4A6HA

Crystal structure of slm1-ph domain in complex with inositol-4- phosphate
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
117
structure length
108
Chain Sequence
HPFTEIKSGFLERRSKFLKSYSKGYYVLTPNFLHEFKTADRKKDLVPVMSLALSECTVTEHSRKNSDAKFVLHAKQNGIIRRGHNWVFKADSYESMMSWFDNLKILTS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Signaling protein
molecule keywords PHOSPHATIDYLINOSITOL 4,5-BISPHOSPHATE-BINDING PROTEIN SLM1
publication title Structural Analyses of Slm1-Ph Domain Demonstrate Ligand Binding in the Non-Canonical Site
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 23
structure length 108
sequence length 117
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2011-11-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00169 PH PH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 4a6hA00
1MIZB 2D2QA 4WSFA 4GZUA 5D27A 5FI1A 2XQNM 4D0NB 4Z2MB 1WI1A 3KY9A 4KAXB 1IRSA 5JHGA 4HAWB 2Y8GA 3TW1A 3ZVRA 1H4RA 3ZDTA 3SUZA 2X18A 5DHFB 3CIKA 1UNQA 1W1GA 2P0FA 5J3YA 4A6KA 1V89A 2DLWA 2H7DA 2Z0OA 1WJMA 2OQBA 4K2PA 1XX0A 2L2IA 4K17A 3SV1A 3PP2A 2D4QA 5KQ4A 1U2BA 2RGNB 2KUPA 1ZC4B 4F7HA 4DX90 4EMOA 2DHKA 2OTXA 2VRWB 2W2WA 3A8PA 1BTKA 1E5WA 3DXCA 1XKEA 5D3YA 1EVHA 4MT7A 2COAA 2D9VA 3KSYA 2YT0A 4HHVA 5LONB 2GCJA 5C6RA 2I5FA 1MIXA 4CHJA 1XCGA 2CODA 1I7AA 4H8SA 1Z87A 4L6EA 1MAIA 1N3HA 2M38A 2YS3A 3IVFA 2J0JA 4Z2NA 2LOXA 1BAKA 2D11A 4YL8A 5J3QA 1TQZA 3VOQA 3PVLA 2DKQA 1FGZA 3AU4A 2LG1A 4GN1A 1LW3A 2I1KA 2RSGA 1WVHA 2I5CA 4PNKA 3D8EA 2K2UA 3AJ4A 2J0MA 1M7EA 3GYOA 4HAXB 2GCLA 5KCVA 3ODWA 4ZRIA 2YT1A 3ULCA 4HAYB 1X1GA 1X11A 4TYZA 1P3RA 2D10A 3A98B 2N0YA 3QIJA 4IAPA 1WGUA 2DKPA 3ML4A 3AU5A 3WA0A 1AQCA 4C0AA 2CY5A 1FB8A 5GOWB 3CXBB 1SGHA 4P7IA 3F0WA 3QWMA 3TO1A 1UNRA 1UNPA 4HDOA 3M1IB 1EF1A 1DROA 2AEHA 3TVVA 2DX1A 1J0WA 1U5FA 2MWNB 4A6FA 5KQ1A 5CLLB 3PEGA 2BCJA 3KRXA 4K2OA 3MDBC 3QBVB 4IOYX 4HATB 4WVFB 1ZC3B 2DHJA 1KI1B 5D3VA 1NTVA 3ODOA 2UVMA 4HDQA 5C5BA 5JLJB 3GYPA 1ZM0A 4IFSA 2DYNA 4YONA 2YS1A 4CHMA 1MPHA 2R0DA 3FM8C 1ZSQA 3PG7A 2M14A 1MKEA 3VIAA 4EKUA 2DHIA 2E2XA 4F7GA 1RRPB 2W2XC 1WGQA 1V61A 5D3WA 5LOPB 1FHOA 1OQNA 1XODA 2QKLA 4HAVB 2HTHB 3F5RA 1V5PA 1H10A 1PFJA 2UZRA 1XR0B 2LULA 3NSUA 3OANA 1DDWA 1KZGA 2KCJA 2D9WA 2W2XD 2P8VA 2G35A 3U7DA 1TJ6A 2DTCA 1P5TA 1EAZA 5FI0A 2HE7A 1PLSA 3MPXA 1X1FA 1FHXA 1DYNA 2J59M 2EMSA 3U8ZA 2YS5A 2ADZA 1FOEA 4XWXA 1ISNA 2ELAA 2RNRB 2R09A 5DH9B 5D3XA 4BBKA 4GMVA 5J3TA 2K2JA 4CYEA 1BWNA 1W1DA 2I1JA 3RCPA 1QC6A 1OY2A 1J19A 1KZ7A 1NI2A 2RUKB 1AWEA 3O96A 1DDMA 5CLQB 4KVGB 3WYFB 3FSSA 3DXDA 2QKMA 1OMWA 3BJIA 1WG7A 3ODXA 1XD4A 2PZ1A 3SYXA 5HE3A 3N7CA 4A6FB 2JP2A 2D9XA 3DXEA 2GJYA 2N23A 3KZ1A 1FAOA 1GG3A 4GPTB 1UPRA 2YVCA 4A5KA 3T06A 1FGYA 5DHAB 2EMTA 2LYDA 4GMXB 4F7UP 3KRWA 2L1CA 2J0KA 3UZTA 1Y19B 4NSWA 5C5BB 3PVUA 3TFMA 2DX5A 1GC7A 1B55A 1P6SA 2P0DA 1V5MA 4ZRKA 2NZ8B 2DN6A 4HB3B 4GXBA 2Z0QA 2DFKA 3HK0A 4HB0B 1K5GB 2COFA 2EC1A 3TCAA 1UPQA 1BTNA 2DYQA 2MKRA 2ZPYA 2Q13A 1Q67A 4KHAA 3D8FA 1W1HA 5EFXA 4K81A 1GC6A 3A8QA 2EJ8A 2H7EA 5HE1A 3HQCA 1M7RA 3P7ZA 1U27A 2CAYA 4NY0A 3D8DA 2FJLA 1TXDA 2YSZA 3ULBA 4DBBA 4EJNA 5DIFB 3SO6A 5L81A 2UZSA 1LB1A 1MK9B 1NTYA 5C16A 1V5UA 2VKIA 4HB2B 4HAZB 1UEFA 2COCA 4TKNA 1X05A 2RLOA 1EGXA 2P0HA 4WJ7A 2Z0PA 2YRYA 2LKOA 5HE2A 2MFQA 2K00A 2V76A 3PVWA 1NU2A 3BINA 5DI9B 4MY6A 2IFSA 2KGXB 1ZVRA 1DDVA 2NMBA 2YF0A 2CY4A 1U29A 2AL6A 4MK0A 1U5EA 2Y8FA 2D9YA 4B6HA 1I2HA 1QQGA 1FHWA 4DX8A 4A6HA 2ELBA 2LOZA 3HW2B 2CRFA 1MK7B 1K5DB 3P6AA 2D9ZA 4DXAB 4KHOA 5HE0A 5JP4A 2ROZB 3PZDA 3X23A 2RVBB 1V88A 1SHCA 4HB4B 4PQ0A 4HAUB 3LJUX 2GS0A 4ZRJA 3V5WA 2ROVA 1Y5OA 2MDXA 5JHHA 5C79A 4KHBB 3PSCA 1PMSA 1U5GA 1WJ1A 3G9WA 1RJ2A 4Y94A 2IYBA 1U5DA 2VSZA 2DA0A 1DBHA 3FEHA 3SNHA 1X86A 2Y7BA
chains in the Genus database with same CATH superfamily
1MIZB 2D2QA 4WSFA 4GZUA 5D27A 5FI1A 2XQNM 4D0NB 4Z2MB 1WI1A 3KY9A 4KAXB 2K49A 1IRSA 4GOUA 5JHGA 4HAWB 2Y8GA 2Z59A 3TW1A 3ZVRA 1H4RA 3ZDTA 3SUZA 2X18A 5DHFB 3CIKA 1UNQA 1W1GA 2P0FA 5J3YA 4A6KA 1V89A 2DLWA 2H7DA 2Z0OA 1WJMA 2R2YA 2OQBA 4K2PA 1XX0A 3NWDA 2L2IA 4HSIA 4K17A 3SV1A 3PP2A 2D4QA 2K8EA 5KQ4A 1U2BA 2RGNB 2KUPA 1ZC4B 4F7HA 4DX90 4EMOA 2DHKA 3FVCA 2OTXA 2VRWB 2W2WA 3A8PA 1BTKA 1E5WA 3DXCA 4CSQA 1XKEA 5D3YA 1EVHA 4MT7A 2COAA 2D9VA 3NW8A 3KSYA 2YT0A 2GUMA 4HHVA 5LONB 2GCJA 5C6RA 2I5FA 1MIXA 4CHJA 1XCGA 2CODA 1I7AA 4H8SA 1Z87A 4L6EA 1MAIA 1N3HA 2M38A 2YS3A 3IVFA 2J0JA 4Z2NA 5LG4B 2LOXA 1BAKA 2D11A 4YL8A 5J3QA 1TQZA 3VOQA 1T77A 3PVLA 2DKQA 1FGZA 3AU4A 2LG1A 4GN1A 1LW3A 2I1KA 2RSGA 1WVHA 2I5CA 4PNKA 3D8EA 2K2UA 3AJ4A 2J0MA 1M7EA 3GYOA 4HAXB 2GCLA 5KCVA 3ODWA 4ZRIA 2YT1A 3ULCA 4HAYB 1X1GA 1X11A 4TYZA 1P3RA 2D10A 3A98B 2N0YA 3QIJA 4IAPA 1WGUA 2DKPA 3ML4A 3AU5A 3WA0A 5IRSA 1AQCA 4C0AA 2CY5A 1FB8A 5GOWB 3CXBB 1SGHA 4P7IA 3DCXA 3F0WA 3QWMA 3TO1A 1UNRA 1UNPA 4HDOA 3M1IB 1EF1A 1DROA 2AEHA 3TVVA 2DX1A 1J0WA 1U5FA 2MWNB 4A6FA 5KQ1A 5CLLB 3PEGA 2BCJA 3KRXA 4K2OA 5I2MA 3MDBC 3QBVB 4IOYX 4HATB 4WVFB 1ZC3B 3HSAA 2DHJA 1KI1B 2NBVA 5D3VA 1NTVA 3ODOA 5I2SA 2UVMA 3NWAA 4HDQA 5C5BA 5JLJB 3GYPA 1ZM0A 4IFSA 2DYNA 4YONA 2YS1A 4CHMA 1MPHA 2R0DA 3FM8C 1ZSQA 3PG7A 2M14A 1MKEA 3VIAA 4EKUA 2DHIA 2E2XA 4F7GA 1RRPB 2W2XC 1WGQA 1V61A 5D3WA 2Z14A 5LOPB 1FHOA 1OQNA 1XODA 2QKLA 4HAVB 2HTHB 2KR0A 1V5PA 3F5RA 1H10A 1PFJA 2UZRA 1XR0B 2LULA 3NSUA 4L1RA 3OANA 1DDWA 1KZGA 2KCJA 2D9WA 2W2XD 2P8VA 2G35A 3U7DA 1TJ6A 2DTCA 1P5TA 1EAZA 5FI0A 2HE7A 1PLSA 4GNKB 3MPXA 1X1FA 1FHXA 1DYNA 2J59M 2EMSA 3U8ZA 2YS5A 2YT2A 2ADZA 1FOEA 4XWXA 1ISNA 2ELAA 2RNRB 2R09A 5DH9B 5D3XA 4BBKA 4GMVA 5J3TA 2K2JA 4CYEA 1BWNA 1W1DA 2I1JA 3RCPA 1QC6A 1OY2A 1J19A 4D6WA 1KZ7A 1NI2A 2RUKB 1AWEA 3O96A 1DDMA 5CLQB 4KVGB 3WYFB 3FSSA 3DXDA 2QKMA 1OMWA 3BJIA 2RRFA 2Z4DA 1WG7A 1XD4A 3ODXA 2PZ1A 3SYXA 3B77A 5HE3A 3N7CA 3OHMB 4A6FB 2JP2A 2D9XA 3DXEA 2GJYA 2N23A 3A58A 3KZ1A 1FAOA 1GG3A 4GPTB 1UPRA 2YVCA 4A5KA 3T06A 1FGYA 5DHAB 2EMTA 2LYDA 4GMXB 4F7UP 3KRWA 1ZYIA 2L1CA 2J0KA 3UZTA 1Y19B 4NSWA 5C5BB 3PVUA 3TFMA 2DX5A 1GC7A 2KIEA 1B55A 1P6SA 2P0DA 1V5MA 4ZRKA 2NZ8B 2DN6A 4HB3B 4GXBA 2Z0QA 2DFKA 3HK0A 2Z13A 4HB0B 1K5GB 4QJ3B 2COFA 2EC1A 3TCAA 1UPQA 1BTNA 4KHBA 2DYQA 2MKRA 2ZPYA 2Q13A 1Q67A 4KHAA 3D8FA 1W1HA 5EFXA 4QJ4B 4K81A 1GC6A 3A8QA 2EJ8A 2H7EA 5M4YB 5HE1A 3HQCA 1M7RA 3P7ZA 1U27A 2CAYA 4NY0A 3D8DA 2FJLA 1TXDA 2YSZA 3ULBA 4DBBA 4EJNA 3HIEA 5DIFB 3SO6A 5L81A 2UZSA 1LB1A 1MK9B 1NTYA 2KIGA 5C16A 1V5UA 2VKIA 1MI1A 2KUQA 4HB2B 4HAZB 1UEFA 2COCA 4TKNA 1X05A 2RLOA 1EGXA 2P0HA 4WJ7A 2Z0PA 2YRYA 3U12A 2LKOA 5HE2A 2MFQA 2K00A 2V76A 3PVWA 1NU2A 3BINA 5DI9B 4MY6A 2IFSA 2KGXB 1ZVRA 1DDVA 2NMBA 2YF0A 2CY4A 1U29A 4OT1A 2AL6A 4MK0A 1U5EA 2Y8FA 4DIXA 2D9YA 4B6HA 1I2HA 1QQGA 1FHWA 4DX8A 4QJ5B 4A6HA 2ELBA 2LOZA 3HW2B 4OSNA 2CRFA 1MK7B 1K5DB 3P6AA 2D9ZA 4QXAB 4DXAB 4KHOA 5HE0A 5JP4A 2ROZB 2ZKMX 3PZDA 3NWFA 3X23A 2RVBB 1V88A 1SHCA 4HB4B 4PQ0A 4HAUB 3LJUX 2GS0A 4ZRJA 3V5WA 2ROVA 1Y5OA 2MDXA 5JHHA 5C79A 4KHBB 3PSCA 1PMSA 1U5GA 2FJUB 1WJ1A 3G9WA 1RJ2A 4Y94A 2IYBA 1U5DA 2VSZA 2DA0A 1DBHA 3FEHA 3SNHA 1X86A 2Y7BA
chains in the Genus database with same CATH topology
1MIZB 2D2QA 4WSFA 4GZUA 5D27A 5FI1A 2XQNM 4D0NB 4Z2MB 1WI1A 3KY9A 4KAXB 1IRSA 5JHGA 4HAWB 2Y8GA 3TW1A 3ZVRA 1H4RA 3ZDTA 3SUZA 2X18A 5DHFB 3CIKA 1UNQA 1W1GA 2P0FA 5J3YA 4A6KA 1V89A 2DLWA 2H7DA 2Z0OA 1WJMA 2OQBA 4K2PA 1XX0A 2L2IA 4K17A 3SV1A 3PP2A 2D4QA 5KQ4A 1U2BA 2RGNB 2KUPA 1ZC4B 4F7HA 4DX90 4EMOA 2DHKA 2OTXA 2VRWB 2W2WA 3A8PA 1BTKA 1E5WA 3DXCA 1XKEA 5D3YA 1EVHA 4MT7A 2COAA 2D9VA 3KSYA 2YT0A 4HHVA 5LONB 2GCJA 5C6RA 2I5FA 1MIXA 4CHJA 1XCGA 2CODA 1I7AA 4H8SA 1Z87A 4L6EA 1MAIA 1N3HA 2M38A 2YS3A 3IVFA 2J0JA 4Z2NA 2LOXA 1BAKA 2D11A 4YL8A 5J3QA 1TQZA 3VOQA 3PVLA 2DKQA 1FGZA 3AU4A 2LG1A 4GN1A 1LW3A 2I1KA 2RSGA 1WVHA 2I5CA 4PNKA 3D8EA 2K2UA 3AJ4A 2J0MA 1M7EA 3GYOA 4HAXB 2GCLA 5KCVA 3ODWA 4ZRIA 2YT1A 3ULCA 4HAYB 1X1GA 1X11A 4TYZA 1P3RA 2D10A 3A98B 2N0YA 3QIJA 4IAPA 1WGUA 2DKPA 3ML4A 3AU5A 3WA0A 1AQCA 4C0AA 2CY5A 1FB8A 5GOWB 3CXBB 1SGHA 4P7IA 3F0WA 3QWMA 3TO1A 1UNRA 1UNPA 4HDOA 3M1IB 1EF1A 1DROA 2AEHA 3TVVA 2DX1A 1J0WA 1U5FA 2MWNB 4A6FA 5KQ1A 5CLLB 3PEGA 2BCJA 3KRXA 4K2OA 3MDBC 3QBVB 4IOYX 4HATB 4WVFB 1ZC3B 2DHJA 1KI1B 5D3VA 1NTVA 3ODOA 2UVMA 4HDQA 5C5BA 5JLJB 3GYPA 1ZM0A 4IFSA 2DYNA 4YONA 2YS1A 4CHMA 1MPHA 2R0DA 3FM8C 1ZSQA 3PG7A 2M14A 1MKEA 3VIAA 4EKUA 2DHIA 2E2XA 4F7GA 1RRPB 2W2XC 1WGQA 1V61A 5D3WA 5LOPB 1FHOA 1OQNA 1XODA 2QKLA 4HAVB 2HTHB 3F5RA 1V5PA 1H10A 1PFJA 2UZRA 1XR0B 2LULA 3NSUA 3OANA 1DDWA 1KZGA 2KCJA 2D9WA 2W2XD 2P8VA 2G35A 3U7DA 1TJ6A 2DTCA 1P5TA 1EAZA 5FI0A 2HE7A 1PLSA 3MPXA 1X1FA 1FHXA 1DYNA 2J59M 2EMSA 3U8ZA 2YS5A 2ADZA 1FOEA 4XWXA 1ISNA 2ELAA 2RNRB 2R09A 5DH9B 5D3XA 4BBKA 4GMVA 5J3TA 2K2JA 4CYEA 1BWNA 1W1DA 2I1JA 3RCPA 1QC6A 1OY2A 1J19A 1KZ7A 1NI2A 2RUKB 1AWEA 3O96A 1DDMA 5CLQB 4KVGB 3WYFB 3FSSA 3DXDA 2QKMA 1OMWA 3BJIA 1WG7A 3ODXA 1XD4A 2PZ1A 3SYXA 5HE3A 3N7CA 4A6FB 2JP2A 2D9XA 3DXEA 2GJYA 2N23A 3KZ1A 1FAOA 1GG3A 4GPTB 1UPRA 2YVCA 4A5KA 3T06A 1FGYA 5DHAB 2EMTA 2LYDA 4GMXB 4F7UP 3KRWA 2L1CA 2J0KA 3UZTA 1Y19B 4NSWA 5C5BB 3PVUA 3TFMA 2DX5A 1GC7A 1B55A 1P6SA 2P0DA 1V5MA 4ZRKA 2NZ8B 2DN6A 4HB3B 4GXBA 2Z0QA 2DFKA 3HK0A 4HB0B 1K5GB 2COFA 2EC1A 3TCAA 1UPQA 1BTNA 2DYQA 2MKRA 2ZPYA 2Q13A 1Q67A 4KHAA 3D8FA 1W1HA 5EFXA 4K81A 1GC6A 3A8QA 2EJ8A 2H7EA 5HE1A 3HQCA 1M7RA 3P7ZA 1U27A 2CAYA 4NY0A 3D8DA 2FJLA 1TXDA 2YSZA 3ULBA 4DBBA 4EJNA 5DIFB 3SO6A 5L81A 2UZSA 1LB1A 1MK9B 1NTYA 5C16A 1V5UA 2VKIA 4HB2B 4HAZB 1UEFA 2COCA 4TKNA 1X05A 2RLOA 1EGXA 2P0HA 4WJ7A 2Z0PA 2YRYA 2LKOA 5HE2A 2MFQA 2K00A 2V76A 3PVWA 1NU2A 3BINA 5DI9B 4MY6A 2IFSA 2KGXB 1ZVRA 1DDVA 2NMBA 2YF0A 2CY4A 1U29A 2AL6A 4MK0A 1U5EA 2Y8FA 2D9YA 4B6HA 1I2HA 1QQGA 1FHWA 4DX8A 4A6HA 2ELBA 2LOZA 3HW2B 2CRFA 1MK7B 1K5DB 3P6AA 2D9ZA 4DXAB 4KHOA 5HE0A 5JP4A 2ROZB 3PZDA 3X23A 2RVBB 1V88A 1SHCA 4HB4B 4PQ0A 4HAUB 3LJUX 2GS0A 4ZRJA 3V5WA 2ROVA 1Y5OA 2MDXA 5JHHA 5C79A 4KHBB 3PSCA 1PMSA 1U5GA 1WJ1A 3G9WA 1RJ2A 4Y94A 2IYBA 1U5DA 2VSZA 2DA0A 1DBHA 3FEHA 3SNHA 1X86A 2Y7BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MIZ B;  2D2Q A;  4WSF A;  4GZU A;  5D27 A;  5FI1 A;  2XQN M;  4D0N B;  4Z2M B;  1WI1 A;  3KY9 A;  4KAX B;  1IRS A;  5JHG A;  4HAW B;  2Y8G A;  3TW1 A;  3ZVR A;  1H4R A;  3ZDT A;  3SUZ A;  2X18 A;  5DHF B;  3CIK A;  1UNQ A;  1W1G A;  2P0F A;  5J3Y A;  4A6K A;  1V89 A;  2DLW A;  2H7D A;  2Z0O A;  1WJM A;  2OQB A;  4K2P A;  1XX0 A;  2L2I A;  4K17 A;  3SV1 A;  3PP2 A;  2D4Q A;  5KQ4 A;  1U2B A;  2RGN B;  2KUP A;  1ZC4 B;  4F7H A;  4DX9 0;  4EMO A;  2DHK A;  2OTX A;  2VRW B;  2W2W A;  3A8P A;  1BTK A;  1E5W A;  3DXC A;  1XKE A;  5D3Y A;  1EVH A;  4MT7 A;  2COA A;  2D9V A;  3KSY A;  2YT0 A;  4HHV A;  5LON B;  2GCJ A;  5C6R A;  2I5F A;  1MIX A;  4CHJ A;  1XCG A;  2COD A;  1I7A A;  4H8S A;  1Z87 A;  4L6E A;  1MAI A;  1N3H A;  2M38 A;  2YS3 A;  3IVF A;  2J0J A;  4Z2N A;  2LOX A;  1BAK A;  2D11 A;  4YL8 A;  5J3Q A;  1TQZ A;  3VOQ A;  3PVL A;  2DKQ A;  1FGZ A;  3AU4 A;  2LG1 A;  4GN1 A;  1LW3 A;  2I1K A;  2RSG A;  1WVH A;  2I5C A;  4PNK A;  3D8E A;  2K2U A;  3AJ4 A;  2J0M A;  1M7E A;  3GYO A;  4HAX B;  2GCL A;  5KCV A;  3ODW A;  4ZRI A;  2YT1 A;  3ULC A;  4HAY B;  1X1G A;  1X11 A;  4TYZ A;  1P3R A;  2D10 A;  3A98 B;  2N0Y A;  3QIJ A;  4IAP A;  1WGU A;  2DKP A;  3ML4 A;  3AU5 A;  3WA0 A;  1AQC A;  4C0A A;  2CY5 A;  1FB8 A;  5GOW B;  3CXB B;  1SGH A;  4P7I A;  3F0W A;  3QWM A;  3TO1 A;  1UNR A;  1UNP A;  4HDO A;  3M1I B;  1EF1 A;  1DRO A;  2AEH A;  3TVV A;  2DX1 A;  1J0W A;  1U5F A;  2MWN B;  4A6F A;  5KQ1 A;  5CLL B;  3PEG A;  2BCJ A;  3KRX A;  4K2O A;  3MDB C;  3QBV B;  4IOY X;  4HAT B;  4WVF B;  1ZC3 B;  2DHJ A;  1KI1 B;  5D3V A;  1NTV A;  3ODO A;  2UVM A;  4HDQ A;  5C5B A;  5JLJ B;  3GYP A;  1ZM0 A;  4IFS A;  2DYN A;  4YON A;  2YS1 A;  4CHM A;  1MPH A;  2R0D A;  3FM8 C;  1ZSQ A;  3PG7 A;  2M14 A;  1MKE A;  3VIA A;  4EKU A;  2DHI A;  2E2X A;  4F7G A;  1RRP B;  2W2X C;  1WGQ A;  1V61 A;  5D3W A;  5LOP B;  1FHO A;  1OQN A;  1XOD A;  2QKL A;  4HAV B;  2HTH B;  3F5R A;  1V5P A;  1H10 A;  1PFJ A;  2UZR A;  1XR0 B;  2LUL A;  3NSU A;  3OAN A;  1DDW A;  1KZG A;  2KCJ A;  2D9W A;  2W2X D;  2P8V A;  2G35 A;  3U7D A;  1TJ6 A;  2DTC A;  1P5T A;  1EAZ A;  5FI0 A;  2HE7 A;  1PLS A;  3MPX A;  1X1F A;  1FHX A;  1DYN A;  2J59 M;  2EMS A;  3U8Z A;  2YS5 A;  2ADZ A;  1FOE A;  4XWX A;  1ISN A;  2ELA A;  2RNR B;  2R09 A;  5DH9 B;  5D3X A;  4BBK A;  4GMV A;  5J3T A;  2K2J A;  4CYE A;  1BWN A;  1W1D A;  2I1J A;  3RCP A;  1QC6 A;  1OY2 A;  1J19 A;  1KZ7 A;  1NI2 A;  2RUK B;  1AWE A;  3O96 A;  1DDM A;  5CLQ B;  4KVG B;  3WYF B;  3FSS A;  3DXD A;  2QKM A;  1OMW A;  3BJI A;  1WG7 A;  3ODX A;  1XD4 A;  2PZ1 A;  3SYX A;  5HE3 A;  3N7C A;  4A6F B;  2JP2 A;  2D9X A;  3DXE A;  2GJY A;  2N23 A;  3KZ1 A;  1FAO A;  1GG3 A;  4GPT B;  1UPR A;  2YVC A;  4A5K A;  3T06 A;  1FGY A;  5DHA B;  2EMT A;  2LYD A;  4GMX B;  4F7U P;  3KRW A;  2L1C A;  2J0K A;  3UZT A;  1Y19 B;  4NSW A;  5C5B B;  3PVU A;  3TFM A;  2DX5 A;  1GC7 A;  1B55 A;  1P6S A;  2P0D A;  1V5M A;  4ZRK A;  2NZ8 B;  2DN6 A;  4HB3 B;  4GXB A;  2Z0Q A;  2DFK A;  3HK0 A;  4HB0 B;  1K5G B;  2COF A;  2EC1 A;  3TCA A;  1UPQ A;  1BTN A;  2DYQ A;  2MKR A;  2ZPY A;  2Q13 A;  1Q67 A;  4KHA A;  3D8F A;  1W1H A;  5EFX A;  4K81 A;  1GC6 A;  3A8Q A;  2EJ8 A;  2H7E A;  5HE1 A;  3HQC A;  1M7R A;  3P7Z A;  1U27 A;  2CAY A;  4NY0 A;  3D8D A;  2FJL A;  1TXD A;  2YSZ A;  3ULB A;  4DBB A;  4EJN A;  5DIF B;  3SO6 A;  5L81 A;  2UZS A;  1LB1 A;  1MK9 B;  1NTY A;  5C16 A;  1V5U A;  2VKI A;  4HB2 B;  4HAZ B;  1UEF A;  2COC A;  4TKN A;  1X05 A;  2RLO A;  1EGX A;  2P0H A;  4WJ7 A;  2Z0P A;  2YRY A;  2LKO A;  5HE2 A;  2MFQ A;  2K00 A;  2V76 A;  3PVW A;  1NU2 A;  3BIN A;  5DI9 B;  4MY6 A;  2IFS A;  2KGX B;  1ZVR A;  1DDV A;  2NMB A;  2YF0 A;  2CY4 A;  1U29 A;  2AL6 A;  4MK0 A;  1U5E A;  2Y8F A;  2D9Y A;  4B6H A;  1I2H A;  1QQG A;  1FHW A;  4DX8 A;  4A6H A;  2ELB A;  2LOZ A;  3HW2 B;  2CRF A;  1MK7 B;  1K5D B;  3P6A A;  2D9Z A;  4DXA B;  4KHO A;  5HE0 A;  5JP4 A;  2ROZ B;  3PZD A;  3X23 A;  2RVB B;  1V88 A;  1SHC A;  4HB4 B;  4PQ0 A;  4HAU B;  3LJU X;  2GS0 A;  4ZRJ A;  3V5W A;  2ROV A;  1Y5O A;  2MDX A;  5JHH A;  5C79 A;  4KHB B;  3PSC A;  1PMS A;  1U5G A;  1WJ1 A;  3G9W A;  1RJ2 A;  4Y94 A;  2IYB A;  1U5D A;  2VSZ A;  2DA0 A;  1DBH A;  3FEH A;  3SNH A;  1X86 A;  2Y7B A; 
#chains in the Genus database with same CATH topology
 1MIZ B;  2D2Q A;  4WSF A;  4GZU A;  5D27 A;  5FI1 A;  2XQN M;  4D0N B;  4Z2M B;  1WI1 A;  3KY9 A;  4KAX B;  2K49 A;  1IRS A;  4GOU A;  5JHG A;  4HAW B;  2Y8G A;  2Z59 A;  3TW1 A;  3ZVR A;  1H4R A;  3ZDT A;  3SUZ A;  2X18 A;  5DHF B;  3CIK A;  1UNQ A;  1W1G A;  2P0F A;  5J3Y A;  4A6K A;  1V89 A;  2DLW A;  2H7D A;  2Z0O A;  1WJM A;  2R2Y A;  2OQB A;  4K2P A;  1XX0 A;  3NWD A;  2L2I A;  4HSI A;  4K17 A;  3SV1 A;  3PP2 A;  2D4Q A;  2K8E A;  5KQ4 A;  1U2B A;  2RGN B;  2KUP A;  1ZC4 B;  4F7H A;  4DX9 0;  4EMO A;  2DHK A;  3FVC A;  2OTX A;  2VRW B;  2W2W A;  3A8P A;  1BTK A;  1E5W A;  3DXC A;  4CSQ A;  1XKE A;  5D3Y A;  1EVH A;  4MT7 A;  2COA A;  2D9V A;  3NW8 A;  3KSY A;  2YT0 A;  2GUM A;  4HHV A;  5LON B;  2GCJ A;  5C6R A;  2I5F A;  1MIX A;  4CHJ A;  1XCG A;  2COD A;  1I7A A;  4H8S A;  1Z87 A;  4L6E A;  1MAI A;  1N3H A;  2M38 A;  2YS3 A;  3IVF A;  2J0J A;  4Z2N A;  5LG4 B;  2LOX A;  1BAK A;  2D11 A;  4YL8 A;  5J3Q A;  1TQZ A;  3VOQ A;  1T77 A;  3PVL A;  2DKQ A;  1FGZ A;  3AU4 A;  2LG1 A;  4GN1 A;  1LW3 A;  2I1K A;  2RSG A;  1WVH A;  2I5C A;  4PNK A;  3D8E A;  2K2U A;  3AJ4 A;  2J0M A;  1M7E A;  3GYO A;  4HAX B;  2GCL A;  5KCV A;  3ODW A;  4ZRI A;  2YT1 A;  3ULC A;  4HAY B;  1X1G A;  1X11 A;  4TYZ A;  1P3R A;  2D10 A;  3A98 B;  2N0Y A;  3QIJ A;  4IAP A;  1WGU A;  2DKP A;  3ML4 A;  3AU5 A;  3WA0 A;  5IRS A;  1AQC A;  4C0A A;  2CY5 A;  1FB8 A;  5GOW B;  3CXB B;  1SGH A;  4P7I A;  3DCX A;  3F0W A;  3QWM A;  3TO1 A;  1UNR A;  1UNP A;  4HDO A;  3M1I B;  1EF1 A;  1DRO A;  2AEH A;  3TVV A;  2DX1 A;  1J0W A;  1U5F A;  2MWN B;  4A6F A;  5KQ1 A;  5CLL B;  3PEG A;  2BCJ A;  3KRX A;  4K2O A;  5I2M A;  3MDB C;  3QBV B;  4IOY X;  4HAT B;  4WVF B;  1ZC3 B;  3HSA A;  2DHJ A;  1KI1 B;  2NBV A;  5D3V A;  1NTV A;  3ODO A;  5I2S A;  2UVM A;  3NWA A;  4HDQ A;  5C5B A;  5JLJ B;  3GYP A;  1ZM0 A;  4IFS A;  2DYN A;  4YON A;  2YS1 A;  4CHM A;  1MPH A;  2R0D A;  3FM8 C;  1ZSQ A;  3PG7 A;  2M14 A;  1MKE A;  3VIA A;  4EKU A;  2DHI A;  2E2X A;  4F7G A;  1RRP B;  2W2X C;  1WGQ A;  1V61 A;  5D3W A;  2Z14 A;  5LOP B;  1FHO A;  1OQN A;  1XOD A;  2QKL A;  4HAV B;  2HTH B;  2KR0 A;  1V5P A;  3F5R A;  1H10 A;  1PFJ A;  2UZR A;  1XR0 B;  2LUL A;  3NSU A;  4L1R A;  3OAN A;  1DDW A;  1KZG A;  2KCJ A;  2D9W A;  2W2X D;  2P8V A;  2G35 A;  3U7D A;  1TJ6 A;  2DTC A;  1P5T A;  1EAZ A;  5FI0 A;  2HE7 A;  1PLS A;  4GNK B;  3MPX A;  1X1F A;  1FHX A;  1DYN A;  2J59 M;  2EMS A;  3U8Z A;  2YS5 A;  2YT2 A;  2ADZ A;  1FOE A;  4XWX A;  1ISN A;  2ELA A;  2RNR B;  2R09 A;  5DH9 B;  5D3X A;  4BBK A;  4GMV A;  5J3T A;  2K2J A;  4CYE A;  1BWN A;  1W1D A;  2I1J A;  3RCP A;  1QC6 A;  1OY2 A;  1J19 A;  4D6W A;  1KZ7 A;  1NI2 A;  2RUK B;  1AWE A;  3O96 A;  1DDM A;  5CLQ B;  4KVG B;  3WYF B;  3FSS A;  3DXD A;  2QKM A;  1OMW A;  3BJI A;  2RRF A;  2Z4D A;  1WG7 A;  1XD4 A;  3ODX A;  2PZ1 A;  3SYX A;  3B77 A;  5HE3 A;  3N7C A;  3OHM B;  4A6F B;  2JP2 A;  2D9X A;  3DXE A;  2GJY A;  2N23 A;  3A58 A;  3KZ1 A;  1FAO A;  1GG3 A;  4GPT B;  1UPR A;  2YVC A;  4A5K A;  3T06 A;  1FGY A;  5DHA B;  2EMT A;  2LYD A;  4GMX B;  4F7U P;  3KRW A;  1ZYI A;  2L1C A;  2J0K A;  3UZT A;  1Y19 B;  4NSW A;  5C5B B;  3PVU A;  3TFM A;  2DX5 A;  1GC7 A;  2KIE A;  1B55 A;  1P6S A;  2P0D A;  1V5M A;  4ZRK A;  2NZ8 B;  2DN6 A;  4HB3 B;  4GXB A;  2Z0Q A;  2DFK A;  3HK0 A;  2Z13 A;  4HB0 B;  1K5G B;  4QJ3 B;  2COF A;  2EC1 A;  3TCA A;  1UPQ A;  1BTN A;  4KHB A;  2DYQ A;  2MKR A;  2ZPY A;  2Q13 A;  1Q67 A;  4KHA A;  3D8F A;  1W1H A;  5EFX A;  4QJ4 B;  4K81 A;  1GC6 A;  3A8Q A;  2EJ8 A;  2H7E A;  5M4Y B;  5HE1 A;  3HQC A;  1M7R A;  3P7Z A;  1U27 A;  2CAY A;  4NY0 A;  3D8D A;  2FJL A;  1TXD A;  2YSZ A;  3ULB A;  4DBB A;  4EJN A;  3HIE A;  5DIF B;  3SO6 A;  5L81 A;  2UZS A;  1LB1 A;  1MK9 B;  1NTY A;  2KIG A;  5C16 A;  1V5U A;  2VKI A;  1MI1 A;  2KUQ A;  4HB2 B;  4HAZ B;  1UEF A;  2COC A;  4TKN A;  1X05 A;  2RLO A;  1EGX A;  2P0H A;  4WJ7 A;  2Z0P A;  2YRY A;  3U12 A;  2LKO A;  5HE2 A;  2MFQ A;  2K00 A;  2V76 A;  3PVW A;  1NU2 A;  3BIN A;  5DI9 B;  4MY6 A;  2IFS A;  2KGX B;  1ZVR A;  1DDV A;  2NMB A;  2YF0 A;  2CY4 A;  1U29 A;  4OT1 A;  2AL6 A;  4MK0 A;  1U5E A;  2Y8F A;  4DIX A;  2D9Y A;  4B6H A;  1I2H A;  1QQG A;  1FHW A;  4DX8 A;  4QJ5 B;  4A6H A;  2ELB A;  2LOZ A;  3HW2 B;  4OSN A;  2CRF A;  1MK7 B;  1K5D B;  3P6A A;  2D9Z A;  4QXA B;  4DXA B;  4KHO A;  5HE0 A;  5JP4 A;  2ROZ B;  2ZKM X;  3PZD A;  3NWF A;  3X23 A;  2RVB B;  1V88 A;  1SHC A;  4HB4 B;  4PQ0 A;  4HAU B;  3LJU X;  2GS0 A;  4ZRJ A;  3V5W A;  2ROV A;  1Y5O A;  2MDX A;  5JHH A;  5C79 A;  4KHB B;  3PSC A;  1PMS A;  1U5G A;  2FJU B;  1WJ1 A;  3G9W A;  1RJ2 A;  4Y94 A;  2IYB A;  1U5D A;  2VSZ A;  2DA0 A;  1DBH A;  3FEH A;  3SNH A;  1X86 A;  2Y7B A; 
#chains in the Genus database with same CATH homology
 1MIZ B;  2D2Q A;  4WSF A;  4GZU A;  5D27 A;  5FI1 A;  2XQN M;  4D0N B;  4Z2M B;  1WI1 A;  3KY9 A;  4KAX B;  1IRS A;  5JHG A;  4HAW B;  2Y8G A;  3TW1 A;  3ZVR A;  1H4R A;  3ZDT A;  3SUZ A;  2X18 A;  5DHF B;  3CIK A;  1UNQ A;  1W1G A;  2P0F A;  5J3Y A;  4A6K A;  1V89 A;  2DLW A;  2H7D A;  2Z0O A;  1WJM A;  2OQB A;  4K2P A;  1XX0 A;  2L2I A;  4K17 A;  3SV1 A;  3PP2 A;  2D4Q A;  5KQ4 A;  1U2B A;  2RGN B;  2KUP A;  1ZC4 B;  4F7H A;  4DX9 0;  4EMO A;  2DHK A;  2OTX A;  2VRW B;  2W2W A;  3A8P A;  1BTK A;  1E5W A;  3DXC A;  1XKE A;  5D3Y A;  1EVH A;  4MT7 A;  2COA A;  2D9V A;  3KSY A;  2YT0 A;  4HHV A;  5LON B;  2GCJ A;  5C6R A;  2I5F A;  1MIX A;  4CHJ A;  1XCG A;  2COD A;  1I7A A;  4H8S A;  1Z87 A;  4L6E A;  1MAI A;  1N3H A;  2M38 A;  2YS3 A;  3IVF A;  2J0J A;  4Z2N A;  2LOX A;  1BAK A;  2D11 A;  4YL8 A;  5J3Q A;  1TQZ A;  3VOQ A;  3PVL A;  2DKQ A;  1FGZ A;  3AU4 A;  2LG1 A;  4GN1 A;  1LW3 A;  2I1K A;  2RSG A;  1WVH A;  2I5C A;  4PNK A;  3D8E A;  2K2U A;  3AJ4 A;  2J0M A;  1M7E A;  3GYO A;  4HAX B;  2GCL A;  5KCV A;  3ODW A;  4ZRI A;  2YT1 A;  3ULC A;  4HAY B;  1X1G A;  1X11 A;  4TYZ A;  1P3R A;  2D10 A;  3A98 B;  2N0Y A;  3QIJ A;  4IAP A;  1WGU A;  2DKP A;  3ML4 A;  3AU5 A;  3WA0 A;  1AQC A;  4C0A A;  2CY5 A;  1FB8 A;  5GOW B;  3CXB B;  1SGH A;  4P7I A;  3F0W A;  3QWM A;  3TO1 A;  1UNR A;  1UNP A;  4HDO A;  3M1I B;  1EF1 A;  1DRO A;  2AEH A;  3TVV A;  2DX1 A;  1J0W A;  1U5F A;  2MWN B;  4A6F A;  5KQ1 A;  5CLL B;  3PEG A;  2BCJ A;  3KRX A;  4K2O A;  3MDB C;  3QBV B;  4IOY X;  4HAT B;  4WVF B;  1ZC3 B;  2DHJ A;  1KI1 B;  5D3V A;  1NTV A;  3ODO A;  2UVM A;  4HDQ A;  5C5B A;  5JLJ B;  3GYP A;  1ZM0 A;  4IFS A;  2DYN A;  4YON A;  2YS1 A;  4CHM A;  1MPH A;  2R0D A;  3FM8 C;  1ZSQ A;  3PG7 A;  2M14 A;  1MKE A;  3VIA A;  4EKU A;  2DHI A;  2E2X A;  4F7G A;  1RRP B;  2W2X C;  1WGQ A;  1V61 A;  5D3W A;  5LOP B;  1FHO A;  1OQN A;  1XOD A;  2QKL A;  4HAV B;  2HTH B;  3F5R A;  1V5P A;  1H10 A;  1PFJ A;  2UZR A;  1XR0 B;  2LUL A;  3NSU A;  3OAN A;  1DDW A;  1KZG A;  2KCJ A;  2D9W A;  2W2X D;  2P8V A;  2G35 A;  3U7D A;  1TJ6 A;  2DTC A;  1P5T A;  1EAZ A;  5FI0 A;  2HE7 A;  1PLS A;  3MPX A;  1X1F A;  1FHX A;  1DYN A;  2J59 M;  2EMS A;  3U8Z A;  2YS5 A;  2ADZ A;  1FOE A;  4XWX A;  1ISN A;  2ELA A;  2RNR B;  2R09 A;  5DH9 B;  5D3X A;  4BBK A;  4GMV A;  5J3T A;  2K2J A;  4CYE A;  1BWN A;  1W1D A;  2I1J A;  3RCP A;  1QC6 A;  1OY2 A;  1J19 A;  1KZ7 A;  1NI2 A;  2RUK B;  1AWE A;  3O96 A;  1DDM A;  5CLQ B;  4KVG B;  3WYF B;  3FSS A;  3DXD A;  2QKM A;  1OMW A;  3BJI A;  1WG7 A;  3ODX A;  1XD4 A;  2PZ1 A;  3SYX A;  5HE3 A;  3N7C A;  4A6F B;  2JP2 A;  2D9X A;  3DXE A;  2GJY A;  2N23 A;  3KZ1 A;  1FAO A;  1GG3 A;  4GPT B;  1UPR A;  2YVC A;  4A5K A;  3T06 A;  1FGY A;  5DHA B;  2EMT A;  2LYD A;  4GMX B;  4F7U P;  3KRW A;  2L1C A;  2J0K A;  3UZT A;  1Y19 B;  4NSW A;  5C5B B;  3PVU A;  3TFM A;  2DX5 A;  1GC7 A;  1B55 A;  1P6S A;  2P0D A;  1V5M A;  4ZRK A;  2NZ8 B;  2DN6 A;  4HB3 B;  4GXB A;  2Z0Q A;  2DFK A;  3HK0 A;  4HB0 B;  1K5G B;  2COF A;  2EC1 A;  3TCA A;  1UPQ A;  1BTN A;  2DYQ A;  2MKR A;  2ZPY A;  2Q13 A;  1Q67 A;  4KHA A;  3D8F A;  1W1H A;  5EFX A;  4K81 A;  1GC6 A;  3A8Q A;  2EJ8 A;  2H7E A;  5HE1 A;  3HQC A;  1M7R A;  3P7Z A;  1U27 A;  2CAY A;  4NY0 A;  3D8D A;  2FJL A;  1TXD A;  2YSZ A;  3ULB A;  4DBB A;  4EJN A;  5DIF B;  3SO6 A;  5L81 A;  2UZS A;  1LB1 A;  1MK9 B;  1NTY A;  5C16 A;  1V5U A;  2VKI A;  4HB2 B;  4HAZ B;  1UEF A;  2COC A;  4TKN A;  1X05 A;  2RLO A;  1EGX A;  2P0H A;  4WJ7 A;  2Z0P A;  2YRY A;  2LKO A;  5HE2 A;  2MFQ A;  2K00 A;  2V76 A;  3PVW A;  1NU2 A;  3BIN A;  5DI9 B;  4MY6 A;  2IFS A;  2KGX B;  1ZVR A;  1DDV A;  2NMB A;  2YF0 A;  2CY4 A;  1U29 A;  2AL6 A;  4MK0 A;  1U5E A;  2Y8F A;  2D9Y A;  4B6H A;  1I2H A;  1QQG A;  1FHW A;  4DX8 A;  4A6H A;  2ELB A;  2LOZ A;  3HW2 B;  2CRF A;  1MK7 B;  1K5D B;  3P6A A;  2D9Z A;  4DXA B;  4KHO A;  5HE0 A;  5JP4 A;  2ROZ B;  3PZD A;  3X23 A;  2RVB B;  1V88 A;  1SHC A;  4HB4 B;  4PQ0 A;  4HAU B;  3LJU X;  2GS0 A;  4ZRJ A;  3V5W A;  2ROV A;  1Y5O A;  2MDX A;  5JHH A;  5C79 A;  4KHB B;  3PSC A;  1PMS A;  1U5G A;  1WJ1 A;  3G9W A;  1RJ2 A;  4Y94 A;  2IYB A;  1U5D A;  2VSZ A;  2DA0 A;  1DBH A;  3FEH A;  3SNH A;  1X86 A;  2Y7B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...