1FHOA

Solution structure of the ph domain from the c. elegans muscle protein unc-89
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
119
structure length
119
Chain Sequence
MGDTGKLGRIIRHDAFQVWEGDEPPKLRYVFLFRNKIMFTEQDASTSPPSYTHYSSIRLDKYNIRQHTTDEDTIVLQPQEPGLPSFRIKPKDFETSEYVRKAWLRDIAEEQEKYAAERD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UNC-89
publication title Structure of a PH domain from the C. elegans muscle protein UNC-89 suggests a novel function.
pubmed doi rcsb
source organism Caenorhabditis elegans
molecule tags Signaling protein
total genus 15
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2000-08-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 1fhoA00
2K2JA 4GMXB 4NSWA 3X23A 1W1GA 5JHHA 1U27A 2NZ8B 1P5TA 2G35A 2EMTA 4K17A 1ZC4B 3OANA 1ISNA 2I5FA 1UNPA 5CLQB 3SNHA 4Z2NA 1X1FA 1K5GB 3D8DA 3TO1A 3HW2B 2QKLA 2K00A 1M7EA 4GXBA 4ZRKA 3A8QA 2DYNA 3QIJA 2D10A 3VOQA 2P8VA 2LULA 3U8ZA 1WGQA 1TJ6A 1V5UA 2DFKA 4GN1A 1U29A 1V61A 1PFJA 5J3YA 1X11A 2CAYA 4HDQA 1FHWA 4YONA 1NTVA 3CXBB 1U5GA 1QQGA 4HB3B 1DROA 4HB0B 5L81A 5EFXA 2RSGA 1IRSA 1X1GA 2COFA 5DH9B 3NSUA 1M7RA 4BBKA 1LW3A 1PMSA 1V5PA 2DTCA 2YRYA 4NY0A 4Y94A 1BAKA 1U5FA 1GG3A 3LJUX 5KQ1A 2LYDA 1FHXA 1NTYA 1V89A 1XD4A 3N7CA 4MK0A 2DA0A 2K2UA 4HAUB 4GZUA 4A6FA 1K5DB 2P0DA 4A6KA 1BWNA 5KCVA 2DHKA 2DX1A 4KAXB 3U7DA 1V88A 2XQNM 2W2XD 3PVWA 1XKEA 5KQ4A 1X86A 1MIXA 4F7GA 4GPTB 2J0JA 1H10A 2DYQA 2Y8FA 4A6FB 4H8SA 2W2WA 1I2HA 2CODA 1TQZA 2YS1A 2DKQA 4MY6A 2ADZA 2D2QA 4WJ7A 1ZVRA 4ZRJA 2RVBB 5LOPB 4KHBB 4A6HA 2J59M 2KUPA 2HE7A 2M38A 1UEFA 3M1IB 1UNRA 3CIKA 1MK7B 4CHMA 1XODA 2LOZA 2R0DA 1NI2A 4D0NB 4IFSA 2MKRA 1EVHA 2PZ1A 3PZDA 1DBHA 2I1KA 3QWMA 2COCA 2GS0A 4ZRIA 1GC6A 2H7EA 1Y5OA 5C16A 2AL6A 5GOWB 2YF0A 1W1DA 2YS3A 2DLWA 4A5KA 2D9ZA 5DI9B 1B55A 3A98B 3FM8C 1DDWA 4HB4B 4KHOA 4F7HA 4C0AA 3D8EA 5JHGA 2D11A 3KRXA 2D4QA 2UZRA 2RLOA 3ULCA 2EJ8A 1WGUA 3V5WA 3PG7A 2N23A 2P0HA 4TYZA 5LONB 2R09A 1GC7A 4CHJA 1UPQA 2N0YA 1TXDA 2ROZB 3PVUA 1Z87A 1OY2A 1V5MA 1WVHA 1Y19B 1RRPB 2M14A 1FB8A 2MWNB 2DHJA 3WA0A 4B6HA 3BINA 2UVMA 1MPHA 4YL8A 1U5DA 1UNQA 2ELAA 3SUZA 2EC1A 4DXAB 3BJIA 5C5BA 5DHAB 1U2BA 2Y8GA 2DN6A 3VIAA 3ML4A 2LKOA 5D3WA 4L6EA 3F0WA 1LB1A 4HHVA 5J3QA 3ODXA 4HAVB 4KHAA 3FEHA 3DXDA 4HAZB 3G9WA 1AWEA 3KZ1A 1EAZA 1MK9B 4K2PA 1E5WA 2X18A 3ZVRA 1U5EA 1FGZA 5C5BB 2J0KA 3ULBA 3GYPA 3GYOA 5JP4A 3O96A 4F7UP 4PQ0A 2W2XC 4EMOA 3TCAA 2KGXB 1ZC3B 3F5RA 3FSSA 4HAYB 4DX8A 4EKUA 1ZM0A 3P7ZA 2H7DA 4TKNA 2IYBA 2EMSA 1H4RA 1KZ7A 2RNRB 2D9WA 5HE2A 1AQCA 1FGYA 4XWXA 5FI1A 5CLLB 3MPXA 2FJLA 2GCJA 4CYEA 1KZGA 2Q13A 5HE0A 3HQCA 3KRWA 3ZDTA 2P0FA 2YT1A 4HATB 2YS5A 1MKEA 1RJ2A 1BTNA 2ZPYA 3AU5A 2E2XA 4DBBA 3TVVA 1DDMA 1N3HA 2DKPA 1OQNA 3PSCA 1WG7A 4HDOA 4IOYX 1W1HA 2YSZA 3AU4A 2AEHA 4IAPA 2LOXA 1PLSA 2OTXA 2Z0OA 3TW1A 2I1JA 2I5CA 3A8PA 2IFSA 2CRFA 1EF1A 2D9YA 1NU2A 3MDBC 2D9XA 3SV1A 3WYFB 4EJNA 1EGXA 1DDVA 5C6RA 5C79A 3IVFA 2MDXA 4MT7A 2GCLA 5D3XA 2VRWB 2Z0QA 4K2OA 2KCJA 1P6SA 1WJMA 2UZSA 5DIFB 2VKIA 4P7IA 1I7AA 2YT0A 2OQBA 3HK0A 1XCGA 5FI0A 5JLJB 4KVGB 1MAIA 2D9VA 3SO6A 3RCPA 1WI1A 2L2IA 2RGNB 1J19A 1SGHA 2BCJA 4Z2MB 3PEGA 3ODOA 2LG1A 1J0WA 1XR0B 2Z0PA 1DYNA 1P3RA 1WJ1A 1XX0A 3D8FA 2CY4A 3UZTA 2V76A 2Y7BA 2GJYA 2COAA 4GMVA 3DXEA 3T06A 4WSFA 1FHOA 2QKMA 4DX90 4K81A 2DHIA 5D3VA 2JP2A 2J0MA 4HB2B 3ODWA 5HE1A 5D3YA 2MFQA 2YVCA 1SHCA 3QBVB 1X05A 1Q67A 1ZSQA 2NMBA 1UPRA 1MIZB 3DXCA 2VSZA 1OMWA 3PVLA 1FAOA 1FOEA 5D27A 4PNKA 2CY5A 3KSYA 2ROVA 2HTHB 4HAXB 4HAWB 2L1CA 2RUKB 3TFMA 5HE3A 5DHFB 3SYXA 1KI1B 3PP2A 2DX5A 3KY9A 3P6AA 1QC6A 1BTKA 3AJ4A 2ELBA 5J3TA 4WVFB
chains in the Genus database with same CATH superfamily
2K2JA 3DCXA 4GMXB 4NSWA 3X23A 1W1GA 5JHHA 1U27A 2NZ8B 1P5TA 2G35A 2EMTA 2K8EA 4K17A 1ZC4B 3OANA 1ISNA 2I5FA 1UNPA 5CLQB 3SNHA 4Z2NA 1X1FA 1K5GB 3D8DA 3TO1A 3HW2B 2QKLA 2K00A 4QJ4B 1M7EA 4GXBA 4ZRKA 3A8QA 2DYNA 4L1RA 3QIJA 2D10A 3VOQA 2P8VA 2LULA 3U8ZA 1WGQA 1TJ6A 1V5UA 2DFKA 4GN1A 1U29A 1V61A 1PFJA 5J3YA 1X11A 2CAYA 4HDQA 1FHWA 4YONA 1NTVA 2Z4DA 3CXBB 1U5GA 1QQGA 4HB3B 1DROA 4HB0B 5L81A 5EFXA 2RSGA 1IRSA 1X1GA 2COFA 5DH9B 3NSUA 1M7RA 4BBKA 1LW3A 1PMSA 1V5PA 2DTCA 2YRYA 4NY0A 4Y94A 1BAKA 1U5FA 1GG3A 3LJUX 5KQ1A 2LYDA 1FHXA 1NTYA 1V89A 1XD4A 3N7CA 4MK0A 2DA0A 2K2UA 2KR0A 4GZUA 4HAUB 4A6FA 1K5DB 2P0DA 4A6KA 1BWNA 5KCVA 2DHKA 2DX1A 4KAXB 3U7DA 1V88A 2XQNM 2W2XD 2RRFA 3PVWA 1XKEA 5KQ4A 1X86A 1MIXA 3NWDA 3HIEA 4F7GA 4GPTB 2J0JA 1H10A 2KUQA 2DYQA 2Y8FA 4A6FB 4H8SA 2W2WA 1I2HA 2CODA 1TQZA 2YS1A 2DKQA 4MY6A 2ADZA 2D2QA 4WJ7A 1ZVRA 4ZRJA 2RVBB 5LOPB 4KHBB 4A6HA 2J59M 2KUPA 2NBVA 2HE7A 2M38A 1UEFA 3M1IB 1MI1A 1UNRA 4GNKB 3CIKA 1MK7B 4CHMA 1XODA 2LOZA 2R0DA 4OT1A 1NI2A 4D0NB 4IFSA 2MKRA 1EVHA 2PZ1A 3PZDA 1DBHA 2I1KA 3QWMA 2COCA 2GS0A 4ZRIA 1GC6A 4HSIA 2H7EA 1Y5OA 5C16A 2AL6A 5GOWB 2YF0A 5I2MA 1W1DA 2YS3A 2DLWA 4A5KA 2D9ZA 5DI9B 1B55A 3A98B 3FM8C 1DDWA 4HB4B 4KHOA 4F7HA 4C0AA 3D8EA 5JHGA 2D11A 3KRXA 2D4QA 2UZRA 2RLOA 2R2YA 3ULCA 2EJ8A 1WGUA 3V5WA 3PG7A 2N23A 2P0HA 3B77A 4TYZA 5LONB 2R09A 1GC7A 4CHJA 1UPQA 2N0YA 1TXDA 2ROZB 3PVUA 5LG4B 1Z87A 1OY2A 1V5MA 2FJUB 1WVHA 1Y19B 1RRPB 2M14A 5IRSA 1FB8A 2MWNB 2DHJA 3WA0A 4B6HA 3BINA 2UVMA 1MPHA 4YL8A 1U5DA 1UNQA 2YT2A 2ELAA 3SUZA 2EC1A 4DXAB 3BJIA 4D6WA 5C5BA 4QJ5B 5DHAB 1U2BA 2Y8GA 2DN6A 3VIAA 3ML4A 2LKOA 5D3WA 4L6EA 3F0WA 1LB1A 4HHVA 5J3QA 3ODXA 4HAVB 4KHAA 3FEHA 3DXDA 4HAZB 3G9WA 1AWEA 4KHBA 3KZ1A 1EAZA 1MK9B 4K2PA 1E5WA 2X18A 3ZVRA 1U5EA 1FGZA 5C5BB 2J0KA 3ULBA 3GYPA 4CSQA 3GYOA 5JP4A 3O96A 4F7UP 4PQ0A 2W2XC 4EMOA 3TCAA 2KGXB 3NWFA 1ZC3B 3F5RA 3FSSA 4HAYB 4DX8A 4EKUA 1ZM0A 3P7ZA 2H7DA 4TKNA 2IYBA 2EMSA 1H4RA 1KZ7A 2RNRB 2D9WA 4QXAB 4QJ3B 5HE2A 1AQCA 1FGYA 4XWXA 3HSAA 5FI1A 2ZKMX 5CLLB 3MPXA 2FJLA 2GCJA 4CYEA 3A58A 1KZGA 2Q13A 5HE0A 3HQCA 3KRWA 3ZDTA 2P0FA 2YT1A 4HATB 2YS5A 1MKEA 1RJ2A 1BTNA 2ZPYA 3AU5A 1T77A 5I2SA 2E2XA 4DBBA 3TVVA 1DDMA 1N3HA 2DKPA 1OQNA 3PSCA 1WG7A 2K49A 4HDOA 4IOYX 1W1HA 2YSZA 3AU4A 2AEHA 4IAPA 2LOXA 1PLSA 2Z14A 2OTXA 5M4YB 2Z0OA 3TW1A 2I1JA 2I5CA 3A8PA 2IFSA 4OSNA 2CRFA 1EF1A 2D9YA 1NU2A 3MDBC 3NW8A 2D9XA 3SV1A 3WYFB 4EJNA 1EGXA 1DDVA 5C6RA 5C79A 3IVFA 2MDXA 4MT7A 2GCLA 5D3XA 2VRWB 2Z0QA 4K2OA 2KCJA 1P6SA 1WJMA 2UZSA 5DIFB 2VKIA 4P7IA 1I7AA 2YT0A 2OQBA 3HK0A 1XCGA 5FI0A 2GUMA 4KVGB 5JLJB 1MAIA 2D9VA 2KIEA 3SO6A 3RCPA 1WI1A 2L2IA 2RGNB 4GOUA 1J19A 1SGHA 2BCJA 4Z2MB 3PEGA 3ODOA 2LG1A 1J0WA 1XR0B 2Z0PA 1DYNA 1P3RA 1WJ1A 1XX0A 3D8FA 2CY4A 3UZTA 2V76A 2Z13A 2Y7BA 2GJYA 2COAA 4GMVA 3DXEA 2Z59A 2KIGA 3OHMB 3T06A 4WSFA 1FHOA 3U12A 2QKMA 4DX90 4K81A 2DHIA 5D3VA 2JP2A 2J0MA 4HB2B 3ODWA 1ZYIA 5HE1A 5D3YA 2MFQA 2YVCA 4DIXA 1SHCA 3FVCA 3QBVB 1X05A 1Q67A 1ZSQA 2NMBA 1UPRA 1MIZB 3DXCA 2VSZA 1OMWA 3PVLA 1FAOA 1FOEA 5D27A 4PNKA 2CY5A 3KSYA 2ROVA 2HTHB 4HAXB 4HAWB 2L1CA 2RUKB 3TFMA 3NWAA 5HE3A 5DHFB 3SYXA 1KI1B 3PP2A 2DX5A 3KY9A 3P6AA 1QC6A 1BTKA 3AJ4A 2ELBA 5J3TA 4WVFB
chains in the Genus database with same CATH topology
2K2JA 4GMXB 4NSWA 3X23A 1W1GA 5JHHA 1U27A 2NZ8B 1P5TA 2G35A 2EMTA 4K17A 1ZC4B 3OANA 1ISNA 2I5FA 1UNPA 5CLQB 3SNHA 4Z2NA 1X1FA 1K5GB 3D8DA 3TO1A 3HW2B 2QKLA 2K00A 1M7EA 4GXBA 4ZRKA 3A8QA 2DYNA 3QIJA 2D10A 3VOQA 2P8VA 2LULA 3U8ZA 1WGQA 1TJ6A 1V5UA 2DFKA 4GN1A 1U29A 1V61A 1PFJA 5J3YA 1X11A 2CAYA 4HDQA 1FHWA 4YONA 1NTVA 3CXBB 1U5GA 1QQGA 4HB3B 1DROA 4HB0B 5L81A 5EFXA 2RSGA 1IRSA 1X1GA 2COFA 5DH9B 3NSUA 1M7RA 4BBKA 1LW3A 1PMSA 1V5PA 2DTCA 2YRYA 4NY0A 4Y94A 1BAKA 1U5FA 1GG3A 3LJUX 5KQ1A 2LYDA 1FHXA 1NTYA 1V89A 1XD4A 3N7CA 4MK0A 2DA0A 2K2UA 4HAUB 4GZUA 4A6FA 1K5DB 2P0DA 4A6KA 1BWNA 5KCVA 2DHKA 2DX1A 4KAXB 3U7DA 1V88A 2XQNM 2W2XD 3PVWA 1XKEA 5KQ4A 1X86A 1MIXA 4F7GA 4GPTB 2J0JA 1H10A 2DYQA 2Y8FA 4A6FB 4H8SA 2W2WA 1I2HA 2CODA 1TQZA 2YS1A 2DKQA 4MY6A 2ADZA 2D2QA 4WJ7A 1ZVRA 4ZRJA 2RVBB 5LOPB 4KHBB 4A6HA 2J59M 2KUPA 2HE7A 2M38A 1UEFA 3M1IB 1UNRA 3CIKA 1MK7B 4CHMA 1XODA 2LOZA 2R0DA 1NI2A 4D0NB 4IFSA 2MKRA 1EVHA 2PZ1A 3PZDA 1DBHA 2I1KA 3QWMA 2COCA 2GS0A 4ZRIA 1GC6A 2H7EA 1Y5OA 5C16A 2AL6A 5GOWB 2YF0A 1W1DA 2YS3A 2DLWA 4A5KA 2D9ZA 5DI9B 1B55A 3A98B 3FM8C 1DDWA 4HB4B 4KHOA 4F7HA 4C0AA 3D8EA 5JHGA 2D11A 3KRXA 2D4QA 2UZRA 2RLOA 3ULCA 2EJ8A 1WGUA 3V5WA 3PG7A 2N23A 2P0HA 4TYZA 5LONB 2R09A 1GC7A 4CHJA 1UPQA 2N0YA 1TXDA 2ROZB 3PVUA 1Z87A 1OY2A 1V5MA 1WVHA 1Y19B 1RRPB 2M14A 1FB8A 2MWNB 2DHJA 3WA0A 4B6HA 3BINA 2UVMA 1MPHA 4YL8A 1U5DA 1UNQA 2ELAA 3SUZA 2EC1A 4DXAB 3BJIA 5C5BA 5DHAB 1U2BA 2Y8GA 2DN6A 3VIAA 3ML4A 2LKOA 5D3WA 4L6EA 3F0WA 1LB1A 4HHVA 5J3QA 3ODXA 4HAVB 4KHAA 3FEHA 3DXDA 4HAZB 3G9WA 1AWEA 3KZ1A 1EAZA 1MK9B 4K2PA 1E5WA 2X18A 3ZVRA 1U5EA 1FGZA 5C5BB 2J0KA 3ULBA 3GYPA 3GYOA 5JP4A 3O96A 4F7UP 4PQ0A 2W2XC 4EMOA 3TCAA 2KGXB 1ZC3B 3F5RA 3FSSA 4HAYB 4DX8A 4EKUA 1ZM0A 3P7ZA 2H7DA 4TKNA 2IYBA 2EMSA 1H4RA 1KZ7A 2RNRB 2D9WA 5HE2A 1AQCA 1FGYA 4XWXA 5FI1A 5CLLB 3MPXA 2FJLA 2GCJA 4CYEA 1KZGA 2Q13A 5HE0A 3HQCA 3KRWA 3ZDTA 2P0FA 2YT1A 4HATB 2YS5A 1MKEA 1RJ2A 1BTNA 2ZPYA 3AU5A 2E2XA 4DBBA 3TVVA 1DDMA 1N3HA 2DKPA 1OQNA 3PSCA 1WG7A 4HDOA 4IOYX 1W1HA 2YSZA 3AU4A 2AEHA 4IAPA 2LOXA 1PLSA 2OTXA 2Z0OA 3TW1A 2I1JA 2I5CA 3A8PA 2IFSA 2CRFA 1EF1A 2D9YA 1NU2A 3MDBC 2D9XA 3SV1A 3WYFB 4EJNA 1EGXA 1DDVA 5C6RA 5C79A 3IVFA 2MDXA 4MT7A 2GCLA 5D3XA 2VRWB 2Z0QA 4K2OA 2KCJA 1P6SA 1WJMA 2UZSA 5DIFB 2VKIA 4P7IA 1I7AA 2YT0A 2OQBA 3HK0A 1XCGA 5FI0A 5JLJB 4KVGB 1MAIA 2D9VA 3SO6A 3RCPA 1WI1A 2L2IA 2RGNB 1J19A 1SGHA 2BCJA 4Z2MB 3PEGA 3ODOA 2LG1A 1J0WA 1XR0B 2Z0PA 1DYNA 1P3RA 1WJ1A 1XX0A 3D8FA 2CY4A 3UZTA 2V76A 2Y7BA 2GJYA 2COAA 4GMVA 3DXEA 3T06A 4WSFA 1FHOA 2QKMA 4DX90 4K81A 2DHIA 5D3VA 2JP2A 2J0MA 4HB2B 3ODWA 5HE1A 5D3YA 2MFQA 2YVCA 1SHCA 3QBVB 1X05A 1Q67A 1ZSQA 2NMBA 1UPRA 1MIZB 3DXCA 2VSZA 1OMWA 3PVLA 1FAOA 1FOEA 5D27A 4PNKA 2CY5A 3KSYA 2ROVA 2HTHB 4HAXB 4HAWB 2L1CA 2RUKB 3TFMA 5HE3A 5DHFB 3SYXA 1KI1B 3PP2A 2DX5A 3KY9A 3P6AA 1QC6A 1BTKA 3AJ4A 2ELBA 5J3TA 4WVFB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2K2J A;  4GMX B;  4NSW A;  3X23 A;  1W1G A;  5JHH A;  1U27 A;  2NZ8 B;  1P5T A;  2G35 A;  2EMT A;  4K17 A;  1ZC4 B;  3OAN A;  1ISN A;  2I5F A;  1UNP A;  5CLQ B;  3SNH A;  4Z2N A;  1X1F A;  1K5G B;  3D8D A;  3TO1 A;  3HW2 B;  2QKL A;  2K00 A;  1M7E A;  4GXB A;  4ZRK A;  3A8Q A;  2DYN A;  3QIJ A;  2D10 A;  3VOQ A;  2P8V A;  2LUL A;  3U8Z A;  1WGQ A;  1TJ6 A;  1V5U A;  2DFK A;  4GN1 A;  1U29 A;  1V61 A;  1PFJ A;  5J3Y A;  1X11 A;  2CAY A;  4HDQ A;  1FHW A;  4YON A;  1NTV A;  3CXB B;  1U5G A;  1QQG A;  4HB3 B;  1DRO A;  4HB0 B;  5L81 A;  5EFX A;  2RSG A;  1IRS A;  1X1G A;  2COF A;  5DH9 B;  3NSU A;  1M7R A;  4BBK A;  1LW3 A;  1PMS A;  1V5P A;  2DTC A;  2YRY A;  4NY0 A;  4Y94 A;  1BAK A;  1U5F A;  1GG3 A;  3LJU X;  5KQ1 A;  2LYD A;  1FHX A;  1NTY A;  1V89 A;  1XD4 A;  3N7C A;  4MK0 A;  2DA0 A;  2K2U A;  4HAU B;  4GZU A;  4A6F A;  1K5D B;  2P0D A;  4A6K A;  1BWN A;  5KCV A;  2DHK A;  2DX1 A;  4KAX B;  3U7D A;  1V88 A;  2XQN M;  2W2X D;  3PVW A;  1XKE A;  5KQ4 A;  1X86 A;  1MIX A;  4F7G A;  4GPT B;  2J0J A;  1H10 A;  2DYQ A;  2Y8F A;  4A6F B;  4H8S A;  2W2W A;  1I2H A;  2COD A;  1TQZ A;  2YS1 A;  2DKQ A;  4MY6 A;  2ADZ A;  2D2Q A;  4WJ7 A;  1ZVR A;  4ZRJ A;  2RVB B;  5LOP B;  4KHB B;  4A6H A;  2J59 M;  2KUP A;  2HE7 A;  2M38 A;  1UEF A;  3M1I B;  1UNR A;  3CIK A;  1MK7 B;  4CHM A;  1XOD A;  2LOZ A;  2R0D A;  1NI2 A;  4D0N B;  4IFS A;  2MKR A;  1EVH A;  2PZ1 A;  3PZD A;  1DBH A;  2I1K A;  3QWM A;  2COC A;  2GS0 A;  4ZRI A;  1GC6 A;  2H7E A;  1Y5O A;  5C16 A;  2AL6 A;  5GOW B;  2YF0 A;  1W1D A;  2YS3 A;  2DLW A;  4A5K A;  2D9Z A;  5DI9 B;  1B55 A;  3A98 B;  3FM8 C;  1DDW A;  4HB4 B;  4KHO A;  4F7H A;  4C0A A;  3D8E A;  5JHG A;  2D11 A;  3KRX A;  2D4Q A;  2UZR A;  2RLO A;  3ULC A;  2EJ8 A;  1WGU A;  3V5W A;  3PG7 A;  2N23 A;  2P0H A;  4TYZ A;  5LON B;  2R09 A;  1GC7 A;  4CHJ A;  1UPQ A;  2N0Y A;  1TXD A;  2ROZ B;  3PVU A;  1Z87 A;  1OY2 A;  1V5M A;  1WVH A;  1Y19 B;  1RRP B;  2M14 A;  1FB8 A;  2MWN B;  2DHJ A;  3WA0 A;  4B6H A;  3BIN A;  2UVM A;  1MPH A;  4YL8 A;  1U5D A;  1UNQ A;  2ELA A;  3SUZ A;  2EC1 A;  4DXA B;  3BJI A;  5C5B A;  5DHA B;  1U2B A;  2Y8G A;  2DN6 A;  3VIA A;  3ML4 A;  2LKO A;  5D3W A;  4L6E A;  3F0W A;  1LB1 A;  4HHV A;  5J3Q A;  3ODX A;  4HAV B;  4KHA A;  3FEH A;  3DXD A;  4HAZ B;  3G9W A;  1AWE A;  3KZ1 A;  1EAZ A;  1MK9 B;  4K2P A;  1E5W A;  2X18 A;  3ZVR A;  1U5E A;  1FGZ A;  5C5B B;  2J0K A;  3ULB A;  3GYP A;  3GYO A;  5JP4 A;  3O96 A;  4F7U P;  4PQ0 A;  2W2X C;  4EMO A;  3TCA A;  2KGX B;  1ZC3 B;  3F5R A;  3FSS A;  4HAY B;  4DX8 A;  4EKU A;  1ZM0 A;  3P7Z A;  2H7D A;  4TKN A;  2IYB A;  2EMS A;  1H4R A;  1KZ7 A;  2RNR B;  2D9W A;  5HE2 A;  1AQC A;  1FGY A;  4XWX A;  5FI1 A;  5CLL B;  3MPX A;  2FJL A;  2GCJ A;  4CYE A;  1KZG A;  2Q13 A;  5HE0 A;  3HQC A;  3KRW A;  3ZDT A;  2P0F A;  2YT1 A;  4HAT B;  2YS5 A;  1MKE A;  1RJ2 A;  1BTN A;  2ZPY A;  3AU5 A;  2E2X A;  4DBB A;  3TVV A;  1DDM A;  1N3H A;  2DKP A;  1OQN A;  3PSC A;  1WG7 A;  4HDO A;  4IOY X;  1W1H A;  2YSZ A;  3AU4 A;  2AEH A;  4IAP A;  2LOX A;  1PLS A;  2OTX A;  2Z0O A;  3TW1 A;  2I1J A;  2I5C A;  3A8P A;  2IFS A;  2CRF A;  1EF1 A;  2D9Y A;  1NU2 A;  3MDB C;  2D9X A;  3SV1 A;  3WYF B;  4EJN A;  1EGX A;  1DDV A;  5C6R A;  5C79 A;  3IVF A;  2MDX A;  4MT7 A;  2GCL A;  5D3X A;  2VRW B;  2Z0Q A;  4K2O A;  2KCJ A;  1P6S A;  1WJM A;  2UZS A;  5DIF B;  2VKI A;  4P7I A;  1I7A A;  2YT0 A;  2OQB A;  3HK0 A;  1XCG A;  5FI0 A;  5JLJ B;  4KVG B;  1MAI A;  2D9V A;  3SO6 A;  3RCP A;  1WI1 A;  2L2I A;  2RGN B;  1J19 A;  1SGH A;  2BCJ A;  4Z2M B;  3PEG A;  3ODO A;  2LG1 A;  1J0W A;  1XR0 B;  2Z0P A;  1DYN A;  1P3R A;  1WJ1 A;  1XX0 A;  3D8F A;  2CY4 A;  3UZT A;  2V76 A;  2Y7B A;  2GJY A;  2COA A;  4GMV A;  3DXE A;  3T06 A;  4WSF A;  1FHO A;  2QKM A;  4DX9 0;  4K81 A;  2DHI A;  5D3V A;  2JP2 A;  2J0M A;  4HB2 B;  3ODW A;  5HE1 A;  5D3Y A;  2MFQ A;  2YVC A;  1SHC A;  3QBV B;  1X05 A;  1Q67 A;  1ZSQ A;  2NMB A;  1UPR A;  1MIZ B;  3DXC A;  2VSZ A;  1OMW A;  3PVL A;  1FAO A;  1FOE A;  5D27 A;  4PNK A;  2CY5 A;  3KSY A;  2ROV A;  2HTH B;  4HAX B;  4HAW B;  2L1C A;  2RUK B;  3TFM A;  5HE3 A;  5DHF B;  3SYX A;  1KI1 B;  3PP2 A;  2DX5 A;  3KY9 A;  3P6A A;  1QC6 A;  1BTK A;  3AJ4 A;  2ELB A;  5J3T A;  4WVF B; 
#chains in the Genus database with same CATH topology
 2K2J A;  3DCX A;  4GMX B;  4NSW A;  3X23 A;  1W1G A;  5JHH A;  1U27 A;  2NZ8 B;  1P5T A;  2G35 A;  2EMT A;  2K8E A;  4K17 A;  1ZC4 B;  3OAN A;  1ISN A;  2I5F A;  1UNP A;  5CLQ B;  3SNH A;  4Z2N A;  1X1F A;  1K5G B;  3D8D A;  3TO1 A;  3HW2 B;  2QKL A;  2K00 A;  4QJ4 B;  1M7E A;  4GXB A;  4ZRK A;  3A8Q A;  2DYN A;  4L1R A;  3QIJ A;  2D10 A;  3VOQ A;  2P8V A;  2LUL A;  3U8Z A;  1WGQ A;  1TJ6 A;  1V5U A;  2DFK A;  4GN1 A;  1U29 A;  1V61 A;  1PFJ A;  5J3Y A;  1X11 A;  2CAY A;  4HDQ A;  1FHW A;  4YON A;  1NTV A;  2Z4D A;  3CXB B;  1U5G A;  1QQG A;  4HB3 B;  1DRO A;  4HB0 B;  5L81 A;  5EFX A;  2RSG A;  1IRS A;  1X1G A;  2COF A;  5DH9 B;  3NSU A;  1M7R A;  4BBK A;  1LW3 A;  1PMS A;  1V5P A;  2DTC A;  2YRY A;  4NY0 A;  4Y94 A;  1BAK A;  1U5F A;  1GG3 A;  3LJU X;  5KQ1 A;  2LYD A;  1FHX A;  1NTY A;  1V89 A;  1XD4 A;  3N7C A;  4MK0 A;  2DA0 A;  2K2U A;  2KR0 A;  4GZU A;  4HAU B;  4A6F A;  1K5D B;  2P0D A;  4A6K A;  1BWN A;  5KCV A;  2DHK A;  2DX1 A;  4KAX B;  3U7D A;  1V88 A;  2XQN M;  2W2X D;  2RRF A;  3PVW A;  1XKE A;  5KQ4 A;  1X86 A;  1MIX A;  3NWD A;  3HIE A;  4F7G A;  4GPT B;  2J0J A;  1H10 A;  2KUQ A;  2DYQ A;  2Y8F A;  4A6F B;  4H8S A;  2W2W A;  1I2H A;  2COD A;  1TQZ A;  2YS1 A;  2DKQ A;  4MY6 A;  2ADZ A;  2D2Q A;  4WJ7 A;  1ZVR A;  4ZRJ A;  2RVB B;  5LOP B;  4KHB B;  4A6H A;  2J59 M;  2KUP A;  2NBV A;  2HE7 A;  2M38 A;  1UEF A;  3M1I B;  1MI1 A;  1UNR A;  4GNK B;  3CIK A;  1MK7 B;  4CHM A;  1XOD A;  2LOZ A;  2R0D A;  4OT1 A;  1NI2 A;  4D0N B;  4IFS A;  2MKR A;  1EVH A;  2PZ1 A;  3PZD A;  1DBH A;  2I1K A;  3QWM A;  2COC A;  2GS0 A;  4ZRI A;  1GC6 A;  4HSI A;  2H7E A;  1Y5O A;  5C16 A;  2AL6 A;  5GOW B;  2YF0 A;  5I2M A;  1W1D A;  2YS3 A;  2DLW A;  4A5K A;  2D9Z A;  5DI9 B;  1B55 A;  3A98 B;  3FM8 C;  1DDW A;  4HB4 B;  4KHO A;  4F7H A;  4C0A A;  3D8E A;  5JHG A;  2D11 A;  3KRX A;  2D4Q A;  2UZR A;  2RLO A;  2R2Y A;  3ULC A;  2EJ8 A;  1WGU A;  3V5W A;  3PG7 A;  2N23 A;  2P0H A;  3B77 A;  4TYZ A;  5LON B;  2R09 A;  1GC7 A;  4CHJ A;  1UPQ A;  2N0Y A;  1TXD A;  2ROZ B;  3PVU A;  5LG4 B;  1Z87 A;  1OY2 A;  1V5M A;  2FJU B;  1WVH A;  1Y19 B;  1RRP B;  2M14 A;  5IRS A;  1FB8 A;  2MWN B;  2DHJ A;  3WA0 A;  4B6H A;  3BIN A;  2UVM A;  1MPH A;  4YL8 A;  1U5D A;  1UNQ A;  2YT2 A;  2ELA A;  3SUZ A;  2EC1 A;  4DXA B;  3BJI A;  4D6W A;  5C5B A;  4QJ5 B;  5DHA B;  1U2B A;  2Y8G A;  2DN6 A;  3VIA A;  3ML4 A;  2LKO A;  5D3W A;  4L6E A;  3F0W A;  1LB1 A;  4HHV A;  5J3Q A;  3ODX A;  4HAV B;  4KHA A;  3FEH A;  3DXD A;  4HAZ B;  3G9W A;  1AWE A;  4KHB A;  3KZ1 A;  1EAZ A;  1MK9 B;  4K2P A;  1E5W A;  2X18 A;  3ZVR A;  1U5E A;  1FGZ A;  5C5B B;  2J0K A;  3ULB A;  3GYP A;  4CSQ A;  3GYO A;  5JP4 A;  3O96 A;  4F7U P;  4PQ0 A;  2W2X C;  4EMO A;  3TCA A;  2KGX B;  3NWF A;  1ZC3 B;  3F5R A;  3FSS A;  4HAY B;  4DX8 A;  4EKU A;  1ZM0 A;  3P7Z A;  2H7D A;  4TKN A;  2IYB A;  2EMS A;  1H4R A;  1KZ7 A;  2RNR B;  2D9W A;  4QXA B;  4QJ3 B;  5HE2 A;  1AQC A;  1FGY A;  4XWX A;  3HSA A;  5FI1 A;  2ZKM X;  5CLL B;  3MPX A;  2FJL A;  2GCJ A;  4CYE A;  3A58 A;  1KZG A;  2Q13 A;  5HE0 A;  3HQC A;  3KRW A;  3ZDT A;  2P0F A;  2YT1 A;  4HAT B;  2YS5 A;  1MKE A;  1RJ2 A;  1BTN A;  2ZPY A;  3AU5 A;  1T77 A;  5I2S A;  2E2X A;  4DBB A;  3TVV A;  1DDM A;  1N3H A;  2DKP A;  1OQN A;  3PSC A;  1WG7 A;  2K49 A;  4HDO A;  4IOY X;  1W1H A;  2YSZ A;  3AU4 A;  2AEH A;  4IAP A;  2LOX A;  1PLS A;  2Z14 A;  2OTX A;  5M4Y B;  2Z0O A;  3TW1 A;  2I1J A;  2I5C A;  3A8P A;  2IFS A;  4OSN A;  2CRF A;  1EF1 A;  2D9Y A;  1NU2 A;  3MDB C;  3NW8 A;  2D9X A;  3SV1 A;  3WYF B;  4EJN A;  1EGX A;  1DDV A;  5C6R A;  5C79 A;  3IVF A;  2MDX A;  4MT7 A;  2GCL A;  5D3X A;  2VRW B;  2Z0Q A;  4K2O A;  2KCJ A;  1P6S A;  1WJM A;  2UZS A;  5DIF B;  2VKI A;  4P7I A;  1I7A A;  2YT0 A;  2OQB A;  3HK0 A;  1XCG A;  5FI0 A;  2GUM A;  4KVG B;  5JLJ B;  1MAI A;  2D9V A;  2KIE A;  3SO6 A;  3RCP A;  1WI1 A;  2L2I A;  2RGN B;  4GOU A;  1J19 A;  1SGH A;  2BCJ A;  4Z2M B;  3PEG A;  3ODO A;  2LG1 A;  1J0W A;  1XR0 B;  2Z0P A;  1DYN A;  1P3R A;  1WJ1 A;  1XX0 A;  3D8F A;  2CY4 A;  3UZT A;  2V76 A;  2Z13 A;  2Y7B A;  2GJY A;  2COA A;  4GMV A;  3DXE A;  2Z59 A;  2KIG A;  3OHM B;  3T06 A;  4WSF A;  1FHO A;  3U12 A;  2QKM A;  4DX9 0;  4K81 A;  2DHI A;  5D3V A;  2JP2 A;  2J0M A;  4HB2 B;  3ODW A;  1ZYI A;  5HE1 A;  5D3Y A;  2MFQ A;  2YVC A;  4DIX A;  1SHC A;  3FVC A;  3QBV B;  1X05 A;  1Q67 A;  1ZSQ A;  2NMB A;  1UPR A;  1MIZ B;  3DXC A;  2VSZ A;  1OMW A;  3PVL A;  1FAO A;  1FOE A;  5D27 A;  4PNK A;  2CY5 A;  3KSY A;  2ROV A;  2HTH B;  4HAX B;  4HAW B;  2L1C A;  2RUK B;  3TFM A;  3NWA A;  5HE3 A;  5DHF B;  3SYX A;  1KI1 B;  3PP2 A;  2DX5 A;  3KY9 A;  3P6A A;  1QC6 A;  1BTK A;  3AJ4 A;  2ELB A;  5J3T A;  4WVF B; 
#chains in the Genus database with same CATH homology
 2K2J A;  4GMX B;  4NSW A;  3X23 A;  1W1G A;  5JHH A;  1U27 A;  2NZ8 B;  1P5T A;  2G35 A;  2EMT A;  4K17 A;  1ZC4 B;  3OAN A;  1ISN A;  2I5F A;  1UNP A;  5CLQ B;  3SNH A;  4Z2N A;  1X1F A;  1K5G B;  3D8D A;  3TO1 A;  3HW2 B;  2QKL A;  2K00 A;  1M7E A;  4GXB A;  4ZRK A;  3A8Q A;  2DYN A;  3QIJ A;  2D10 A;  3VOQ A;  2P8V A;  2LUL A;  3U8Z A;  1WGQ A;  1TJ6 A;  1V5U A;  2DFK A;  4GN1 A;  1U29 A;  1V61 A;  1PFJ A;  5J3Y A;  1X11 A;  2CAY A;  4HDQ A;  1FHW A;  4YON A;  1NTV A;  3CXB B;  1U5G A;  1QQG A;  4HB3 B;  1DRO A;  4HB0 B;  5L81 A;  5EFX A;  2RSG A;  1IRS A;  1X1G A;  2COF A;  5DH9 B;  3NSU A;  1M7R A;  4BBK A;  1LW3 A;  1PMS A;  1V5P A;  2DTC A;  2YRY A;  4NY0 A;  4Y94 A;  1BAK A;  1U5F A;  1GG3 A;  3LJU X;  5KQ1 A;  2LYD A;  1FHX A;  1NTY A;  1V89 A;  1XD4 A;  3N7C A;  4MK0 A;  2DA0 A;  2K2U A;  4HAU B;  4GZU A;  4A6F A;  1K5D B;  2P0D A;  4A6K A;  1BWN A;  5KCV A;  2DHK A;  2DX1 A;  4KAX B;  3U7D A;  1V88 A;  2XQN M;  2W2X D;  3PVW A;  1XKE A;  5KQ4 A;  1X86 A;  1MIX A;  4F7G A;  4GPT B;  2J0J A;  1H10 A;  2DYQ A;  2Y8F A;  4A6F B;  4H8S A;  2W2W A;  1I2H A;  2COD A;  1TQZ A;  2YS1 A;  2DKQ A;  4MY6 A;  2ADZ A;  2D2Q A;  4WJ7 A;  1ZVR A;  4ZRJ A;  2RVB B;  5LOP B;  4KHB B;  4A6H A;  2J59 M;  2KUP A;  2HE7 A;  2M38 A;  1UEF A;  3M1I B;  1UNR A;  3CIK A;  1MK7 B;  4CHM A;  1XOD A;  2LOZ A;  2R0D A;  1NI2 A;  4D0N B;  4IFS A;  2MKR A;  1EVH A;  2PZ1 A;  3PZD A;  1DBH A;  2I1K A;  3QWM A;  2COC A;  2GS0 A;  4ZRI A;  1GC6 A;  2H7E A;  1Y5O A;  5C16 A;  2AL6 A;  5GOW B;  2YF0 A;  1W1D A;  2YS3 A;  2DLW A;  4A5K A;  2D9Z A;  5DI9 B;  1B55 A;  3A98 B;  3FM8 C;  1DDW A;  4HB4 B;  4KHO A;  4F7H A;  4C0A A;  3D8E A;  5JHG A;  2D11 A;  3KRX A;  2D4Q A;  2UZR A;  2RLO A;  3ULC A;  2EJ8 A;  1WGU A;  3V5W A;  3PG7 A;  2N23 A;  2P0H A;  4TYZ A;  5LON B;  2R09 A;  1GC7 A;  4CHJ A;  1UPQ A;  2N0Y A;  1TXD A;  2ROZ B;  3PVU A;  1Z87 A;  1OY2 A;  1V5M A;  1WVH A;  1Y19 B;  1RRP B;  2M14 A;  1FB8 A;  2MWN B;  2DHJ A;  3WA0 A;  4B6H A;  3BIN A;  2UVM A;  1MPH A;  4YL8 A;  1U5D A;  1UNQ A;  2ELA A;  3SUZ A;  2EC1 A;  4DXA B;  3BJI A;  5C5B A;  5DHA B;  1U2B A;  2Y8G A;  2DN6 A;  3VIA A;  3ML4 A;  2LKO A;  5D3W A;  4L6E A;  3F0W A;  1LB1 A;  4HHV A;  5J3Q A;  3ODX A;  4HAV B;  4KHA A;  3FEH A;  3DXD A;  4HAZ B;  3G9W A;  1AWE A;  3KZ1 A;  1EAZ A;  1MK9 B;  4K2P A;  1E5W A;  2X18 A;  3ZVR A;  1U5E A;  1FGZ A;  5C5B B;  2J0K A;  3ULB A;  3GYP A;  3GYO A;  5JP4 A;  3O96 A;  4F7U P;  4PQ0 A;  2W2X C;  4EMO A;  3TCA A;  2KGX B;  1ZC3 B;  3F5R A;  3FSS A;  4HAY B;  4DX8 A;  4EKU A;  1ZM0 A;  3P7Z A;  2H7D A;  4TKN A;  2IYB A;  2EMS A;  1H4R A;  1KZ7 A;  2RNR B;  2D9W A;  5HE2 A;  1AQC A;  1FGY A;  4XWX A;  5FI1 A;  5CLL B;  3MPX A;  2FJL A;  2GCJ A;  4CYE A;  1KZG A;  2Q13 A;  5HE0 A;  3HQC A;  3KRW A;  3ZDT A;  2P0F A;  2YT1 A;  4HAT B;  2YS5 A;  1MKE A;  1RJ2 A;  1BTN A;  2ZPY A;  3AU5 A;  2E2X A;  4DBB A;  3TVV A;  1DDM A;  1N3H A;  2DKP A;  1OQN A;  3PSC A;  1WG7 A;  4HDO A;  4IOY X;  1W1H A;  2YSZ A;  3AU4 A;  2AEH A;  4IAP A;  2LOX A;  1PLS A;  2OTX A;  2Z0O A;  3TW1 A;  2I1J A;  2I5C A;  3A8P A;  2IFS A;  2CRF A;  1EF1 A;  2D9Y A;  1NU2 A;  3MDB C;  2D9X A;  3SV1 A;  3WYF B;  4EJN A;  1EGX A;  1DDV A;  5C6R A;  5C79 A;  3IVF A;  2MDX A;  4MT7 A;  2GCL A;  5D3X A;  2VRW B;  2Z0Q A;  4K2O A;  2KCJ A;  1P6S A;  1WJM A;  2UZS A;  5DIF B;  2VKI A;  4P7I A;  1I7A A;  2YT0 A;  2OQB A;  3HK0 A;  1XCG A;  5FI0 A;  5JLJ B;  4KVG B;  1MAI A;  2D9V A;  3SO6 A;  3RCP A;  1WI1 A;  2L2I A;  2RGN B;  1J19 A;  1SGH A;  2BCJ A;  4Z2M B;  3PEG A;  3ODO A;  2LG1 A;  1J0W A;  1XR0 B;  2Z0P A;  1DYN A;  1P3R A;  1WJ1 A;  1XX0 A;  3D8F A;  2CY4 A;  3UZT A;  2V76 A;  2Y7B A;  2GJY A;  2COA A;  4GMV A;  3DXE A;  3T06 A;  4WSF A;  1FHO A;  2QKM A;  4DX9 0;  4K81 A;  2DHI A;  5D3V A;  2JP2 A;  2J0M A;  4HB2 B;  3ODW A;  5HE1 A;  5D3Y A;  2MFQ A;  2YVC A;  1SHC A;  3QBV B;  1X05 A;  1Q67 A;  1ZSQ A;  2NMB A;  1UPR A;  1MIZ B;  3DXC A;  2VSZ A;  1OMW A;  3PVL A;  1FAO A;  1FOE A;  5D27 A;  4PNK A;  2CY5 A;  3KSY A;  2ROV A;  2HTH B;  4HAX B;  4HAW B;  2L1C A;  2RUK B;  3TFM A;  5HE3 A;  5DHF B;  3SYX A;  1KI1 B;  3PP2 A;  2DX5 A;  3KY9 A;  3P6A A;  1QC6 A;  1BTK A;  3AJ4 A;  2ELB A;  5J3T A;  4WVF B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...