4A6HA

Crystal structure of slm1-ph domain in complex with inositol-4- phosphate
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
117
structure length
108
Chain Sequence
HPFTEIKSGFLERRSKFLKSYSKGYYVLTPNFLHEFKTADRKKDLVPVMSLALSECTVTEHSRKNSDAKFVLHAKQNGIIRRGHNWVFKADSYESMMSWFDNLKILTS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords PHOSPHATIDYLINOSITOL 4,5-BISPHOSPHATE-BINDING PROTEIN SLM1
publication title Structural Analyses of Slm1-Ph Domain Demonstrate Ligand Binding in the Non-Canonical Site
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Signaling protein
total genus 23
structure length 108
sequence length 117
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2011-11-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00169 PH PH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 4a6hA00
1DDVA 1NTYA 2DN6A 1WVHA 5KQ4A 2CRFA 1MKEA 4NSWA 1PLSA 3U8ZA 4ZRIA 1M7EA 4TKNA 4HATB 2D9ZA 2J0MA 5LOPB 2IYBA 2DHKA 2I1JA 4HDQA 3FEHA 3F0WA 2W2XC 2DX5A 3ZVRA 1W1GA 4HB4B 2COAA 4A6FB 1UPQA 2ROVA 1DROA 1K5GB 1UPRA 1EF1A 3U7DA 3ULBA 3ODOA 2P0DA 5JHHA 1NU2A 3A8QA 3G9WA 4HB3B 1ISNA 3SNHA 3PSCA 4HDOA 4EKUA 1N3HA 5C5BB 3SV1A 1FOEA 4A6FA 1AQCA 1GC7A 1U5DA 1W1DA 2YT0A 1TQZA 1U29A 2LULA 3TCAA 1V89A 2K2UA 5C5BA 2D2QA 2CY4A 3DXEA 3IVFA 2YRYA 4KHBB 1WJ1A 1UEFA 2NMBA 2D10A 4B6HA 2J0KA 2YS5A 5JLJB 4MY6A 4D0NB 2I1KA 2YF0A 3UZTA 2D11A 1V5UA 1X1GA 4CYEA 2DTCA 3D8FA 1X1FA 2L1CA 4GMVA 3WA0A 3PVWA 2Z0QA 2RVBB 5EFXA 5C6RA 2UZSA 1WGQA 4H8SA 3P6AA 2ADZA 2LG1A 2R0DA 2AL6A 4WJ7A 1UNRA 4A5KA 1MAIA 3T06A 1IRSA 4HHVA 1W1HA 2UVMA 1H10A 2RUKB 1XD4A 2D9YA 4TYZA 4HAWB 1UNQA 1OQNA 4IFSA 1OY2A 4YONA 1X05A 1WJMA 2D9WA 5KQ1A 4PNKA 1P5TA 1GG3A 1ZC3B 1DBHA 3KZ1A 1J0WA 2MDXA 4A6HA 5DIFB 4HAUB 1XX0A 2D9XA 1DYNA 4YL8A 3RCPA 2EMSA 4K2OA 2LOZA 4Z2NA 2I5FA 2KCJA 3DXCA 2HE7A 1UNPA 5DHAB 3CIKA 1Z87A 1FAOA 4K2PA 1ZSQA 3KY9A 1PFJA 2DX1A 2MFQA 1Y19B 3PVUA 2ELAA 2M38A 2MWNB 1E5WA 4EJNA 3O96A 1KZGA 4GPTB 3CXBB 5L81A 2EMTA 4DX90 2CAYA 2Y8FA 2COCA 2E2XA 3ULCA 3BINA 2LKOA 4HB2B 1NI2A 3GYOA 2X18A 5D3VA 1MK7B 2DFKA 4CHJA 1BTNA 4HAVB 2Y8GA 1GC6A 4HAYB 1EVHA 3ODWA 3AU4A 4KHOA 2Z0OA 2J59M 3TW1A 4KAXB 1Q67A 3PG7A 1OMWA 2V76A 4DX8A 3AU5A 3SO6A 2HTHB 3QWMA 2IFSA 5JHGA 2EC1A 3ML4A 5D3XA 3PP2A 1Y5OA 1FHWA 3PZDA 4KHAA 5D3WA 3NSUA 2YS3A 2UZRA 5FI1A 4HB0B 2Q13A 3VOQA 4HAZB 2XQNM 1U5EA 4PQ0A 2RNRB 2OTXA 1ZM0A 4ZRJA 2DYQA 2ZPYA 3FM8C 2BCJA 1SHCA 1AWEA 5D27A 4DXAB 2P0HA 2H7DA 3KSYA 2QKLA 2GJYA 4A6KA 1MIZB 1EGXA 2R09A 1X86A 2DKPA 2DHIA 4Z2MB 1MK9B 1J19A 2VSZA 3KRWA 2VRWB 2P0FA 1WGUA 1ZVRA 4F7UP 1KZ7A 2GS0A 5HE1A 4BBKA 1BTKA 2K2JA 1KI1B 1WI1A 1LW3A 1M7RA 3HK0A 5HE0A 3OANA 4NY0A 2YS1A 2D9VA 1SGHA 3GYPA 4K17A 2YSZA 2H7EA 3M1IB 2EJ8A 1FHOA 2LOXA 5DHFB 2RGNB 4HAXB 3D8EA 5HE3A 3ZDTA 1DDMA 4DBBA 1NTVA 3N7CA 5HE2A 5CLLB 3P7ZA 3F5RA 5DH9B 2MKRA 1PMSA 2M14A 2P8VA 1XCGA 1FGYA 2D4QA 1X11A 1U5GA 1QQGA 4WSFA 4P7IA 1K5DB 2GCLA 4WVFB 3MDBC 2NZ8B 3TFMA 1V88A 2CODA 2YVCA 5JP4A 2QKMA 3VIAA 4GXBA 2KUPA 3KRXA 1V5PA 2W2XD 3HQCA 2DKQA 3HW2B 1RJ2A 4MT7A 1V5MA 3DXDA 5J3TA 3A8PA 1WG7A 2RSGA 5J3YA 3FSSA 1MPHA 2W2WA 4C0AA 2K00A 4GN1A 2N23A 4MK0A 2YT1A 5D3YA 1ZC4B 1U27A 2G35A 4EMOA 3PEGA 2COFA 3PVLA 2Y7BA 1V61A 3A98B 4CHMA 2FJLA 3D8DA 1H4RA 5GOWB 3MPXA 4IAPA 3ODXA 5C79A 2N0YA 3X23A 1FB8A 1U5FA 1I7AA 2ELBA 2ROZB 2J0JA 1FGZA 3SUZA 5CLQB 2KGXB 3AJ4A 2LYDA 2JP2A 1BWNA 4F7HA 4GZUA 4IOYX 1DDWA 1TJ6A 1RRPB 2L2IA 4GMXB 1BAKA 1QC6A 2I5CA 4L6EA 2CY5A 1XKEA 4KVGB 2AEHA 2DYNA 1U2BA 5FI0A 2RLOA 5KCVA 2VKIA 4XWXA 5J3QA 1XR0B 1B55A 3BJIA 3SYXA 3LJUX 3TVVA 3WYFB 2DLWA 5C16A 5DI9B 1I2HA 4ZRKA 3QIJA 2OQBA 2Z0PA 3V5WA 1MIXA 2PZ1A 2DA0A 3TO1A 4K81A 1FHXA 1EAZA 3QBVB 2GCJA 4Y94A 1TXDA 1P3RA 1P6SA 5LONB 1XODA 2DHJA 4F7GA 1LB1A
chains in the Genus database with same CATH superfamily
1DDVA 3DCXA 1NTYA 2DN6A 1WVHA 5KQ4A 2CRFA 1MKEA 4NSWA 1PLSA 3U8ZA 4HSIA 4ZRIA 1M7EA 4TKNA 4HATB 2D9ZA 2J0MA 5LOPB 2IYBA 2DHKA 3OHMB 2I1JA 2K49A 4HDQA 2FJUB 3FEHA 3F0WA 2W2XC 2DX5A 2R2YA 3ZVRA 1W1GA 4HB4B 2COAA 4A6FB 2Z59A 1UPQA 2ROVA 1DROA 1K5GB 1UPRA 1EF1A 3U7DA 3ULBA 3ODOA 2P0DA 5JHHA 1NU2A 3NWFA 3A8QA 3G9WA 4HB3B 1ISNA 3SNHA 3PSCA 4HDOA 4EKUA 1N3HA 5C5BB 3SV1A 1FOEA 4A6FA 1AQCA 1GC7A 1U5DA 1W1DA 4DIXA 2YT0A 1TQZA 1U29A 2LULA 3TCAA 1V89A 5IRSA 2K2UA 5C5BA 2D2QA 2CY4A 3DXEA 3IVFA 2YRYA 4KHBB 1WJ1A 1UEFA 2NMBA 2D10A 4B6HA 2J0KA 2YS5A 5JLJB 4MY6A 4GNKB 4D0NB 2I1KA 2YF0A 3UZTA 2D11A 1V5UA 1X1GA 4CYEA 2DTCA 3D8FA 1X1FA 4KHBA 2L1CA 4GMVA 3WA0A 3PVWA 2Z0QA 2RVBB 5EFXA 5C6RA 2UZSA 1WGQA 4H8SA 3P6AA 2ADZA 2LG1A 2R0DA 4D6WA 2AL6A 4WJ7A 1UNRA 4A5KA 1MAIA 3T06A 1IRSA 4HHVA 1W1HA 2UVMA 1H10A 2RUKB 1XD4A 2D9YA 4TYZA 4HAWB 1UNQA 1OQNA 4IFSA 1OY2A 4YONA 1X05A 4L1RA 1WJMA 2D9WA 5KQ1A 4PNKA 1P5TA 1GG3A 1ZC3B 1DBHA 3HIEA 3KZ1A 1J0WA 2MDXA 4A6HA 5DIFB 4HAUB 1XX0A 2D9XA 1DYNA 4YL8A 3RCPA 2EMSA 4K2OA 2LOZA 4Z2NA 2I5FA 2KCJA 3DXCA 2HE7A 1UNPA 5DHAB 5I2SA 3CIKA 1Z87A 1FAOA 4K2PA 1ZSQA 3KY9A 1T77A 1PFJA 2DX1A 2MFQA 1Y19B 2KIEA 3PVUA 2ELAA 2M38A 2MWNB 1E5WA 2YT2A 4EJNA 3O96A 1KZGA 4GPTB 3CXBB 5L81A 2EMTA 2Z4DA 2CAYA 4DX90 2Y8FA 2COCA 2E2XA 3ULCA 3BINA 2LKOA 2KR0A 2NBVA 4HB2B 1NI2A 3GYOA 2X18A 5D3VA 1MK7B 2DFKA 4CHJA 1BTNA 4HAVB 2Y8GA 3NWAA 1GC6A 4HAYB 1EVHA 3ODWA 3AU4A 4KHOA 2K8EA 2Z0OA 2J59M 3TW1A 4KAXB 1Q67A 3PG7A 1OMWA 2V76A 4DX8A 3AU5A 3U12A 3SO6A 2HTHB 3QWMA 2IFSA 5JHGA 2EC1A 4GOUA 3ML4A 5D3XA 3PP2A 1Y5OA 1FHWA 3PZDA 4KHAA 5D3WA 3NSUA 2YS3A 2UZRA 5FI1A 4HB0B 2Q13A 5I2MA 3VOQA 4HAZB 2XQNM 1U5EA 4PQ0A 2RNRB 2OTXA 1ZM0A 4ZRJA 2DYQA 2ZPYA 3FM8C 2BCJA 1SHCA 1AWEA 5D27A 5LG4B 4DXAB 2P0HA 2H7DA 2Z14A 3KSYA 2QKLA 2GJYA 4A6KA 1MIZB 3FVCA 1EGXA 2R09A 1X86A 2DKPA 2DHIA 4Z2MB 1MK9B 1J19A 2VSZA 3KRWA 2RRFA 2KIGA 2VRWB 2P0FA 1WGUA 1ZVRA 4F7UP 4CSQA 1KZ7A 2GS0A 5HE1A 4BBKA 1BTKA 2K2JA 1KI1B 1WI1A 1LW3A 3HK0A 1M7RA 2Z13A 3NW8A 1MI1A 5HE0A 3OANA 4NY0A 2YS1A 2D9VA 1SGHA 3GYPA 4K17A 2YSZA 2H7EA 3M1IB 2EJ8A 1FHOA 2LOXA 5DHFB 2RGNB 4HAXB 3D8EA 3B77A 5HE3A 3ZDTA 1DDMA 4DBBA 1NTVA 3N7CA 5HE2A 5CLLB 3P7ZA 3F5RA 5DH9B 2MKRA 1PMSA 2M14A 2P8VA 1XCGA 1FGYA 2D4QA 1X11A 1U5GA 1QQGA 4WSFA 4P7IA 1K5DB 5M4YB 2GCLA 4WVFB 3MDBC 2NZ8B 3TFMA 1V88A 2CODA 2YVCA 5JP4A 2QKMA 3VIAA 4GXBA 2KUPA 3KRXA 1V5PA 3NWDA 2W2XD 3HQCA 2DKQA 3HW2B 1RJ2A 4MT7A 1V5MA 3DXDA 5J3TA 3A8PA 1WG7A 2RSGA 5J3YA 3FSSA 1MPHA 4OT1A 1ZYIA 4QJ5B 2W2WA 4C0AA 2K00A 4GN1A 2N23A 4MK0A 2YT1A 5D3YA 1ZC4B 1U27A 2KUQA 4OSNA 2G35A 4QJ4B 4EMOA 3PEGA 2GUMA 2COFA 3PVLA 2Y7BA 1V61A 3A98B 4CHMA 2FJLA 3D8DA 1H4RA 5GOWB 3MPXA 4IAPA 3ODXA 5C79A 2N0YA 4QJ3B 3X23A 1FB8A 1U5FA 1I7AA 2ELBA 2ROZB 2J0JA 1FGZA 3SUZA 5CLQB 2KGXB 3AJ4A 2LYDA 2ZKMX 2JP2A 1BWNA 4F7HA 4GZUA 4IOYX 1DDWA 1TJ6A 1RRPB 2L2IA 4GMXB 1BAKA 1QC6A 2I5CA 4QXAB 4L6EA 2CY5A 1XKEA 4KVGB 2AEHA 2DYNA 3A58A 1U2BA 5FI0A 2RLOA 5KCVA 2VKIA 4XWXA 5J3QA 1XR0B 1B55A 3BJIA 3SYXA 3LJUX 3TVVA 3WYFB 2DLWA 5C16A 5DI9B 1I2HA 4ZRKA 3QIJA 2OQBA 2Z0PA 3V5WA 1MIXA 2PZ1A 2DA0A 3TO1A 4K81A 1FHXA 1EAZA 3QBVB 2GCJA 4Y94A 1TXDA 1P3RA 3HSAA 1P6SA 5LONB 1XODA 2DHJA 4F7GA 1LB1A
chains in the Genus database with same CATH topology
1DDVA 1NTYA 2DN6A 1WVHA 5KQ4A 2CRFA 1MKEA 4NSWA 1PLSA 3U8ZA 4ZRIA 1M7EA 4TKNA 4HATB 2D9ZA 2J0MA 5LOPB 2IYBA 2DHKA 2I1JA 4HDQA 3FEHA 3F0WA 2W2XC 2DX5A 3ZVRA 1W1GA 4HB4B 2COAA 4A6FB 1UPQA 2ROVA 1DROA 1K5GB 1UPRA 1EF1A 3U7DA 3ULBA 3ODOA 2P0DA 5JHHA 1NU2A 3A8QA 3G9WA 4HB3B 1ISNA 3SNHA 3PSCA 4HDOA 4EKUA 1N3HA 5C5BB 3SV1A 1FOEA 4A6FA 1AQCA 1GC7A 1U5DA 1W1DA 2YT0A 1TQZA 1U29A 2LULA 3TCAA 1V89A 2K2UA 5C5BA 2D2QA 2CY4A 3DXEA 3IVFA 2YRYA 4KHBB 1WJ1A 1UEFA 2NMBA 2D10A 4B6HA 2J0KA 2YS5A 5JLJB 4MY6A 4D0NB 2I1KA 2YF0A 3UZTA 2D11A 1V5UA 1X1GA 4CYEA 2DTCA 3D8FA 1X1FA 2L1CA 4GMVA 3WA0A 3PVWA 2Z0QA 2RVBB 5EFXA 5C6RA 2UZSA 1WGQA 4H8SA 3P6AA 2ADZA 2LG1A 2R0DA 2AL6A 4WJ7A 1UNRA 4A5KA 1MAIA 3T06A 1IRSA 4HHVA 1W1HA 2UVMA 1H10A 2RUKB 1XD4A 2D9YA 4TYZA 4HAWB 1UNQA 1OQNA 4IFSA 1OY2A 4YONA 1X05A 1WJMA 2D9WA 5KQ1A 4PNKA 1P5TA 1GG3A 1ZC3B 1DBHA 3KZ1A 1J0WA 2MDXA 4A6HA 5DIFB 4HAUB 1XX0A 2D9XA 1DYNA 4YL8A 3RCPA 2EMSA 4K2OA 2LOZA 4Z2NA 2I5FA 2KCJA 3DXCA 2HE7A 1UNPA 5DHAB 3CIKA 1Z87A 1FAOA 4K2PA 1ZSQA 3KY9A 1PFJA 2DX1A 2MFQA 1Y19B 3PVUA 2ELAA 2M38A 2MWNB 1E5WA 4EJNA 3O96A 1KZGA 4GPTB 3CXBB 5L81A 2EMTA 4DX90 2CAYA 2Y8FA 2COCA 2E2XA 3ULCA 3BINA 2LKOA 4HB2B 1NI2A 3GYOA 2X18A 5D3VA 1MK7B 2DFKA 4CHJA 1BTNA 4HAVB 2Y8GA 1GC6A 4HAYB 1EVHA 3ODWA 3AU4A 4KHOA 2Z0OA 2J59M 3TW1A 4KAXB 1Q67A 3PG7A 1OMWA 2V76A 4DX8A 3AU5A 3SO6A 2HTHB 3QWMA 2IFSA 5JHGA 2EC1A 3ML4A 5D3XA 3PP2A 1Y5OA 1FHWA 3PZDA 4KHAA 5D3WA 3NSUA 2YS3A 2UZRA 5FI1A 4HB0B 2Q13A 3VOQA 4HAZB 2XQNM 1U5EA 4PQ0A 2RNRB 2OTXA 1ZM0A 4ZRJA 2DYQA 2ZPYA 3FM8C 2BCJA 1SHCA 1AWEA 5D27A 4DXAB 2P0HA 2H7DA 3KSYA 2QKLA 2GJYA 4A6KA 1MIZB 1EGXA 2R09A 1X86A 2DKPA 2DHIA 4Z2MB 1MK9B 1J19A 2VSZA 3KRWA 2VRWB 2P0FA 1WGUA 1ZVRA 4F7UP 1KZ7A 2GS0A 5HE1A 4BBKA 1BTKA 2K2JA 1KI1B 1WI1A 1LW3A 1M7RA 3HK0A 5HE0A 3OANA 4NY0A 2YS1A 2D9VA 1SGHA 3GYPA 4K17A 2YSZA 2H7EA 3M1IB 2EJ8A 1FHOA 2LOXA 5DHFB 2RGNB 4HAXB 3D8EA 5HE3A 3ZDTA 1DDMA 4DBBA 1NTVA 3N7CA 5HE2A 5CLLB 3P7ZA 3F5RA 5DH9B 2MKRA 1PMSA 2M14A 2P8VA 1XCGA 1FGYA 2D4QA 1X11A 1U5GA 1QQGA 4WSFA 4P7IA 1K5DB 2GCLA 4WVFB 3MDBC 2NZ8B 3TFMA 1V88A 2CODA 2YVCA 5JP4A 2QKMA 3VIAA 4GXBA 2KUPA 3KRXA 1V5PA 2W2XD 3HQCA 2DKQA 3HW2B 1RJ2A 4MT7A 1V5MA 3DXDA 5J3TA 3A8PA 1WG7A 2RSGA 5J3YA 3FSSA 1MPHA 2W2WA 4C0AA 2K00A 4GN1A 2N23A 4MK0A 2YT1A 5D3YA 1ZC4B 1U27A 2G35A 4EMOA 3PEGA 2COFA 3PVLA 2Y7BA 1V61A 3A98B 4CHMA 2FJLA 3D8DA 1H4RA 5GOWB 3MPXA 4IAPA 3ODXA 5C79A 2N0YA 3X23A 1FB8A 1U5FA 1I7AA 2ELBA 2ROZB 2J0JA 1FGZA 3SUZA 5CLQB 2KGXB 3AJ4A 2LYDA 2JP2A 1BWNA 4F7HA 4GZUA 4IOYX 1DDWA 1TJ6A 1RRPB 2L2IA 4GMXB 1BAKA 1QC6A 2I5CA 4L6EA 2CY5A 1XKEA 4KVGB 2AEHA 2DYNA 1U2BA 5FI0A 2RLOA 5KCVA 2VKIA 4XWXA 5J3QA 1XR0B 1B55A 3BJIA 3SYXA 3LJUX 3TVVA 3WYFB 2DLWA 5C16A 5DI9B 1I2HA 4ZRKA 3QIJA 2OQBA 2Z0PA 3V5WA 1MIXA 2PZ1A 2DA0A 3TO1A 4K81A 1FHXA 1EAZA 3QBVB 2GCJA 4Y94A 1TXDA 1P3RA 1P6SA 5LONB 1XODA 2DHJA 4F7GA 1LB1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DDV A;  1NTY A;  2DN6 A;  1WVH A;  5KQ4 A;  2CRF A;  1MKE A;  4NSW A;  1PLS A;  3U8Z A;  4ZRI A;  1M7E A;  4TKN A;  4HAT B;  2D9Z A;  2J0M A;  5LOP B;  2IYB A;  2DHK A;  2I1J A;  4HDQ A;  3FEH A;  3F0W A;  2W2X C;  2DX5 A;  3ZVR A;  1W1G A;  4HB4 B;  2COA A;  4A6F B;  1UPQ A;  2ROV A;  1DRO A;  1K5G B;  1UPR A;  1EF1 A;  3U7D A;  3ULB A;  3ODO A;  2P0D A;  5JHH A;  1NU2 A;  3A8Q A;  3G9W A;  4HB3 B;  1ISN A;  3SNH A;  3PSC A;  4HDO A;  4EKU A;  1N3H A;  5C5B B;  3SV1 A;  1FOE A;  4A6F A;  1AQC A;  1GC7 A;  1U5D A;  1W1D A;  2YT0 A;  1TQZ A;  1U29 A;  2LUL A;  3TCA A;  1V89 A;  2K2U A;  5C5B A;  2D2Q A;  2CY4 A;  3DXE A;  3IVF A;  2YRY A;  4KHB B;  1WJ1 A;  1UEF A;  2NMB A;  2D10 A;  4B6H A;  2J0K A;  2YS5 A;  5JLJ B;  4MY6 A;  4D0N B;  2I1K A;  2YF0 A;  3UZT A;  2D11 A;  1V5U A;  1X1G A;  4CYE A;  2DTC A;  3D8F A;  1X1F A;  2L1C A;  4GMV A;  3WA0 A;  3PVW A;  2Z0Q A;  2RVB B;  5EFX A;  5C6R A;  2UZS A;  1WGQ A;  4H8S A;  3P6A A;  2ADZ A;  2LG1 A;  2R0D A;  2AL6 A;  4WJ7 A;  1UNR A;  4A5K A;  1MAI A;  3T06 A;  1IRS A;  4HHV A;  1W1H A;  2UVM A;  1H10 A;  2RUK B;  1XD4 A;  2D9Y A;  4TYZ A;  4HAW B;  1UNQ A;  1OQN A;  4IFS A;  1OY2 A;  4YON A;  1X05 A;  1WJM A;  2D9W A;  5KQ1 A;  4PNK A;  1P5T A;  1GG3 A;  1ZC3 B;  1DBH A;  3KZ1 A;  1J0W A;  2MDX A;  4A6H A;  5DIF B;  4HAU B;  1XX0 A;  2D9X A;  1DYN A;  4YL8 A;  3RCP A;  2EMS A;  4K2O A;  2LOZ A;  4Z2N A;  2I5F A;  2KCJ A;  3DXC A;  2HE7 A;  1UNP A;  5DHA B;  3CIK A;  1Z87 A;  1FAO A;  4K2P A;  1ZSQ A;  3KY9 A;  1PFJ A;  2DX1 A;  2MFQ A;  1Y19 B;  3PVU A;  2ELA A;  2M38 A;  2MWN B;  1E5W A;  4EJN A;  3O96 A;  1KZG A;  4GPT B;  3CXB B;  5L81 A;  2EMT A;  4DX9 0;  2CAY A;  2Y8F A;  2COC A;  2E2X A;  3ULC A;  3BIN A;  2LKO A;  4HB2 B;  1NI2 A;  3GYO A;  2X18 A;  5D3V A;  1MK7 B;  2DFK A;  4CHJ A;  1BTN A;  4HAV B;  2Y8G A;  1GC6 A;  4HAY B;  1EVH A;  3ODW A;  3AU4 A;  4KHO A;  2Z0O A;  2J59 M;  3TW1 A;  4KAX B;  1Q67 A;  3PG7 A;  1OMW A;  2V76 A;  4DX8 A;  3AU5 A;  3SO6 A;  2HTH B;  3QWM A;  2IFS A;  5JHG A;  2EC1 A;  3ML4 A;  5D3X A;  3PP2 A;  1Y5O A;  1FHW A;  3PZD A;  4KHA A;  5D3W A;  3NSU A;  2YS3 A;  2UZR A;  5FI1 A;  4HB0 B;  2Q13 A;  3VOQ A;  4HAZ B;  2XQN M;  1U5E A;  4PQ0 A;  2RNR B;  2OTX A;  1ZM0 A;  4ZRJ A;  2DYQ A;  2ZPY A;  3FM8 C;  2BCJ A;  1SHC A;  1AWE A;  5D27 A;  4DXA B;  2P0H A;  2H7D A;  3KSY A;  2QKL A;  2GJY A;  4A6K A;  1MIZ B;  1EGX A;  2R09 A;  1X86 A;  2DKP A;  2DHI A;  4Z2M B;  1MK9 B;  1J19 A;  2VSZ A;  3KRW A;  2VRW B;  2P0F A;  1WGU A;  1ZVR A;  4F7U P;  1KZ7 A;  2GS0 A;  5HE1 A;  4BBK A;  1BTK A;  2K2J A;  1KI1 B;  1WI1 A;  1LW3 A;  1M7R A;  3HK0 A;  5HE0 A;  3OAN A;  4NY0 A;  2YS1 A;  2D9V A;  1SGH A;  3GYP A;  4K17 A;  2YSZ A;  2H7E A;  3M1I B;  2EJ8 A;  1FHO A;  2LOX A;  5DHF B;  2RGN B;  4HAX B;  3D8E A;  5HE3 A;  3ZDT A;  1DDM A;  4DBB A;  1NTV A;  3N7C A;  5HE2 A;  5CLL B;  3P7Z A;  3F5R A;  5DH9 B;  2MKR A;  1PMS A;  2M14 A;  2P8V A;  1XCG A;  1FGY A;  2D4Q A;  1X11 A;  1U5G A;  1QQG A;  4WSF A;  4P7I A;  1K5D B;  2GCL A;  4WVF B;  3MDB C;  2NZ8 B;  3TFM A;  1V88 A;  2COD A;  2YVC A;  5JP4 A;  2QKM A;  3VIA A;  4GXB A;  2KUP A;  3KRX A;  1V5P A;  2W2X D;  3HQC A;  2DKQ A;  3HW2 B;  1RJ2 A;  4MT7 A;  1V5M A;  3DXD A;  5J3T A;  3A8P A;  1WG7 A;  2RSG A;  5J3Y A;  3FSS A;  1MPH A;  2W2W A;  4C0A A;  2K00 A;  4GN1 A;  2N23 A;  4MK0 A;  2YT1 A;  5D3Y A;  1ZC4 B;  1U27 A;  2G35 A;  4EMO A;  3PEG A;  2COF A;  3PVL A;  2Y7B A;  1V61 A;  3A98 B;  4CHM A;  2FJL A;  3D8D A;  1H4R A;  5GOW B;  3MPX A;  4IAP A;  3ODX A;  5C79 A;  2N0Y A;  3X23 A;  1FB8 A;  1U5F A;  1I7A A;  2ELB A;  2ROZ B;  2J0J A;  1FGZ A;  3SUZ A;  5CLQ B;  2KGX B;  3AJ4 A;  2LYD A;  2JP2 A;  1BWN A;  4F7H A;  4GZU A;  4IOY X;  1DDW A;  1TJ6 A;  1RRP B;  2L2I A;  4GMX B;  1BAK A;  1QC6 A;  2I5C A;  4L6E A;  2CY5 A;  1XKE A;  4KVG B;  2AEH A;  2DYN A;  1U2B A;  5FI0 A;  2RLO A;  5KCV A;  2VKI A;  4XWX A;  5J3Q A;  1XR0 B;  1B55 A;  3BJI A;  3SYX A;  3LJU X;  3TVV A;  3WYF B;  2DLW A;  5C16 A;  5DI9 B;  1I2H A;  4ZRK A;  3QIJ A;  2OQB A;  2Z0P A;  3V5W A;  1MIX A;  2PZ1 A;  2DA0 A;  3TO1 A;  4K81 A;  1FHX A;  1EAZ A;  3QBV B;  2GCJ A;  4Y94 A;  1TXD A;  1P3R A;  1P6S A;  5LON B;  1XOD A;  2DHJ A;  4F7G A;  1LB1 A; 
#chains in the Genus database with same CATH topology
 1DDV A;  3DCX A;  1NTY A;  2DN6 A;  1WVH A;  5KQ4 A;  2CRF A;  1MKE A;  4NSW A;  1PLS A;  3U8Z A;  4HSI A;  4ZRI A;  1M7E A;  4TKN A;  4HAT B;  2D9Z A;  2J0M A;  5LOP B;  2IYB A;  2DHK A;  3OHM B;  2I1J A;  2K49 A;  4HDQ A;  2FJU B;  3FEH A;  3F0W A;  2W2X C;  2DX5 A;  2R2Y A;  3ZVR A;  1W1G A;  4HB4 B;  2COA A;  4A6F B;  2Z59 A;  1UPQ A;  2ROV A;  1DRO A;  1K5G B;  1UPR A;  1EF1 A;  3U7D A;  3ULB A;  3ODO A;  2P0D A;  5JHH A;  1NU2 A;  3NWF A;  3A8Q A;  3G9W A;  4HB3 B;  1ISN A;  3SNH A;  3PSC A;  4HDO A;  4EKU A;  1N3H A;  5C5B B;  3SV1 A;  1FOE A;  4A6F A;  1AQC A;  1GC7 A;  1U5D A;  1W1D A;  4DIX A;  2YT0 A;  1TQZ A;  1U29 A;  2LUL A;  3TCA A;  1V89 A;  5IRS A;  2K2U A;  5C5B A;  2D2Q A;  2CY4 A;  3DXE A;  3IVF A;  2YRY A;  4KHB B;  1WJ1 A;  1UEF A;  2NMB A;  2D10 A;  4B6H A;  2J0K A;  2YS5 A;  5JLJ B;  4MY6 A;  4GNK B;  4D0N B;  2I1K A;  2YF0 A;  3UZT A;  2D11 A;  1V5U A;  1X1G A;  4CYE A;  2DTC A;  3D8F A;  1X1F A;  4KHB A;  2L1C A;  4GMV A;  3WA0 A;  3PVW A;  2Z0Q A;  2RVB B;  5EFX A;  5C6R A;  2UZS A;  1WGQ A;  4H8S A;  3P6A A;  2ADZ A;  2LG1 A;  2R0D A;  4D6W A;  2AL6 A;  4WJ7 A;  1UNR A;  4A5K A;  1MAI A;  3T06 A;  1IRS A;  4HHV A;  1W1H A;  2UVM A;  1H10 A;  2RUK B;  1XD4 A;  2D9Y A;  4TYZ A;  4HAW B;  1UNQ A;  1OQN A;  4IFS A;  1OY2 A;  4YON A;  1X05 A;  4L1R A;  1WJM A;  2D9W A;  5KQ1 A;  4PNK A;  1P5T A;  1GG3 A;  1ZC3 B;  1DBH A;  3HIE A;  3KZ1 A;  1J0W A;  2MDX A;  4A6H A;  5DIF B;  4HAU B;  1XX0 A;  2D9X A;  1DYN A;  4YL8 A;  3RCP A;  2EMS A;  4K2O A;  2LOZ A;  4Z2N A;  2I5F A;  2KCJ A;  3DXC A;  2HE7 A;  1UNP A;  5DHA B;  5I2S A;  3CIK A;  1Z87 A;  1FAO A;  4K2P A;  1ZSQ A;  3KY9 A;  1T77 A;  1PFJ A;  2DX1 A;  2MFQ A;  1Y19 B;  2KIE A;  3PVU A;  2ELA A;  2M38 A;  2MWN B;  1E5W A;  2YT2 A;  4EJN A;  3O96 A;  1KZG A;  4GPT B;  3CXB B;  5L81 A;  2EMT A;  2Z4D A;  2CAY A;  4DX9 0;  2Y8F A;  2COC A;  2E2X A;  3ULC A;  3BIN A;  2LKO A;  2KR0 A;  2NBV A;  4HB2 B;  1NI2 A;  3GYO A;  2X18 A;  5D3V A;  1MK7 B;  2DFK A;  4CHJ A;  1BTN A;  4HAV B;  2Y8G A;  3NWA A;  1GC6 A;  4HAY B;  1EVH A;  3ODW A;  3AU4 A;  4KHO A;  2K8E A;  2Z0O A;  2J59 M;  3TW1 A;  4KAX B;  1Q67 A;  3PG7 A;  1OMW A;  2V76 A;  4DX8 A;  3AU5 A;  3U12 A;  3SO6 A;  2HTH B;  3QWM A;  2IFS A;  5JHG A;  2EC1 A;  4GOU A;  3ML4 A;  5D3X A;  3PP2 A;  1Y5O A;  1FHW A;  3PZD A;  4KHA A;  5D3W A;  3NSU A;  2YS3 A;  2UZR A;  5FI1 A;  4HB0 B;  2Q13 A;  5I2M A;  3VOQ A;  4HAZ B;  2XQN M;  1U5E A;  4PQ0 A;  2RNR B;  2OTX A;  1ZM0 A;  4ZRJ A;  2DYQ A;  2ZPY A;  3FM8 C;  2BCJ A;  1SHC A;  1AWE A;  5D27 A;  5LG4 B;  4DXA B;  2P0H A;  2H7D A;  2Z14 A;  3KSY A;  2QKL A;  2GJY A;  4A6K A;  1MIZ B;  3FVC A;  1EGX A;  2R09 A;  1X86 A;  2DKP A;  2DHI A;  4Z2M B;  1MK9 B;  1J19 A;  2VSZ A;  3KRW A;  2RRF A;  2KIG A;  2VRW B;  2P0F A;  1WGU A;  1ZVR A;  4F7U P;  4CSQ A;  1KZ7 A;  2GS0 A;  5HE1 A;  4BBK A;  1BTK A;  2K2J A;  1KI1 B;  1WI1 A;  1LW3 A;  3HK0 A;  1M7R A;  2Z13 A;  3NW8 A;  1MI1 A;  5HE0 A;  3OAN A;  4NY0 A;  2YS1 A;  2D9V A;  1SGH A;  3GYP A;  4K17 A;  2YSZ A;  2H7E A;  3M1I B;  2EJ8 A;  1FHO A;  2LOX A;  5DHF B;  2RGN B;  4HAX B;  3D8E A;  3B77 A;  5HE3 A;  3ZDT A;  1DDM A;  4DBB A;  1NTV A;  3N7C A;  5HE2 A;  5CLL B;  3P7Z A;  3F5R A;  5DH9 B;  2MKR A;  1PMS A;  2M14 A;  2P8V A;  1XCG A;  1FGY A;  2D4Q A;  1X11 A;  1U5G A;  1QQG A;  4WSF A;  4P7I A;  1K5D B;  5M4Y B;  2GCL A;  4WVF B;  3MDB C;  2NZ8 B;  3TFM A;  1V88 A;  2COD A;  2YVC A;  5JP4 A;  2QKM A;  3VIA A;  4GXB A;  2KUP A;  3KRX A;  1V5P A;  3NWD A;  2W2X D;  3HQC A;  2DKQ A;  3HW2 B;  1RJ2 A;  4MT7 A;  1V5M A;  3DXD A;  5J3T A;  3A8P A;  1WG7 A;  2RSG A;  5J3Y A;  3FSS A;  1MPH A;  4OT1 A;  1ZYI A;  4QJ5 B;  2W2W A;  4C0A A;  2K00 A;  4GN1 A;  2N23 A;  4MK0 A;  2YT1 A;  5D3Y A;  1ZC4 B;  1U27 A;  2KUQ A;  4OSN A;  2G35 A;  4QJ4 B;  4EMO A;  3PEG A;  2GUM A;  2COF A;  3PVL A;  2Y7B A;  1V61 A;  3A98 B;  4CHM A;  2FJL A;  3D8D A;  1H4R A;  5GOW B;  3MPX A;  4IAP A;  3ODX A;  5C79 A;  2N0Y A;  4QJ3 B;  3X23 A;  1FB8 A;  1U5F A;  1I7A A;  2ELB A;  2ROZ B;  2J0J A;  1FGZ A;  3SUZ A;  5CLQ B;  2KGX B;  3AJ4 A;  2LYD A;  2ZKM X;  2JP2 A;  1BWN A;  4F7H A;  4GZU A;  4IOY X;  1DDW A;  1TJ6 A;  1RRP B;  2L2I A;  4GMX B;  1BAK A;  1QC6 A;  2I5C A;  4QXA B;  4L6E A;  2CY5 A;  1XKE A;  4KVG B;  2AEH A;  2DYN A;  3A58 A;  1U2B A;  5FI0 A;  2RLO A;  5KCV A;  2VKI A;  4XWX A;  5J3Q A;  1XR0 B;  1B55 A;  3BJI A;  3SYX A;  3LJU X;  3TVV A;  3WYF B;  2DLW A;  5C16 A;  5DI9 B;  1I2H A;  4ZRK A;  3QIJ A;  2OQB A;  2Z0P A;  3V5W A;  1MIX A;  2PZ1 A;  2DA0 A;  3TO1 A;  4K81 A;  1FHX A;  1EAZ A;  3QBV B;  2GCJ A;  4Y94 A;  1TXD A;  1P3R A;  3HSA A;  1P6S A;  5LON B;  1XOD A;  2DHJ A;  4F7G A;  1LB1 A; 
#chains in the Genus database with same CATH homology
 1DDV A;  1NTY A;  2DN6 A;  1WVH A;  5KQ4 A;  2CRF A;  1MKE A;  4NSW A;  1PLS A;  3U8Z A;  4ZRI A;  1M7E A;  4TKN A;  4HAT B;  2D9Z A;  2J0M A;  5LOP B;  2IYB A;  2DHK A;  2I1J A;  4HDQ A;  3FEH A;  3F0W A;  2W2X C;  2DX5 A;  3ZVR A;  1W1G A;  4HB4 B;  2COA A;  4A6F B;  1UPQ A;  2ROV A;  1DRO A;  1K5G B;  1UPR A;  1EF1 A;  3U7D A;  3ULB A;  3ODO A;  2P0D A;  5JHH A;  1NU2 A;  3A8Q A;  3G9W A;  4HB3 B;  1ISN A;  3SNH A;  3PSC A;  4HDO A;  4EKU A;  1N3H A;  5C5B B;  3SV1 A;  1FOE A;  4A6F A;  1AQC A;  1GC7 A;  1U5D A;  1W1D A;  2YT0 A;  1TQZ A;  1U29 A;  2LUL A;  3TCA A;  1V89 A;  2K2U A;  5C5B A;  2D2Q A;  2CY4 A;  3DXE A;  3IVF A;  2YRY A;  4KHB B;  1WJ1 A;  1UEF A;  2NMB A;  2D10 A;  4B6H A;  2J0K A;  2YS5 A;  5JLJ B;  4MY6 A;  4D0N B;  2I1K A;  2YF0 A;  3UZT A;  2D11 A;  1V5U A;  1X1G A;  4CYE A;  2DTC A;  3D8F A;  1X1F A;  2L1C A;  4GMV A;  3WA0 A;  3PVW A;  2Z0Q A;  2RVB B;  5EFX A;  5C6R A;  2UZS A;  1WGQ A;  4H8S A;  3P6A A;  2ADZ A;  2LG1 A;  2R0D A;  2AL6 A;  4WJ7 A;  1UNR A;  4A5K A;  1MAI A;  3T06 A;  1IRS A;  4HHV A;  1W1H A;  2UVM A;  1H10 A;  2RUK B;  1XD4 A;  2D9Y A;  4TYZ A;  4HAW B;  1UNQ A;  1OQN A;  4IFS A;  1OY2 A;  4YON A;  1X05 A;  1WJM A;  2D9W A;  5KQ1 A;  4PNK A;  1P5T A;  1GG3 A;  1ZC3 B;  1DBH A;  3KZ1 A;  1J0W A;  2MDX A;  4A6H A;  5DIF B;  4HAU B;  1XX0 A;  2D9X A;  1DYN A;  4YL8 A;  3RCP A;  2EMS A;  4K2O A;  2LOZ A;  4Z2N A;  2I5F A;  2KCJ A;  3DXC A;  2HE7 A;  1UNP A;  5DHA B;  3CIK A;  1Z87 A;  1FAO A;  4K2P A;  1ZSQ A;  3KY9 A;  1PFJ A;  2DX1 A;  2MFQ A;  1Y19 B;  3PVU A;  2ELA A;  2M38 A;  2MWN B;  1E5W A;  4EJN A;  3O96 A;  1KZG A;  4GPT B;  3CXB B;  5L81 A;  2EMT A;  4DX9 0;  2CAY A;  2Y8F A;  2COC A;  2E2X A;  3ULC A;  3BIN A;  2LKO A;  4HB2 B;  1NI2 A;  3GYO A;  2X18 A;  5D3V A;  1MK7 B;  2DFK A;  4CHJ A;  1BTN A;  4HAV B;  2Y8G A;  1GC6 A;  4HAY B;  1EVH A;  3ODW A;  3AU4 A;  4KHO A;  2Z0O A;  2J59 M;  3TW1 A;  4KAX B;  1Q67 A;  3PG7 A;  1OMW A;  2V76 A;  4DX8 A;  3AU5 A;  3SO6 A;  2HTH B;  3QWM A;  2IFS A;  5JHG A;  2EC1 A;  3ML4 A;  5D3X A;  3PP2 A;  1Y5O A;  1FHW A;  3PZD A;  4KHA A;  5D3W A;  3NSU A;  2YS3 A;  2UZR A;  5FI1 A;  4HB0 B;  2Q13 A;  3VOQ A;  4HAZ B;  2XQN M;  1U5E A;  4PQ0 A;  2RNR B;  2OTX A;  1ZM0 A;  4ZRJ A;  2DYQ A;  2ZPY A;  3FM8 C;  2BCJ A;  1SHC A;  1AWE A;  5D27 A;  4DXA B;  2P0H A;  2H7D A;  3KSY A;  2QKL A;  2GJY A;  4A6K A;  1MIZ B;  1EGX A;  2R09 A;  1X86 A;  2DKP A;  2DHI A;  4Z2M B;  1MK9 B;  1J19 A;  2VSZ A;  3KRW A;  2VRW B;  2P0F A;  1WGU A;  1ZVR A;  4F7U P;  1KZ7 A;  2GS0 A;  5HE1 A;  4BBK A;  1BTK A;  2K2J A;  1KI1 B;  1WI1 A;  1LW3 A;  1M7R A;  3HK0 A;  5HE0 A;  3OAN A;  4NY0 A;  2YS1 A;  2D9V A;  1SGH A;  3GYP A;  4K17 A;  2YSZ A;  2H7E A;  3M1I B;  2EJ8 A;  1FHO A;  2LOX A;  5DHF B;  2RGN B;  4HAX B;  3D8E A;  5HE3 A;  3ZDT A;  1DDM A;  4DBB A;  1NTV A;  3N7C A;  5HE2 A;  5CLL B;  3P7Z A;  3F5R A;  5DH9 B;  2MKR A;  1PMS A;  2M14 A;  2P8V A;  1XCG A;  1FGY A;  2D4Q A;  1X11 A;  1U5G A;  1QQG A;  4WSF A;  4P7I A;  1K5D B;  2GCL A;  4WVF B;  3MDB C;  2NZ8 B;  3TFM A;  1V88 A;  2COD A;  2YVC A;  5JP4 A;  2QKM A;  3VIA A;  4GXB A;  2KUP A;  3KRX A;  1V5P A;  2W2X D;  3HQC A;  2DKQ A;  3HW2 B;  1RJ2 A;  4MT7 A;  1V5M A;  3DXD A;  5J3T A;  3A8P A;  1WG7 A;  2RSG A;  5J3Y A;  3FSS A;  1MPH A;  2W2W A;  4C0A A;  2K00 A;  4GN1 A;  2N23 A;  4MK0 A;  2YT1 A;  5D3Y A;  1ZC4 B;  1U27 A;  2G35 A;  4EMO A;  3PEG A;  2COF A;  3PVL A;  2Y7B A;  1V61 A;  3A98 B;  4CHM A;  2FJL A;  3D8D A;  1H4R A;  5GOW B;  3MPX A;  4IAP A;  3ODX A;  5C79 A;  2N0Y A;  3X23 A;  1FB8 A;  1U5F A;  1I7A A;  2ELB A;  2ROZ B;  2J0J A;  1FGZ A;  3SUZ A;  5CLQ B;  2KGX B;  3AJ4 A;  2LYD A;  2JP2 A;  1BWN A;  4F7H A;  4GZU A;  4IOY X;  1DDW A;  1TJ6 A;  1RRP B;  2L2I A;  4GMX B;  1BAK A;  1QC6 A;  2I5C A;  4L6E A;  2CY5 A;  1XKE A;  4KVG B;  2AEH A;  2DYN A;  1U2B A;  5FI0 A;  2RLO A;  5KCV A;  2VKI A;  4XWX A;  5J3Q A;  1XR0 B;  1B55 A;  3BJI A;  3SYX A;  3LJU X;  3TVV A;  3WYF B;  2DLW A;  5C16 A;  5DI9 B;  1I2H A;  4ZRK A;  3QIJ A;  2OQB A;  2Z0P A;  3V5W A;  1MIX A;  2PZ1 A;  2DA0 A;  3TO1 A;  4K81 A;  1FHX A;  1EAZ A;  3QBV B;  2GCJ A;  4Y94 A;  1TXD A;  1P3R A;  1P6S A;  5LON B;  1XOD A;  2DHJ A;  4F7G A;  1LB1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...