;  5J3Y A;  3PSC A;  1U27 A;  3PG7 A;  1U5G A;  4A6H A;  4GPT B;  3AU4 A;  4HDO A;  4ZRK A;  1XCG A;  1FGZ A;  3P6A A;  1XKE A;  5FI1 A;  4GMV A;  1NTV A;  1DDW A;  2MKR A;  2P8V A;  4HB0 B;  2BCJ A;  1LW3 A;  4A6F A;  2M14 A;  1NTY A;  1WGU A;  2D9X A;  5JLJ B;  2ELA A;  4H8S A;  4K2O A;  3SO6 A;  3CIK A;  3QIJ A;  3U8Z A;  1Y19 B;  1U5F A;  2DFK A;  5LOP B;  2GJY A;  4IAP A;  3ML4 A;  1X1F A;  1Y5O A;  3D8F A;  1SHC A;  2QKL A;  4HAT B;  1WJM A;  2D11 A;  1I7A A;  3FEH A;  2Y8F A;  1FHW A;  2P0H A;  4KVG B;  5HE2 A;  2KCJ A;  1MIZ B;  3MDB C;  2I1J A;  1NI2 A;  5KQ1 A;  4K17 A;  4HB3 B;  2RLO A;  2ELB A;  5J3T A;  4CYE A;  3HW2 B;  2LYD A;  2MDX A;  2UZS A;  1AWE A;  2ADZ A;  2G35 A;  3FM8 C;  2CY4 A;  1EAZ A;  3PEG A;  3BJI A;  5JHH A;  2DA0 A;  2LG1 A;  5EFX A;  2V76 A;  2COF A;  3HQC A;  1ZSQ A;  4HAY B;  5HE3 A;  2LOX A;  3PVL A;  2DKQ A;  2YT1 A;  4F7G A;  1B55 A;  1PMS A;  1PLS A;  1U5E A;  5C79 A;  1I2H A;  2UZR A;  1KZG A;  4XWX A;  4CHJ A;  1U5D A;  1EGX A;  4C0A A;  1H4R A;  2EJ8 A;  3OAN A;  1TQZ A;  3M1I B;  2W2X C;  3ULC A;  2H7E A;  2KUP A;  3ZDT A;  2OTX A;  2NMB A;  1MPH A;  2D9W A;  1J0W A;  1FB8 A;  3D8E A;  3KRW A;  2EC1 A;  2HE7 A;  2CAY A;  4Z2N A;  2N0Y A;  4YL8 A;  3TVV A;  1DDM A;  1X1G A;  1X86 A;  1Z87 A;  3A98 B;  2GCL A;  1FGY A;  2IYB A;  2J0K A;  4EKU A;  4WSF A;  2EMT A;  2ZPY A;  2K00 A;  4GN1 A;  3PVU A;  1ISN A;  1V61 A;  3N7C A;  2H7D A;  2YRY A;  2DHK A;  2ROZ B;  1DBH A;  5L81 A;  3UZT A;  4MK0 A;  2LOZ A;  1UNQ A;  2L2I A;  4F7U P;  1QC6 A;  1MAI A;  2YF0 A;  2QKM A;  2Z0Q A;  3SNH A;  3WA0 A;  2KGX B;  3RCP A;  2YT0 A;  3SUZ A;  3TFM A;  4NSW A;  1W1D A;  4D0N B;  4ZRI A;  2P0F A;  4WJ7 A;  1UPR A;  1MIX A;  3KY9 A;  3DXC A;  2Y7B A;  2COC A;  2E2X A;  2Z0P A;  4A6F B;  2RUK B;  2AL6 A;  2Y8G A;  2COA A;  4DX8 A;  5C5B A;  4KHO A;  4DBB A;  1W1H A;  2MFQ A;  3O96 A;  2L1C A;  1GC6 A;  1M7R A;  1OQN A;  2J59 M;  1BWN A;  3GYO A;  4HAZ B;  2I1K A;  5J3Q A;  4HAW B;  5D3X A;  2DTC A;  3DXD A;  4NY0 A;  5FI0 A;  4K2P A;  1WGQ A;  4HB2 B;  5C6R A;  1WI1 A;  4Y94 A;  2YS3 A;  3G9W A;  1BTN A;  2COD A;  1U29 A;  1ZC3 B;  2IFS A;  2YS1 A;  3QWM A;  2YS5 A;  1SGH A;  3QBV B;  1XD4 A;  1DDV A;  2UVM A;  4HHV A;  3PZD A;  4YON A;  1RJ2 A;  2DKP A;  1K5D B;  5JP4 A;  4WVF B;  4A5K A;  2HTH B;  4KHB B;  1OMW A;  2MWN B;  1ZVR A;  2RSG A;  3VIA A;  2JP2 A;  2Q13 A;  2FJL A;  1WJ1 A;  4PQ0 A;  2DYQ A;  3LJU X;  1DRO A;  2M38 A;  2D9Y A;  5D3Y A;  5HE0 A;  1X11 A;  4P7I A;  1NU2 A;  3FSS A;  2VRW B;  2VKI A;  3BIN A;  4GXB A;  2LUL A;  5CLL B;  3KRX A;  5HE1 A;  1P5T A;  2D2Q A;  3X23 A;  1EVH A;  1FHO A;  1IRS A;  3GYP A;  5D3V A;  1MKE A;  3ODO A;  4HAU B;  1W1G A;  2DX5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...