1FAOA

Structure of the pleckstrin homology domain from dapp1/phish in complex with inositol 1,3,4,5-tetrakisphosphate
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
100
structure length
100
Chain Sequence
PSLGTKEGYLTKQGGLVKTWKTRWFTLHRNELKYFKDQMSPEPIRILDLTECSAVQFDYSQERVNCFCLVFPFRTFYLCAKTGVEADEWIKILRWKLSQI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural basis for discrimination of 3-phosphoinositides by pleckstrin homology domains.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords DUAL ADAPTOR OF PHOSPHOTYROSINE AND 3-PHOSPHOINOSITIDES
total genus 23
structure length 100
sequence length 100
ec nomenclature
pdb deposition date 2000-07-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00169 PH PH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 1faoA00
2AEHA 4NY0A 1EF1A 2J0MA 2Y8FA 4Z2MB 2YS1A 2DYQA 2P0DA 1DDVA 1GC6A 2KCJA 5KQ4A 2EJ8A 1H4RA 1V88A 2DX1A 3M1IB 1XKEA 2I1KA 3KSYA 4EJNA 2RNRB 1QQGA 3N7CA 3SYXA 2NMBA 1I2HA 1GG3A 4KHAA 1MK7B 2DHKA 4F7UP 2CY5A 2W2XC 1DDMA 1WVHA 1FGYA 4ZRKA 1J0WA 2DX5A 1OY2A 1SGHA 1DDWA 2YF0A 1N3HA 4L6EA 1EGXA 3PSCA 2DTCA 4A5KA 2P0FA 5HE0A 2YT0A 3ZDTA 1LW3A 2DLWA 2DHJA 1PFJA 4H8SA 4K2OA 3ZVRA 2NZ8B 5C5BB 3LJUX 1ZSQA 3ODOA 2Y7BA 1X1GA 2DKQA 5JHHA 3U7DA 1U5EA 4P7IA 1P3RA 1KZGA 1XR0B 4PNKA 3DXDA 5D3YA 3WA0A 3SO6A 4DX8A 2E2XA 4CHMA 4HB2B 4MY6A 5FI0A 2H7DA 3FEHA 1EAZA 1P5TA 2RUKB 4PQ0A 5C5BA 1M7RA 4XWXA 2IYBA 3FSSA 4IFSA 1U5FA 2D9ZA 5JHGA 1ZC4B 1ZVRA 2K00A 4HAZB 1XCGA 2ELBA 2BCJA 1SHCA 2ZPYA 3PVUA 2DHIA 4GMXB 3AU4A 1NTYA 4F7GA 1WJMA 4Y94A 5KQ1A 2I5CA 3SUZA 1FB8A 1KZ7A 5C6RA 1J19A 2GCJA 1UNRA 2YS5A 4HAVB 2UZSA 1V89A 2UZRA 4GXBA 4HDQA 3VIAA 4IAPA 4IOYX 5EFXA 3TVVA 4HAXB 1W1GA 5D3XA 1AQCA 1GC7A 2ELAA 3HK0A 3KZ1A 2LOZA 1UPQA 4HB0B 2DN6A 1RJ2A 5CLQB 2VKIA 2G35A 5HE1A 2D4QA 5DH9B 5HE3A 2CODA 2ADZA 1E5WA 1FOEA 3MDBC 4EKUA 2P0HA 1BTNA 2AL6A 5JLJB 5LONB 2RVBB 3QWMA 1X11A 4Z2NA 1IRSA 2QKMA 3TO1A 1Y19B 3A8PA 1WJ1A 3DXEA 1FHXA 3QBVB 1H10A 4D0NB 1BTKA 2CAYA 3SNHA 1MPHA 2MKRA 2QKLA 3F5RA 4A6FA 2MDXA 1XD4A 2ROZB 1TQZA 3PG7A 1Y5OA 4ZRIA 2Q13A 3D8FA 2KUPA 5JP4A 1U5DA 4CYEA 1XODA 2EC1A 2LYDA 5C79A 2DYNA 1X1FA 4HHVA 4DBBA 1UPRA 2FJLA 1NTVA 1UNPA 4HB3B 1MIZB 1FHWA 2J0JA 2K2JA 3PVLA 2CRFA 3PEGA 5LOPB 1P6SA 1MAIA 3G9WA 3T06A 2H7EA 4K81A 4WSFA 2UVMA 5FI1A 4B6HA 1PMSA 2LKOA 4DX90 2VRWB 4A6HA 3O96A 3BJIA 2DA0A 2D9XA 4EMOA 4GMVA 2RLOA 1MK9B 3BINA 2K2UA 4MT7A 2I1JA 2D9YA 1WGQA 2XQNM 2LULA 4YL8A 1FHOA 3ODWA 2HE7A 2Z0OA 1UEFA 3PVWA 2R0DA 3D8DA 2Z0QA 1BAKA 1TJ6A 5J3YA 1Q67A 1WGUA 1OMWA 3DXCA 2DKPA 4TKNA 4A6KA 2DFKA 1DYNA 3OANA 5DIFB 2KGXB 3SV1A 1ZM0A 2YT1A 4A6FB 4NSWA 1V5PA 1MKEA 3CIKA 3D8EA 5J3TA 1TXDA 1X86A 4F7HA 4TYZA 1FGZA 2RSGA 2V76A 2OTXA 3P7ZA 1U29A 3F0WA 1B55A 4KHBB 2MWNB 4HAYB 4GZUA 1ISNA 4HAWB 5GOWB 2VSZA 1XX0A 3NSUA 3ULCA 5J3QA 2R09A 4HAUB 3P6AA 1RRPB 2J0KA 4KHOA 2D9WA 2COCA 1WI1A 4HATB 4WVFB 2N0YA 3U8ZA 3GYOA 1V5UA 1KI1B 2N23A 2YSZA 3IVFA 2OQBA 2D11A 4WJ7A 2P8VA 1PLSA 2EMSA 2J59M 5D3VA 5HE2A 2D10A 5D27A 4HDOA 2EMTA 1AWEA 2COFA 1U27A 3AU5A 2IFSA 1W1HA 4ZRJA 1V5MA 1K5DB 3RCPA 3CXBB 2CY4A 1K5GB 2Y8GA 2Z0PA 2PZ1A 1NU2A 2YRYA 2GJYA 3HQCA 3A8QA 3A98B 1WG7A 1QC6A 4DXAB 5KCVA 5L81A 4K2PA 2M38A 2W2WA 5CLLB 4C0AA 3MPXA 2LOXA 2D9VA 2GCLA 1ZC3B 1LB1A 2COAA 2L1CA 1BWNA 2HTHB 1DBHA 2W2XD 3FM8C 1DROA 4BBKA 1I7AA 1M7EA 1U2BA 1Z87A 4HB4B 4MK0A 1OQNA 2MFQA 4K17A 4YONA 3TW1A 3ML4A 3PZDA 3VOQA 3KRXA 5DHAB 2LG1A 2RGNB 3V5WA 2YS3A 4KAXB 3UZTA 2X18A 1EVHA 4GPTB 2GS0A 1U5GA 2L2IA 3TFMA 3KRWA 1V61A 1FAOA 2YVCA 3HW2B 3X23A 2D2QA 3AJ4A 3ODXA 1MIXA 2I5FA 3QIJA 1X05A 2M14A 5DHFB 2ROVA 5D3WA 4KVGB 3WYFB 5DI9B 1NI2A 4GN1A 3ULBA 2JP2A 4CHJA 5C16A 3KY9A 3TCAA 3GYPA 1W1DA 1UNQA 3PP2A
chains in the Genus database with same CATH superfamily
2AEHA 4NY0A 1EF1A 1T77A 2J0MA 2Y8FA 4Z2MB 2YS1A 2DYQA 2P0DA 1DDVA 1GC6A 2KCJA 5KQ4A 2EJ8A 1H4RA 1V88A 2DX1A 3M1IB 1XKEA 2I1KA 3KSYA 4EJNA 2RNRB 1QQGA 2KIGA 3N7CA 3SYXA 2NMBA 1I2HA 1GG3A 4KHAA 1MK7B 2DHKA 4F7UP 2CY5A 2W2XC 1DDMA 1WVHA 1FGYA 4HSIA 4ZRKA 1J0WA 2DX5A 1OY2A 1SGHA 1DDWA 2YF0A 1N3HA 4CSQA 4L6EA 1EGXA 3PSCA 2DTCA 4A5KA 2P0FA 5HE0A 4QJ5B 2YT0A 2Z4DA 3ZDTA 1LW3A 2DLWA 2DHJA 4OT1A 1PFJA 4H8SA 4K2OA 3ZVRA 2NZ8B 4D6WA 5C5BB 4OSNA 3LJUX 1ZSQA 3ODOA 2Y7BA 1X1GA 2DKQA 5JHHA 3U7DA 1U5EA 4P7IA 1P3RA 1KZGA 1XR0B 4PNKA 3DXDA 5D3YA 3WA0A 3SO6A 4DX8A 2E2XA 4CHMA 4HB2B 4MY6A 5FI0A 2H7DA 3FEHA 1EAZA 1P5TA 2RUKB 4PQ0A 5C5BA 1M7RA 4XWXA 4DIXA 2R2YA 2IYBA 3FSSA 4IFSA 1U5FA 2D9ZA 5JHGA 1ZC4B 1ZVRA 2K00A 4HAZB 3NW8A 1XCGA 2ELBA 2BCJA 1SHCA 2ZPYA 3PVUA 2DHIA 4GMXB 3AU4A 1NTYA 4F7GA 1WJMA 4Y94A 5KQ1A 2I5CA 5LG4B 3SUZA 5I2SA 1FB8A 2K49A 2ZKMX 1KZ7A 5C6RA 1J19A 2RRFA 2GCJA 1UNRA 2YS5A 4HAVB 2UZSA 1V89A 2UZRA 4GXBA 4HDQA 3VIAA 5IRSA 4IAPA 4IOYX 5EFXA 3TVVA 4HAXB 1W1GA 5D3XA 1AQCA 1GC7A 2ELAA 2NBVA 3HK0A 2LOZA 3KZ1A 1UPQA 4HB0B 2DN6A 1RJ2A 5CLQB 2VKIA 2G35A 5HE1A 2D4QA 5DH9B 5HE3A 2CODA 2ADZA 1E5WA 1FOEA 3MDBC 4EKUA 2P0HA 1BTNA 2AL6A 5JLJB 5LONB 2RVBB 3QWMA 1X11A 4Z2NA 1IRSA 2QKMA 3TO1A 1Y19B 3A8PA 1WJ1A 3DXEA 1FHXA 3QBVB 1H10A 4D0NB 1BTKA 2GUMA 2CAYA 3NWFA 3SNHA 1MPHA 2MKRA 2QKLA 3F5RA 4A6FA 2MDXA 5I2MA 1XD4A 5M4YB 2ROZB 1TQZA 2KR0A 4L1RA 4GOUA 3PG7A 1Y5OA 4ZRIA 2Q13A 3D8FA 2KUPA 5JP4A 1U5DA 4CYEA 3U12A 1XODA 2YT2A 2EC1A 2LYDA 5C79A 2DYNA 1X1FA 4HHVA 4DBBA 3DCXA 4QJ3B 1UPRA 2FJLA 1NTVA 2Z59A 1UNPA 4HB3B 1MIZB 1FHWA 2J0JA 2K2JA 3OHMB 2Z13A 3PVLA 2CRFA 1MI1A 3PEGA 5LOPB 1P6SA 1MAIA 3G9WA 3T06A 2H7EA 4K81A 4WSFA 2UVMA 5FI1A 4B6HA 1PMSA 2LKOA 4DX90 2VRWB 4A6HA 3O96A 3FVCA 3BJIA 2DA0A 2D9XA 4EMOA 4GMVA 2RLOA 1MK9B 3BINA 2K2UA 4MT7A 2I1JA 2D9YA 1WGQA 2XQNM 2LULA 4YL8A 1FHOA 3ODWA 2HE7A 2Z0OA 1UEFA 3HIEA 3PVWA 2R0DA 3D8DA 2Z0QA 1BAKA 1TJ6A 5J3YA 1Q67A 1WGUA 1OMWA 3DXCA 2DKPA 4TKNA 4A6KA 2DFKA 1DYNA 3OANA 5DIFB 2KGXB 3SV1A 1ZM0A 2YT1A 4A6FB 4NSWA 1V5PA 1MKEA 3CIKA 3D8EA 5J3TA 3B77A 1ZYIA 1TXDA 1X86A 4F7HA 4TYZA 1FGZA 2RSGA 2V76A 2OTXA 3P7ZA 1U29A 2KIEA 3F0WA 1B55A 4KHBB 2MWNB 4HAYB 4GZUA 1ISNA 4HAWB 5GOWB 2VSZA 1XX0A 3NSUA 4GNKB 3ULCA 5J3QA 2R09A 4HAUB 3P6AA 1RRPB 2J0KA 4KHOA 2D9WA 2COCA 1WI1A 4HATB 4WVFB 2KUQA 2N0YA 3U8ZA 3GYOA 2Z14A 4KHBA 1V5UA 1KI1B 2N23A 2YSZA 3IVFA 2OQBA 2D11A 4WJ7A 2P8VA 1PLSA 2EMSA 2J59M 5D3VA 5HE2A 2D10A 5D27A 4HDOA 2EMTA 1AWEA 2COFA 1U27A 3AU5A 2IFSA 1W1HA 4ZRJA 1V5MA 1K5DB 3RCPA 3CXBB 2CY4A 1K5GB 2Y8GA 2Z0PA 2PZ1A 1NU2A 2YRYA 2GJYA 3HSAA 4QXAB 3A58A 3HQCA 3A8QA 3A98B 1WG7A 1QC6A 3NWAA 4DXAB 5KCVA 5L81A 4K2PA 3NWDA 4QJ4B 2M38A 2W2WA 5CLLB 4C0AA 3MPXA 2LOXA 2D9VA 2GCLA 1ZC3B 1LB1A 2COAA 2L1CA 1BWNA 2HTHB 1DBHA 2W2XD 3FM8C 1DROA 4BBKA 1I7AA 1M7EA 1U2BA 1Z87A 4HB4B 4MK0A 1OQNA 2MFQA 4K17A 4YONA 3TW1A 3ML4A 3PZDA 3VOQA 3KRXA 5DHAB 2LG1A 2RGNB 3V5WA 2YS3A 4KAXB 3UZTA 2X18A 1EVHA 4GPTB 2GS0A 1U5GA 2L2IA 3TFMA 3KRWA 1V61A 1FAOA 2YVCA 3HW2B 3X23A 2D2QA 3AJ4A 3ODXA 1MIXA 2I5FA 3QIJA 1X05A 2M14A 5DHFB 2ROVA 5D3WA 4KVGB 2K8EA 3WYFB 5DI9B 1NI2A 4GN1A 3ULBA 2JP2A 4CHJA 5C16A 3KY9A 3TCAA 2FJUB 3GYPA 1W1DA 1UNQA 3PP2A
chains in the Genus database with same CATH topology
2AEHA 4NY0A 1EF1A 2J0MA 2Y8FA 4Z2MB 2YS1A 2DYQA 2P0DA 1DDVA 1GC6A 2KCJA 5KQ4A 2EJ8A 1H4RA 1V88A 2DX1A 3M1IB 1XKEA 2I1KA 3KSYA 4EJNA 2RNRB 1QQGA 3N7CA 3SYXA 2NMBA 1I2HA 1GG3A 4KHAA 1MK7B 2DHKA 4F7UP 2CY5A 2W2XC 1DDMA 1WVHA 1FGYA 4ZRKA 1J0WA 2DX5A 1OY2A 1SGHA 1DDWA 2YF0A 1N3HA 4L6EA 1EGXA 3PSCA 2DTCA 4A5KA 2P0FA 5HE0A 2YT0A 3ZDTA 1LW3A 2DLWA 2DHJA 1PFJA 4H8SA 4K2OA 3ZVRA 2NZ8B 5C5BB 3LJUX 1ZSQA 3ODOA 2Y7BA 1X1GA 2DKQA 5JHHA 3U7DA 1U5EA 4P7IA 1P3RA 1KZGA 1XR0B 4PNKA 3DXDA 5D3YA 3WA0A 3SO6A 4DX8A 2E2XA 4CHMA 4HB2B 4MY6A 5FI0A 2H7DA 3FEHA 1EAZA 1P5TA 2RUKB 4PQ0A 5C5BA 1M7RA 4XWXA 2IYBA 3FSSA 4IFSA 1U5FA 2D9ZA 5JHGA 1ZC4B 1ZVRA 2K00A 4HAZB 1XCGA 2ELBA 2BCJA 1SHCA 2ZPYA 3PVUA 2DHIA 4GMXB 3AU4A 1NTYA 4F7GA 1WJMA 4Y94A 5KQ1A 2I5CA 3SUZA 1FB8A 1KZ7A 5C6RA 1J19A 2GCJA 1UNRA 2YS5A 4HAVB 2UZSA 1V89A 2UZRA 4GXBA 4HDQA 3VIAA 4IAPA 4IOYX 5EFXA 3TVVA 4HAXB 1W1GA 5D3XA 1AQCA 1GC7A 2ELAA 3HK0A 3KZ1A 2LOZA 1UPQA 4HB0B 2DN6A 1RJ2A 5CLQB 2VKIA 2G35A 5HE1A 2D4QA 5DH9B 5HE3A 2CODA 2ADZA 1E5WA 1FOEA 3MDBC 4EKUA 2P0HA 1BTNA 2AL6A 5JLJB 5LONB 2RVBB 3QWMA 1X11A 4Z2NA 1IRSA 2QKMA 3TO1A 1Y19B 3A8PA 1WJ1A 3DXEA 1FHXA 3QBVB 1H10A 4D0NB 1BTKA 2CAYA 3SNHA 1MPHA 2MKRA 2QKLA 3F5RA 4A6FA 2MDXA 1XD4A 2ROZB 1TQZA 3PG7A 1Y5OA 4ZRIA 2Q13A 3D8FA 2KUPA 5JP4A 1U5DA 4CYEA 1XODA 2EC1A 2LYDA 5C79A 2DYNA 1X1FA 4HHVA 4DBBA 1UPRA 2FJLA 1NTVA 1UNPA 4HB3B 1MIZB 1FHWA 2J0JA 2K2JA 3PVLA 2CRFA 3PEGA 5LOPB 1P6SA 1MAIA 3G9WA 3T06A 2H7EA 4K81A 4WSFA 2UVMA 5FI1A 4B6HA 1PMSA 2LKOA 4DX90 2VRWB 4A6HA 3O96A 3BJIA 2DA0A 2D9XA 4EMOA 4GMVA 2RLOA 1MK9B 3BINA 2K2UA 4MT7A 2I1JA 2D9YA 1WGQA 2XQNM 2LULA 4YL8A 1FHOA 3ODWA 2HE7A 2Z0OA 1UEFA 3PVWA 2R0DA 3D8DA 2Z0QA 1BAKA 1TJ6A 5J3YA 1Q67A 1WGUA 1OMWA 3DXCA 2DKPA 4TKNA 4A6KA 2DFKA 1DYNA 3OANA 5DIFB 2KGXB 3SV1A 1ZM0A 2YT1A 4A6FB 4NSWA 1V5PA 1MKEA 3CIKA 3D8EA 5J3TA 1TXDA 1X86A 4F7HA 4TYZA 1FGZA 2RSGA 2V76A 2OTXA 3P7ZA 1U29A 3F0WA 1B55A 4KHBB 2MWNB 4HAYB 4GZUA 1ISNA 4HAWB 5GOWB 2VSZA 1XX0A 3NSUA 3ULCA 5J3QA 2R09A 4HAUB 3P6AA 1RRPB 2J0KA 4KHOA 2D9WA 2COCA 1WI1A 4HATB 4WVFB 2N0YA 3U8ZA 3GYOA 1V5UA 1KI1B 2N23A 2YSZA 3IVFA 2OQBA 2D11A 4WJ7A 2P8VA 1PLSA 2EMSA 2J59M 5D3VA 5HE2A 2D10A 5D27A 4HDOA 2EMTA 1AWEA 2COFA 1U27A 3AU5A 2IFSA 1W1HA 4ZRJA 1V5MA 1K5DB 3RCPA 3CXBB 2CY4A 1K5GB 2Y8GA 2Z0PA 2PZ1A 1NU2A 2YRYA 2GJYA 3HQCA 3A8QA 3A98B 1WG7A 1QC6A 4DXAB 5KCVA 5L81A 4K2PA 2M38A 2W2WA 5CLLB 4C0AA 3MPXA 2LOXA 2D9VA 2GCLA 1ZC3B 1LB1A 2COAA 2L1CA 1BWNA 2HTHB 1DBHA 2W2XD 3FM8C 1DROA 4BBKA 1I7AA 1M7EA 1U2BA 1Z87A 4HB4B 4MK0A 1OQNA 2MFQA 4K17A 4YONA 3TW1A 3ML4A 3PZDA 3VOQA 3KRXA 5DHAB 2LG1A 2RGNB 3V5WA 2YS3A 4KAXB 3UZTA 2X18A 1EVHA 4GPTB 2GS0A 1U5GA 2L2IA 3TFMA 3KRWA 1V61A 1FAOA 2YVCA 3HW2B 3X23A 2D2QA 3AJ4A 3ODXA 1MIXA 2I5FA 3QIJA 1X05A 2M14A 5DHFB 2ROVA 5D3WA 4KVGB 3WYFB 5DI9B 1NI2A 4GN1A 3ULBA 2JP2A 4CHJA 5C16A 3KY9A 3TCAA 3GYPA 1W1DA 1UNQA 3PP2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AEH A;  4NY0 A;  1EF1 A;  2J0M A;  2Y8F A;  4Z2M B;  2YS1 A;  2DYQ A;  2P0D A;  1DDV A;  1GC6 A;  2KCJ A;  5KQ4 A;  2EJ8 A;  1H4R A;  1V88 A;  2DX1 A;  3M1I B;  1XKE A;  2I1K A;  3KSY A;  4EJN A;  2RNR B;  1QQG A;  3N7C A;  3SYX A;  2NMB A;  1I2H A;  1GG3 A;  4KHA A;  1MK7 B;  2DHK A;  4F7U P;  2CY5 A;  2W2X C;  1DDM A;  1WVH A;  1FGY A;  4ZRK A;  1J0W A;  2DX5 A;  1OY2 A;  1SGH A;  1DDW A;  2YF0 A;  1N3H A;  4L6E A;  1EGX A;  3PSC A;  2DTC A;  4A5K A;  2P0F A;  5HE0 A;  2YT0 A;  3ZDT A;  1LW3 A;  2DLW A;  2DHJ A;  1PFJ A;  4H8S A;  4K2O A;  3ZVR A;  2NZ8 B;  5C5B B;  3LJU X;  1ZSQ A;  3ODO A;  2Y7B A;  1X1G A;  2DKQ A;  5JHH A;  3U7D A;  1U5E A;  4P7I A;  1P3R A;  1KZG A;  1XR0 B;  4PNK A;  3DXD A;  5D3Y A;  3WA0 A;  3SO6 A;  4DX8 A;  2E2X A;  4CHM A;  4HB2 B;  4MY6 A;  5FI0 A;  2H7D A;  3FEH A;  1EAZ A;  1P5T A;  2RUK B;  4PQ0 A;  5C5B A;  1M7R A;  4XWX A;  2IYB A;  3FSS A;  4IFS A;  1U5F A;  2D9Z A;  5JHG A;  1ZC4 B;  1ZVR A;  2K00 A;  4HAZ B;  1XCG A;  2ELB A;  2BCJ A;  1SHC A;  2ZPY A;  3PVU A;  2DHI A;  4GMX B;  3AU4 A;  1NTY A;  4F7G A;  1WJM A;  4Y94 A;  5KQ1 A;  2I5C A;  3SUZ A;  1FB8 A;  1KZ7 A;  5C6R A;  1J19 A;  2GCJ A;  1UNR A;  2YS5 A;  4HAV B;  2UZS A;  1V89 A;  2UZR A;  4GXB A;  4HDQ A;  3VIA A;  4IAP A;  4IOY X;  5EFX A;  3TVV A;  4HAX B;  1W1G A;  5D3X A;  1AQC A;  1GC7 A;  2ELA A;  3HK0 A;  3KZ1 A;  2LOZ A;  1UPQ A;  4HB0 B;  2DN6 A;  1RJ2 A;  5CLQ B;  2VKI A;  2G35 A;  5HE1 A;  2D4Q A;  5DH9 B;  5HE3 A;  2COD A;  2ADZ A;  1E5W A;  1FOE A;  3MDB C;  4EKU A;  2P0H A;  1BTN A;  2AL6 A;  5JLJ B;  5LON B;  2RVB B;  3QWM A;  1X11 A;  4Z2N A;  1IRS A;  2QKM A;  3TO1 A;  1Y19 B;  3A8P A;  1WJ1 A;  3DXE A;  1FHX A;  3QBV B;  1H10 A;  4D0N B;  1BTK A;  2CAY A;  3SNH A;  1MPH A;  2MKR A;  2QKL A;  3F5R A;  4A6F A;  2MDX A;  1XD4 A;  2ROZ B;  1TQZ A;  3PG7 A;  1Y5O A;  4ZRI A;  2Q13 A;  3D8F A;  2KUP A;  5JP4 A;  1U5D A;  4CYE A;  1XOD A;  2EC1 A;  2LYD A;  5C79 A;  2DYN A;  1X1F A;  4HHV A;  4DBB A;  1UPR A;  2FJL A;  1NTV A;  1UNP A;  4HB3 B;  1MIZ B;  1FHW A;  2J0J A;  2K2J A;  3PVL A;  2CRF A;  3PEG A;  5LOP B;  1P6S A;  1MAI A;  3G9W A;  3T06 A;  2H7E A;  4K81 A;  4WSF A;  2UVM A;  5FI1 A;  4B6H A;  1PMS A;  2LKO A;  4DX9 0;  2VRW B;  4A6H A;  3O96 A;  3BJI A;  2DA0 A;  2D9X A;  4EMO A;  4GMV A;  2RLO A;  1MK9 B;  3BIN A;  2K2U A;  4MT7 A;  2I1J A;  2D9Y A;  1WGQ A;  2XQN M;  2LUL A;  4YL8 A;  1FHO A;  3ODW A;  2HE7 A;  2Z0O A;  1UEF A;  3PVW A;  2R0D A;  3D8D A;  2Z0Q A;  1BAK A;  1TJ6 A;  5J3Y A;  1Q67 A;  1WGU A;  1OMW A;  3DXC A;  2DKP A;  4TKN A;  4A6K A;  2DFK A;  1DYN A;  3OAN A;  5DIF B;  2KGX B;  3SV1 A;  1ZM0 A;  2YT1 A;  4A6F B;  4NSW A;  1V5P A;  1MKE A;  3CIK A;  3D8E A;  5J3T A;  1TXD A;  1X86 A;  4F7H A;  4TYZ A;  1FGZ A;  2RSG A;  2V76 A;  2OTX A;  3P7Z A;  1U29 A;  3F0W A;  1B55 A;  4KHB B;  2MWN B;  4HAY B;  4GZU A;  1ISN A;  4HAW B;  5GOW B;  2VSZ A;  1XX0 A;  3NSU A;  3ULC A;  5J3Q A;  2R09 A;  4HAU B;  3P6A A;  1RRP B;  2J0K A;  4KHO A;  2D9W A;  2COC A;  1WI1 A;  4HAT B;  4WVF B;  2N0Y A;  3U8Z A;  3GYO A;  1V5U A;  1KI1 B;  2N23 A;  2YSZ A;  3IVF A;  2OQB A;  2D11 A;  4WJ7 A;  2P8V A;  1PLS A;  2EMS A;  2J59 M;  5D3V A;  5HE2 A;  2D10 A;  5D27 A;  4HDO A;  2EMT A;  1AWE A;  2COF A;  1U27 A;  3AU5 A;  2IFS A;  1W1H A;  4ZRJ A;  1V5M A;  1K5D B;  3RCP A;  3CXB B;  2CY4 A;  1K5G B;  2Y8G A;  2Z0P A;  2PZ1 A;  1NU2 A;  2YRY A;  2GJY A;  3HQC A;  3A8Q A;  3A98 B;  1WG7 A;  1QC6 A;  4DXA B;  5KCV A;  5L81 A;  4K2P A;  2M38 A;  2W2W A;  5CLL B;  4C0A A;  3MPX A;  2LOX A;  2D9V A;  2GCL A;  1ZC3 B;  1LB1 A;  2COA A;  2L1C A;  1BWN A;  2HTH B;  1DBH A;  2W2X D;  3FM8 C;  1DRO A;  4BBK A;  1I7A A;  1M7E A;  1U2B A;  1Z87 A;  4HB4 B;  4MK0 A;  1OQN A;  2MFQ A;  4K17 A;  4YON A;  3TW1 A;  3ML4 A;  3PZD A;  3VOQ A;  3KRX A;  5DHA B;  2LG1 A;  2RGN B;  3V5W A;  2YS3 A;  4KAX B;  3UZT A;  2X18 A;  1EVH A;  4GPT B;  2GS0 A;  1U5G A;  2L2I A;  3TFM A;  3KRW A;  1V61 A;  1FAO A;  2YVC A;  3HW2 B;  3X23 A;  2D2Q A;  3AJ4 A;  3ODX A;  1MIX A;  2I5F A;  3QIJ A;  1X05 A;  2M14 A;  5DHF B;  2ROV A;  5D3W A;  4KVG B;  3WYF B;  5DI9 B;  1NI2 A;  4GN1 A;  3ULB A;  2JP2 A;  4CHJ A;  5C16 A;  3KY9 A;  3TCA A;  3GYP A;  1W1D A;  1UNQ A;  3PP2 A; 
#chains in the Genus database with same CATH topology
 2AEH A;  4NY0 A;  1EF1 A;  1T77 A;  2J0M A;  2Y8F A;  4Z2M B;  2YS1 A;  2DYQ A;  2P0D A;  1DDV A;  1GC6 A;  2KCJ A;  5KQ4 A;  2EJ8 A;  1H4R A;  1V88 A;  2DX1 A;  3M1I B;  1XKE A;  2I1K A;  3KSY A;  4EJN A;  2RNR B;  1QQG A;  2KIG A;  3N7C A;  3SYX A;  2NMB A;  1I2H A;  1GG3 A;  4KHA A;  1MK7 B;  2DHK A;  4F7U P;  2CY5 A;  2W2X C;  1DDM A;  1WVH A;  1FGY A;  4HSI A;  4ZRK A;  1J0W A;  2DX5 A;  1OY2 A;  1SGH A;  1DDW A;  2YF0 A;  1N3H A;  4CSQ A;  4L6E A;  1EGX A;  3PSC A;  2DTC A;  4A5K A;  2P0F A;  5HE0 A;  4QJ5 B;  2YT0 A;  2Z4D A;  3ZDT A;  1LW3 A;  2DLW A;  2DHJ A;  4OT1 A;  1PFJ A;  4H8S A;  4K2O A;  3ZVR A;  2NZ8 B;  4D6W A;  5C5B B;  4OSN A;  3LJU X;  1ZSQ A;  3ODO A;  2Y7B A;  1X1G A;  2DKQ A;  5JHH A;  3U7D A;  1U5E A;  4P7I A;  1P3R A;  1KZG A;  1XR0 B;  4PNK A;  3DXD A;  5D3Y A;  3WA0 A;  3SO6 A;  4DX8 A;  2E2X A;  4CHM A;  4HB2 B;  4MY6 A;  5FI0 A;  2H7D A;  3FEH A;  1EAZ A;  1P5T A;  2RUK B;  4PQ0 A;  5C5B A;  1M7R A;  4XWX A;  4DIX A;  2R2Y A;  2IYB A;  3FSS A;  4IFS A;  1U5F A;  2D9Z A;  5JHG A;  1ZC4 B;  1ZVR A;  2K00 A;  4HAZ B;  3NW8 A;  1XCG A;  2ELB A;  2BCJ A;  1SHC A;  2ZPY A;  3PVU A;  2DHI A;  4GMX B;  3AU4 A;  1NTY A;  4F7G A;  1WJM A;  4Y94 A;  5KQ1 A;  2I5C A;  5LG4 B;  3SUZ A;  5I2S A;  1FB8 A;  2K49 A;  2ZKM X;  1KZ7 A;  5C6R A;  1J19 A;  2RRF A;  2GCJ A;  1UNR A;  2YS5 A;  4HAV B;  2UZS A;  1V89 A;  2UZR A;  4GXB A;  4HDQ A;  3VIA A;  5IRS A;  4IAP A;  4IOY X;  5EFX A;  3TVV A;  4HAX B;  1W1G A;  5D3X A;  1AQC A;  1GC7 A;  2ELA A;  2NBV A;  3HK0 A;  2LOZ A;  3KZ1 A;  1UPQ A;  4HB0 B;  2DN6 A;  1RJ2 A;  5CLQ B;  2VKI A;  2G35 A;  5HE1 A;  2D4Q A;  5DH9 B;  5HE3 A;  2COD A;  2ADZ A;  1E5W A;  1FOE A;  3MDB C;  4EKU A;  2P0H A;  1BTN A;  2AL6 A;  5JLJ B;  5LON B;  2RVB B;  3QWM A;  1X11 A;  4Z2N A;  1IRS A;  2QKM A;  3TO1 A;  1Y19 B;  3A8P A;  1WJ1 A;  3DXE A;  1FHX A;  3QBV B;  1H10 A;  4D0N B;  1BTK A;  2GUM A;  2CAY A;  3NWF A;  3SNH A;  1MPH A;  2MKR A;  2QKL A;  3F5R A;  4A6F A;  2MDX A;  5I2M A;  1XD4 A;  5M4Y B;  2ROZ B;  1TQZ A;  2KR0 A;  4L1R A;  4GOU A;  3PG7 A;  1Y5O A;  4ZRI A;  2Q13 A;  3D8F A;  2KUP A;  5JP4 A;  1U5D A;  4CYE A;  3U12 A;  1XOD A;  2YT2 A;  2EC1 A;  2LYD A;  5C79 A;  2DYN A;  1X1F A;  4HHV A;  4DBB A;  3DCX A;  4QJ3 B;  1UPR A;  2FJL A;  1NTV A;  2Z59 A;  1UNP A;  4HB3 B;  1MIZ B;  1FHW A;  2J0J A;  2K2J A;  3OHM B;  2Z13 A;  3PVL A;  2CRF A;  1MI1 A;  3PEG A;  5LOP B;  1P6S A;  1MAI A;  3G9W A;  3T06 A;  2H7E A;  4K81 A;  4WSF A;  2UVM A;  5FI1 A;  4B6H A;  1PMS A;  2LKO A;  4DX9 0;  2VRW B;  4A6H A;  3O96 A;  3FVC A;  3BJI A;  2DA0 A;  2D9X A;  4EMO A;  4GMV A;  2RLO A;  1MK9 B;  3BIN A;  2K2U A;  4MT7 A;  2I1J A;  2D9Y A;  1WGQ A;  2XQN M;  2LUL A;  4YL8 A;  1FHO A;  3ODW A;  2HE7 A;  2Z0O A;  1UEF A;  3HIE A;  3PVW A;  2R0D A;  3D8D A;  2Z0Q A;  1BAK A;  1TJ6 A;  5J3Y A;  1Q67 A;  1WGU A;  1OMW A;  3DXC A;  2DKP A;  4TKN A;  4A6K A;  2DFK A;  1DYN A;  3OAN A;  5DIF B;  2KGX B;  3SV1 A;  1ZM0 A;  2YT1 A;  4A6F B;  4NSW A;  1V5P A;  1MKE A;  3CIK A;  3D8E A;  5J3T A;  3B77 A;  1ZYI A;  1TXD A;  1X86 A;  4F7H A;  4TYZ A;  1FGZ A;  2RSG A;  2V76 A;  2OTX A;  3P7Z A;  1U29 A;  2KIE A;  3F0W A;  1B55 A;  4KHB B;  2MWN B;  4HAY B;  4GZU A;  1ISN A;  4HAW B;  5GOW B;  2VSZ A;  1XX0 A;  3NSU A;  4GNK B;  3ULC A;  5J3Q A;  2R09 A;  4HAU B;  3P6A A;  1RRP B;  2J0K A;  4KHO A;  2D9W A;  2COC A;  1WI1 A;  4HAT B;  4WVF B;  2KUQ A;  2N0Y A;  3U8Z A;  3GYO A;  2Z14 A;  4KHB A;  1V5U A;  1KI1 B;  2N23 A;  2YSZ A;  3IVF A;  2OQB A;  2D11 A;  4WJ7 A;  2P8V A;  1PLS A;  2EMS A;  2J59 M;  5D3V A;  5HE2 A;  2D10 A;  5D27 A;  4HDO A;  2EMT A;  1AWE A;  2COF A;  1U27 A;  3AU5 A;  2IFS A;  1W1H A;  4ZRJ A;  1V5M A;  1K5D B;  3RCP A;  3CXB B;  2CY4 A;  1K5G B;  2Y8G A;  2Z0P A;  2PZ1 A;  1NU2 A;  2YRY A;  2GJY A;  3HSA A;  4QXA B;  3A58 A;  3HQC A;  3A8Q A;  3A98 B;  1WG7 A;  1QC6 A;  3NWA A;  4DXA B;  5KCV A;  5L81 A;  4K2P A;  3NWD A;  4QJ4 B;  2M38 A;  2W2W A;  5CLL B;  4C0A A;  3MPX A;  2LOX A;  2D9V A;  2GCL A;  1ZC3 B;  1LB1 A;  2COA A;  2L1C A;  1BWN A;  2HTH B;  1DBH A;  2W2X D;  3FM8 C;  1DRO A;  4BBK A;  1I7A A;  1M7E A;  1U2B A;  1Z87 A;  4HB4 B;  4MK0 A;  1OQN A;  2MFQ A;  4K17 A;  4YON A;  3TW1 A;  3ML4 A;  3PZD A;  3VOQ A;  3KRX A;  5DHA B;  2LG1 A;  2RGN B;  3V5W A;  2YS3 A;  4KAX B;  3UZT A;  2X18 A;  1EVH A;  4GPT B;  2GS0 A;  1U5G A;  2L2I A;  3TFM A;  3KRW A;  1V61 A;  1FAO A;  2YVC A;  3HW2 B;  3X23 A;  2D2Q A;  3AJ4 A;  3ODX A;  1MIX A;  2I5F A;  3QIJ A;  1X05 A;  2M14 A;  5DHF B;  2ROV A;  5D3W A;  4KVG B;  2K8E A;  3WYF B;  5DI9 B;  1NI2 A;  4GN1 A;  3ULB A;  2JP2 A;  4CHJ A;  5C16 A;  3KY9 A;  3TCA A;  2FJU B;  3GYP A;  1W1D A;  1UNQ A;  3PP2 A; 
#chains in the Genus database with same CATH homology
 2AEH A;  4NY0 A;  1EF1 A;  2J0M A;  2Y8F A;  4Z2M B;  2YS1 A;  2DYQ A;  2P0D A;  1DDV A;  1GC6 A;  2KCJ A;  5KQ4 A;  2EJ8 A;  1H4R A;  1V88 A;  2DX1 A;  3M1I B;  1XKE A;  2I1K A;  3KSY A;  4EJN A;  2RNR B;  1QQG A;  3N7C A;  3SYX A;  2NMB A;  1I2H A;  1GG3 A;  4KHA A;  1MK7 B;  2DHK A;  4F7U P;  2CY5 A;  2W2X C;  1DDM A;  1WVH A;  1FGY A;  4ZRK A;  1J0W A;  2DX5 A;  1OY2 A;  1SGH A;  1DDW A;  2YF0 A;  1N3H A;  4L6E A;  1EGX A;  3PSC A;  2DTC A;  4A5K A;  2P0F A;  5HE0 A;  2YT0 A;  3ZDT A;  1LW3 A;  2DLW A;  2DHJ A;  1PFJ A;  4H8S A;  4K2O A;  3ZVR A;  2NZ8 B;  5C5B B;  3LJU X;  1ZSQ A;  3ODO A;  2Y7B A;  1X1G A;  2DKQ A;  5JHH A;  3U7D A;  1U5E A;  4P7I A;  1P3R A;  1KZG A;  1XR0 B;  4PNK A;  3DXD A;  5D3Y A;  3WA0 A;  3SO6 A;  4DX8 A;  2E2X A;  4CHM A;  4HB2 B;  4MY6 A;  5FI0 A;  2H7D A;  3FEH A;  1EAZ A;  1P5T A;  2RUK B;  4PQ0 A;  5C5B A;  1M7R A;  4XWX A;  2IYB A;  3FSS A;  4IFS A;  1U5F A;  2D9Z A;  5JHG A;  1ZC4 B;  1ZVR A;  2K00 A;  4HAZ B;  1XCG A;  2ELB A;  2BCJ A;  1SHC A;  2ZPY A;  3PVU A;  2DHI A;  4GMX B;  3AU4 A;  1NTY A;  4F7G A;  1WJM A;  4Y94 A;  5KQ1 A;  2I5C A;  3SUZ A;  1FB8 A;  1KZ7 A;  5C6R A;  1J19 A;  2GCJ A;  1UNR A;  2YS5 A;  4HAV B;  2UZS A;  1V89 A;  2UZR A;  4GXB A;  4HDQ A;  3VIA A;  4IAP A;  4IOY X;  5EFX A;  3TVV A;  4HAX B;  1W1G A;  5D3X A;  1AQC A;  1GC7 A;  2ELA A;  3HK0 A;  3KZ1 A;  2LOZ A;  1UPQ A;  4HB0 B;  2DN6 A;  1RJ2 A;  5CLQ B;  2VKI A;  2G35 A;  5HE1 A;  2D4Q A;  5DH9 B;  5HE3 A;  2COD A;  2ADZ A;  1E5W A;  1FOE A;  3MDB C;  4EKU A;  2P0H A;  1BTN A;  2AL6 A;  5JLJ B;  5LON B;  2RVB B;  3QWM A;  1X11 A;  4Z2N A;  1IRS A;  2QKM A;  3TO1 A;  1Y19 B;  3A8P A;  1WJ1 A;  3DXE A;  1FHX A;  3QBV B;  1H10 A;  4D0N B;  1BTK A;  2CAY A;  3SNH A;  1MPH A;  2MKR A;  2QKL A;  3F5R A;  4A6F A;  2MDX A;  1XD4 A;  2ROZ B;  1TQZ A;  3PG7 A;  1Y5O A;  4ZRI A;  2Q13 A;  3D8F A;  2KUP A;  5JP4 A;  1U5D A;  4CYE A;  1XOD A;  2EC1 A;  2LYD A;  5C79 A;  2DYN A;  1X1F A;  4HHV A;  4DBB A;  1UPR A;  2FJL A;  1NTV A;  1UNP A;  4HB3 B;  1MIZ B;  1FHW A;  2J0J A;  2K2J A;  3PVL A;  2CRF A;  3PEG A;  5LOP B;  1P6S A;  1MAI A;  3G9W A;  3T06 A;  2H7E A;  4K81 A;  4WSF A;  2UVM A;  5FI1 A;  4B6H A;  1PMS A;  2LKO A;  4DX9 0;  2VRW B;  4A6H A;  3O96 A;  3BJI A;  2DA0 A;  2D9X A;  4EMO A;  4GMV A;  2RLO A;  1MK9 B;  3BIN A;  2K2U A;  4MT7 A;  2I1J A;  2D9Y A;  1WGQ A;  2XQN M;  2LUL A;  4YL8 A;  1FHO A;  3ODW A;  2HE7 A;  2Z0O A;  1UEF A;  3PVW A;  2R0D A;  3D8D A;  2Z0Q A;  1BAK A;  1TJ6 A;  5J3Y A;  1Q67 A;  1WGU A;  1OMW A;  3DXC A;  2DKP A;  4TKN A;  4A6K A;  2DFK A;  1DYN A;  3OAN A;  5DIF B;  2KGX B;  3SV1 A;  1ZM0 A;  2YT1 A;  4A6F B;  4NSW A;  1V5P A;  1MKE A;  3CIK A;  3D8E A;  5J3T A;  1TXD A;  1X86 A;  4F7H A;  4TYZ A;  1FGZ A;  2RSG A;  2V76 A;  2OTX A;  3P7Z A;  1U29 A;  3F0W A;  1B55 A;  4KHB B;  2MWN B;  4HAY B;  4GZU A;  1ISN A;  4HAW B;  5GOW B;  2VSZ A;  1XX0 A;  3NSU A;  3ULC A;  5J3Q A;  2R09 A;  4HAU B;  3P6A A;  1RRP B;  2J0K A;  4KHO A;  2D9W A;  2COC A;  1WI1 A;  4HAT B;  4WVF B;  2N0Y A;  3U8Z A;  3GYO A;  1V5U A;  1KI1 B;  2N23 A;  2YSZ A;  3IVF A;  2OQB A;  2D11 A;  4WJ7 A;  2P8V A;  1PLS A;  2EMS A;  2J59 M;  5D3V A;  5HE2 A;  2D10 A;  5D27 A;  4HDO A;  2EMT A;  1AWE A;  2COF A;  1U27 A;  3AU5 A;  2IFS A;  1W1H A;  4ZRJ A;  1V5M A;  1K5D B;  3RCP A;  3CXB B;  2CY4 A;  1K5G B;  2Y8G A;  2Z0P A;  2PZ1 A;  1NU2 A;  2YRY A;  2GJY A;  3HQC A;  3A8Q A;  3A98 B;  1WG7 A;  1QC6 A;  4DXA B;  5KCV A;  5L81 A;  4K2P A;  2M38 A;  2W2W A;  5CLL B;  4C0A A;  3MPX A;  2LOX A;  2D9V A;  2GCL A;  1ZC3 B;  1LB1 A;  2COA A;  2L1C A;  1BWN A;  2HTH B;  1DBH A;  2W2X D;  3FM8 C;  1DRO A;  4BBK A;  1I7A A;  1M7E A;  1U2B A;  1Z87 A;  4HB4 B;  4MK0 A;  1OQN A;  2MFQ A;  4K17 A;  4YON A;  3TW1 A;  3ML4 A;  3PZD A;  3VOQ A;  3KRX A;  5DHA B;  2LG1 A;  2RGN B;  3V5W A;  2YS3 A;  4KAX B;  3UZT A;  2X18 A;  1EVH A;  4GPT B;  2GS0 A;  1U5G A;  2L2I A;  3TFM A;  3KRW A;  1V61 A;  1FAO A;  2YVC A;  3HW2 B;  3X23 A;  2D2Q A;  3AJ4 A;  3ODX A;  1MIX A;  2I5F A;  3QIJ A;  1X05 A;  2M14 A;  5DHF B;  2ROV A;  5D3W A;  4KVG B;  3WYF B;  5DI9 B;  1NI2 A;  4GN1 A;  3ULB A;  2JP2 A;  4CHJ A;  5C16 A;  3KY9 A;  3TCA A;  3GYP A;  1W1D A;  1UNQ A;  3PP2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...