1FHOA

Solution structure of the ph domain from the c. elegans muscle protein unc-89
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
119
structure length
119
Chain Sequence
MGDTGKLGRIIRHDAFQVWEGDEPPKLRYVFLFRNKIMFTEQDASTSPPSYTHYSSIRLDKYNIRQHTTDEDTIVLQPQEPGLPSFRIKPKDFETSEYVRKAWLRDIAEEQEKYAAERD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UNC-89
publication title Structure of a PH domain from the C. elegans muscle protein UNC-89 suggests a novel function.
pubmed doi rcsb
source organism Caenorhabditis elegans
molecule tags Signaling protein
total genus 15
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2000-08-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 1fhoA00
3G9WA 1MK9B 1WVHA 4K81A 1H10A 1OMWA 3D8DA 4EKUA 1X1GA 1XODA 2YS1A 5HE2A 3ML4A 1NTYA 4A6FA 1OQNA 1EGXA 2VSZA 4EMOA 2DYNA 2YF0A 4GPTB 1V89A 3FEHA 4CHJA 3AU4A 2LG1A 2MKRA 2DLWA 5KQ1A 1QQGA 2P0DA 1V5UA 2LOXA 2D9XA 1WJMA 4HDOA 1UPQA 5CLLB 4KHAA 1ZM0A 4Z2NA 2RSGA 5C79A 1U27A 1UPRA 1FHWA 4HB0B 2ELBA 1ISNA 1X05A 5GOWB 2KGXB 3BJIA 2HTHB 4HB3B 3GYOA 2J0KA 2RUKB 5D3WA 3A8QA 1P3RA 2P8VA 5DHAB 4HDQA 2VKIA 2OQBA 3PZDA 4MK0A 2H7EA 5HE3A 2KUPA 5D3XA 4XWXA 3FM8C 2Z0QA 3VIAA 2Y8GA 2GCLA 1RJ2A 2RVBB 4NSWA 4C0AA 2I5FA 2E2XA 1TQZA 4K2OA 1LB1A 5HE0A 1LW3A 1XX0A 1KZGA 2ROZB 1WGUA 1Q67A 2D9YA 1BTKA 1BWNA 2Q13A 2ADZA 2H7DA 3F0WA 2EMSA 1QC6A 2JP2A 1H4RA 2D9ZA 3M1IB 4F7UP 2CY4A 1GC6A 2M38A 4GXBA 1RRPB 4PNKA 3T06A 4GMXB 2AL6A 3QBVB 4K17A 3TCAA 3P7ZA 3WA0A 1FGYA 1BTNA 3TO1A 1ZVRA 1TJ6A 1V88A 2K2JA 5LONB 4Y94A 3MDBC 3TW1A 2N23A 1V5MA 3DXEA 2W2XD 5J3YA 1DYNA 2P0HA 2YSZA 2Z0PA 3ZVRA 1Y19B 4DBBA 4HAZB 1UNRA 4DX8A 3CXBB 2DHKA 3F5RA 3RCPA 5L81A 2DHJA 3SO6A 3QIJA 2I1JA 1EVHA 2D11A 4WJ7A 5DIFB 5FI1A 3NSUA 4TYZA 2YT0A 1XCGA 1U5GA 1X11A 3KY9A 1MIZB 3VOQA 2YVCA 4A6FB 1NU2A 1MK7B 1ZSQA 3PEGA 1BAKA 3PVUA 2OTXA 3LJUX 1TXDA 2FJLA 2D9VA 2LULA 4DXAB 1SHCA 2LYDA 1V5PA 2DA0A 1NI2A 2COAA 5C5BA 3O96A 3SUZA 3ODXA 4GZUA 3P6AA 2MDXA 1W1GA 1DDMA 4KVGB 1EAZA 4Z2MB 2N0YA 1FOEA 4YL8A 1N3HA 2RLOA 1ZC3B 1Y5OA 2DTCA 3KRWA 2UZSA 1J0WA 1U2BA 4HAYB 3U8ZA 5JHHA 3OANA 3D8FA 1PMSA 4HAVB 4ZRIA 1U5FA 4P7IA 1P6SA 5DI9B 3V5WA 3AU5A 3PVLA 2KCJA 1I7AA 3ODOA 1WGQA 2J0MA 2CAYA 1M7RA 1MAIA 3SNHA 2QKMA 2D9WA 4MT7A 5KCVA 2BCJA 2EMTA 3HW2B 2HE7A 1FB8A 3D8EA 4HB4B 4KHBB 4ZRKA 2DFKA 1UNPA 4CHMA 2YRYA 2GCJA 3TFMA 1I2HA 2R0DA 2COCA 3FSSA 1FHXA 4HB2B 4BBKA 2LOZA 3ULBA 5D3VA 1V61A 1W1HA 1XD4A 4A5KA 1FAOA 3A98B 1AWEA 2DKQA 1KI1B 2ZPYA 1Z87A 1NTVA 2YS3A 4IAPA 2YS5A 4HAWB 2GS0A 1J19A 2MFQA 2QKLA 2RNRB 2YT1A 3SV1A 2D4QA 3PP2A 2CODA 1K5DB 3PVWA 4GN1A 1UNQA 1AQCA 1X1FA 2DX5A 2LKOA 5D3YA 3IVFA 4H8SA 1MIXA 2AEHA 3CIKA 3KSYA 4ZRJA 2XQNM 4KHOA 2RGNB 1XR0B 1E5WA 4WVFB 3WYFB 2Y7BA 4DX90 4D0NB 1OY2A 4TKNA 4CYEA 5DH9B 2W2WA 2IYBA 1B55A 1U29A 2VRWB 4MY6A 4GMVA 1PFJA 2M14A 2D2QA 4EJNA 2DX1A 5D27A 5C5BB 5C16A 2ELAA 1W1DA 5FI0A 5KQ4A 1DDWA 2CY5A 2I1KA 3ULCA 1P5TA 1M7EA 5DHFB 2L1CA 4B6HA 2CRFA 3DXCA 1FHOA 1DDVA 3A8PA 4YONA 2GJYA 5EFXA 5J3QA 1GG3A 2NZ8B 4K2PA 1MPHA 5J3TA 2DN6A 3QWMA 2DKPA 4HATB 5HE1A 1WJ1A 1ZC4B 2ROVA 4HAUB 5JP4A 1MKEA 1KZ7A 2G35A 1WG7A 3UZTA 2J59M 4KAXB 2W2XC 3HQCA 1WI1A 3SYXA 4HAXB 2COFA 2DYQA 3GYPA 5C6RA 2IFSA 5JHGA 1UEFA 3X23A 1PLSA 3MPXA 1K5GB 4IOYX 2X18A 4HHVA 1FGZA 2UVMA 3N7CA 3ODWA 3ZDTA 1IRSA 2NMBA 3AJ4A 5CLQB 2J0JA 1X86A 3TVVA 3HK0A 5JLJB 1DROA 2EJ8A 2I5CA 2Z0OA 4F7GA 4PQ0A 2DHIA 3PSCA 2EC1A 2P0FA 1SGHA 5LOPB 3KRXA 4IFSA 2K00A 2Y8FA 3DXDA 4A6KA 3U7DA 2V76A 2MWNB 2D10A 3PG7A 4A6HA 2L2IA 2UZRA 1EF1A 1U5DA 1GC7A 4F7HA 4NY0A 3KZ1A 1DBHA 4WSFA 2K2UA 1U5EA 3BINA 1XKEA 4L6EA 2R09A 2PZ1A
chains in the Genus database with same CATH superfamily
3G9WA 1MK9B 1WVHA 4K81A 1H10A 1OMWA 1T77A 3D8DA 4GOUA 4EKUA 1X1GA 1XODA 2YS1A 5HE2A 3ML4A 1NTYA 2FJUB 4A6FA 1OQNA 1EGXA 2R2YA 2VSZA 4EMOA 2DYNA 2YF0A 4GPTB 1V89A 3FEHA 4CHJA 3AU4A 2LG1A 2MKRA 2DLWA 5KQ1A 1QQGA 2P0DA 1V5UA 2LOXA 2D9XA 1WJMA 4HDOA 1UPQA 5CLLB 2Z59A 4KHAA 1ZM0A 3NWDA 4Z2NA 2RSGA 5C79A 1U27A 1UPRA 1FHWA 4HB0B 2ELBA 1ISNA 1X05A 3DCXA 5GOWB 2KGXB 3BJIA 2HTHB 4HB3B 3GYOA 2GUMA 2J0KA 2RUKB 5D3WA 3A8QA 1P3RA 2P8VA 5DHAB 4HDQA 2VKIA 2OQBA 3PZDA 4MK0A 2H7EA 5HE3A 2KUPA 5D3XA 4XWXA 3FM8C 2Z0QA 3VIAA 2Y8GA 2GCLA 1RJ2A 2RVBB 4NSWA 4C0AA 2I5FA 2E2XA 1TQZA 4K2OA 1LB1A 5HE0A 1LW3A 1XX0A 1KZGA 4KHBA 2ROZB 1WGUA 1Q67A 2D9YA 5I2MA 1BTKA 1BWNA 2Q13A 2ADZA 4D6WA 2H7DA 3F0WA 3OHMB 2EMSA 1QC6A 2JP2A 1H4RA 2D9ZA 3M1IB 4F7UP 2CY4A 2KIGA 1GC6A 2M38A 4GXBA 1RRPB 4PNKA 3T06A 4GMXB 2AL6A 3QBVB 4K17A 3TCAA 3P7ZA 3WA0A 1FGYA 1BTNA 3TO1A 1ZVRA 3HSAA 1TJ6A 1V88A 5IRSA 2K2JA 5LONB 4Y94A 3MDBC 3TW1A 2N23A 1V5MA 1MI1A 3DXEA 2W2XD 5J3YA 1DYNA 2P0HA 2YSZA 2Z0PA 3ZVRA 1Y19B 4DBBA 4HAZB 4DIXA 1UNRA 4DX8A 5M4YB 3CXBB 2DHKA 2K49A 3F5RA 3RCPA 5L81A 2DHJA 3SO6A 3QIJA 2I1JA 1EVHA 2D11A 4WJ7A 5DIFB 5FI1A 3NSUA 4TYZA 2Z4DA 2YT0A 1XCGA 1U5GA 1X11A 3KY9A 1MIZB 3VOQA 2KUQA 2YVCA 4A6FB 1NU2A 1MK7B 1ZSQA 3PEGA 1BAKA 3PVUA 2OTXA 3LJUX 1TXDA 2FJLA 2D9VA 2LULA 4DXAB 1SHCA 2LYDA 1V5PA 2DA0A 1NI2A 2COAA 5C5BA 3O96A 3SUZA 3ODXA 4GZUA 3P6AA 2MDXA 1W1GA 1DDMA 4KVGB 1EAZA 4Z2MB 2ZKMX 2N0YA 1FOEA 4QJ4B 4YL8A 1N3HA 2RLOA 1ZC3B 1Y5OA 2DTCA 3KRWA 2UZSA 1J0WA 3NWFA 1U2BA 4HAYB 3HIEA 3U8ZA 5JHHA 3OANA 3D8FA 1PMSA 4HAVB 4ZRIA 1U5FA 4P7IA 1P6SA 5DI9B 3V5WA 3AU5A 3PVLA 2KCJA 1I7AA 3ODOA 1WGQA 2J0MA 2CAYA 1M7RA 1ZYIA 1MAIA 4OT1A 3SNHA 2QKMA 2D9WA 4MT7A 5KCVA 2BCJA 2EMTA 3HW2B 2HE7A 1FB8A 3D8EA 4HB4B 4KHBB 4ZRKA 4QJ5B 2DFKA 1UNPA 4CHMA 2YRYA 2GCJA 3TFMA 1I2HA 2R0DA 2COCA 3FVCA 3FSSA 1FHXA 4HB2B 3A58A 4BBKA 2LOZA 3ULBA 5D3VA 2RRFA 1V61A 1W1HA 1XD4A 4A5KA 1FAOA 3A98B 2K8EA 1AWEA 2DKQA 1KI1B 2ZPYA 1Z87A 1NTVA 2YS3A 3B77A 2KIEA 4IAPA 2YS5A 4HAWB 2GS0A 4GNKB 1J19A 2MFQA 2QKLA 2RNRB 2YT1A 3SV1A 2D4QA 2YT2A 3PP2A 2CODA 1K5DB 3PVWA 4GN1A 1UNQA 1AQCA 1X1FA 2DX5A 2LKOA 5D3YA 3IVFA 4H8SA 1MIXA 2AEHA 3CIKA 3KSYA 4ZRJA 2XQNM 4KHOA 2RGNB 5I2SA 1XR0B 1E5WA 4WVFB 4L1RA 2Y7BA 3WYFB 4DX90 4D0NB 1OY2A 4TKNA 4CYEA 5DH9B 2W2WA 2NBVA 2IYBA 1B55A 1U29A 2VRWB 4MY6A 4GMVA 1PFJA 2M14A 2D2QA 3NWAA 4EJNA 2DX1A 5LG4B 5D27A 5C5BB 5C16A 2ELAA 1W1DA 5FI0A 5KQ4A 1DDWA 2CY5A 2I1KA 3ULCA 1P5TA 1M7EA 5DHFB 2L1CA 4B6HA 2CRFA 3DXCA 1FHOA 1DDVA 3A8PA 4YONA 2GJYA 5EFXA 5J3QA 1GG3A 2NZ8B 4K2PA 1MPHA 5J3TA 2DN6A 3QWMA 2DKPA 4HATB 5HE1A 1WJ1A 1ZC4B 2ROVA 4HAUB 5JP4A 1MKEA 1KZ7A 2G35A 1WG7A 4OSNA 3UZTA 2J59M 4KAXB 2W2XC 3HQCA 1WI1A 3SYXA 4HAXB 2COFA 2DYQA 3GYPA 5C6RA 2IFSA 5JHGA 1UEFA 3X23A 1PLSA 3MPXA 1K5GB 4IOYX 2X18A 4HHVA 2KR0A 1FGZA 2UVMA 3N7CA 3ODWA 3ZDTA 1IRSA 2NMBA 3AJ4A 5CLQB 2J0JA 1X86A 4QJ3B 3TVVA 3HK0A 5JLJB 1DROA 2EJ8A 2I5CA 2Z0OA 4F7GA 3U12A 4PQ0A 2DHIA 3PSCA 2EC1A 2P0FA 1SGHA 5LOPB 3KRXA 4IFSA 2K00A 2Y8FA 3DXDA 4A6KA 3U7DA 2V76A 2Z13A 4HSIA 2Z14A 2MWNB 2D10A 3PG7A 4A6HA 4CSQA 2L2IA 2UZRA 1EF1A 1U5DA 1GC7A 4F7HA 4NY0A 3KZ1A 1DBHA 4WSFA 4QXAB 3NW8A 2K2UA 1U5EA 3BINA 1XKEA 4L6EA 2R09A 2PZ1A
chains in the Genus database with same CATH topology
3G9WA 1MK9B 1WVHA 4K81A 1H10A 1OMWA 3D8DA 4EKUA 1X1GA 1XODA 2YS1A 5HE2A 3ML4A 1NTYA 4A6FA 1OQNA 1EGXA 2VSZA 4EMOA 2DYNA 2YF0A 4GPTB 1V89A 3FEHA 4CHJA 3AU4A 2LG1A 2MKRA 2DLWA 5KQ1A 1QQGA 2P0DA 1V5UA 2LOXA 2D9XA 1WJMA 4HDOA 1UPQA 5CLLB 4KHAA 1ZM0A 4Z2NA 2RSGA 5C79A 1U27A 1UPRA 1FHWA 4HB0B 2ELBA 1ISNA 1X05A 5GOWB 2KGXB 3BJIA 2HTHB 4HB3B 3GYOA 2J0KA 2RUKB 5D3WA 3A8QA 1P3RA 2P8VA 5DHAB 4HDQA 2VKIA 2OQBA 3PZDA 4MK0A 2H7EA 5HE3A 2KUPA 5D3XA 4XWXA 3FM8C 2Z0QA 3VIAA 2Y8GA 2GCLA 1RJ2A 2RVBB 4NSWA 4C0AA 2I5FA 2E2XA 1TQZA 4K2OA 1LB1A 5HE0A 1LW3A 1XX0A 1KZGA 2ROZB 1WGUA 1Q67A 2D9YA 1BTKA 1BWNA 2Q13A 2ADZA 2H7DA 3F0WA 2EMSA 1QC6A 2JP2A 1H4RA 2D9ZA 3M1IB 4F7UP 2CY4A 1GC6A 2M38A 4GXBA 1RRPB 4PNKA 3T06A 4GMXB 2AL6A 3QBVB 4K17A 3TCAA 3P7ZA 3WA0A 1FGYA 1BTNA 3TO1A 1ZVRA 1TJ6A 1V88A 2K2JA 5LONB 4Y94A 3MDBC 3TW1A 2N23A 1V5MA 3DXEA 2W2XD 5J3YA 1DYNA 2P0HA 2YSZA 2Z0PA 3ZVRA 1Y19B 4DBBA 4HAZB 1UNRA 4DX8A 3CXBB 2DHKA 3F5RA 3RCPA 5L81A 2DHJA 3SO6A 3QIJA 2I1JA 1EVHA 2D11A 4WJ7A 5DIFB 5FI1A 3NSUA 4TYZA 2YT0A 1XCGA 1U5GA 1X11A 3KY9A 1MIZB 3VOQA 2YVCA 4A6FB 1NU2A 1MK7B 1ZSQA 3PEGA 1BAKA 3PVUA 2OTXA 3LJUX 1TXDA 2FJLA 2D9VA 2LULA 4DXAB 1SHCA 2LYDA 1V5PA 2DA0A 1NI2A 2COAA 5C5BA 3O96A 3SUZA 3ODXA 4GZUA 3P6AA 2MDXA 1W1GA 1DDMA 4KVGB 1EAZA 4Z2MB 2N0YA 1FOEA 4YL8A 1N3HA 2RLOA 1ZC3B 1Y5OA 2DTCA 3KRWA 2UZSA 1J0WA 1U2BA 4HAYB 3U8ZA 5JHHA 3OANA 3D8FA 1PMSA 4HAVB 4ZRIA 1U5FA 4P7IA 1P6SA 5DI9B 3V5WA 3AU5A 3PVLA 2KCJA 1I7AA 3ODOA 1WGQA 2J0MA 2CAYA 1M7RA 1MAIA 3SNHA 2QKMA 2D9WA 4MT7A 5KCVA 2BCJA 2EMTA 3HW2B 2HE7A 1FB8A 3D8EA 4HB4B 4KHBB 4ZRKA 2DFKA 1UNPA 4CHMA 2YRYA 2GCJA 3TFMA 1I2HA 2R0DA 2COCA 3FSSA 1FHXA 4HB2B 4BBKA 2LOZA 3ULBA 5D3VA 1V61A 1W1HA 1XD4A 4A5KA 1FAOA 3A98B 1AWEA 2DKQA 1KI1B 2ZPYA 1Z87A 1NTVA 2YS3A 4IAPA 2YS5A 4HAWB 2GS0A 1J19A 2MFQA 2QKLA 2RNRB 2YT1A 3SV1A 2D4QA 3PP2A 2CODA 1K5DB 3PVWA 4GN1A 1UNQA 1AQCA 1X1FA 2DX5A 2LKOA 5D3YA 3IVFA 4H8SA 1MIXA 2AEHA 3CIKA 3KSYA 4ZRJA 2XQNM 4KHOA 2RGNB 1XR0B 1E5WA 4WVFB 3WYFB 2Y7BA 4DX90 4D0NB 1OY2A 4TKNA 4CYEA 5DH9B 2W2WA 2IYBA 1B55A 1U29A 2VRWB 4MY6A 4GMVA 1PFJA 2M14A 2D2QA 4EJNA 2DX1A 5D27A 5C5BB 5C16A 2ELAA 1W1DA 5FI0A 5KQ4A 1DDWA 2CY5A 2I1KA 3ULCA 1P5TA 1M7EA 5DHFB 2L1CA 4B6HA 2CRFA 3DXCA 1FHOA 1DDVA 3A8PA 4YONA 2GJYA 5EFXA 5J3QA 1GG3A 2NZ8B 4K2PA 1MPHA 5J3TA 2DN6A 3QWMA 2DKPA 4HATB 5HE1A 1WJ1A 1ZC4B 2ROVA 4HAUB 5JP4A 1MKEA 1KZ7A 2G35A 1WG7A 3UZTA 2J59M 4KAXB 2W2XC 3HQCA 1WI1A 3SYXA 4HAXB 2COFA 2DYQA 3GYPA 5C6RA 2IFSA 5JHGA 1UEFA 3X23A 1PLSA 3MPXA 1K5GB 4IOYX 2X18A 4HHVA 1FGZA 2UVMA 3N7CA 3ODWA 3ZDTA 1IRSA 2NMBA 3AJ4A 5CLQB 2J0JA 1X86A 3TVVA 3HK0A 5JLJB 1DROA 2EJ8A 2I5CA 2Z0OA 4F7GA 4PQ0A 2DHIA 3PSCA 2EC1A 2P0FA 1SGHA 5LOPB 3KRXA 4IFSA 2K00A 2Y8FA 3DXDA 4A6KA 3U7DA 2V76A 2MWNB 2D10A 3PG7A 4A6HA 2L2IA 2UZRA 1EF1A 1U5DA 1GC7A 4F7HA 4NY0A 3KZ1A 1DBHA 4WSFA 2K2UA 1U5EA 3BINA 1XKEA 4L6EA 2R09A 2PZ1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3G9W A;  1MK9 B;  1WVH A;  4K81 A;  1H10 A;  1OMW A;  3D8D A;  4EKU A;  1X1G A;  1XOD A;  2YS1 A;  5HE2 A;  3ML4 A;  1NTY A;  4A6F A;  1OQN A;  1EGX A;  2VSZ A;  4EMO A;  2DYN A;  2YF0 A;  4GPT B;  1V89 A;  3FEH A;  4CHJ A;  3AU4 A;  2LG1 A;  2MKR A;  2DLW A;  5KQ1 A;  1QQG A;  2P0D A;  1V5U A;  2LOX A;  2D9X A;  1WJM A;  4HDO A;  1UPQ A;  5CLL B;  4KHA A;  1ZM0 A;  4Z2N A;  2RSG A;  5C79 A;  1U27 A;  1UPR A;  1FHW A;  4HB0 B;  2ELB A;  1ISN A;  1X05 A;  5GOW B;  2KGX B;  3BJI A;  2HTH B;  4HB3 B;  3GYO A;  2J0K A;  2RUK B;  5D3W A;  3A8Q A;  1P3R A;  2P8V A;  5DHA B;  4HDQ A;  2VKI A;  2OQB A;  3PZD A;  4MK0 A;  2H7E A;  5HE3 A;  2KUP A;  5D3X A;  4XWX A;  3FM8 C;  2Z0Q A;  3VIA A;  2Y8G A;  2GCL A;  1RJ2 A;  2RVB B;  4NSW A;  4C0A A;  2I5F A;  2E2X A;  1TQZ A;  4K2O A;  1LB1 A;  5HE0 A;  1LW3 A;  1XX0 A;  1KZG A;  2ROZ B;  1WGU A;  1Q67 A;  2D9Y A;  1BTK A;  1BWN A;  2Q13 A;  2ADZ A;  2H7D A;  3F0W A;  2EMS A;  1QC6 A;  2JP2 A;  1H4R A;  2D9Z A;  3M1I B;  4F7U P;  2CY4 A;  1GC6 A;  2M38 A;  4GXB A;  1RRP B;  4PNK A;  3T06 A;  4GMX B;  2AL6 A;  3QBV B;  4K17 A;  3TCA A;  3P7Z A;  3WA0 A;  1FGY A;  1BTN A;  3TO1 A;  1ZVR A;  1TJ6 A;  1V88 A;  2K2J A;  5LON B;  4Y94 A;  3MDB C;  3TW1 A;  2N23 A;  1V5M A;  3DXE A;  2W2X D;  5J3Y A;  1DYN A;  2P0H A;  2YSZ A;  2Z0P A;  3ZVR A;  1Y19 B;  4DBB A;  4HAZ B;  1UNR A;  4DX8 A;  3CXB B;  2DHK A;  3F5R A;  3RCP A;  5L81 A;  2DHJ A;  3SO6 A;  3QIJ A;  2I1J A;  1EVH A;  2D11 A;  4WJ7 A;  5DIF B;  5FI1 A;  3NSU A;  4TYZ A;  2YT0 A;  1XCG A;  1U5G A;  1X11 A;  3KY9 A;  1MIZ B;  3VOQ A;  2YVC A;  4A6F B;  1NU2 A;  1MK7 B;  1ZSQ A;  3PEG A;  1BAK A;  3PVU A;  2OTX A;  3LJU X;  1TXD A;  2FJL A;  2D9V A;  2LUL A;  4DXA B;  1SHC A;  2LYD A;  1V5P A;  2DA0 A;  1NI2 A;  2COA A;  5C5B A;  3O96 A;  3SUZ A;  3ODX A;  4GZU A;  3P6A A;  2MDX A;  1W1G A;  1DDM A;  4KVG B;  1EAZ A;  4Z2M B;  2N0Y A;  1FOE A;  4YL8 A;  1N3H A;  2RLO A;  1ZC3 B;  1Y5O A;  2DTC A;  3KRW A;  2UZS A;  1J0W A;  1U2B A;  4HAY B;  3U8Z A;  5JHH A;  3OAN A;  3D8F A;  1PMS A;  4HAV B;  4ZRI A;  1U5F A;  4P7I A;  1P6S A;  5DI9 B;  3V5W A;  3AU5 A;  3PVL A;  2KCJ A;  1I7A A;  3ODO A;  1WGQ A;  2J0M A;  2CAY A;  1M7R A;  1MAI A;  3SNH A;  2QKM A;  2D9W A;  4MT7 A;  5KCV A;  2BCJ A;  2EMT A;  3HW2 B;  2HE7 A;  1FB8 A;  3D8E A;  4HB4 B;  4KHB B;  4ZRK A;  2DFK A;  1UNP A;  4CHM A;  2YRY A;  2GCJ A;  3TFM A;  1I2H A;  2R0D A;  2COC A;  3FSS A;  1FHX A;  4HB2 B;  4BBK A;  2LOZ A;  3ULB A;  5D3V A;  1V61 A;  1W1H A;  1XD4 A;  4A5K A;  1FAO A;  3A98 B;  1AWE A;  2DKQ A;  1KI1 B;  2ZPY A;  1Z87 A;  1NTV A;  2YS3 A;  4IAP A;  2YS5 A;  4HAW B;  2GS0 A;  1J19 A;  2MFQ A;  2QKL A;  2RNR B;  2YT1 A;  3SV1 A;  2D4Q A;  3PP2 A;  2COD A;  1K5D B;  3PVW A;  4GN1 A;  1UNQ A;  1AQC A;  1X1F A;  2DX5 A;  2LKO A;  5D3Y A;  3IVF A;  4H8S A;  1MIX A;  2AEH A;  3CIK A;  3KSY A;  4ZRJ A;  2XQN M;  4KHO A;  2RGN B;  1XR0 B;  1E5W A;  4WVF B;  3WYF B;  2Y7B A;  4DX9 0;  4D0N B;  1OY2 A;  4TKN A;  4CYE A;  5DH9 B;  2W2W A;  2IYB A;  1B55 A;  1U29 A;  2VRW B;  4MY6 A;  4GMV A;  1PFJ A;  2M14 A;  2D2Q A;  4EJN A;  2DX1 A;  5D27 A;  5C5B B;  5C16 A;  2ELA A;  1W1D A;  5FI0 A;  5KQ4 A;  1DDW A;  2CY5 A;  2I1K A;  3ULC A;  1P5T A;  1M7E A;  5DHF B;  2L1C A;  4B6H A;  2CRF A;  3DXC A;  1FHO A;  1DDV A;  3A8P A;  4YON A;  2GJY A;  5EFX A;  5J3Q A;  1GG3 A;  2NZ8 B;  4K2P A;  1MPH A;  5J3T A;  2DN6 A;  3QWM A;  2DKP A;  4HAT B;  5HE1 A;  1WJ1 A;  1ZC4 B;  2ROV A;  4HAU B;  5JP4 A;  1MKE A;  1KZ7 A;  2G35 A;  1WG7 A;  3UZT A;  2J59 M;  4KAX B;  2W2X C;  3HQC A;  1WI1 A;  3SYX A;  4HAX B;  2COF A;  2DYQ A;  3GYP A;  5C6R A;  2IFS A;  5JHG A;  1UEF A;  3X23 A;  1PLS A;  3MPX A;  1K5G B;  4IOY X;  2X18 A;  4HHV A;  1FGZ A;  2UVM A;  3N7C A;  3ODW A;  3ZDT A;  1IRS A;  2NMB A;  3AJ4 A;  5CLQ B;  2J0J A;  1X86 A;  3TVV A;  3HK0 A;  5JLJ B;  1DRO A;  2EJ8 A;  2I5C A;  2Z0O A;  4F7G A;  4PQ0 A;  2DHI A;  3PSC A;  2EC1 A;  2P0F A;  1SGH A;  5LOP B;  3KRX A;  4IFS A;  2K00 A;  2Y8F A;  3DXD A;  4A6K A;  3U7D A;  2V76 A;  2MWN B;  2D10 A;  3PG7 A;  4A6H A;  2L2I A;  2UZR A;  1EF1 A;  1U5D A;  1GC7 A;  4F7H A;  4NY0 A;  3KZ1 A;  1DBH A;  4WSF A;  2K2U A;  1U5E A;  3BIN A;  1XKE A;  4L6E A;  2R09 A;  2PZ1 A; 
#chains in the Genus database with same CATH topology
 3G9W A;  1MK9 B;  1WVH A;  4K81 A;  1H10 A;  1OMW A;  1T77 A;  3D8D A;  4GOU A;  4EKU A;  1X1G A;  1XOD A;  2YS1 A;  5HE2 A;  3ML4 A;  1NTY A;  2FJU B;  4A6F A;  1OQN A;  1EGX A;  2R2Y A;  2VSZ A;  4EMO A;  2DYN A;  2YF0 A;  4GPT B;  1V89 A;  3FEH A;  4CHJ A;  3AU4 A;  2LG1 A;  2MKR A;  2DLW A;  5KQ1 A;  1QQG A;  2P0D A;  1V5U A;  2LOX A;  2D9X A;  1WJM A;  4HDO A;  1UPQ A;  5CLL B;  2Z59 A;  4KHA A;  1ZM0 A;  3NWD A;  4Z2N A;  2RSG A;  5C79 A;  1U27 A;  1UPR A;  1FHW A;  4HB0 B;  2ELB A;  1ISN A;  1X05 A;  3DCX A;  5GOW B;  2KGX B;  3BJI A;  2HTH B;  4HB3 B;  3GYO A;  2GUM A;  2J0K A;  2RUK B;  5D3W A;  3A8Q A;  1P3R A;  2P8V A;  5DHA B;  4HDQ A;  2VKI A;  2OQB A;  3PZD A;  4MK0 A;  2H7E A;  5HE3 A;  2KUP A;  5D3X A;  4XWX A;  3FM8 C;  2Z0Q A;  3VIA A;  2Y8G A;  2GCL A;  1RJ2 A;  2RVB B;  4NSW A;  4C0A A;  2I5F A;  2E2X A;  1TQZ A;  4K2O A;  1LB1 A;  5HE0 A;  1LW3 A;  1XX0 A;  1KZG A;  4KHB A;  2ROZ B;  1WGU A;  1Q67 A;  2D9Y A;  5I2M A;  1BTK A;  1BWN A;  2Q13 A;  2ADZ A;  4D6W A;  2H7D A;  3F0W A;  3OHM B;  2EMS A;  1QC6 A;  2JP2 A;  1H4R A;  2D9Z A;  3M1I B;  4F7U P;  2CY4 A;  2KIG A;  1GC6 A;  2M38 A;  4GXB A;  1RRP B;  4PNK A;  3T06 A;  4GMX B;  2AL6 A;  3QBV B;  4K17 A;  3TCA A;  3P7Z A;  3WA0 A;  1FGY A;  1BTN A;  3TO1 A;  1ZVR A;  3HSA A;  1TJ6 A;  1V88 A;  5IRS A;  2K2J A;  5LON B;  4Y94 A;  3MDB C;  3TW1 A;  2N23 A;  1V5M A;  1MI1 A;  3DXE A;  2W2X D;  5J3Y A;  1DYN A;  2P0H A;  2YSZ A;  2Z0P A;  3ZVR A;  1Y19 B;  4DBB A;  4HAZ B;  4DIX A;  1UNR A;  4DX8 A;  5M4Y B;  3CXB B;  2DHK A;  2K49 A;  3F5R A;  3RCP A;  5L81 A;  2DHJ A;  3SO6 A;  3QIJ A;  2I1J A;  1EVH A;  2D11 A;  4WJ7 A;  5DIF B;  5FI1 A;  3NSU A;  4TYZ A;  2Z4D A;  2YT0 A;  1XCG A;  1U5G A;  1X11 A;  3KY9 A;  1MIZ B;  3VOQ A;  2KUQ A;  2YVC A;  4A6F B;  1NU2 A;  1MK7 B;  1ZSQ A;  3PEG A;  1BAK A;  3PVU A;  2OTX A;  3LJU X;  1TXD A;  2FJL A;  2D9V A;  2LUL A;  4DXA B;  1SHC A;  2LYD A;  1V5P A;  2DA0 A;  1NI2 A;  2COA A;  5C5B A;  3O96 A;  3SUZ A;  3ODX A;  4GZU A;  3P6A A;  2MDX A;  1W1G A;  1DDM A;  4KVG B;  1EAZ A;  4Z2M B;  2ZKM X;  2N0Y A;  1FOE A;  4QJ4 B;  4YL8 A;  1N3H A;  2RLO A;  1ZC3 B;  1Y5O A;  2DTC A;  3KRW A;  2UZS A;  1J0W A;  3NWF A;  1U2B A;  4HAY B;  3HIE A;  3U8Z A;  5JHH A;  3OAN A;  3D8F A;  1PMS A;  4HAV B;  4ZRI A;  1U5F A;  4P7I A;  1P6S A;  5DI9 B;  3V5W A;  3AU5 A;  3PVL A;  2KCJ A;  1I7A A;  3ODO A;  1WGQ A;  2J0M A;  2CAY A;  1M7R A;  1ZYI A;  1MAI A;  4OT1 A;  3SNH A;  2QKM A;  2D9W A;  4MT7 A;  5KCV A;  2BCJ A;  2EMT A;  3HW2 B;  2HE7 A;  1FB8 A;  3D8E A;  4HB4 B;  4KHB B;  4ZRK A;  4QJ5 B;  2DFK A;  1UNP A;  4CHM A;  2YRY A;  2GCJ A;  3TFM A;  1I2H A;  2R0D A;  2COC A;  3FVC A;  3FSS A;  1FHX A;  4HB2 B;  3A58 A;  4BBK A;  2LOZ A;  3ULB A;  5D3V A;  2RRF A;  1V61 A;  1W1H A;  1XD4 A;  4A5K A;  1FAO A;  3A98 B;  2K8E A;  1AWE A;  2DKQ A;  1KI1 B;  2ZPY A;  1Z87 A;  1NTV A;  2YS3 A;  3B77 A;  2KIE A;  4IAP A;  2YS5 A;  4HAW B;  2GS0 A;  4GNK B;  1J19 A;  2MFQ A;  2QKL A;  2RNR B;  2YT1 A;  3SV1 A;  2D4Q A;  2YT2 A;  3PP2 A;  2COD A;  1K5D B;  3PVW A;  4GN1 A;  1UNQ A;  1AQC A;  1X1F A;  2DX5 A;  2LKO A;  5D3Y A;  3IVF A;  4H8S A;  1MIX A;  2AEH A;  3CIK A;  3KSY A;  4ZRJ A;  2XQN M;  4KHO A;  2RGN B;  5I2S A;  1XR0 B;  1E5W A;  4WVF B;  4L1R A;  2Y7B A;  3WYF B;  4DX9 0;  4D0N B;  1OY2 A;  4TKN A;  4CYE A;  5DH9 B;  2W2W A;  2NBV A;  2IYB A;  1B55 A;  1U29 A;  2VRW B;  4MY6 A;  4GMV A;  1PFJ A;  2M14 A;  2D2Q A;  3NWA A;  4EJN A;  2DX1 A;  5LG4 B;  5D27 A;  5C5B B;  5C16 A;  2ELA A;  1W1D A;  5FI0 A;  5KQ4 A;  1DDW A;  2CY5 A;  2I1K A;  3ULC A;  1P5T A;  1M7E A;  5DHF B;  2L1C A;  4B6H A;  2CRF A;  3DXC A;  1FHO A;  1DDV A;  3A8P A;  4YON A;  2GJY A;  5EFX A;  5J3Q A;  1GG3 A;  2NZ8 B;  4K2P A;  1MPH A;  5J3T A;  2DN6 A;  3QWM A;  2DKP A;  4HAT B;  5HE1 A;  1WJ1 A;  1ZC4 B;  2ROV A;  4HAU B;  5JP4 A;  1MKE A;  1KZ7 A;  2G35 A;  1WG7 A;  4OSN A;  3UZT A;  2J59 M;  4KAX B;  2W2X C;  3HQC A;  1WI1 A;  3SYX A;  4HAX B;  2COF A;  2DYQ A;  3GYP A;  5C6R A;  2IFS A;  5JHG A;  1UEF A;  3X23 A;  1PLS A;  3MPX A;  1K5G B;  4IOY X;  2X18 A;  4HHV A;  2KR0 A;  1FGZ A;  2UVM A;  3N7C A;  3ODW A;  3ZDT A;  1IRS A;  2NMB A;  3AJ4 A;  5CLQ B;  2J0J A;  1X86 A;  4QJ3 B;  3TVV A;  3HK0 A;  5JLJ B;  1DRO A;  2EJ8 A;  2I5C A;  2Z0O A;  4F7G A;  3U12 A;  4PQ0 A;  2DHI A;  3PSC A;  2EC1 A;  2P0F A;  1SGH A;  5LOP B;  3KRX A;  4IFS A;  2K00 A;  2Y8F A;  3DXD A;  4A6K A;  3U7D A;  2V76 A;  2Z13 A;  4HSI A;  2Z14 A;  2MWN B;  2D10 A;  3PG7 A;  4A6H A;  4CSQ A;  2L2I A;  2UZR A;  1EF1 A;  1U5D A;  1GC7 A;  4F7H A;  4NY0 A;  3KZ1 A;  1DBH A;  4WSF A;  4QXA B;  3NW8 A;  2K2U A;  1U5E A;  3BIN A;  1XKE A;  4L6E A;  2R09 A;  2PZ1 A; 
#chains in the Genus database with same CATH homology
 3G9W A;  1MK9 B;  1WVH A;  4K81 A;  1H10 A;  1OMW A;  3D8D A;  4EKU A;  1X1G A;  1XOD A;  2YS1 A;  5HE2 A;  3ML4 A;  1NTY A;  4A6F A;  1OQN A;  1EGX A;  2VSZ A;  4EMO A;  2DYN A;  2YF0 A;  4GPT B;  1V89 A;  3FEH A;  4CHJ A;  3AU4 A;  2LG1 A;  2MKR A;  2DLW A;  5KQ1 A;  1QQG A;  2P0D A;  1V5U A;  2LOX A;  2D9X A;  1WJM A;  4HDO A;  1UPQ A;  5CLL B;  4KHA A;  1ZM0 A;  4Z2N A;  2RSG A;  5C79 A;  1U27 A;  1UPR A;  1FHW A;  4HB0 B;  2ELB A;  1ISN A;  1X05 A;  5GOW B;  2KGX B;  3BJI A;  2HTH B;  4HB3 B;  3GYO A;  2J0K A;  2RUK B;  5D3W A;  3A8Q A;  1P3R A;  2P8V A;  5DHA B;  4HDQ A;  2VKI A;  2OQB A;  3PZD A;  4MK0 A;  2H7E A;  5HE3 A;  2KUP A;  5D3X A;  4XWX A;  3FM8 C;  2Z0Q A;  3VIA A;  2Y8G A;  2GCL A;  1RJ2 A;  2RVB B;  4NSW A;  4C0A A;  2I5F A;  2E2X A;  1TQZ A;  4K2O A;  1LB1 A;  5HE0 A;  1LW3 A;  1XX0 A;  1KZG A;  2ROZ B;  1WGU A;  1Q67 A;  2D9Y A;  1BTK A;  1BWN A;  2Q13 A;  2ADZ A;  2H7D A;  3F0W A;  2EMS A;  1QC6 A;  2JP2 A;  1H4R A;  2D9Z A;  3M1I B;  4F7U P;  2CY4 A;  1GC6 A;  2M38 A;  4GXB A;  1RRP B;  4PNK A;  3T06 A;  4GMX B;  2AL6 A;  3QBV B;  4K17 A;  3TCA A;  3P7Z A;  3WA0 A;  1FGY A;  1BTN A;  3TO1 A;  1ZVR A;  1TJ6 A;  1V88 A;  2K2J A;  5LON B;  4Y94 A;  3MDB C;  3TW1 A;  2N23 A;  1V5M A;  3DXE A;  2W2X D;  5J3Y A;  1DYN A;  2P0H A;  2YSZ A;  2Z0P A;  3ZVR A;  1Y19 B;  4DBB A;  4HAZ B;  1UNR A;  4DX8 A;  3CXB B;  2DHK A;  3F5R A;  3RCP A;  5L81 A;  2DHJ A;  3SO6 A;  3QIJ A;  2I1J A;  1EVH A;  2D11 A;  4WJ7 A;  5DIF B;  5FI1 A;  3NSU A;  4TYZ A;  2YT0 A;  1XCG A;  1U5G A;  1X11 A;  3KY9 A;  1MIZ B;  3VOQ A;  2YVC A;  4A6F B;  1NU2 A;  1MK7 B;  1ZSQ A;  3PEG A;  1BAK A;  3PVU A;  2OTX A;  3LJU X;  1TXD A;  2FJL A;  2D9V A;  2LUL A;  4DXA B;  1SHC A;  2LYD A;  1V5P A;  2DA0 A;  1NI2 A;  2COA A;  5C5B A;  3O96 A;  3SUZ A;  3ODX A;  4GZU A;  3P6A A;  2MDX A;  1W1G A;  1DDM A;  4KVG B;  1EAZ A;  4Z2M B;  2N0Y A;  1FOE A;  4YL8 A;  1N3H A;  2RLO A;  1ZC3 B;  1Y5O A;  2DTC A;  3KRW A;  2UZS A;  1J0W A;  1U2B A;  4HAY B;  3U8Z A;  5JHH A;  3OAN A;  3D8F A;  1PMS A;  4HAV B;  4ZRI A;  1U5F A;  4P7I A;  1P6S A;  5DI9 B;  3V5W A;  3AU5 A;  3PVL A;  2KCJ A;  1I7A A;  3ODO A;  1WGQ A;  2J0M A;  2CAY A;  1M7R A;  1MAI A;  3SNH A;  2QKM A;  2D9W A;  4MT7 A;  5KCV A;  2BCJ A;  2EMT A;  3HW2 B;  2HE7 A;  1FB8 A;  3D8E A;  4HB4 B;  4KHB B;  4ZRK A;  2DFK A;  1UNP A;  4CHM A;  2YRY A;  2GCJ A;  3TFM A;  1I2H A;  2R0D A;  2COC A;  3FSS A;  1FHX A;  4HB2 B;  4BBK A;  2LOZ A;  3ULB A;  5D3V A;  1V61 A;  1W1H A;  1XD4 A;  4A5K A;  1FAO A;  3A98 B;  1AWE A;  2DKQ A;  1KI1 B;  2ZPY A;  1Z87 A;  1NTV A;  2YS3 A;  4IAP A;  2YS5 A;  4HAW B;  2GS0 A;  1J19 A;  2MFQ A;  2QKL A;  2RNR B;  2YT1 A;  3SV1 A;  2D4Q A;  3PP2 A;  2COD A;  1K5D B;  3PVW A;  4GN1 A;  1UNQ A;  1AQC A;  1X1F A;  2DX5 A;  2LKO A;  5D3Y A;  3IVF A;  4H8S A;  1MIX A;  2AEH A;  3CIK A;  3KSY A;  4ZRJ A;  2XQN M;  4KHO A;  2RGN B;  1XR0 B;  1E5W A;  4WVF B;  3WYF B;  2Y7B A;  4DX9 0;  4D0N B;  1OY2 A;  4TKN A;  4CYE A;  5DH9 B;  2W2W A;  2IYB A;  1B55 A;  1U29 A;  2VRW B;  4MY6 A;  4GMV A;  1PFJ A;  2M14 A;  2D2Q A;  4EJN A;  2DX1 A;  5D27 A;  5C5B B;  5C16 A;  2ELA A;  1W1D A;  5FI0 A;  5KQ4 A;  1DDW A;  2CY5 A;  2I1K A;  3ULC A;  1P5T A;  1M7E A;  5DHF B;  2L1C A;  4B6H A;  2CRF A;  3DXC A;  1FHO A;  1DDV A;  3A8P A;  4YON A;  2GJY A;  5EFX A;  5J3Q A;  1GG3 A;  2NZ8 B;  4K2P A;  1MPH A;  5J3T A;  2DN6 A;  3QWM A;  2DKP A;  4HAT B;  5HE1 A;  1WJ1 A;  1ZC4 B;  2ROV A;  4HAU B;  5JP4 A;  1MKE A;  1KZ7 A;  2G35 A;  1WG7 A;  3UZT A;  2J59 M;  4KAX B;  2W2X C;  3HQC A;  1WI1 A;  3SYX A;  4HAX B;  2COF A;  2DYQ A;  3GYP A;  5C6R A;  2IFS A;  5JHG A;  1UEF A;  3X23 A;  1PLS A;  3MPX A;  1K5G B;  4IOY X;  2X18 A;  4HHV A;  1FGZ A;  2UVM A;  3N7C A;  3ODW A;  3ZDT A;  1IRS A;  2NMB A;  3AJ4 A;  5CLQ B;  2J0J A;  1X86 A;  3TVV A;  3HK0 A;  5JLJ B;  1DRO A;  2EJ8 A;  2I5C A;  2Z0O A;  4F7G A;  4PQ0 A;  2DHI A;  3PSC A;  2EC1 A;  2P0F A;  1SGH A;  5LOP B;  3KRX A;  4IFS A;  2K00 A;  2Y8F A;  3DXD A;  4A6K A;  3U7D A;  2V76 A;  2MWN B;  2D10 A;  3PG7 A;  4A6H A;  2L2I A;  2UZR A;  1EF1 A;  1U5D A;  1GC7 A;  4F7H A;  4NY0 A;  3KZ1 A;  1DBH A;  4WSF A;  2K2U A;  1U5E A;  3BIN A;  1XKE A;  4L6E A;  2R09 A;  2PZ1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...