1FGYA

Grp1 ph domain with ins(1,3,4,5)p4
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
127
structure length
127
Chain Sequence
TFFNPDREGWLLKLGGRVKTWKRRWFILTDNCLYYFEYTTDKEPRGIIPLENLSIREVLDPRKPNCFELYNPSHKGQVIKACKTEADGRVVEGNHVVYRISAPSPEEKEEWMKSIKASISRDPFYDM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords GRP1
publication title Structural basis of 3-phosphoinositide recognition by pleckstrin homology domains.
pubmed doi rcsb
source organism Mus musculus
molecule tags Signaling protein
total genus 23
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2000-07-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00169 PH PH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 1fgyA00
5HE3A 1P6SA 2FJLA 3ZDTA 4K2PA 4H8SA 5D3WA 2M14A 1DDMA 5J3TA 4B6HA 1SHCA 1XCGA 4KHOA 1XD4A 4HAVB 1I7AA 5J3QA 3CIKA 1EAZA 2GJYA 2P0HA 4WSFA 3RCPA 2KCJA 4GZUA 1WG7A 2K2UA 1M7EA 2P8VA 2GS0A 5GOWB 4WVFB 5JLJB 2D9ZA 1PMSA 1U5EA 1Y19B 4HAUB 1K5DB 1J19A 4Z2NA 2RNRB 1RJ2A 1AQCA 4C0AA 3V5WA 4GXBA 4WJ7A 5J3YA 1V88A 2P0FA 2VKIA 2Z0OA 1ZSQA 2DHJA 4DBBA 2G35A 3SV1A 2YRYA 4K17A 1U5FA 2KUPA 1GC6A 2D9YA 1H10A 5D3VA 5FI0A 4KHBB 2RUKB 1DYNA 1TJ6A 2DKQA 2NZ8B 2EJ8A 4HDQA 4DX90 2EMTA 4MT7A 3KY9A 3KSYA 3UZTA 2DX5A 2LOXA 3HW2B 2ROVA 4HAZB 2D9XA 4EKUA 3M1IB 4CHJA 1V5UA 1E5WA 4GMXB 4CYEA 3NSUA 1KZGA 4HB3B 5C6RA 5KQ4A 2V76A 2COAA 1XR0B 2D11A 1N3HA 5CLQB 3PVUA 5DH9B 2XQNM 2D2QA 1NTVA 2K00A 3ODXA 2YS1A 3ULCA 1M7RA 2YSZA 3ULBA 1P3RA 2ADZA 1FHWA 4YL8A 4CHMA 3AU4A 1W1HA 2CODA 1DROA 2PZ1A 2GCJA 1EGXA 2H7EA 2E2XA 3T06A 2DHIA 3GYOA 2N0YA 1XKEA 3DXEA 2MKRA 3F0WA 1WI1A 4IAPA 4DX8A 4A6FB 1I2HA 2COCA 3KZ1A 2ELBA 2I1JA 5JP4A 1ZM0A 1MPHA 1QQGA 3FM8C 2UVMA 5CLLB 2DKPA 1V5PA 3ML4A 2OTXA 3BJIA 3HQCA 1WJMA 4HAXB 3TFMA 1UNQA 2J0MA 2Z0PA 1OMWA 2DN6A 1GG3A 1UEFA 5C16A 2ELAA 1ZVRA 4TYZA 5KCVA 2VRWB 3CXBB 2ZPYA 2L2IA 2DLWA 4HHVA 2R0DA 1XODA 2CRFA 3QBVB 3IVFA 4XWXA 3AU5A 4IOYX 1RRPB 1X86A 2KGXB 1NTYA 2J0JA 4L6EA 1MIZB 2LKOA 3SNHA 3QIJA 3PG7A 3SYXA 4TKNA 1WVHA 2IFSA 3KRWA 1P5TA 4YONA 3PVLA 1X1GA 3MDBC 3GYPA 2LULA 2HTHB 4K2OA 1FGYA 1WGQA 5D27A 3P6AA 4A6FA 3PZDA 1EVHA 1B55A 2DFKA 1X11A 3PP2A 1FGZA 2COFA 1ISNA 2W2XD 4MK0A 5LOPB 2RLOA 2AEHA 2CY5A 2VSZA 3X23A 4GMVA 2Q13A 2EC1A 2DX1A 4ZRKA 2EMSA 1ZC4B 2L1CA 4MY6A 2I5CA 2P0DA 4ZRIA 2RVBB 4HB0B 4D0NB 1AWEA 1V5MA 5DI9B 3KRXA 4HAWB 3PSCA 4KVGB 3WYFB 3A8QA 4EJNA 2LG1A 5FI1A 2JP2A 1BAKA 3D8DA 5HE2A 3U8ZA 2DTCA 4Y94A 1MAIA 3DXCA 2I5FA 1DDWA 1UPQA 4K81A 1MK9B 4HDOA 3WA0A 5JHHA 2D4QA 4F7HA 3U7DA 4NSWA 3A8PA 3PVWA 1U2BA 2YVCA 1SGHA 1LB1A 1U29A 1FHOA 2NMBA 2X18A 3FSSA 1DDVA 2LYDA 3P7ZA 3LJUX 5DHFB 4PNKA 2CAYA 5LONB 2YT0A 1WGUA 4HB2B 1X1FA 1FAOA 1DBHA 1W1GA 1H4RA 3HK0A 4KAXB 2QKMA 4NY0A 5D3YA 3TVVA 5HE0A 2MWNB 2DA0A 2UZSA 1UNPA 1X05A 2R09A 4ZRJA 5HE1A 3D8EA 5DHAB 2DYNA 3MPXA 2W2WA 2CY4A 2AL6A 1FHXA 2D9VA 1MIXA 1V61A 1Y5OA 4A6HA 3SO6A 1MK7B 5L81A 4BBKA 2BCJA 3TCAA 1Q67A 2ROZB 1BWNA 4KHAA 1UPRA 1QC6A 2DYQA 5D3XA 3VIAA 3OANA 1Z87A 2RGNB 1OQNA 3DXDA 3AJ4A 1K5GB 3FEHA 4HB4B 5EFXA 3TO1A 2D9WA 3O96A 2YS5A 5JHGA 4EMOA 2N23A 3SUZA 5KQ1A 1V89A 4Z2MB 3QWMA 2K2JA 1XX0A 2W2XC 1OY2A 2YS3A 1U5DA 1ZC3B 2Y7BA 5C5BB 1NI2A 1MKEA 2YF0A 1TQZA 1FB8A 1W1DA 4GPTB 2HE7A 3PEGA 2GCLA 4PQ0A 2RSGA 3G9WA 4IFSA 4GN1A 1KZ7A 4F7GA 3VOQA 3ZVRA 1TXDA 4P7IA 1PLSA 1UNRA 1PFJA 4HAYB 1U5GA 4HATB 3ODOA 2QKLA 2D10A 2J59M 4A5KA 1NU2A 3BINA 2IYBA 1WJ1A 3N7CA 4F7UP 1EF1A 1BTNA 3A98B 2LOZA 2Z0QA 1U27A 2M38A 2MFQA 3F5RA 1J0WA 2H7DA 2Y8GA 5C5BA 2Y8FA 1IRSA 2UZRA 1BTKA 1KI1B 4DXAB 3TW1A 2I1KA 3ODWA 2YT1A 1LW3A 5C79A 2OQBA 2MDXA 1FOEA 2DHKA 3D8FA 5DIFB 1GC7A 2J0KA 4A6KA
chains in the Genus database with same CATH superfamily
5HE3A 1P6SA 2FJLA 3ZDTA 4K2PA 4H8SA 5D3WA 2M14A 4DIXA 1DDMA 5J3TA 4B6HA 1SHCA 4HSIA 1XCGA 4QXAB 4KHOA 1XD4A 4HAVB 1I7AA 5J3QA 3CIKA 1EAZA 3OHMB 2GJYA 2P0HA 4WSFA 3RCPA 2KCJA 4GZUA 1WG7A 2K2UA 1M7EA 2P8VA 2GS0A 2KUQA 5GOWB 4WVFB 5JLJB 2D9ZA 1PMSA 1U5EA 1Y19B 4HAUB 1K5DB 1J19A 4Z2NA 4D6WA 2RNRB 1RJ2A 1AQCA 4C0AA 3V5WA 4GXBA 4WJ7A 4QJ4B 5J3YA 1V88A 2P0FA 2VKIA 2Z0OA 1ZSQA 2DHJA 4DBBA 2G35A 3SV1A 2YRYA 4K17A 3NW8A 1U5FA 2KUPA 1GC6A 2D9YA 1H10A 5D3VA 5FI0A 4KHBB 2RUKB 1DYNA 1TJ6A 2DKQA 2NZ8B 2EJ8A 4HDQA 4DX90 2EMTA 4MT7A 3KY9A 3KSYA 3UZTA 2DX5A 3HW2B 2LOXA 2ROVA 4OSNA 4HAZB 2D9XA 4EKUA 3M1IB 4CHJA 1V5UA 1E5WA 4GMXB 4CYEA 3NSUA 1KZGA 4HB3B 5C6RA 5KQ4A 2V76A 2COAA 1XR0B 2D11A 1N3HA 5CLQB 3PVUA 5DH9B 2XQNM 2D2QA 4L1RA 1NTVA 2K00A 1ZYIA 3ODXA 2YS1A 3ULCA 1T77A 2R2YA 1M7RA 2YSZA 3ULBA 1P3RA 2ADZA 1FHWA 3A58A 4YL8A 4CHMA 3AU4A 1W1HA 2CODA 1DROA 2PZ1A 2GCJA 1EGXA 2H7EA 5LG4B 2E2XA 3T06A 2DHIA 3GYOA 2N0YA 5IRSA 1XKEA 3DXEA 2MKRA 3F0WA 1WI1A 4IAPA 4DX8A 4A6FB 1I2HA 2COCA 3KZ1A 2ELBA 2I1JA 5JP4A 1ZM0A 1MPHA 1QQGA 3FM8C 2UVMA 5CLLB 2DKPA 1V5PA 3ML4A 2OTXA 3BJIA 3HQCA 1WJMA 4HAXB 3TFMA 1UNQA 2J0MA 2Z0PA 1OMWA 2DN6A 1GG3A 1UEFA 5C16A 2ELAA 1ZVRA 4TYZA 5KCVA 2VRWB 3CXBB 2ZPYA 2L2IA 2DLWA 1MI1A 4HHVA 2R0DA 1XODA 2CRFA 2Z4DA 3IVFA 3QBVB 5M4YB 4XWXA 3AU5A 4IOYX 1RRPB 1X86A 2KGXB 1NTYA 3NWDA 2J0JA 4L6EA 1MIZB 2LKOA 3SNHA 3B77A 3QIJA 3PG7A 3SYXA 4TKNA 1WVHA 2IFSA 3KRWA 1P5TA 4YONA 3PVLA 2K8EA 3HIEA 1X1GA 3MDBC 3GYPA 2LULA 2HTHB 4K2OA 1FGYA 1WGQA 5D27A 3P6AA 4A6FA 3PZDA 1EVHA 2YT2A 4GOUA 1B55A 2DFKA 1X11A 3PP2A 1FGZA 2COFA 1ISNA 2W2XD 4MK0A 5LOPB 2RLOA 2AEHA 4QJ3B 2CY5A 2VSZA 3NWFA 3X23A 4GMVA 2Q13A 2EC1A 2DX1A 4ZRKA 2EMSA 1ZC4B 2L1CA 4MY6A 2I5CA 4QJ5B 2P0DA 4ZRIA 2RVBB 4HB0B 4D0NB 1AWEA 1V5MA 5DI9B 3KRXA 4HAWB 3PSCA 4KVGB 4CSQA 3WYFB 3A8QA 4EJNA 2LG1A 5FI1A 2JP2A 1BAKA 3D8DA 5HE2A 3U8ZA 2DTCA 4Y94A 1MAIA 3DCXA 3DXCA 2I5FA 1DDWA 1UPQA 4K81A 1MK9B 4HDOA 3WA0A 5JHHA 2D4QA 4F7HA 3U7DA 4NSWA 3A8PA 3PVWA 1U2BA 2YVCA 1SGHA 1LB1A 1U29A 1FHOA 2NMBA 2X18A 3FSSA 4KHBA 1DDVA 2LYDA 3P7ZA 3LJUX 5DHFB 4PNKA 2CAYA 5LONB 2GUMA 2YT0A 1WGUA 4HB2B 1X1FA 2ZKMX 1FAOA 1DBHA 2KR0A 1W1GA 1H4RA 3HK0A 4KAXB 2QKMA 4NY0A 5D3YA 3TVVA 5HE0A 2MWNB 2DA0A 2UZSA 1UNPA 1X05A 2R09A 2NBVA 4ZRJA 5HE1A 3D8EA 5DHAB 2DYNA 3MPXA 2W2WA 2CY4A 2AL6A 1FHXA 2D9VA 1MIXA 1V61A 1Y5OA 2RRFA 4A6HA 3SO6A 1MK7B 5L81A 4BBKA 2KIGA 2BCJA 3TCAA 1Q67A 2ROZB 1BWNA 4KHAA 1UPRA 1QC6A 2DYQA 5D3XA 3VIAA 3OANA 1Z87A 2KIEA 2FJUB 2RGNB 4OT1A 1OQNA 3DXDA 3AJ4A 1K5GB 3FEHA 5I2MA 4HB4B 5EFXA 3TO1A 2D9WA 3O96A 2YS5A 5JHGA 4EMOA 3U12A 2N23A 3SUZA 5KQ1A 1V89A 4Z2MB 3QWMA 2K2JA 1XX0A 2W2XC 1OY2A 2K49A 2YS3A 1U5DA 1ZC3B 2Y7BA 5C5BB 1NI2A 1MKEA 2YF0A 1TQZA 1FB8A 1W1DA 4GPTB 2HE7A 3PEGA 2GCLA 4PQ0A 2RSGA 3G9WA 4IFSA 4GN1A 1KZ7A 4F7GA 3VOQA 3ZVRA 1TXDA 4P7IA 1PLSA 2Z59A 3FVCA 1UNRA 1PFJA 4HAYB 1U5GA 4HATB 3ODOA 2QKLA 2D10A 2J59M 4A5KA 1NU2A 3BINA 2IYBA 5I2SA 1WJ1A 3N7CA 4F7UP 3HSAA 1EF1A 2Z14A 4GNKB 1BTNA 3A98B 2LOZA 2Z13A 2Z0QA 1U27A 2M38A 2MFQA 3F5RA 1J0WA 2H7DA 2Y8GA 5C5BA 2Y8FA 1IRSA 2UZRA 1BTKA 1KI1B 4DXAB 3TW1A 2I1KA 3ODWA 2YT1A 1LW3A 5C79A 2OQBA 2MDXA 3NWAA 1FOEA 2DHKA 3D8FA 5DIFB 1GC7A 2J0KA 4A6KA
chains in the Genus database with same CATH topology
5HE3A 1P6SA 2FJLA 3ZDTA 4K2PA 4H8SA 5D3WA 2M14A 1DDMA 5J3TA 4B6HA 1SHCA 1XCGA 4KHOA 1XD4A 4HAVB 1I7AA 5J3QA 3CIKA 1EAZA 2GJYA 2P0HA 4WSFA 3RCPA 2KCJA 4GZUA 1WG7A 2K2UA 1M7EA 2P8VA 2GS0A 5GOWB 4WVFB 5JLJB 2D9ZA 1PMSA 1U5EA 1Y19B 4HAUB 1K5DB 1J19A 4Z2NA 2RNRB 1RJ2A 1AQCA 4C0AA 3V5WA 4GXBA 4WJ7A 5J3YA 1V88A 2P0FA 2VKIA 2Z0OA 1ZSQA 2DHJA 4DBBA 2G35A 3SV1A 2YRYA 4K17A 1U5FA 2KUPA 1GC6A 2D9YA 1H10A 5D3VA 5FI0A 4KHBB 2RUKB 1DYNA 1TJ6A 2DKQA 2NZ8B 2EJ8A 4HDQA 4DX90 2EMTA 4MT7A 3KY9A 3KSYA 3UZTA 2DX5A 2LOXA 3HW2B 2ROVA 4HAZB 2D9XA 4EKUA 3M1IB 4CHJA 1V5UA 1E5WA 4GMXB 4CYEA 3NSUA 1KZGA 4HB3B 5C6RA 5KQ4A 2V76A 2COAA 1XR0B 2D11A 1N3HA 5CLQB 3PVUA 5DH9B 2XQNM 2D2QA 1NTVA 2K00A 3ODXA 2YS1A 3ULCA 1M7RA 2YSZA 3ULBA 1P3RA 2ADZA 1FHWA 4YL8A 4CHMA 3AU4A 1W1HA 2CODA 1DROA 2PZ1A 2GCJA 1EGXA 2H7EA 2E2XA 3T06A 2DHIA 3GYOA 2N0YA 1XKEA 3DXEA 2MKRA 3F0WA 1WI1A 4IAPA 4DX8A 4A6FB 1I2HA 2COCA 3KZ1A 2ELBA 2I1JA 5JP4A 1ZM0A 1MPHA 1QQGA 3FM8C 2UVMA 5CLLB 2DKPA 1V5PA 3ML4A 2OTXA 3BJIA 3HQCA 1WJMA 4HAXB 3TFMA 1UNQA 2J0MA 2Z0PA 1OMWA 2DN6A 1GG3A 1UEFA 5C16A 2ELAA 1ZVRA 4TYZA 5KCVA 2VRWB 3CXBB 2ZPYA 2L2IA 2DLWA 4HHVA 2R0DA 1XODA 2CRFA 3QBVB 3IVFA 4XWXA 3AU5A 4IOYX 1RRPB 1X86A 2KGXB 1NTYA 2J0JA 4L6EA 1MIZB 2LKOA 3SNHA 3QIJA 3PG7A 3SYXA 4TKNA 1WVHA 2IFSA 3KRWA 1P5TA 4YONA 3PVLA 1X1GA 3MDBC 3GYPA 2LULA 2HTHB 4K2OA 1FGYA 1WGQA 5D27A 3P6AA 4A6FA 3PZDA 1EVHA 1B55A 2DFKA 1X11A 3PP2A 1FGZA 2COFA 1ISNA 2W2XD 4MK0A 5LOPB 2RLOA 2AEHA 2CY5A 2VSZA 3X23A 4GMVA 2Q13A 2EC1A 2DX1A 4ZRKA 2EMSA 1ZC4B 2L1CA 4MY6A 2I5CA 2P0DA 4ZRIA 2RVBB 4HB0B 4D0NB 1AWEA 1V5MA 5DI9B 3KRXA 4HAWB 3PSCA 4KVGB 3WYFB 3A8QA 4EJNA 2LG1A 5FI1A 2JP2A 1BAKA 3D8DA 5HE2A 3U8ZA 2DTCA 4Y94A 1MAIA 3DXCA 2I5FA 1DDWA 1UPQA 4K81A 1MK9B 4HDOA 3WA0A 5JHHA 2D4QA 4F7HA 3U7DA 4NSWA 3A8PA 3PVWA 1U2BA 2YVCA 1SGHA 1LB1A 1U29A 1FHOA 2NMBA 2X18A 3FSSA 1DDVA 2LYDA 3P7ZA 3LJUX 5DHFB 4PNKA 2CAYA 5LONB 2YT0A 1WGUA 4HB2B 1X1FA 1FAOA 1DBHA 1W1GA 1H4RA 3HK0A 4KAXB 2QKMA 4NY0A 5D3YA 3TVVA 5HE0A 2MWNB 2DA0A 2UZSA 1UNPA 1X05A 2R09A 4ZRJA 5HE1A 3D8EA 5DHAB 2DYNA 3MPXA 2W2WA 2CY4A 2AL6A 1FHXA 2D9VA 1MIXA 1V61A 1Y5OA 4A6HA 3SO6A 1MK7B 5L81A 4BBKA 2BCJA 3TCAA 1Q67A 2ROZB 1BWNA 4KHAA 1UPRA 1QC6A 2DYQA 5D3XA 3VIAA 3OANA 1Z87A 2RGNB 1OQNA 3DXDA 3AJ4A 1K5GB 3FEHA 4HB4B 5EFXA 3TO1A 2D9WA 3O96A 2YS5A 5JHGA 4EMOA 2N23A 3SUZA 5KQ1A 1V89A 4Z2MB 3QWMA 2K2JA 1XX0A 2W2XC 1OY2A 2YS3A 1U5DA 1ZC3B 2Y7BA 5C5BB 1NI2A 1MKEA 2YF0A 1TQZA 1FB8A 1W1DA 4GPTB 2HE7A 3PEGA 2GCLA 4PQ0A 2RSGA 3G9WA 4IFSA 4GN1A 1KZ7A 4F7GA 3VOQA 3ZVRA 1TXDA 4P7IA 1PLSA 1UNRA 1PFJA 4HAYB 1U5GA 4HATB 3ODOA 2QKLA 2D10A 2J59M 4A5KA 1NU2A 3BINA 2IYBA 1WJ1A 3N7CA 4F7UP 1EF1A 1BTNA 3A98B 2LOZA 2Z0QA 1U27A 2M38A 2MFQA 3F5RA 1J0WA 2H7DA 2Y8GA 5C5BA 2Y8FA 1IRSA 2UZRA 1BTKA 1KI1B 4DXAB 3TW1A 2I1KA 3ODWA 2YT1A 1LW3A 5C79A 2OQBA 2MDXA 1FOEA 2DHKA 3D8FA 5DIFB 1GC7A 2J0KA 4A6KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HE3 A;  1P6S A;  2FJL A;  3ZDT A;  4K2P A;  4H8S A;  5D3W A;  2M14 A;  1DDM A;  5J3T A;  4B6H A;  1SHC A;  1XCG A;  4KHO A;  1XD4 A;  4HAV B;  1I7A A;  5J3Q A;  3CIK A;  1EAZ A;  2GJY A;  2P0H A;  4WSF A;  3RCP A;  2KCJ A;  4GZU A;  1WG7 A;  2K2U A;  1M7E A;  2P8V A;  2GS0 A;  5GOW B;  4WVF B;  5JLJ B;  2D9Z A;  1PMS A;  1U5E A;  1Y19 B;  4HAU B;  1K5D B;  1J19 A;  4Z2N A;  2RNR B;  1RJ2 A;  1AQC A;  4C0A A;  3V5W A;  4GXB A;  4WJ7 A;  5J3Y A;  1V88 A;  2P0F A;  2VKI A;  2Z0O A;  1ZSQ A;  2DHJ A;  4DBB A;  2G35 A;  3SV1 A;  2YRY A;  4K17 A;  1U5F A;  2KUP A;  1GC6 A;  2D9Y A;  1H10 A;  5D3V A;  5FI0 A;  4KHB B;  2RUK B;  1DYN A;  1TJ6 A;  2DKQ A;  2NZ8 B;  2EJ8 A;  4HDQ A;  4DX9 0;  2EMT A;  4MT7 A;  3KY9 A;  3KSY A;  3UZT A;  2DX5 A;  2LOX A;  3HW2 B;  2ROV A;  4HAZ B;  2D9X A;  4EKU A;  3M1I B;  4CHJ A;  1V5U A;  1E5W A;  4GMX B;  4CYE A;  3NSU A;  1KZG A;  4HB3 B;  5C6R A;  5KQ4 A;  2V76 A;  2COA A;  1XR0 B;  2D11 A;  1N3H A;  5CLQ B;  3PVU A;  5DH9 B;  2XQN M;  2D2Q A;  1NTV A;  2K00 A;  3ODX A;  2YS1 A;  3ULC A;  1M7R A;  2YSZ A;  3ULB A;  1P3R A;  2ADZ A;  1FHW A;  4YL8 A;  4CHM A;  3AU4 A;  1W1H A;  2COD A;  1DRO A;  2PZ1 A;  2GCJ A;  1EGX A;  2H7E A;  2E2X A;  3T06 A;  2DHI A;  3GYO A;  2N0Y A;  1XKE A;  3DXE A;  2MKR A;  3F0W A;  1WI1 A;  4IAP A;  4DX8 A;  4A6F B;  1I2H A;  2COC A;  3KZ1 A;  2ELB A;  2I1J A;  5JP4 A;  1ZM0 A;  1MPH A;  1QQG A;  3FM8 C;  2UVM A;  5CLL B;  2DKP A;  1V5P A;  3ML4 A;  2OTX A;  3BJI A;  3HQC A;  1WJM A;  4HAX B;  3TFM A;  1UNQ A;  2J0M A;  2Z0P A;  1OMW A;  2DN6 A;  1GG3 A;  1UEF A;  5C16 A;  2ELA A;  1ZVR A;  4TYZ A;  5KCV A;  2VRW B;  3CXB B;  2ZPY A;  2L2I A;  2DLW A;  4HHV A;  2R0D A;  1XOD A;  2CRF A;  3QBV B;  3IVF A;  4XWX A;  3AU5 A;  4IOY X;  1RRP B;  1X86 A;  2KGX B;  1NTY A;  2J0J A;  4L6E A;  1MIZ B;  2LKO A;  3SNH A;  3QIJ A;  3PG7 A;  3SYX A;  4TKN A;  1WVH A;  2IFS A;  3KRW A;  1P5T A;  4YON A;  3PVL A;  1X1G A;  3MDB C;  3GYP A;  2LUL A;  2HTH B;  4K2O A;  1FGY A;  1WGQ A;  5D27 A;  3P6A A;  4A6F A;  3PZD A;  1EVH A;  1B55 A;  2DFK A;  1X11 A;  3PP2 A;  1FGZ A;  2COF A;  1ISN A;  2W2X D;  4MK0 A;  5LOP B;  2RLO A;  2AEH A;  2CY5 A;  2VSZ A;  3X23 A;  4GMV A;  2Q13 A;  2EC1 A;  2DX1 A;  4ZRK A;  2EMS A;  1ZC4 B;  2L1C A;  4MY6 A;  2I5C A;  2P0D A;  4ZRI A;  2RVB B;  4HB0 B;  4D0N B;  1AWE A;  1V5M A;  5DI9 B;  3KRX A;  4HAW B;  3PSC A;  4KVG B;  3WYF B;  3A8Q A;  4EJN A;  2LG1 A;  5FI1 A;  2JP2 A;  1BAK A;  3D8D A;  5HE2 A;  3U8Z A;  2DTC A;  4Y94 A;  1MAI A;  3DXC A;  2I5F A;  1DDW A;  1UPQ A;  4K81 A;  1MK9 B;  4HDO A;  3WA0 A;  5JHH A;  2D4Q A;  4F7H A;  3U7D A;  4NSW A;  3A8P A;  3PVW A;  1U2B A;  2YVC A;  1SGH A;  1LB1 A;  1U29 A;  1FHO A;  2NMB A;  2X18 A;  3FSS A;  1DDV A;  2LYD A;  3P7Z A;  3LJU X;  5DHF B;  4PNK A;  2CAY A;  5LON B;  2YT0 A;  1WGU A;  4HB2 B;  1X1F A;  1FAO A;  1DBH A;  1W1G A;  1H4R A;  3HK0 A;  4KAX B;  2QKM A;  4NY0 A;  5D3Y A;  3TVV A;  5HE0 A;  2MWN B;  2DA0 A;  2UZS A;  1UNP A;  1X05 A;  2R09 A;  4ZRJ A;  5HE1 A;  3D8E A;  5DHA B;  2DYN A;  3MPX A;  2W2W A;  2CY4 A;  2AL6 A;  1FHX A;  2D9V A;  1MIX A;  1V61 A;  1Y5O A;  4A6H A;  3SO6 A;  1MK7 B;  5L81 A;  4BBK A;  2BCJ A;  3TCA A;  1Q67 A;  2ROZ B;  1BWN A;  4KHA A;  1UPR A;  1QC6 A;  2DYQ A;  5D3X A;  3VIA A;  3OAN A;  1Z87 A;  2RGN B;  1OQN A;  3DXD A;  3AJ4 A;  1K5G B;  3FEH A;  4HB4 B;  5EFX A;  3TO1 A;  2D9W A;  3O96 A;  2YS5 A;  5JHG A;  4EMO A;  2N23 A;  3SUZ A;  5KQ1 A;  1V89 A;  4Z2M B;  3QWM A;  2K2J A;  1XX0 A;  2W2X C;  1OY2 A;  2YS3 A;  1U5D A;  1ZC3 B;  2Y7B A;  5C5B B;  1NI2 A;  1MKE A;  2YF0 A;  1TQZ A;  1FB8 A;  1W1D A;  4GPT B;  2HE7 A;  3PEG A;  2GCL A;  4PQ0 A;  2RSG A;  3G9W A;  4IFS A;  4GN1 A;  1KZ7 A;  4F7G A;  3VOQ A;  3ZVR A;  1TXD A;  4P7I A;  1PLS A;  1UNR A;  1PFJ A;  4HAY B;  1U5G A;  4HAT B;  3ODO A;  2QKL A;  2D10 A;  2J59 M;  4A5K A;  1NU2 A;  3BIN A;  2IYB A;  1WJ1 A;  3N7C A;  4F7U P;  1EF1 A;  1BTN A;  3A98 B;  2LOZ A;  2Z0Q A;  1U27 A;  2M38 A;  2MFQ A;  3F5R A;  1J0W A;  2H7D A;  2Y8G A;  5C5B A;  2Y8F A;  1IRS A;  2UZR A;  1BTK A;  1KI1 B;  4DXA B;  3TW1 A;  2I1K A;  3ODW A;  2YT1 A;  1LW3 A;  5C79 A;  2OQB A;  2MDX A;  1FOE A;  2DHK A;  3D8F A;  5DIF B;  1GC7 A;  2J0K A;  4A6K A; 
#chains in the Genus database with same CATH topology
 5HE3 A;  1P6S A;  2FJL A;  3ZDT A;  4K2P A;  4H8S A;  5D3W A;  2M14 A;  4DIX A;  1DDM A;  5J3T A;  4B6H A;  1SHC A;  4HSI A;  1XCG A;  4QXA B;  4KHO A;  1XD4 A;  4HAV B;  1I7A A;  5J3Q A;  3CIK A;  1EAZ A;  3OHM B;  2GJY A;  2P0H A;  4WSF A;  3RCP A;  2KCJ A;  4GZU A;  1WG7 A;  2K2U A;  1M7E A;  2P8V A;  2GS0 A;  2KUQ A;  5GOW B;  4WVF B;  5JLJ B;  2D9Z A;  1PMS A;  1U5E A;  1Y19 B;  4HAU B;  1K5D B;  1J19 A;  4Z2N A;  4D6W A;  2RNR B;  1RJ2 A;  1AQC A;  4C0A A;  3V5W A;  4GXB A;  4WJ7 A;  4QJ4 B;  5J3Y A;  1V88 A;  2P0F A;  2VKI A;  2Z0O A;  1ZSQ A;  2DHJ A;  4DBB A;  2G35 A;  3SV1 A;  2YRY A;  4K17 A;  3NW8 A;  1U5F A;  2KUP A;  1GC6 A;  2D9Y A;  1H10 A;  5D3V A;  5FI0 A;  4KHB B;  2RUK B;  1DYN A;  1TJ6 A;  2DKQ A;  2NZ8 B;  2EJ8 A;  4HDQ A;  4DX9 0;  2EMT A;  4MT7 A;  3KY9 A;  3KSY A;  3UZT A;  2DX5 A;  3HW2 B;  2LOX A;  2ROV A;  4OSN A;  4HAZ B;  2D9X A;  4EKU A;  3M1I B;  4CHJ A;  1V5U A;  1E5W A;  4GMX B;  4CYE A;  3NSU A;  1KZG A;  4HB3 B;  5C6R A;  5KQ4 A;  2V76 A;  2COA A;  1XR0 B;  2D11 A;  1N3H A;  5CLQ B;  3PVU A;  5DH9 B;  2XQN M;  2D2Q A;  4L1R A;  1NTV A;  2K00 A;  1ZYI A;  3ODX A;  2YS1 A;  3ULC A;  1T77 A;  2R2Y A;  1M7R A;  2YSZ A;  3ULB A;  1P3R A;  2ADZ A;  1FHW A;  3A58 A;  4YL8 A;  4CHM A;  3AU4 A;  1W1H A;  2COD A;  1DRO A;  2PZ1 A;  2GCJ A;  1EGX A;  2H7E A;  5LG4 B;  2E2X A;  3T06 A;  2DHI A;  3GYO A;  2N0Y A;  5IRS A;  1XKE A;  3DXE A;  2MKR A;  3F0W A;  1WI1 A;  4IAP A;  4DX8 A;  4A6F B;  1I2H A;  2COC A;  3KZ1 A;  2ELB A;  2I1J A;  5JP4 A;  1ZM0 A;  1MPH A;  1QQG A;  3FM8 C;  2UVM A;  5CLL B;  2DKP A;  1V5P A;  3ML4 A;  2OTX A;  3BJI A;  3HQC A;  1WJM A;  4HAX B;  3TFM A;  1UNQ A;  2J0M A;  2Z0P A;  1OMW A;  2DN6 A;  1GG3 A;  1UEF A;  5C16 A;  2ELA A;  1ZVR A;  4TYZ A;  5KCV A;  2VRW B;  3CXB B;  2ZPY A;  2L2I A;  2DLW A;  1MI1 A;  4HHV A;  2R0D A;  1XOD A;  2CRF A;  2Z4D A;  3IVF A;  3QBV B;  5M4Y B;  4XWX A;  3AU5 A;  4IOY X;  1RRP B;  1X86 A;  2KGX B;  1NTY A;  3NWD A;  2J0J A;  4L6E A;  1MIZ B;  2LKO A;  3SNH A;  3B77 A;  3QIJ A;  3PG7 A;  3SYX A;  4TKN A;  1WVH A;  2IFS A;  3KRW A;  1P5T A;  4YON A;  3PVL A;  2K8E A;  3HIE A;  1X1G A;  3MDB C;  3GYP A;  2LUL A;  2HTH B;  4K2O A;  1FGY A;  1WGQ A;  5D27 A;  3P6A A;  4A6F A;  3PZD A;  1EVH A;  2YT2 A;  4GOU A;  1B55 A;  2DFK A;  1X11 A;  3PP2 A;  1FGZ A;  2COF A;  1ISN A;  2W2X D;  4MK0 A;  5LOP B;  2RLO A;  2AEH A;  4QJ3 B;  2CY5 A;  2VSZ A;  3NWF A;  3X23 A;  4GMV A;  2Q13 A;  2EC1 A;  2DX1 A;  4ZRK A;  2EMS A;  1ZC4 B;  2L1C A;  4MY6 A;  2I5C A;  4QJ5 B;  2P0D A;  4ZRI A;  2RVB B;  4HB0 B;  4D0N B;  1AWE A;  1V5M A;  5DI9 B;  3KRX A;  4HAW B;  3PSC A;  4KVG B;  4CSQ A;  3WYF B;  3A8Q A;  4EJN A;  2LG1 A;  5FI1 A;  2JP2 A;  1BAK A;  3D8D A;  5HE2 A;  3U8Z A;  2DTC A;  4Y94 A;  1MAI A;  3DCX A;  3DXC A;  2I5F A;  1DDW A;  1UPQ A;  4K81 A;  1MK9 B;  4HDO A;  3WA0 A;  5JHH A;  2D4Q A;  4F7H A;  3U7D A;  4NSW A;  3A8P A;  3PVW A;  1U2B A;  2YVC A;  1SGH A;  1LB1 A;  1U29 A;  1FHO A;  2NMB A;  2X18 A;  3FSS A;  4KHB A;  1DDV A;  2LYD A;  3P7Z A;  3LJU X;  5DHF B;  4PNK A;  2CAY A;  5LON B;  2GUM A;  2YT0 A;  1WGU A;  4HB2 B;  1X1F A;  2ZKM X;  1FAO A;  1DBH A;  2KR0 A;  1W1G A;  1H4R A;  3HK0 A;  4KAX B;  2QKM A;  4NY0 A;  5D3Y A;  3TVV A;  5HE0 A;  2MWN B;  2DA0 A;  2UZS A;  1UNP A;  1X05 A;  2R09 A;  2NBV A;  4ZRJ A;  5HE1 A;  3D8E A;  5DHA B;  2DYN A;  3MPX A;  2W2W A;  2CY4 A;  2AL6 A;  1FHX A;  2D9V A;  1MIX A;  1V61 A;  1Y5O A;  2RRF A;  4A6H A;  3SO6 A;  1MK7 B;  5L81 A;  4BBK A;  2KIG A;  2BCJ A;  3TCA A;  1Q67 A;  2ROZ B;  1BWN A;  4KHA A;  1UPR A;  1QC6 A;  2DYQ A;  5D3X A;  3VIA A;  3OAN A;  1Z87 A;  2KIE A;  2FJU B;  2RGN B;  4OT1 A;  1OQN A;  3DXD A;  3AJ4 A;  1K5G B;  3FEH A;  5I2M A;  4HB4 B;  5EFX A;  3TO1 A;  2D9W A;  3O96 A;  2YS5 A;  5JHG A;  4EMO A;  3U12 A;  2N23 A;  3SUZ A;  5KQ1 A;  1V89 A;  4Z2M B;  3QWM A;  2K2J A;  1XX0 A;  2W2X C;  1OY2 A;  2K49 A;  2YS3 A;  1U5D A;  1ZC3 B;  2Y7B A;  5C5B B;  1NI2 A;  1MKE A;  2YF0 A;  1TQZ A;  1FB8 A;  1W1D A;  4GPT B;  2HE7 A;  3PEG A;  2GCL A;  4PQ0 A;  2RSG A;  3G9W A;  4IFS A;  4GN1 A;  1KZ7 A;  4F7G A;  3VOQ A;  3ZVR A;  1TXD A;  4P7I A;  1PLS A;  2Z59 A;  3FVC A;  1UNR A;  1PFJ A;  4HAY B;  1U5G A;  4HAT B;  3ODO A;  2QKL A;  2D10 A;  2J59 M;  4A5K A;  1NU2 A;  3BIN A;  2IYB A;  5I2S A;  1WJ1 A;  3N7C A;  4F7U P;  3HSA A;  1EF1 A;  2Z14 A;  4GNK B;  1BTN A;  3A98 B;  2LOZ A;  2Z13 A;  2Z0Q A;  1U27 A;  2M38 A;  2MFQ A;  3F5R A;  1J0W A;  2H7D A;  2Y8G A;  5C5B A;  2Y8F A;  1IRS A;  2UZR A;  1BTK A;  1KI1 B;  4DXA B;  3TW1 A;  2I1K A;  3ODW A;  2YT1 A;  1LW3 A;  5C79 A;  2OQB A;  2MDX A;  3NWA A;  1FOE A;  2DHK A;  3D8F A;  5DIF B;  1GC7 A;  2J0K A;  4A6K A; 
#chains in the Genus database with same CATH homology
 5HE3 A;  1P6S A;  2FJL A;  3ZDT A;  4K2P A;  4H8S A;  5D3W A;  2M14 A;  1DDM A;  5J3T A;  4B6H A;  1SHC A;  1XCG A;  4KHO A;  1XD4 A;  4HAV B;  1I7A A;  5J3Q A;  3CIK A;  1EAZ A;  2GJY A;  2P0H A;  4WSF A;  3RCP A;  2KCJ A;  4GZU A;  1WG7 A;  2K2U A;  1M7E A;  2P8V A;  2GS0 A;  5GOW B;  4WVF B;  5JLJ B;  2D9Z A;  1PMS A;  1U5E A;  1Y19 B;  4HAU B;  1K5D B;  1J19 A;  4Z2N A;  2RNR B;  1RJ2 A;  1AQC A;  4C0A A;  3V5W A;  4GXB A;  4WJ7 A;  5J3Y A;  1V88 A;  2P0F A;  2VKI A;  2Z0O A;  1ZSQ A;  2DHJ A;  4DBB A;  2G35 A;  3SV1 A;  2YRY A;  4K17 A;  1U5F A;  2KUP A;  1GC6 A;  2D9Y A;  1H10 A;  5D3V A;  5FI0 A;  4KHB B;  2RUK B;  1DYN A;  1TJ6 A;  2DKQ A;  2NZ8 B;  2EJ8 A;  4HDQ A;  4DX9 0;  2EMT A;  4MT7 A;  3KY9 A;  3KSY A;  3UZT A;  2DX5 A;  2LOX A;  3HW2 B;  2ROV A;  4HAZ B;  2D9X A;  4EKU A;  3M1I B;  4CHJ A;  1V5U A;  1E5W A;  4GMX B;  4CYE A;  3NSU A;  1KZG A;  4HB3 B;  5C6R A;  5KQ4 A;  2V76 A;  2COA A;  1XR0 B;  2D11 A;  1N3H A;  5CLQ B;  3PVU A;  5DH9 B;  2XQN M;  2D2Q A;  1NTV A;  2K00 A;  3ODX A;  2YS1 A;  3ULC A;  1M7R A;  2YSZ A;  3ULB A;  1P3R A;  2ADZ A;  1FHW A;  4YL8 A;  4CHM A;  3AU4 A;  1W1H A;  2COD A;  1DRO A;  2PZ1 A;  2GCJ A;  1EGX A;  2H7E A;  2E2X A;  3T06 A;  2DHI A;  3GYO A;  2N0Y A;  1XKE A;  3DXE A;  2MKR A;  3F0W A;  1WI1 A;  4IAP A;  4DX8 A;  4A6F B;  1I2H A;  2COC A;  3KZ1 A;  2ELB A;  2I1J A;  5JP4 A;  1ZM0 A;  1MPH A;  1QQG A;  3FM8 C;  2UVM A;  5CLL B;  2DKP A;  1V5P A;  3ML4 A;  2OTX A;  3BJI A;  3HQC A;  1WJM A;  4HAX B;  3TFM A;  1UNQ A;  2J0M A;  2Z0P A;  1OMW A;  2DN6 A;  1GG3 A;  1UEF A;  5C16 A;  2ELA A;  1ZVR A;  4TYZ A;  5KCV A;  2VRW B;  3CXB B;  2ZPY A;  2L2I A;  2DLW A;  4HHV A;  2R0D A;  1XOD A;  2CRF A;  3QBV B;  3IVF A;  4XWX A;  3AU5 A;  4IOY X;  1RRP B;  1X86 A;  2KGX B;  1NTY A;  2J0J A;  4L6E A;  1MIZ B;  2LKO A;  3SNH A;  3QIJ A;  3PG7 A;  3SYX A;  4TKN A;  1WVH A;  2IFS A;  3KRW A;  1P5T A;  4YON A;  3PVL A;  1X1G A;  3MDB C;  3GYP A;  2LUL A;  2HTH B;  4K2O A;  1FGY A;  1WGQ A;  5D27 A;  3P6A A;  4A6F A;  3PZD A;  1EVH A;  1B55 A;  2DFK A;  1X11 A;  3PP2 A;  1FGZ A;  2COF A;  1ISN A;  2W2X D;  4MK0 A;  5LOP B;  2RLO A;  2AEH A;  2CY5 A;  2VSZ A;  3X23 A;  4GMV A;  2Q13 A;  2EC1 A;  2DX1 A;  4ZRK A;  2EMS A;  1ZC4 B;  2L1C A;  4MY6 A;  2I5C A;  2P0D A;  4ZRI A;  2RVB B;  4HB0 B;  4D0N B;  1AWE A;  1V5M A;  5DI9 B;  3KRX A;  4HAW B;  3PSC A;  4KVG B;  3WYF B;  3A8Q A;  4EJN A;  2LG1 A;  5FI1 A;  2JP2 A;  1BAK A;  3D8D A;  5HE2 A;  3U8Z A;  2DTC A;  4Y94 A;  1MAI A;  3DXC A;  2I5F A;  1DDW A;  1UPQ A;  4K81 A;  1MK9 B;  4HDO A;  3WA0 A;  5JHH A;  2D4Q A;  4F7H A;  3U7D A;  4NSW A;  3A8P A;  3PVW A;  1U2B A;  2YVC A;  1SGH A;  1LB1 A;  1U29 A;  1FHO A;  2NMB A;  2X18 A;  3FSS A;  1DDV A;  2LYD A;  3P7Z A;  3LJU X;  5DHF B;  4PNK A;  2CAY A;  5LON B;  2YT0 A;  1WGU A;  4HB2 B;  1X1F A;  1FAO A;  1DBH A;  1W1G A;  1H4R A;  3HK0 A;  4KAX B;  2QKM A;  4NY0 A;  5D3Y A;  3TVV A;  5HE0 A;  2MWN B;  2DA0 A;  2UZS A;  1UNP A;  1X05 A;  2R09 A;  4ZRJ A;  5HE1 A;  3D8E A;  5DHA B;  2DYN A;  3MPX A;  2W2W A;  2CY4 A;  2AL6 A;  1FHX A;  2D9V A;  1MIX A;  1V61 A;  1Y5O A;  4A6H A;  3SO6 A;  1MK7 B;  5L81 A;  4BBK A;  2BCJ A;  3TCA A;  1Q67 A;  2ROZ B;  1BWN A;  4KHA A;  1UPR A;  1QC6 A;  2DYQ A;  5D3X A;  3VIA A;  3OAN A;  1Z87 A;  2RGN B;  1OQN A;  3DXD A;  3AJ4 A;  1K5G B;  3FEH A;  4HB4 B;  5EFX A;  3TO1 A;  2D9W A;  3O96 A;  2YS5 A;  5JHG A;  4EMO A;  2N23 A;  3SUZ A;  5KQ1 A;  1V89 A;  4Z2M B;  3QWM A;  2K2J A;  1XX0 A;  2W2X C;  1OY2 A;  2YS3 A;  1U5D A;  1ZC3 B;  2Y7B A;  5C5B B;  1NI2 A;  1MKE A;  2YF0 A;  1TQZ A;  1FB8 A;  1W1D A;  4GPT B;  2HE7 A;  3PEG A;  2GCL A;  4PQ0 A;  2RSG A;  3G9W A;  4IFS A;  4GN1 A;  1KZ7 A;  4F7G A;  3VOQ A;  3ZVR A;  1TXD A;  4P7I A;  1PLS A;  1UNR A;  1PFJ A;  4HAY B;  1U5G A;  4HAT B;  3ODO A;  2QKL A;  2D10 A;  2J59 M;  4A5K A;  1NU2 A;  3BIN A;  2IYB A;  1WJ1 A;  3N7C A;  4F7U P;  1EF1 A;  1BTN A;  3A98 B;  2LOZ A;  2Z0Q A;  1U27 A;  2M38 A;  2MFQ A;  3F5R A;  1J0W A;  2H7D A;  2Y8G A;  5C5B A;  2Y8F A;  1IRS A;  2UZR A;  1BTK A;  1KI1 B;  4DXA B;  3TW1 A;  2I1K A;  3ODW A;  2YT1 A;  1LW3 A;  5C79 A;  2OQB A;  2MDX A;  1FOE A;  2DHK A;  3D8F A;  5DIF B;  1GC7 A;  2J0K A;  4A6K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...