1FHOA

Solution structure of the ph domain from the c. elegans muscle protein unc-89
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
119
structure length
119
Chain Sequence
MGDTGKLGRIIRHDAFQVWEGDEPPKLRYVFLFRNKIMFTEQDASTSPPSYTHYSSIRLDKYNIRQHTTDEDTIVLQPQEPGLPSFRIKPKDFETSEYVRKAWLRDIAEEQEKYAAERD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords UNC-89
publication title Structure of a PH domain from the C. elegans muscle protein UNC-89 suggests a novel function.
pubmed doi rcsb
source organism Caenorhabditis elegans
total genus 15
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2000-08-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 1fhoA00
3DXCA 2KCJA 2D9XA 3VOQA 4KHBB 1Y19B 3RCPA 2DFKA 2G35A 2DA0A 2UZSA 3SNHA 2Y8GA 2PZ1A 4H8SA 2XQNM 4DBBA 3U7DA 4CHJA 4KVGB 1WJ1A 2W2XC 5DH9B 5C79A 4F7HA 2UVMA 2BCJA 1BTKA 1DBHA 1UNRA 2I5FA 1GC6A 1NTYA 2CODA 1U5EA 2Z0QA 2H7DA 4Z2NA 3D8EA 5D27A 1BTNA 2DHIA 1BWNA 1UEFA 3ZVRA 5DHFB 1ZM0A 4GPTB 3MPXA 1ZC3B 1IRSA 1OQNA 2HE7A 5KCVA 1U29A 3V5WA 2MDXA 2M38A 4IOYX 5EFXA 1EGXA 2W2WA 4KHOA 4TYZA 3ML4A 2ROVA 4MK0A 3AU4A 5LONB 1P3RA 1M7EA 3PVUA 4NSWA 2K2JA 1H4RA 1DDVA 1LW3A 5HE3A 1Q67A 2J0MA 2GS0A 1XD4A 1RJ2A 2DLWA 2D4QA 2D2QA 2RUKB 3ODWA 4K17A 3TFMA 4IAPA 2EMTA 2YSZA 1FGYA 1X05A 3KY9A 3SUZA 2H7EA 1ISNA 4HDOA 1FHXA 4MT7A 1H10A 1Y5OA 2V76A 1MAIA 2CRFA 1TQZA 2NZ8B 2UZRA 4CHMA 2I1KA 2ELBA 5JP4A 1X1FA 3O96A 1WI1A 2AEHA 1U5DA 1DROA 5HE2A 4GMVA 5C5BB 2QKLA 2L2IA 5C5BA 2R09A 1XR0B 2DTCA 1V5UA 2Y8FA 2RGNB 2VKIA 4D0NB 2LKOA 2Y7BA 3AU5A 4F7UP 1M7RA 1FOEA 4EJNA 1P5TA 1GC7A 1SGHA 1TJ6A 3PP2A 2LULA 5FI0A 4YL8A 5DIFB 3FM8C 3TO1A 4B6HA 5FI1A 3ODXA 2YVCA 4ZRIA 1W1GA 1NTVA 3QWMA 2QKMA 3HW2B 5C16A 2COCA 1X1GA 2P0FA 3TVVA 1EAZA 3KZ1A 4K2PA 3P6AA 4EMOA 3GYPA 3D8FA 1I7AA 1U5GA 2JP2A 3OANA 2D9ZA 2KGXB 1UNQA 1UNPA 1DDMA 3SYXA 1WG7A 1DDWA 1XODA 4KHAA 4ZRJA 1V89A 1W1DA 5GOWB 2MFQA 5JHHA 2VRWB 4HAXB 1ZSQA 2J0JA 1GG3A 4Z2MB 2Q13A 2FJLA 2L1CA 2DN6A 1MKEA 2YS5A 3HK0A 2IYBA 2J59M 3PVWA 1ZVRA 2LYDA 3ZDTA 2YF0A 1UPRA 1P6SA 3TW1A 1WGQA 5J3YA 1J19A 3WA0A 2AL6A 1J0WA 2COFA 5JLJB 1I2HA 2YT0A 2CY5A 3PSCA 1B55A 5J3TA 1TXDA 1WVHA 5CLQB 4HDQA 2YS3A 3LJUX 4EKUA 2DHJA 2DYQA 3U8ZA 1W1HA 2YRYA 1PFJA 2ADZA 3QIJA 3UZTA 3F5RA 3MDBC 3P7ZA 2LG1A 5CLLB 3SO6A 1KZ7A 4XWXA 2N23A 4C0AA 2N0YA 3DXEA 3BJIA 3VIAA 3WYFB 3HQCA 2MWNB 2DX5A 3CXBB 4IFSA 2GCJA 2P8VA 4HAUB 2GJYA 1AWEA 3D8DA 3IVFA 5JHGA 4HAWB 1NU2A 4P7IA 5L81A 1X11A 4ZRKA 1QQGA 2X18A 1SHCA 2W2XD 3KRWA 4A6HA 2GCLA 3QBVB 4HB2B 2E2XA 4GMXB 3FSSA 1WJMA 2LOZA 4A5KA 2YT1A 2HTHB 4DX8A 4HHVA 5C6RA 4A6KA 1OMWA 1NI2A 2J0KA 3FEHA 2RVBB 4HB3B 2D9WA 5HE0A 5LOPB 1KZGA 2RNRB 3ULCA 1BAKA 4WJ7A 1N3HA 2MKRA 2DYNA 2ZPYA 1PMSA 1DYNA 1EVHA 2COAA 2Z0PA 4TKNA 3F0WA 1V5MA 1PLSA 2DKQA 3N7CA 1U5FA 4K2OA 2NMBA 2EMSA 4DXAB 3CIKA 4GN1A 1FGZA 4F7GA 2P0DA 3TCAA 2ROZB 2D10A 2D9YA 2P0HA 2DHKA 1QC6A 5D3WA 1ZC4B 1EF1A 4HAZB 2CY4A 3DXDA 3KRXA 1AQCA 2D11A 4DX90 1MIZB 3BINA 2K2UA 1E5WA 1FHWA 2KUPA 3A8QA 4K81A 2YS1A 5HE1A 4PNKA 2I1JA 2D9VA 4YONA 1MK7B 2K00A 3ODOA 3PG7A 2I5CA 4CYEA 1V5PA 2RLOA 3M1IB 2ELAA 3PVLA 1FHOA 2Z0OA 2DX1A 2RSGA 2VSZA 5DHAB 4L6EA 1WGUA 5DI9B 4HATB 2OQBA 3X23A 4HAYB 2CAYA 3G9WA 5D3YA 1K5DB 4A6FB 3ULBA 4PQ0A 3AJ4A 1XCGA 3SV1A 4A6FA 1KI1B 2EJ8A 3KSYA 4HAVB 3PZDA 2DKPA 1V61A 1U27A 4WVFB 1OY2A 1XX0A 1MPHA 1U2BA 2R0DA 2EC1A 3PEGA 3GYOA 4Y94A 3NSUA 1LB1A 1UPQA 3T06A 2OTXA 4MY6A 1MK9B 4NY0A 1FB8A 2IFSA 3A98B 4HB0B 2M14A 4KAXB 1Z87A 1FAOA 4BBKA 2LOXA 5KQ1A 1MIXA 5D3XA 1XKEA 5D3VA 1K5GB 4GZUA 5KQ4A 4HB4B 4WSFA 1RRPB 3A8PA 1X86A 4GXBA 1V88A 5J3QA
chains in the Genus database with same CATH superfamily
3DXCA 2KCJA 2D9XA 3VOQA 4KHBB 1Y19B 3RCPA 2DFKA 4KHBA 3NWDA 2G35A 2DA0A 2UZSA 4QJ3B 3SNHA 2Y8GA 2PZ1A 4H8SA 2XQNM 4DBBA 3U7DA 4CHJA 5LG4B 4KVGB 1WJ1A 2W2XC 5DH9B 5C79A 4F7HA 2UVMA 2BCJA 1BTKA 1DBHA 5I2SA 1UNRA 2I5FA 1GC6A 1NTYA 2CODA 1U5EA 2Z0QA 2H7DA 4Z2NA 3D8EA 5D27A 4DIXA 1BTNA 2DHIA 1BWNA 1UEFA 3ZVRA 5DHFB 1ZM0A 4GPTB 3MPXA 1ZC3B 1IRSA 1OQNA 2ZKMX 2HE7A 5KCVA 1U29A 3V5WA 2MDXA 2M38A 4IOYX 5EFXA 1EGXA 2W2WA 4KHOA 4GOUA 4TYZA 4CSQA 3ML4A 3HSAA 2ROVA 4MK0A 3AU4A 5LONB 1P3RA 1M7EA 3PVUA 4NSWA 2K2JA 1H4RA 1DDVA 1LW3A 5HE3A 1Q67A 2J0MA 2GS0A 1XD4A 1RJ2A 2DLWA 2D4QA 2D2QA 2RUKB 3ODWA 4K17A 5M4YB 1ZYIA 3TFMA 4IAPA 2EMTA 2YSZA 1FGYA 1X05A 3KY9A 3SUZA 2H7EA 1ISNA 4HDOA 1FHXA 4MT7A 1H10A 1Y5OA 2V76A 1MAIA 2CRFA 3NWAA 1TQZA 2NZ8B 2UZRA 4CHMA 2I1KA 2ELBA 2GUMA 5JP4A 1X1FA 3O96A 1WI1A 2AEHA 1U5DA 1DROA 5HE2A 4GMVA 5C5BB 2QKLA 2L2IA 5C5BA 2R09A 1XR0B 2DTCA 2KUQA 1V5UA 2Y8FA 2RGNB 2VKIA 4D0NB 2LKOA 2Y7BA 3AU5A 4F7UP 1M7RA 1FOEA 4EJNA 1P5TA 1GC7A 1SGHA 1TJ6A 3PP2A 2LULA 5FI0A 4YL8A 5DIFB 3FM8C 3TO1A 4B6HA 5FI1A 3ODXA 2YVCA 4ZRIA 1W1GA 1NTVA 3QWMA 2QKMA 3HW2B 5C16A 2COCA 1X1GA 2P0FA 3TVVA 1EAZA 3KZ1A 2Z14A 4K2PA 3P6AA 4EMOA 3GYPA 3D8FA 1I7AA 1U5GA 2JP2A 3U12A 3OANA 2D9ZA 2KGXB 1UNQA 1UNPA 1DDMA 3SYXA 1WG7A 2KR0A 1DDWA 3B77A 1XODA 3OHMB 4KHAA 4ZRJA 1V89A 3FVCA 1W1DA 2KIEA 5GOWB 2MFQA 2Z59A 5JHHA 2VRWB 4HAXB 1ZSQA 2J0JA 1GG3A 5I2MA 2Q13A 4Z2MB 2FJLA 2FJUB 2L1CA 2DN6A 1MKEA 2YS5A 3HK0A 2IYBA 2J59M 3DCXA 3PVWA 1ZVRA 2LYDA 2Z4DA 3ZDTA 2YF0A 1UPRA 1P6SA 3TW1A 1WGQA 5J3YA 1J19A 3NW8A 3WA0A 2AL6A 1J0WA 2COFA 5JLJB 1I2HA 2YT0A 2CY5A 3PSCA 1B55A 5J3TA 1TXDA 1WVHA 5CLQB 4HDQA 2YS3A 3LJUX 4EKUA 2DHJA 2DYQA 3U8ZA 1W1HA 2YRYA 1PFJA 2ADZA 3QIJA 4OT1A 3UZTA 3F5RA 3MDBC 3P7ZA 2LG1A 5CLLB 3SO6A 1KZ7A 4XWXA 2N23A 4C0AA 2N0YA 3DXEA 3BJIA 3VIAA 2K49A 3WYFB 3HQCA 2MWNB 2DX5A 3CXBB 4IFSA 2GCJA 2P8VA 4HAUB 2GJYA 1AWEA 3D8DA 3IVFA 5JHGA 4HAWB 1NU2A 4P7IA 5L81A 1X11A 4ZRKA 1QQGA 2X18A 4OSNA 1SHCA 2W2XD 3KRWA 4A6HA 2GCLA 3QBVB 4HB2B 2E2XA 4GMXB 3FSSA 1WJMA 2LOZA 4A5KA 2YT1A 2HTHB 4DX8A 4HHVA 5C6RA 4A6KA 1OMWA 1NI2A 4HSIA 2J0KA 4QJ4B 3FEHA 2RVBB 4HB3B 2D9WA 5HE0A 5LOPB 1KZGA 2RNRB 3ULCA 1BAKA 4WJ7A 1N3HA 2MKRA 4L1RA 2DYNA 2ZPYA 1PMSA 1DYNA 1EVHA 2COAA 4D6WA 2Z0PA 4TKNA 3F0WA 1V5MA 1PLSA 2DKQA 3NWFA 3N7CA 1U5FA 4K2OA 2Z13A 2NMBA 2EMSA 4DXAB 3CIKA 4GN1A 1FGZA 4F7GA 2P0DA 3TCAA 2ROZB 2D10A 2D9YA 2P0HA 2DHKA 1QC6A 5D3WA 1ZC4B 1EF1A 4HAZB 2CY4A 3DXDA 3KRXA 1AQCA 4QJ5B 2D11A 4DX90 1MI1A 1MIZB 2K2UA 1E5WA 3BINA 1FHWA 2KUPA 3A8QA 4GNKB 4K81A 2YS1A 5HE1A 4PNKA 2YT2A 2I1JA 2D9VA 4YONA 1MK7B 3HIEA 2K00A 3ODOA 3PG7A 2I5CA 2K8EA 4CYEA 1V5PA 2RLOA 3A58A 3M1IB 2ELAA 2R2YA 3PVLA 1FHOA 2Z0OA 2DX1A 2RSGA 2VSZA 5DHAB 4L6EA 1WGUA 5DI9B 2RRFA 4HATB 2OQBA 3X23A 4HAYB 2CAYA 3G9WA 5D3YA 1K5DB 4A6FB 3ULBA 4PQ0A 3AJ4A 1XCGA 3SV1A 4A6FA 1KI1B 2EJ8A 3KSYA 4HAVB 3PZDA 4QXAB 5IRSA 2DKPA 1V61A 1U27A 4WVFB 1OY2A 1XX0A 1MPHA 1U2BA 2R0DA 2EC1A 3PEGA 3GYOA 4Y94A 3NSUA 1LB1A 2NBVA 1UPQA 3T06A 2OTXA 2KIGA 4MY6A 1MK9B 4NY0A 1FB8A 2IFSA 3A98B 4HB0B 1T77A 2M14A 4KAXB 1Z87A 1FAOA 4BBKA 2LOXA 5KQ1A 1MIXA 5D3XA 1XKEA 5D3VA 1K5GB 4GZUA 5KQ4A 4HB4B 4WSFA 1RRPB 3A8PA 1X86A 4GXBA 1V88A 5J3QA
chains in the Genus database with same CATH topology
3DXCA 2KCJA 2D9XA 3VOQA 4KHBB 1Y19B 3RCPA 2DFKA 2G35A 2DA0A 2UZSA 3SNHA 2Y8GA 2PZ1A 4H8SA 2XQNM 4DBBA 3U7DA 4CHJA 4KVGB 1WJ1A 2W2XC 5DH9B 5C79A 4F7HA 2UVMA 2BCJA 1BTKA 1DBHA 1UNRA 2I5FA 1GC6A 1NTYA 2CODA 1U5EA 2Z0QA 2H7DA 4Z2NA 3D8EA 5D27A 1BTNA 2DHIA 1BWNA 1UEFA 3ZVRA 5DHFB 1ZM0A 4GPTB 3MPXA 1ZC3B 1IRSA 1OQNA 2HE7A 5KCVA 1U29A 3V5WA 2MDXA 2M38A 4IOYX 5EFXA 1EGXA 2W2WA 4KHOA 4TYZA 3ML4A 2ROVA 4MK0A 3AU4A 5LONB 1P3RA 1M7EA 3PVUA 4NSWA 2K2JA 1H4RA 1DDVA 1LW3A 5HE3A 1Q67A 2J0MA 2GS0A 1XD4A 1RJ2A 2DLWA 2D4QA 2D2QA 2RUKB 3ODWA 4K17A 3TFMA 4IAPA 2EMTA 2YSZA 1FGYA 1X05A 3KY9A 3SUZA 2H7EA 1ISNA 4HDOA 1FHXA 4MT7A 1H10A 1Y5OA 2V76A 1MAIA 2CRFA 1TQZA 2NZ8B 2UZRA 4CHMA 2I1KA 2ELBA 5JP4A 1X1FA 3O96A 1WI1A 2AEHA 1U5DA 1DROA 5HE2A 4GMVA 5C5BB 2QKLA 2L2IA 5C5BA 2R09A 1XR0B 2DTCA 1V5UA 2Y8FA 2RGNB 2VKIA 4D0NB 2LKOA 2Y7BA 3AU5A 4F7UP 1M7RA 1FOEA 4EJNA 1P5TA 1GC7A 1SGHA 1TJ6A 3PP2A 2LULA 5FI0A 4YL8A 5DIFB 3FM8C 3TO1A 4B6HA 5FI1A 3ODXA 2YVCA 4ZRIA 1W1GA 1NTVA 3QWMA 2QKMA 3HW2B 5C16A 2COCA 1X1GA 2P0FA 3TVVA 1EAZA 3KZ1A 4K2PA 3P6AA 4EMOA 3GYPA 3D8FA 1I7AA 1U5GA 2JP2A 3OANA 2D9ZA 2KGXB 1UNQA 1UNPA 1DDMA 3SYXA 1WG7A 1DDWA 1XODA 4KHAA 4ZRJA 1V89A 1W1DA 5GOWB 2MFQA 5JHHA 2VRWB 4HAXB 1ZSQA 2J0JA 1GG3A 4Z2MB 2Q13A 2FJLA 2L1CA 2DN6A 1MKEA 2YS5A 3HK0A 2IYBA 2J59M 3PVWA 1ZVRA 2LYDA 3ZDTA 2YF0A 1UPRA 1P6SA 3TW1A 1WGQA 5J3YA 1J19A 3WA0A 2AL6A 1J0WA 2COFA 5JLJB 1I2HA 2YT0A 2CY5A 3PSCA 1B55A 5J3TA 1TXDA 1WVHA 5CLQB 4HDQA 2YS3A 3LJUX 4EKUA 2DHJA 2DYQA 3U8ZA 1W1HA 2YRYA 1PFJA 2ADZA 3QIJA 3UZTA 3F5RA 3MDBC 3P7ZA 2LG1A 5CLLB 3SO6A 1KZ7A 4XWXA 2N23A 4C0AA 2N0YA 3DXEA 3BJIA 3VIAA 3WYFB 3HQCA 2MWNB 2DX5A 3CXBB 4IFSA 2GCJA 2P8VA 4HAUB 2GJYA 1AWEA 3D8DA 3IVFA 5JHGA 4HAWB 1NU2A 4P7IA 5L81A 1X11A 4ZRKA 1QQGA 2X18A 1SHCA 2W2XD 3KRWA 4A6HA 2GCLA 3QBVB 4HB2B 2E2XA 4GMXB 3FSSA 1WJMA 2LOZA 4A5KA 2YT1A 2HTHB 4DX8A 4HHVA 5C6RA 4A6KA 1OMWA 1NI2A 2J0KA 3FEHA 2RVBB 4HB3B 2D9WA 5HE0A 5LOPB 1KZGA 2RNRB 3ULCA 1BAKA 4WJ7A 1N3HA 2MKRA 2DYNA 2ZPYA 1PMSA 1DYNA 1EVHA 2COAA 2Z0PA 4TKNA 3F0WA 1V5MA 1PLSA 2DKQA 3N7CA 1U5FA 4K2OA 2NMBA 2EMSA 4DXAB 3CIKA 4GN1A 1FGZA 4F7GA 2P0DA 3TCAA 2ROZB 2D10A 2D9YA 2P0HA 2DHKA 1QC6A 5D3WA 1ZC4B 1EF1A 4HAZB 2CY4A 3DXDA 3KRXA 1AQCA 2D11A 4DX90 1MIZB 3BINA 2K2UA 1E5WA 1FHWA 2KUPA 3A8QA 4K81A 2YS1A 5HE1A 4PNKA 2I1JA 2D9VA 4YONA 1MK7B 2K00A 3ODOA 3PG7A 2I5CA 4CYEA 1V5PA 2RLOA 3M1IB 2ELAA 3PVLA 1FHOA 2Z0OA 2DX1A 2RSGA 2VSZA 5DHAB 4L6EA 1WGUA 5DI9B 4HATB 2OQBA 3X23A 4HAYB 2CAYA 3G9WA 5D3YA 1K5DB 4A6FB 3ULBA 4PQ0A 3AJ4A 1XCGA 3SV1A 4A6FA 1KI1B 2EJ8A 3KSYA 4HAVB 3PZDA 2DKPA 1V61A 1U27A 4WVFB 1OY2A 1XX0A 1MPHA 1U2BA 2R0DA 2EC1A 3PEGA 3GYOA 4Y94A 3NSUA 1LB1A 1UPQA 3T06A 2OTXA 4MY6A 1MK9B 4NY0A 1FB8A 2IFSA 3A98B 4HB0B 2M14A 4KAXB 1Z87A 1FAOA 4BBKA 2LOXA 5KQ1A 1MIXA 5D3XA 1XKEA 5D3VA 1K5GB 4GZUA 5KQ4A 4HB4B 4WSFA 1RRPB 3A8PA 1X86A 4GXBA 1V88A 5J3QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DXC A;  2KCJ A;  2D9X A;  3VOQ A;  4KHB B;  1Y19 B;  3RCP A;  2DFK A;  2G35 A;  2DA0 A;  2UZS A;  3SNH A;  2Y8G A;  2PZ1 A;  4H8S A;  2XQN M;  4DBB A;  3U7D A;  4CHJ A;  4KVG B;  1WJ1 A;  2W2X C;  5DH9 B;  5C79 A;  4F7H A;  2UVM A;  2BCJ A;  1BTK A;  1DBH A;  1UNR A;  2I5F A;  1GC6 A;  1NTY A;  2COD A;  1U5E A;  2Z0Q A;  2H7D A;  4Z2N A;  3D8E A;  5D27 A;  1BTN A;  2DHI A;  1BWN A;  1UEF A;  3ZVR A;  5DHF B;  1ZM0 A;  4GPT B;  3MPX A;  1ZC3 B;  1IRS A;  1OQN A;  2HE7 A;  5KCV A;  1U29 A;  3V5W A;  2MDX A;  2M38 A;  4IOY X;  5EFX A;  1EGX A;  2W2W A;  4KHO A;  4TYZ A;  3ML4 A;  2ROV A;  4MK0 A;  3AU4 A;  5LON B;  1P3R A;  1M7E A;  3PVU A;  4NSW A;  2K2J A;  1H4R A;  1DDV A;  1LW3 A;  5HE3 A;  1Q67 A;  2J0M A;  2GS0 A;  1XD4 A;  1RJ2 A;  2DLW A;  2D4Q A;  2D2Q A;  2RUK B;  3ODW A;  4K17 A;  3TFM A;  4IAP A;  2EMT A;  2YSZ A;  1FGY A;  1X05 A;  3KY9 A;  3SUZ A;  2H7E A;  1ISN A;  4HDO A;  1FHX A;  4MT7 A;  1H10 A;  1Y5O A;  2V76 A;  1MAI A;  2CRF A;  1TQZ A;  2NZ8 B;  2UZR A;  4CHM A;  2I1K A;  2ELB A;  5JP4 A;  1X1F A;  3O96 A;  1WI1 A;  2AEH A;  1U5D A;  1DRO A;  5HE2 A;  4GMV A;  5C5B B;  2QKL A;  2L2I A;  5C5B A;  2R09 A;  1XR0 B;  2DTC A;  1V5U A;  2Y8F A;  2RGN B;  2VKI A;  4D0N B;  2LKO A;  2Y7B A;  3AU5 A;  4F7U P;  1M7R A;  1FOE A;  4EJN A;  1P5T A;  1GC7 A;  1SGH A;  1TJ6 A;  3PP2 A;  2LUL A;  5FI0 A;  4YL8 A;  5DIF B;  3FM8 C;  3TO1 A;  4B6H A;  5FI1 A;  3ODX A;  2YVC A;  4ZRI A;  1W1G A;  1NTV A;  3QWM A;  2QKM A;  3HW2 B;  5C16 A;  2COC A;  1X1G A;  2P0F A;  3TVV A;  1EAZ A;  3KZ1 A;  4K2P A;  3P6A A;  4EMO A;  3GYP A;  3D8F A;  1I7A A;  1U5G A;  2JP2 A;  3OAN A;  2D9Z A;  2KGX B;  1UNQ A;  1UNP A;  1DDM A;  3SYX A;  1WG7 A;  1DDW A;  1XOD A;  4KHA A;  4ZRJ A;  1V89 A;  1W1D A;  5GOW B;  2MFQ A;  5JHH A;  2VRW B;  4HAX B;  1ZSQ A;  2J0J A;  1GG3 A;  4Z2M B;  2Q13 A;  2FJL A;  2L1C A;  2DN6 A;  1MKE A;  2YS5 A;  3HK0 A;  2IYB A;  2J59 M;  3PVW A;  1ZVR A;  2LYD A;  3ZDT A;  2YF0 A;  1UPR A;  1P6S A;  3TW1 A;  1WGQ A;  5J3Y A;  1J19 A;  3WA0 A;  2AL6 A;  1J0W A;  2COF A;  5JLJ B;  1I2H A;  2YT0 A;  2CY5 A;  3PSC A;  1B55 A;  5J3T A;  1TXD A;  1WVH A;  5CLQ B;  4HDQ A;  2YS3 A;  3LJU X;  4EKU A;  2DHJ A;  2DYQ A;  3U8Z A;  1W1H A;  2YRY A;  1PFJ A;  2ADZ A;  3QIJ A;  3UZT A;  3F5R A;  3MDB C;  3P7Z A;  2LG1 A;  5CLL B;  3SO6 A;  1KZ7 A;  4XWX A;  2N23 A;  4C0A A;  2N0Y A;  3DXE A;  3BJI A;  3VIA A;  3WYF B;  3HQC A;  2MWN B;  2DX5 A;  3CXB B;  4IFS A;  2GCJ A;  2P8V A;  4HAU B;  2GJY A;  1AWE A;  3D8D A;  3IVF A;  5JHG A;  4HAW B;  1NU2 A;  4P7I A;  5L81 A;  1X11 A;  4ZRK A;  1QQG A;  2X18 A;  1SHC A;  2W2X D;  3KRW A;  4A6H A;  2GCL A;  3QBV B;  4HB2 B;  2E2X A;  4GMX B;  3FSS A;  1WJM A;  2LOZ A;  4A5K A;  2YT1 A;  2HTH B;  4DX8 A;  4HHV A;  5C6R A;  4A6K A;  1OMW A;  1NI2 A;  2J0K A;  3FEH A;  2RVB B;  4HB3 B;  2D9W A;  5HE0 A;  5LOP B;  1KZG A;  2RNR B;  3ULC A;  1BAK A;  4WJ7 A;  1N3H A;  2MKR A;  2DYN A;  2ZPY A;  1PMS A;  1DYN A;  1EVH A;  2COA A;  2Z0P A;  4TKN A;  3F0W A;  1V5M A;  1PLS A;  2DKQ A;  3N7C A;  1U5F A;  4K2O A;  2NMB A;  2EMS A;  4DXA B;  3CIK A;  4GN1 A;  1FGZ A;  4F7G A;  2P0D A;  3TCA A;  2ROZ B;  2D10 A;  2D9Y A;  2P0H A;  2DHK A;  1QC6 A;  5D3W A;  1ZC4 B;  1EF1 A;  4HAZ B;  2CY4 A;  3DXD A;  3KRX A;  1AQC A;  2D11 A;  4DX9 0;  1MIZ B;  3BIN A;  2K2U A;  1E5W A;  1FHW A;  2KUP A;  3A8Q A;  4K81 A;  2YS1 A;  5HE1 A;  4PNK A;  2I1J A;  2D9V A;  4YON A;  1MK7 B;  2K00 A;  3ODO A;  3PG7 A;  2I5C A;  4CYE A;  1V5P A;  2RLO A;  3M1I B;  2ELA A;  3PVL A;  1FHO A;  2Z0O A;  2DX1 A;  2RSG A;  2VSZ A;  5DHA B;  4L6E A;  1WGU A;  5DI9 B;  4HAT B;  2OQB A;  3X23 A;  4HAY B;  2CAY A;  3G9W A;  5D3Y A;  1K5D B;  4A6F B;  3ULB A;  4PQ0 A;  3AJ4 A;  1XCG A;  3SV1 A;  4A6F A;  1KI1 B;  2EJ8 A;  3KSY A;  4HAV B;  3PZD A;  2DKP A;  1V61 A;  1U27 A;  4WVF B;  1OY2 A;  1XX0 A;  1MPH A;  1U2B A;  2R0D A;  2EC1 A;  3PEG A;  3GYO A;  4Y94 A;  3NSU A;  1LB1 A;  1UPQ A;  3T06 A;  2OTX A;  4MY6 A;  1MK9 B;  4NY0 A;  1FB8 A;  2IFS A;  3A98 B;  4HB0 B;  2M14 A;  4KAX B;  1Z87 A;  1FAO A;  4BBK A;  2LOX A;  5KQ1 A;  1MIX A;  5D3X A;  1XKE A;  5D3V A;  1K5G B;  4GZU A;  5KQ4 A;  4HB4 B;  4WSF A;  1RRP B;  3A8P A;  1X86 A;  4GXB A;  1V88 A;  5J3Q A; 
#chains in the Genus database with same CATH topology
 3DXC A;  2KCJ A;  2D9X A;  3VOQ A;  4KHB B;  1Y19 B;  3RCP A;  2DFK A;  4KHB A;  3NWD A;  2G35 A;  2DA0 A;  2UZS A;  4QJ3 B;  3SNH A;  2Y8G A;  2PZ1 A;  4H8S A;  2XQN M;  4DBB A;  3U7D A;  4CHJ A;  5LG4 B;  4KVG B;  1WJ1 A;  2W2X C;  5DH9 B;  5C79 A;  4F7H A;  2UVM A;  2BCJ A;  1BTK A;  1DBH A;  5I2S A;  1UNR A;  2I5F A;  1GC6 A;  1NTY A;  2COD A;  1U5E A;  2Z0Q A;  2H7D A;  4Z2N A;  3D8E A;  5D27 A;  4DIX A;  1BTN A;  2DHI A;  1BWN A;  1UEF A;  3ZVR A;  5DHF B;  1ZM0 A;  4GPT B;  3MPX A;  1ZC3 B;  1IRS A;  1OQN A;  2ZKM X;  2HE7 A;  5KCV A;  1U29 A;  3V5W A;  2MDX A;  2M38 A;  4IOY X;  5EFX A;  1EGX A;  2W2W A;  4KHO A;  4GOU A;  4TYZ A;  4CSQ A;  3ML4 A;  3HSA A;  2ROV A;  4MK0 A;  3AU4 A;  5LON B;  1P3R A;  1M7E A;  3PVU A;  4NSW A;  2K2J A;  1H4R A;  1DDV A;  1LW3 A;  5HE3 A;  1Q67 A;  2J0M A;  2GS0 A;  1XD4 A;  1RJ2 A;  2DLW A;  2D4Q A;  2D2Q A;  2RUK B;  3ODW A;  4K17 A;  5M4Y B;  1ZYI A;  3TFM A;  4IAP A;  2EMT A;  2YSZ A;  1FGY A;  1X05 A;  3KY9 A;  3SUZ A;  2H7E A;  1ISN A;  4HDO A;  1FHX A;  4MT7 A;  1H10 A;  1Y5O A;  2V76 A;  1MAI A;  2CRF A;  3NWA A;  1TQZ A;  2NZ8 B;  2UZR A;  4CHM A;  2I1K A;  2ELB A;  2GUM A;  5JP4 A;  1X1F A;  3O96 A;  1WI1 A;  2AEH A;  1U5D A;  1DRO A;  5HE2 A;  4GMV A;  5C5B B;  2QKL A;  2L2I A;  5C5B A;  2R09 A;  1XR0 B;  2DTC A;  2KUQ A;  1V5U A;  2Y8F A;  2RGN B;  2VKI A;  4D0N B;  2LKO A;  2Y7B A;  3AU5 A;  4F7U P;  1M7R A;  1FOE A;  4EJN A;  1P5T A;  1GC7 A;  1SGH A;  1TJ6 A;  3PP2 A;  2LUL A;  5FI0 A;  4YL8 A;  5DIF B;  3FM8 C;  3TO1 A;  4B6H A;  5FI1 A;  3ODX A;  2YVC A;  4ZRI A;  1W1G A;  1NTV A;  3QWM A;  2QKM A;  3HW2 B;  5C16 A;  2COC A;  1X1G A;  2P0F A;  3TVV A;  1EAZ A;  3KZ1 A;  2Z14 A;  4K2P A;  3P6A A;  4EMO A;  3GYP A;  3D8F A;  1I7A A;  1U5G A;  2JP2 A;  3U12 A;  3OAN A;  2D9Z A;  2KGX B;  1UNQ A;  1UNP A;  1DDM A;  3SYX A;  1WG7 A;  2KR0 A;  1DDW A;  3B77 A;  1XOD A;  3OHM B;  4KHA A;  4ZRJ A;  1V89 A;  3FVC A;  1W1D A;  2KIE A;  5GOW B;  2MFQ A;  2Z59 A;  5JHH A;  2VRW B;  4HAX B;  1ZSQ A;  2J0J A;  1GG3 A;  5I2M A;  2Q13 A;  4Z2M B;  2FJL A;  2FJU B;  2L1C A;  2DN6 A;  1MKE A;  2YS5 A;  3HK0 A;  2IYB A;  2J59 M;  3DCX A;  3PVW A;  1ZVR A;  2LYD A;  2Z4D A;  3ZDT A;  2YF0 A;  1UPR A;  1P6S A;  3TW1 A;  1WGQ A;  5J3Y A;  1J19 A;  3NW8 A;  3WA0 A;  2AL6 A;  1J0W A;  2COF A;  5JLJ B;  1I2H A;  2YT0 A;  2CY5 A;  3PSC A;  1B55 A;  5J3T A;  1TXD A;  1WVH A;  5CLQ B;  4HDQ A;  2YS3 A;  3LJU X;  4EKU A;  2DHJ A;  2DYQ A;  3U8Z A;  1W1H A;  2YRY A;  1PFJ A;  2ADZ A;  3QIJ A;  4OT1 A;  3UZT A;  3F5R A;  3MDB C;  3P7Z A;  2LG1 A;  5CLL B;  3SO6 A;  1KZ7 A;  4XWX A;  2N23 A;  4C0A A;  2N0Y A;  3DXE A;  3BJI A;  3VIA A;  2K49 A;  3WYF B;  3HQC A;  2MWN B;  2DX5 A;  3CXB B;  4IFS A;  2GCJ A;  2P8V A;  4HAU B;  2GJY A;  1AWE A;  3D8D A;  3IVF A;  5JHG A;  4HAW B;  1NU2 A;  4P7I A;  5L81 A;  1X11 A;  4ZRK A;  1QQG A;  2X18 A;  4OSN A;  1SHC A;  2W2X D;  3KRW A;  4A6H A;  2GCL A;  3QBV B;  4HB2 B;  2E2X A;  4GMX B;  3FSS A;  1WJM A;  2LOZ A;  4A5K A;  2YT1 A;  2HTH B;  4DX8 A;  4HHV A;  5C6R A;  4A6K A;  1OMW A;  1NI2 A;  4HSI A;  2J0K A;  4QJ4 B;  3FEH A;  2RVB B;  4HB3 B;  2D9W A;  5HE0 A;  5LOP B;  1KZG A;  2RNR B;  3ULC A;  1BAK A;  4WJ7 A;  1N3H A;  2MKR A;  4L1R A;  2DYN A;  2ZPY A;  1PMS A;  1DYN A;  1EVH A;  2COA A;  4D6W A;  2Z0P A;  4TKN A;  3F0W A;  1V5M A;  1PLS A;  2DKQ A;  3NWF A;  3N7C A;  1U5F A;  4K2O A;  2Z13 A;  2NMB A;  2EMS A;  4DXA B;  3CIK A;  4GN1 A;  1FGZ A;  4F7G A;  2P0D A;  3TCA A;  2ROZ B;  2D10 A;  2D9Y A;  2P0H A;  2DHK A;  1QC6 A;  5D3W A;  1ZC4 B;  1EF1 A;  4HAZ B;  2CY4 A;  3DXD A;  3KRX A;  1AQC A;  4QJ5 B;  2D11 A;  4DX9 0;  1MI1 A;  1MIZ B;  2K2U A;  1E5W A;  3BIN A;  1FHW A;  2KUP A;  3A8Q A;  4GNK B;  4K81 A;  2YS1 A;  5HE1 A;  4PNK A;  2YT2 A;  2I1J A;  2D9V A;  4YON A;  1MK7 B;  3HIE A;  2K00 A;  3ODO A;  3PG7 A;  2I5C A;  2K8E A;  4CYE A;  1V5P A;  2RLO A;  3A58 A;  3M1I B;  2ELA A;  2R2Y A;  3PVL A;  1FHO A;  2Z0O A;  2DX1 A;  2RSG A;  2VSZ A;  5DHA B;  4L6E A;  1WGU A;  5DI9 B;  2RRF A;  4HAT B;  2OQB A;  3X23 A;  4HAY B;  2CAY A;  3G9W A;  5D3Y A;  1K5D B;  4A6F B;  3ULB A;  4PQ0 A;  3AJ4 A;  1XCG A;  3SV1 A;  4A6F A;  1KI1 B;  2EJ8 A;  3KSY A;  4HAV B;  3PZD A;  4QXA B;  5IRS A;  2DKP A;  1V61 A;  1U27 A;  4WVF B;  1OY2 A;  1XX0 A;  1MPH A;  1U2B A;  2R0D A;  2EC1 A;  3PEG A;  3GYO A;  4Y94 A;  3NSU A;  1LB1 A;  2NBV A;  1UPQ A;  3T06 A;  2OTX A;  2KIG A;  4MY6 A;  1MK9 B;  4NY0 A;  1FB8 A;  2IFS A;  3A98 B;  4HB0 B;  1T77 A;  2M14 A;  4KAX B;  1Z87 A;  1FAO A;  4BBK A;  2LOX A;  5KQ1 A;  1MIX A;  5D3X A;  1XKE A;  5D3V A;  1K5G B;  4GZU A;  5KQ4 A;  4HB4 B;  4WSF A;  1RRP B;  3A8P A;  1X86 A;  4GXB A;  1V88 A;  5J3Q A; 
#chains in the Genus database with same CATH homology
 3DXC A;  2KCJ A;  2D9X A;  3VOQ A;  4KHB B;  1Y19 B;  3RCP A;  2DFK A;  2G35 A;  2DA0 A;  2UZS A;  3SNH A;  2Y8G A;  2PZ1 A;  4H8S A;  2XQN M;  4DBB A;  3U7D A;  4CHJ A;  4KVG B;  1WJ1 A;  2W2X C;  5DH9 B;  5C79 A;  4F7H A;  2UVM A;  2BCJ A;  1BTK A;  1DBH A;  1UNR A;  2I5F A;  1GC6 A;  1NTY A;  2COD A;  1U5E A;  2Z0Q A;  2H7D A;  4Z2N A;  3D8E A;  5D27 A;  1BTN A;  2DHI A;  1BWN A;  1UEF A;  3ZVR A;  5DHF B;  1ZM0 A;  4GPT B;  3MPX A;  1ZC3 B;  1IRS A;  1OQN A;  2HE7 A;  5KCV A;  1U29 A;  3V5W A;  2MDX A;  2M38 A;  4IOY X;  5EFX A;  1EGX A;  2W2W A;  4KHO A;  4TYZ A;  3ML4 A;  2ROV A;  4MK0 A;  3AU4 A;  5LON B;  1P3R A;  1M7E A;  3PVU A;  4NSW A;  2K2J A;  1H4R A;  1DDV A;  1LW3 A;  5HE3 A;  1Q67 A;  2J0M A;  2GS0 A;  1XD4 A;  1RJ2 A;  2DLW A;  2D4Q A;  2D2Q A;  2RUK B;  3ODW A;  4K17 A;  3TFM A;  4IAP A;  2EMT A;  2YSZ A;  1FGY A;  1X05 A;  3KY9 A;  3SUZ A;  2H7E A;  1ISN A;  4HDO A;  1FHX A;  4MT7 A;  1H10 A;  1Y5O A;  2V76 A;  1MAI A;  2CRF A;  1TQZ A;  2NZ8 B;  2UZR A;  4CHM A;  2I1K A;  2ELB A;  5JP4 A;  1X1F A;  3O96 A;  1WI1 A;  2AEH A;  1U5D A;  1DRO A;  5HE2 A;  4GMV A;  5C5B B;  2QKL A;  2L2I A;  5C5B A;  2R09 A;  1XR0 B;  2DTC A;  1V5U A;  2Y8F A;  2RGN B;  2VKI A;  4D0N B;  2LKO A;  2Y7B A;  3AU5 A;  4F7U P;  1M7R A;  1FOE A;  4EJN A;  1P5T A;  1GC7 A;  1SGH A;  1TJ6 A;  3PP2 A;  2LUL A;  5FI0 A;  4YL8 A;  5DIF B;  3FM8 C;  3TO1 A;  4B6H A;  5FI1 A;  3ODX A;  2YVC A;  4ZRI A;  1W1G A;  1NTV A;  3QWM A;  2QKM A;  3HW2 B;  5C16 A;  2COC A;  1X1G A;  2P0F A;  3TVV A;  1EAZ A;  3KZ1 A;  4K2P A;  3P6A A;  4EMO A;  3GYP A;  3D8F A;  1I7A A;  1U5G A;  2JP2 A;  3OAN A;  2D9Z A;  2KGX B;  1UNQ A;  1UNP A;  1DDM A;  3SYX A;  1WG7 A;  1DDW A;  1XOD A;  4KHA A;  4ZRJ A;  1V89 A;  1W1D A;  5GOW B;  2MFQ A;  5JHH A;  2VRW B;  4HAX B;  1ZSQ A;  2J0J A;  1GG3 A;  4Z2M B;  2Q13 A;  2FJL A;  2L1C A;  2DN6 A;  1MKE A;  2YS5 A;  3HK0 A;  2IYB A;  2J59 M;  3PVW A;  1ZVR A;  2LYD A;  3ZDT A;  2YF0 A;  1UPR A;  1P6S A;  3TW1 A;  1WGQ A;  5J3Y A;  1J19 A;  3WA0 A;  2AL6 A;  1J0W A;  2COF A;  5JLJ B;  1I2H A;  2YT0 A;  2CY5 A;  3PSC A;  1B55 A;  5J3T A;  1TXD A;  1WVH A;  5CLQ B;  4HDQ A;  2YS3 A;  3LJU X;  4EKU A;  2DHJ A;  2DYQ A;  3U8Z A;  1W1H A;  2YRY A;  1PFJ A;  2ADZ A;  3QIJ A;  3UZT A;  3F5R A;  3MDB C;  3P7Z A;  2LG1 A;  5CLL B;  3SO6 A;  1KZ7 A;  4XWX A;  2N23 A;  4C0A A;  2N0Y A;  3DXE A;  3BJI A;  3VIA A;  3WYF B;  3HQC A;  2MWN B;  2DX5 A;  3CXB B;  4IFS A;  2GCJ A;  2P8V A;  4HAU B;  2GJY A;  1AWE A;  3D8D A;  3IVF A;  5JHG A;  4HAW B;  1NU2 A;  4P7I A;  5L81 A;  1X11 A;  4ZRK A;  1QQG A;  2X18 A;  1SHC A;  2W2X D;  3KRW A;  4A6H A;  2GCL A;  3QBV B;  4HB2 B;  2E2X A;  4GMX B;  3FSS A;  1WJM A;  2LOZ A;  4A5K A;  2YT1 A;  2HTH B;  4DX8 A;  4HHV A;  5C6R A;  4A6K A;  1OMW A;  1NI2 A;  2J0K A;  3FEH A;  2RVB B;  4HB3 B;  2D9W A;  5HE0 A;  5LOP B;  1KZG A;  2RNR B;  3ULC A;  1BAK A;  4WJ7 A;  1N3H A;  2MKR A;  2DYN A;  2ZPY A;  1PMS A;  1DYN A;  1EVH A;  2COA A;  2Z0P A;  4TKN A;  3F0W A;  1V5M A;  1PLS A;  2DKQ A;  3N7C A;  1U5F A;  4K2O A;  2NMB A;  2EMS A;  4DXA B;  3CIK A;  4GN1 A;  1FGZ A;  4F7G A;  2P0D A;  3TCA A;  2ROZ B;  2D10 A;  2D9Y A;  2P0H A;  2DHK A;  1QC6 A;  5D3W A;  1ZC4 B;  1EF1 A;  4HAZ B;  2CY4 A;  3DXD A;  3KRX A;  1AQC A;  2D11 A;  4DX9 0;  1MIZ B;  3BIN A;  2K2U A;  1E5W A;  1FHW A;  2KUP A;  3A8Q A;  4K81 A;  2YS1 A;  5HE1 A;  4PNK A;  2I1J A;  2D9V A;  4YON A;  1MK7 B;  2K00 A;  3ODO A;  3PG7 A;  2I5C A;  4CYE A;  1V5P A;  2RLO A;  3M1I B;  2ELA A;  3PVL A;  1FHO A;  2Z0O A;  2DX1 A;  2RSG A;  2VSZ A;  5DHA B;  4L6E A;  1WGU A;  5DI9 B;  4HAT B;  2OQB A;  3X23 A;  4HAY B;  2CAY A;  3G9W A;  5D3Y A;  1K5D B;  4A6F B;  3ULB A;  4PQ0 A;  3AJ4 A;  1XCG A;  3SV1 A;  4A6F A;  1KI1 B;  2EJ8 A;  3KSY A;  4HAV B;  3PZD A;  2DKP A;  1V61 A;  1U27 A;  4WVF B;  1OY2 A;  1XX0 A;  1MPH A;  1U2B A;  2R0D A;  2EC1 A;  3PEG A;  3GYO A;  4Y94 A;  3NSU A;  1LB1 A;  1UPQ A;  3T06 A;  2OTX A;  4MY6 A;  1MK9 B;  4NY0 A;  1FB8 A;  2IFS A;  3A98 B;  4HB0 B;  2M14 A;  4KAX B;  1Z87 A;  1FAO A;  4BBK A;  2LOX A;  5KQ1 A;  1MIX A;  5D3X A;  1XKE A;  5D3V A;  1K5G B;  4GZU A;  5KQ4 A;  4HB4 B;  4WSF A;  1RRP B;  3A8P A;  1X86 A;  4GXB A;  1V88 A;  5J3Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...