1FGYA

Grp1 ph domain with ins(1,3,4,5)p4
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
127
structure length
127
Chain Sequence
TFFNPDREGWLLKLGGRVKTWKRRWFILTDNCLYYFEYTTDKEPRGIIPLENLSIREVLDPRKPNCFELYNPSHKGQVIKACKTEADGRVVEGNHVVYRISAPSPEEKEEWMKSIKASISRDPFYDM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural basis of 3-phosphoinositide recognition by pleckstrin homology domains.
pubmed doi rcsb
source organism Mus musculus
molecule tags Signaling protein
molecule keywords GRP1
total genus 23
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2000-07-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00169 PH PH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 1fgyA00
2DTCA 1TJ6A 2W2XC 1MAIA 3A98B 4HAVB 2DHKA 3ULBA 2UZSA 4CYEA 2D9VA 3ZDTA 4HATB 3AJ4A 5D3VA 3VIAA 2ZPYA 4HAXB 4MK0A 2M38A 1NTVA 1I7AA 1ZSQA 4GN1A 1EF1A 2LYDA 4IFSA 2YS3A 5FI0A 1PLSA 4GPTB 2V76A 5D27A 5DH9B 2LOZA 4Z2NA 4CHJA 1N3HA 1FOEA 2H7EA 2LKOA 5CLLB 2W2WA 3P6AA 3D8EA 1V5MA 3HW2B 4PNKA 1AWEA 1U5EA 2M14A 1NU2A 2ELBA 3P7ZA 4KHOA 3PVUA 3QBVB 4DX8A 2I1KA 3ODOA 3PP2A 1H10A 4MY6A 5KQ1A 1LW3A 3KZ1A 3CXBB 1WJ1A 5C79A 1LB1A 3CIKA 1FHWA 4HB3B 2D9XA 1V88A 3PG7A 1K5GB 1WI1A 2YVCA 2RSGA 4GMXB 1PMSA 2P0DA 1UEFA 2COFA 2NMBA 1GC6A 1V5PA 2RLOA 2KCJA 5J3YA 2GJYA 1XX0A 2LULA 4HAZB 1QC6A 5KQ4A 2FJLA 2DHIA 3A8PA 2P0HA 1RJ2A 2OQBA 2AEHA 4IOYX 1V89A 1WGUA 1GG3A 2CODA 1DDWA 3WA0A 4TYZA 2DFKA 3BJIA 2MFQA 3PEGA 5J3TA 4HB4B 2EMTA 2RNRB 4HDQA 4EKUA 5CLQB 4WJ7A 1I2HA 2MDXA 2VKIA 4CHMA 4NY0A 2VRWB 2N23A 3O96A 3TCAA 1OQNA 2K00A 3DXDA 2D4QA 1NTYA 1UNPA 1W1DA 1NI2A 2EC1A 4F7GA 2DA0A 5DHAB 4HB2B 1MPHA 2QKLA 2Y7BA 2JP2A 1PFJA 1WG7A 5LONB 2RUKB 1FHXA 1TQZA 2D11A 5HE1A 1X1GA 1XD4A 2CAYA 5J3QA 3D8FA 4WVFB 3TVVA 4F7HA 1XR0B 3ULCA 5DIFB 3MPXA 3GYPA 1M7RA 3ODWA 1DYNA 2IFSA 1KI1B 3G9WA 5DHFB 2Z0QA 2K2UA 3SV1A 5HE3A 4C0AA 2J59M 3ODXA 2DHJA 4A6HA 1X11A 2HE7A 1UNQA 3VOQA 1FB8A 1UPRA 3UZTA 5DI9B 3X23A 5GOWB 4F7UP 2P8VA 3NSUA 1U29A 3TO1A 3QWMA 1MIZB 2X18A 1BTNA 3IVFA 2COAA 2R09A 2IYBA 1BAKA 1B55A 4KAXB 4EJNA 1MKEA 4TKNA 4ZRIA 1XODA 1Y5OA 2ROZB 1X86A 1W1GA 4MT7A 3DXCA 5FI1A 1KZGA 1Y19B 1UPQA 2RGNB 1FHOA 2UZRA 4HAWB 4K2PA 3A8QA 4Z2MB 2YS5A 5JP4A 3SO6A 2COCA 4A6FB 1AQCA 4KHAA 1TXDA 4HB0B 1U2BA 3GYOA 5JHHA 3TW1A 3QIJA 2NZ8B 2N0YA 4L6EA 2DX5A 2L2IA 1MIXA 3F0WA 4HAUB 2G35A 2ROVA 1UNRA 2GCJA 2P0FA 2Y8FA 2I5CA 2CY5A 2J0KA 3SNHA 3M1IB 1FAOA 2E2XA 2DYNA 1WGQA 4GZUA 1P6SA 3OANA 1U5FA 1ZC4B 4EMOA 2DX1A 1KZ7A 3KY9A 1RRPB 2HTHB 2LOXA 3DXEA 3MDBC 4BBKA 1X1FA 1EAZA 2J0MA 2D9ZA 1DBHA 1X05A 4D0NB 2UVMA 1V5UA 3BINA 3PVWA 1E5WA 3D8DA 4IAPA 3N7CA 2MKRA 1U5DA 4HHVA 2CRFA 3KRWA 4GMVA 1SGHA 2VSZA 3U8ZA 1DDVA 1U5GA 5EFXA 3U7DA 2D9WA 1U27A 1BTKA 2YSZA 3T06A 1J0WA 4A6KA 2Z0PA 1OY2A 5JLJB 1M7EA 2D9YA 5D3YA 2I5FA 1EGXA 2QKMA 1DDMA 2YF0A 4YL8A 4K17A 2Z0OA 2GS0A 2GCLA 3WYFB 5C16A 3FSSA 5D3XA 2DKPA 3FM8C 1GC7A 2LG1A 3ZVRA 1OMWA 1SHCA 5HE2A 4YONA 2AL6A 2KUPA 5L81A 1V61A 3F5RA 1J19A 4KVGB 1ZM0A 2W2XD 5KCVA 2OTXA 3SUZA 3PVLA 1P5TA 3KRXA 1WVHA 2L1CA 1H4RA 2D2QA 2YT0A 4XWXA 3KSYA 1ZC3B 2DLWA 2Y8GA 4ZRJA 2Q13A 2YS1A 1FGZA 2RVBB 1XCGA 4DX90 4KHBB 4A6FA 3PSCA 5C5BA 2YT1A 3AU4A 2DKQA 2MWNB 1BWNA 1DROA 2ELAA 4PQ0A 2BCJA 4HAYB 1P3RA 1WJMA 3PZDA 3HQCA 2KGXB 1MK9B 2YRYA 3AU5A 5C5BB 2DYQA 2PZ1A 4K2OA 5JHGA 1W1HA 1XKEA 2EJ8A 2DN6A 1Z87A 2K2JA 2ADZA 3ML4A 5HE0A 1IRSA 3FEHA 3LJUX 2J0JA 4A5KA 3TFMA 1QQGA 2CY4A 2R0DA 4GXBA 3V5WA 1EVHA 4WSFA 2XQNM 4ZRKA 4P7IA 3RCPA 1Q67A 3SYXA 1ISNA 4Y94A 4DBBA 4HDOA 2D10A 3HK0A 5D3WA 5LOPB 2EMSA 1ZVRA 4DXAB 4B6HA 1FGYA 4H8SA 2I1JA 5C6RA 4K81A 2H7DA 4NSWA 1K5DB 1MK7B
chains in the Genus database with same CATH superfamily
2DTCA 3DCXA 2RRFA 3NWDA 1TJ6A 2W2XC 1MAIA 3A98B 4HAVB 2DHKA 3ULBA 2UZSA 4CYEA 2D9VA 3ZDTA 4HATB 3AJ4A 5D3VA 3VIAA 2ZPYA 4HAXB 4MK0A 2M38A 1NTVA 1I7AA 1ZSQA 4GN1A 1EF1A 2LYDA 4IFSA 2YS3A 2R2YA 5FI0A 1PLSA 4GPTB 2V76A 5D27A 5DH9B 2LOZA 4Z2NA 4CHJA 1N3HA 1FOEA 2H7EA 2LKOA 5CLLB 2W2WA 3P6AA 3D8EA 2Z59A 1V5MA 3HW2B 4GOUA 4PNKA 1AWEA 1U5EA 2M14A 1NU2A 2ELBA 3P7ZA 4KHOA 3PVUA 5I2SA 3QBVB 4DX8A 2I1KA 3ODOA 3PP2A 1H10A 4MY6A 5KQ1A 1LW3A 3KZ1A 3CXBB 1WJ1A 5C79A 1LB1A 3CIKA 1FHWA 4HB3B 2D9XA 1V88A 3PG7A 1K5GB 1WI1A 2YVCA 2RSGA 4GMXB 1PMSA 2P0DA 1UEFA 2COFA 2NMBA 1GC6A 1V5PA 2RLOA 2KCJA 5J3YA 2GJYA 1XX0A 2LULA 4HAZB 1QC6A 4L1RA 5KQ4A 2FJLA 2DHIA 2KUQA 3A8PA 2P0HA 1RJ2A 2OQBA 2AEHA 4IOYX 1V89A 1WGUA 1GG3A 2CODA 1DDWA 3WA0A 4TYZA 2DFKA 3BJIA 2MFQA 3PEGA 5J3TA 4HB4B 2EMTA 2RNRB 4HDQA 4EKUA 4D6WA 5CLQB 4CSQA 4WJ7A 1I2HA 2MDXA 2VKIA 4CHMA 4NY0A 2VRWB 2N23A 3O96A 3TCAA 1OQNA 2K00A 3DXDA 2D4QA 1NTYA 1UNPA 1W1DA 2K49A 1NI2A 2ZKMX 2EC1A 4F7GA 2DA0A 5DHAB 4HB2B 1MPHA 2QKLA 2Y7BA 2JP2A 1PFJA 1WG7A 5LONB 2RUKB 1FHXA 1TQZA 2D11A 5HE1A 1X1GA 1XD4A 2CAYA 2K8EA 5J3QA 3D8FA 4WVFB 3TVVA 4F7HA 1XR0B 3ULCA 5DIFB 3MPXA 3GYPA 1M7RA 3ODWA 1DYNA 2IFSA 3NWAA 1KI1B 3G9WA 5DHFB 2Z0QA 2K2UA 3SV1A 5HE3A 4C0AA 2J59M 2Z13A 3ODXA 2DHJA 4A6HA 2KIGA 1X11A 1UNQA 2HE7A 3VOQA 1FB8A 1UPRA 3UZTA 5DI9B 3X23A 5M4YB 5GOWB 4F7UP 2P8VA 3NSUA 1U29A 3TO1A 3QWMA 1MIZB 2X18A 1BTNA 3IVFA 2COAA 2R09A 2IYBA 1BAKA 2NBVA 1B55A 4KAXB 4EJNA 1MKEA 4TKNA 4ZRIA 1XODA 1Y5OA 2ROZB 1X86A 1W1GA 3B77A 3DXCA 4MT7A 5FI1A 1KZGA 1Y19B 1UPQA 2RGNB 1FHOA 2UZRA 4HAWB 4K2PA 3A8QA 4Z2MB 2YS5A 5JP4A 3SO6A 2COCA 4A6FB 1AQCA 4KHAA 1TXDA 3U12A 2YT2A 4HB0B 1U2BA 3GYOA 5JHHA 3TW1A 3QIJA 2NZ8B 2N0YA 4L6EA 2DX5A 2L2IA 1MIXA 3F0WA 4HAUB 2G35A 3NWFA 2ROVA 1UNRA 2GCJA 2P0FA 5LG4B 2Y8FA 2FJUB 2I5CA 3A58A 2CY5A 2J0KA 3SNHA 3M1IB 1FAOA 2E2XA 3OHMB 2DYNA 4QXAB 1WGQA 4GZUA 1ZYIA 1P6SA 3OANA 1U5FA 4OT1A 1ZC4B 4EMOA 2DX1A 1KZ7A 3KY9A 1RRPB 2HTHB 2LOXA 3DXEA 3MDBC 4BBKA 1X1FA 4GNKB 1EAZA 2J0MA 2D9ZA 1DBHA 1X05A 4D0NB 2UVMA 4QJ5B 1V5UA 3BINA 3PVWA 1E5WA 3D8DA 4IAPA 3N7CA 2Z4DA 2MKRA 1U5DA 2Z14A 4HHVA 2CRFA 3KRWA 4GMVA 4HSIA 4DIXA 1SGHA 2VSZA 3U8ZA 1DDVA 1U5GA 5EFXA 3U7DA 4QJ4B 2D9WA 1U27A 1BTKA 2YSZA 3T06A 1J0WA 4A6KA 2Z0PA 1OY2A 5JLJB 1M7EA 2D9YA 5D3YA 2I5FA 1EGXA 2QKMA 1DDMA 2YF0A 4YL8A 4K17A 2Z0OA 2GS0A 2GCLA 3WYFB 5C16A 3FSSA 5D3XA 2DKPA 3FM8C 1GC7A 2LG1A 3ZVRA 1OMWA 1SHCA 5HE2A 4YONA 2AL6A 2KUPA 1T77A 5L81A 2GUMA 1V61A 3F5RA 1J19A 4KVGB 1ZM0A 2W2XD 5KCVA 2OTXA 3SUZA 4OSNA 3PVLA 1P5TA 3KRXA 1WVHA 2L1CA 1H4RA 2D2QA 2YT0A 4XWXA 3KSYA 1ZC3B 2DLWA 2Y8GA 4ZRJA 2Q13A 2YS1A 1FGZA 2RVBB 1XCGA 4QJ3B 4DX90 4KHBB 4A6FA 3PSCA 5C5BA 2YT1A 3AU4A 2DKQA 2MWNB 1BWNA 2KIEA 1DROA 5IRSA 3HSAA 2ELAA 4PQ0A 2BCJA 2KR0A 4HAYB 1P3RA 1WJMA 3PZDA 3HQCA 2KGXB 3NW8A 1MK9B 2YRYA 3AU5A 5C5BB 2DYQA 2PZ1A 4K2OA 5JHGA 4KHBA 1W1HA 1XKEA 1MI1A 2EJ8A 2DN6A 1Z87A 2K2JA 2ADZA 3ML4A 5HE0A 1IRSA 3FEHA 3LJUX 2J0JA 4A5KA 3FVCA 3TFMA 1QQGA 2CY4A 2R0DA 4GXBA 3V5WA 1EVHA 4WSFA 2XQNM 4ZRKA 4P7IA 3RCPA 1Q67A 3SYXA 5I2MA 1ISNA 4Y94A 4DBBA 4HDOA 2D10A 3HK0A 5D3WA 5LOPB 2EMSA 1ZVRA 4DXAB 4B6HA 1FGYA 4H8SA 2I1JA 5C6RA 4K81A 2H7DA 3HIEA 4NSWA 1K5DB 1MK7B
chains in the Genus database with same CATH topology
2DTCA 1TJ6A 2W2XC 1MAIA 3A98B 4HAVB 2DHKA 3ULBA 2UZSA 4CYEA 2D9VA 3ZDTA 4HATB 3AJ4A 5D3VA 3VIAA 2ZPYA 4HAXB 4MK0A 2M38A 1NTVA 1I7AA 1ZSQA 4GN1A 1EF1A 2LYDA 4IFSA 2YS3A 5FI0A 1PLSA 4GPTB 2V76A 5D27A 5DH9B 2LOZA 4Z2NA 4CHJA 1N3HA 1FOEA 2H7EA 2LKOA 5CLLB 2W2WA 3P6AA 3D8EA 1V5MA 3HW2B 4PNKA 1AWEA 1U5EA 2M14A 1NU2A 2ELBA 3P7ZA 4KHOA 3PVUA 3QBVB 4DX8A 2I1KA 3ODOA 3PP2A 1H10A 4MY6A 5KQ1A 1LW3A 3KZ1A 3CXBB 1WJ1A 5C79A 1LB1A 3CIKA 1FHWA 4HB3B 2D9XA 1V88A 3PG7A 1K5GB 1WI1A 2YVCA 2RSGA 4GMXB 1PMSA 2P0DA 1UEFA 2COFA 2NMBA 1GC6A 1V5PA 2RLOA 2KCJA 5J3YA 2GJYA 1XX0A 2LULA 4HAZB 1QC6A 5KQ4A 2FJLA 2DHIA 3A8PA 2P0HA 1RJ2A 2OQBA 2AEHA 4IOYX 1V89A 1WGUA 1GG3A 2CODA 1DDWA 3WA0A 4TYZA 2DFKA 3BJIA 2MFQA 3PEGA 5J3TA 4HB4B 2EMTA 2RNRB 4HDQA 4EKUA 5CLQB 4WJ7A 1I2HA 2MDXA 2VKIA 4CHMA 4NY0A 2VRWB 2N23A 3O96A 3TCAA 1OQNA 2K00A 3DXDA 2D4QA 1NTYA 1UNPA 1W1DA 1NI2A 2EC1A 4F7GA 2DA0A 5DHAB 4HB2B 1MPHA 2QKLA 2Y7BA 2JP2A 1PFJA 1WG7A 5LONB 2RUKB 1FHXA 1TQZA 2D11A 5HE1A 1X1GA 1XD4A 2CAYA 5J3QA 3D8FA 4WVFB 3TVVA 4F7HA 1XR0B 3ULCA 5DIFB 3MPXA 3GYPA 1M7RA 3ODWA 1DYNA 2IFSA 1KI1B 3G9WA 5DHFB 2Z0QA 2K2UA 3SV1A 5HE3A 4C0AA 2J59M 3ODXA 2DHJA 4A6HA 1X11A 2HE7A 1UNQA 3VOQA 1FB8A 1UPRA 3UZTA 5DI9B 3X23A 5GOWB 4F7UP 2P8VA 3NSUA 1U29A 3TO1A 3QWMA 1MIZB 2X18A 1BTNA 3IVFA 2COAA 2R09A 2IYBA 1BAKA 1B55A 4KAXB 4EJNA 1MKEA 4TKNA 4ZRIA 1XODA 1Y5OA 2ROZB 1X86A 1W1GA 4MT7A 3DXCA 5FI1A 1KZGA 1Y19B 1UPQA 2RGNB 1FHOA 2UZRA 4HAWB 4K2PA 3A8QA 4Z2MB 2YS5A 5JP4A 3SO6A 2COCA 4A6FB 1AQCA 4KHAA 1TXDA 4HB0B 1U2BA 3GYOA 5JHHA 3TW1A 3QIJA 2NZ8B 2N0YA 4L6EA 2DX5A 2L2IA 1MIXA 3F0WA 4HAUB 2G35A 2ROVA 1UNRA 2GCJA 2P0FA 2Y8FA 2I5CA 2CY5A 2J0KA 3SNHA 3M1IB 1FAOA 2E2XA 2DYNA 1WGQA 4GZUA 1P6SA 3OANA 1U5FA 1ZC4B 4EMOA 2DX1A 1KZ7A 3KY9A 1RRPB 2HTHB 2LOXA 3DXEA 3MDBC 4BBKA 1X1FA 1EAZA 2J0MA 2D9ZA 1DBHA 1X05A 4D0NB 2UVMA 1V5UA 3BINA 3PVWA 1E5WA 3D8DA 4IAPA 3N7CA 2MKRA 1U5DA 4HHVA 2CRFA 3KRWA 4GMVA 1SGHA 2VSZA 3U8ZA 1DDVA 1U5GA 5EFXA 3U7DA 2D9WA 1U27A 1BTKA 2YSZA 3T06A 1J0WA 4A6KA 2Z0PA 1OY2A 5JLJB 1M7EA 2D9YA 5D3YA 2I5FA 1EGXA 2QKMA 1DDMA 2YF0A 4YL8A 4K17A 2Z0OA 2GS0A 2GCLA 3WYFB 5C16A 3FSSA 5D3XA 2DKPA 3FM8C 1GC7A 2LG1A 3ZVRA 1OMWA 1SHCA 5HE2A 4YONA 2AL6A 2KUPA 5L81A 1V61A 3F5RA 1J19A 4KVGB 1ZM0A 2W2XD 5KCVA 2OTXA 3SUZA 3PVLA 1P5TA 3KRXA 1WVHA 2L1CA 1H4RA 2D2QA 2YT0A 4XWXA 3KSYA 1ZC3B 2DLWA 2Y8GA 4ZRJA 2Q13A 2YS1A 1FGZA 2RVBB 1XCGA 4DX90 4KHBB 4A6FA 3PSCA 5C5BA 2YT1A 3AU4A 2DKQA 2MWNB 1BWNA 1DROA 2ELAA 4PQ0A 2BCJA 4HAYB 1P3RA 1WJMA 3PZDA 3HQCA 2KGXB 1MK9B 2YRYA 3AU5A 5C5BB 2DYQA 2PZ1A 4K2OA 5JHGA 1W1HA 1XKEA 2EJ8A 2DN6A 1Z87A 2K2JA 2ADZA 3ML4A 5HE0A 1IRSA 3FEHA 3LJUX 2J0JA 4A5KA 3TFMA 1QQGA 2CY4A 2R0DA 4GXBA 3V5WA 1EVHA 4WSFA 2XQNM 4ZRKA 4P7IA 3RCPA 1Q67A 3SYXA 1ISNA 4Y94A 4DBBA 4HDOA 2D10A 3HK0A 5D3WA 5LOPB 2EMSA 1ZVRA 4DXAB 4B6HA 1FGYA 4H8SA 2I1JA 5C6RA 4K81A 2H7DA 4NSWA 1K5DB 1MK7B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DTC A;  1TJ6 A;  2W2X C;  1MAI A;  3A98 B;  4HAV B;  2DHK A;  3ULB A;  2UZS A;  4CYE A;  2D9V A;  3ZDT A;  4HAT B;  3AJ4 A;  5D3V A;  3VIA A;  2ZPY A;  4HAX B;  4MK0 A;  2M38 A;  1NTV A;  1I7A A;  1ZSQ A;  4GN1 A;  1EF1 A;  2LYD A;  4IFS A;  2YS3 A;  5FI0 A;  1PLS A;  4GPT B;  2V76 A;  5D27 A;  5DH9 B;  2LOZ A;  4Z2N A;  4CHJ A;  1N3H A;  1FOE A;  2H7E A;  2LKO A;  5CLL B;  2W2W A;  3P6A A;  3D8E A;  1V5M A;  3HW2 B;  4PNK A;  1AWE A;  1U5E A;  2M14 A;  1NU2 A;  2ELB A;  3P7Z A;  4KHO A;  3PVU A;  3QBV B;  4DX8 A;  2I1K A;  3ODO A;  3PP2 A;  1H10 A;  4MY6 A;  5KQ1 A;  1LW3 A;  3KZ1 A;  3CXB B;  1WJ1 A;  5C79 A;  1LB1 A;  3CIK A;  1FHW A;  4HB3 B;  2D9X A;  1V88 A;  3PG7 A;  1K5G B;  1WI1 A;  2YVC A;  2RSG A;  4GMX B;  1PMS A;  2P0D A;  1UEF A;  2COF A;  2NMB A;  1GC6 A;  1V5P A;  2RLO A;  2KCJ A;  5J3Y A;  2GJY A;  1XX0 A;  2LUL A;  4HAZ B;  1QC6 A;  5KQ4 A;  2FJL A;  2DHI A;  3A8P A;  2P0H A;  1RJ2 A;  2OQB A;  2AEH A;  4IOY X;  1V89 A;  1WGU A;  1GG3 A;  2COD A;  1DDW A;  3WA0 A;  4TYZ A;  2DFK A;  3BJI A;  2MFQ A;  3PEG A;  5J3T A;  4HB4 B;  2EMT A;  2RNR B;  4HDQ A;  4EKU A;  5CLQ B;  4WJ7 A;  1I2H A;  2MDX A;  2VKI A;  4CHM A;  4NY0 A;  2VRW B;  2N23 A;  3O96 A;  3TCA A;  1OQN A;  2K00 A;  3DXD A;  2D4Q A;  1NTY A;  1UNP A;  1W1D A;  1NI2 A;  2EC1 A;  4F7G A;  2DA0 A;  5DHA B;  4HB2 B;  1MPH A;  2QKL A;  2Y7B A;  2JP2 A;  1PFJ A;  1WG7 A;  5LON B;  2RUK B;  1FHX A;  1TQZ A;  2D11 A;  5HE1 A;  1X1G A;  1XD4 A;  2CAY A;  5J3Q A;  3D8F A;  4WVF B;  3TVV A;  4F7H A;  1XR0 B;  3ULC A;  5DIF B;  3MPX A;  3GYP A;  1M7R A;  3ODW A;  1DYN A;  2IFS A;  1KI1 B;  3G9W A;  5DHF B;  2Z0Q A;  2K2U A;  3SV1 A;  5HE3 A;  4C0A A;  2J59 M;  3ODX A;  2DHJ A;  4A6H A;  1X11 A;  2HE7 A;  1UNQ A;  3VOQ A;  1FB8 A;  1UPR A;  3UZT A;  5DI9 B;  3X23 A;  5GOW B;  4F7U P;  2P8V A;  3NSU A;  1U29 A;  3TO1 A;  3QWM A;  1MIZ B;  2X18 A;  1BTN A;  3IVF A;  2COA A;  2R09 A;  2IYB A;  1BAK A;  1B55 A;  4KAX B;  4EJN A;  1MKE A;  4TKN A;  4ZRI A;  1XOD A;  1Y5O A;  2ROZ B;  1X86 A;  1W1G A;  4MT7 A;  3DXC A;  5FI1 A;  1KZG A;  1Y19 B;  1UPQ A;  2RGN B;  1FHO A;  2UZR A;  4HAW B;  4K2P A;  3A8Q A;  4Z2M B;  2YS5 A;  5JP4 A;  3SO6 A;  2COC A;  4A6F B;  1AQC A;  4KHA A;  1TXD A;  4HB0 B;  1U2B A;  3GYO A;  5JHH A;  3TW1 A;  3QIJ A;  2NZ8 B;  2N0Y A;  4L6E A;  2DX5 A;  2L2I A;  1MIX A;  3F0W A;  4HAU B;  2G35 A;  2ROV A;  1UNR A;  2GCJ A;  2P0F A;  2Y8F A;  2I5C A;  2CY5 A;  2J0K A;  3SNH A;  3M1I B;  1FAO A;  2E2X A;  2DYN A;  1WGQ A;  4GZU A;  1P6S A;  3OAN A;  1U5F A;  1ZC4 B;  4EMO A;  2DX1 A;  1KZ7 A;  3KY9 A;  1RRP B;  2HTH B;  2LOX A;  3DXE A;  3MDB C;  4BBK A;  1X1F A;  1EAZ A;  2J0M A;  2D9Z A;  1DBH A;  1X05 A;  4D0N B;  2UVM A;  1V5U A;  3BIN A;  3PVW A;  1E5W A;  3D8D A;  4IAP A;  3N7C A;  2MKR A;  1U5D A;  4HHV A;  2CRF A;  3KRW A;  4GMV A;  1SGH A;  2VSZ A;  3U8Z A;  1DDV A;  1U5G A;  5EFX A;  3U7D A;  2D9W A;  1U27 A;  1BTK A;  2YSZ A;  3T06 A;  1J0W A;  4A6K A;  2Z0P A;  1OY2 A;  5JLJ B;  1M7E A;  2D9Y A;  5D3Y A;  2I5F A;  1EGX A;  2QKM A;  1DDM A;  2YF0 A;  4YL8 A;  4K17 A;  2Z0O A;  2GS0 A;  2GCL A;  3WYF B;  5C16 A;  3FSS A;  5D3X A;  2DKP A;  3FM8 C;  1GC7 A;  2LG1 A;  3ZVR A;  1OMW A;  1SHC A;  5HE2 A;  4YON A;  2AL6 A;  2KUP A;  5L81 A;  1V61 A;  3F5R A;  1J19 A;  4KVG B;  1ZM0 A;  2W2X D;  5KCV A;  2OTX A;  3SUZ A;  3PVL A;  1P5T A;  3KRX A;  1WVH A;  2L1C A;  1H4R A;  2D2Q A;  2YT0 A;  4XWX A;  3KSY A;  1ZC3 B;  2DLW A;  2Y8G A;  4ZRJ A;  2Q13 A;  2YS1 A;  1FGZ A;  2RVB B;  1XCG A;  4DX9 0;  4KHB B;  4A6F A;  3PSC A;  5C5B A;  2YT1 A;  3AU4 A;  2DKQ A;  2MWN B;  1BWN A;  1DRO A;  2ELA A;  4PQ0 A;  2BCJ A;  4HAY B;  1P3R A;  1WJM A;  3PZD A;  3HQC A;  2KGX B;  1MK9 B;  2YRY A;  3AU5 A;  5C5B B;  2DYQ A;  2PZ1 A;  4K2O A;  5JHG A;  1W1H A;  1XKE A;  2EJ8 A;  2DN6 A;  1Z87 A;  2K2J A;  2ADZ A;  3ML4 A;  5HE0 A;  1IRS A;  3FEH A;  3LJU X;  2J0J A;  4A5K A;  3TFM A;  1QQG A;  2CY4 A;  2R0D A;  4GXB A;  3V5W A;  1EVH A;  4WSF A;  2XQN M;  4ZRK A;  4P7I A;  3RCP A;  1Q67 A;  3SYX A;  1ISN A;  4Y94 A;  4DBB A;  4HDO A;  2D10 A;  3HK0 A;  5D3W A;  5LOP B;  2EMS A;  1ZVR A;  4DXA B;  4B6H A;  1FGY A;  4H8S A;  2I1J A;  5C6R A;  4K81 A;  2H7D A;  4NSW A;  1K5D B;  1MK7 B; 
#chains in the Genus database with same CATH topology
 2DTC A;  3DCX A;  2RRF A;  3NWD A;  1TJ6 A;  2W2X C;  1MAI A;  3A98 B;  4HAV B;  2DHK A;  3ULB A;  2UZS A;  4CYE A;  2D9V A;  3ZDT A;  4HAT B;  3AJ4 A;  5D3V A;  3VIA A;  2ZPY A;  4HAX B;  4MK0 A;  2M38 A;  1NTV A;  1I7A A;  1ZSQ A;  4GN1 A;  1EF1 A;  2LYD A;  4IFS A;  2YS3 A;  2R2Y A;  5FI0 A;  1PLS A;  4GPT B;  2V76 A;  5D27 A;  5DH9 B;  2LOZ A;  4Z2N A;  4CHJ A;  1N3H A;  1FOE A;  2H7E A;  2LKO A;  5CLL B;  2W2W A;  3P6A A;  3D8E A;  2Z59 A;  1V5M A;  3HW2 B;  4GOU A;  4PNK A;  1AWE A;  1U5E A;  2M14 A;  1NU2 A;  2ELB A;  3P7Z A;  4KHO A;  3PVU A;  5I2S A;  3QBV B;  4DX8 A;  2I1K A;  3ODO A;  3PP2 A;  1H10 A;  4MY6 A;  5KQ1 A;  1LW3 A;  3KZ1 A;  3CXB B;  1WJ1 A;  5C79 A;  1LB1 A;  3CIK A;  1FHW A;  4HB3 B;  2D9X A;  1V88 A;  3PG7 A;  1K5G B;  1WI1 A;  2YVC A;  2RSG A;  4GMX B;  1PMS A;  2P0D A;  1UEF A;  2COF A;  2NMB A;  1GC6 A;  1V5P A;  2RLO A;  2KCJ A;  5J3Y A;  2GJY A;  1XX0 A;  2LUL A;  4HAZ B;  1QC6 A;  4L1R A;  5KQ4 A;  2FJL A;  2DHI A;  2KUQ A;  3A8P A;  2P0H A;  1RJ2 A;  2OQB A;  2AEH A;  4IOY X;  1V89 A;  1WGU A;  1GG3 A;  2COD A;  1DDW A;  3WA0 A;  4TYZ A;  2DFK A;  3BJI A;  2MFQ A;  3PEG A;  5J3T A;  4HB4 B;  2EMT A;  2RNR B;  4HDQ A;  4EKU A;  4D6W A;  5CLQ B;  4CSQ A;  4WJ7 A;  1I2H A;  2MDX A;  2VKI A;  4CHM A;  4NY0 A;  2VRW B;  2N23 A;  3O96 A;  3TCA A;  1OQN A;  2K00 A;  3DXD A;  2D4Q A;  1NTY A;  1UNP A;  1W1D A;  2K49 A;  1NI2 A;  2ZKM X;  2EC1 A;  4F7G A;  2DA0 A;  5DHA B;  4HB2 B;  1MPH A;  2QKL A;  2Y7B A;  2JP2 A;  1PFJ A;  1WG7 A;  5LON B;  2RUK B;  1FHX A;  1TQZ A;  2D11 A;  5HE1 A;  1X1G A;  1XD4 A;  2CAY A;  2K8E A;  5J3Q A;  3D8F A;  4WVF B;  3TVV A;  4F7H A;  1XR0 B;  3ULC A;  5DIF B;  3MPX A;  3GYP A;  1M7R A;  3ODW A;  1DYN A;  2IFS A;  3NWA A;  1KI1 B;  3G9W A;  5DHF B;  2Z0Q A;  2K2U A;  3SV1 A;  5HE3 A;  4C0A A;  2J59 M;  2Z13 A;  3ODX A;  2DHJ A;  4A6H A;  2KIG A;  1X11 A;  1UNQ A;  2HE7 A;  3VOQ A;  1FB8 A;  1UPR A;  3UZT A;  5DI9 B;  3X23 A;  5M4Y B;  5GOW B;  4F7U P;  2P8V A;  3NSU A;  1U29 A;  3TO1 A;  3QWM A;  1MIZ B;  2X18 A;  1BTN A;  3IVF A;  2COA A;  2R09 A;  2IYB A;  1BAK A;  2NBV A;  1B55 A;  4KAX B;  4EJN A;  1MKE A;  4TKN A;  4ZRI A;  1XOD A;  1Y5O A;  2ROZ B;  1X86 A;  1W1G A;  3B77 A;  3DXC A;  4MT7 A;  5FI1 A;  1KZG A;  1Y19 B;  1UPQ A;  2RGN B;  1FHO A;  2UZR A;  4HAW B;  4K2P A;  3A8Q A;  4Z2M B;  2YS5 A;  5JP4 A;  3SO6 A;  2COC A;  4A6F B;  1AQC A;  4KHA A;  1TXD A;  3U12 A;  2YT2 A;  4HB0 B;  1U2B A;  3GYO A;  5JHH A;  3TW1 A;  3QIJ A;  2NZ8 B;  2N0Y A;  4L6E A;  2DX5 A;  2L2I A;  1MIX A;  3F0W A;  4HAU B;  2G35 A;  3NWF A;  2ROV A;  1UNR A;  2GCJ A;  2P0F A;  5LG4 B;  2Y8F A;  2FJU B;  2I5C A;  3A58 A;  2CY5 A;  2J0K A;  3SNH A;  3M1I B;  1FAO A;  2E2X A;  3OHM B;  2DYN A;  4QXA B;  1WGQ A;  4GZU A;  1ZYI A;  1P6S A;  3OAN A;  1U5F A;  4OT1 A;  1ZC4 B;  4EMO A;  2DX1 A;  1KZ7 A;  3KY9 A;  1RRP B;  2HTH B;  2LOX A;  3DXE A;  3MDB C;  4BBK A;  1X1F A;  4GNK B;  1EAZ A;  2J0M A;  2D9Z A;  1DBH A;  1X05 A;  4D0N B;  2UVM A;  4QJ5 B;  1V5U A;  3BIN A;  3PVW A;  1E5W A;  3D8D A;  4IAP A;  3N7C A;  2Z4D A;  2MKR A;  1U5D A;  2Z14 A;  4HHV A;  2CRF A;  3KRW A;  4GMV A;  4HSI A;  4DIX A;  1SGH A;  2VSZ A;  3U8Z A;  1DDV A;  1U5G A;  5EFX A;  3U7D A;  4QJ4 B;  2D9W A;  1U27 A;  1BTK A;  2YSZ A;  3T06 A;  1J0W A;  4A6K A;  2Z0P A;  1OY2 A;  5JLJ B;  1M7E A;  2D9Y A;  5D3Y A;  2I5F A;  1EGX A;  2QKM A;  1DDM A;  2YF0 A;  4YL8 A;  4K17 A;  2Z0O A;  2GS0 A;  2GCL A;  3WYF B;  5C16 A;  3FSS A;  5D3X A;  2DKP A;  3FM8 C;  1GC7 A;  2LG1 A;  3ZVR A;  1OMW A;  1SHC A;  5HE2 A;  4YON A;  2AL6 A;  2KUP A;  1T77 A;  5L81 A;  2GUM A;  1V61 A;  3F5R A;  1J19 A;  4KVG B;  1ZM0 A;  2W2X D;  5KCV A;  2OTX A;  3SUZ A;  4OSN A;  3PVL A;  1P5T A;  3KRX A;  1WVH A;  2L1C A;  1H4R A;  2D2Q A;  2YT0 A;  4XWX A;  3KSY A;  1ZC3 B;  2DLW A;  2Y8G A;  4ZRJ A;  2Q13 A;  2YS1 A;  1FGZ A;  2RVB B;  1XCG A;  4QJ3 B;  4DX9 0;  4KHB B;  4A6F A;  3PSC A;  5C5B A;  2YT1 A;  3AU4 A;  2DKQ A;  2MWN B;  1BWN A;  2KIE A;  1DRO A;  5IRS A;  3HSA A;  2ELA A;  4PQ0 A;  2BCJ A;  2KR0 A;  4HAY B;  1P3R A;  1WJM A;  3PZD A;  3HQC A;  2KGX B;  3NW8 A;  1MK9 B;  2YRY A;  3AU5 A;  5C5B B;  2DYQ A;  2PZ1 A;  4K2O A;  5JHG A;  4KHB A;  1W1H A;  1XKE A;  1MI1 A;  2EJ8 A;  2DN6 A;  1Z87 A;  2K2J A;  2ADZ A;  3ML4 A;  5HE0 A;  1IRS A;  3FEH A;  3LJU X;  2J0J A;  4A5K A;  3FVC A;  3TFM A;  1QQG A;  2CY4 A;  2R0D A;  4GXB A;  3V5W A;  1EVH A;  4WSF A;  2XQN M;  4ZRK A;  4P7I A;  3RCP A;  1Q67 A;  3SYX A;  5I2M A;  1ISN A;  4Y94 A;  4DBB A;  4HDO A;  2D10 A;  3HK0 A;  5D3W A;  5LOP B;  2EMS A;  1ZVR A;  4DXA B;  4B6H A;  1FGY A;  4H8S A;  2I1J A;  5C6R A;  4K81 A;  2H7D A;  3HIE A;  4NSW A;  1K5D B;  1MK7 B; 
#chains in the Genus database with same CATH homology
 2DTC A;  1TJ6 A;  2W2X C;  1MAI A;  3A98 B;  4HAV B;  2DHK A;  3ULB A;  2UZS A;  4CYE A;  2D9V A;  3ZDT A;  4HAT B;  3AJ4 A;  5D3V A;  3VIA A;  2ZPY A;  4HAX B;  4MK0 A;  2M38 A;  1NTV A;  1I7A A;  1ZSQ A;  4GN1 A;  1EF1 A;  2LYD A;  4IFS A;  2YS3 A;  5FI0 A;  1PLS A;  4GPT B;  2V76 A;  5D27 A;  5DH9 B;  2LOZ A;  4Z2N A;  4CHJ A;  1N3H A;  1FOE A;  2H7E A;  2LKO A;  5CLL B;  2W2W A;  3P6A A;  3D8E A;  1V5M A;  3HW2 B;  4PNK A;  1AWE A;  1U5E A;  2M14 A;  1NU2 A;  2ELB A;  3P7Z A;  4KHO A;  3PVU A;  3QBV B;  4DX8 A;  2I1K A;  3ODO A;  3PP2 A;  1H10 A;  4MY6 A;  5KQ1 A;  1LW3 A;  3KZ1 A;  3CXB B;  1WJ1 A;  5C79 A;  1LB1 A;  3CIK A;  1FHW A;  4HB3 B;  2D9X A;  1V88 A;  3PG7 A;  1K5G B;  1WI1 A;  2YVC A;  2RSG A;  4GMX B;  1PMS A;  2P0D A;  1UEF A;  2COF A;  2NMB A;  1GC6 A;  1V5P A;  2RLO A;  2KCJ A;  5J3Y A;  2GJY A;  1XX0 A;  2LUL A;  4HAZ B;  1QC6 A;  5KQ4 A;  2FJL A;  2DHI A;  3A8P A;  2P0H A;  1RJ2 A;  2OQB A;  2AEH A;  4IOY X;  1V89 A;  1WGU A;  1GG3 A;  2COD A;  1DDW A;  3WA0 A;  4TYZ A;  2DFK A;  3BJI A;  2MFQ A;  3PEG A;  5J3T A;  4HB4 B;  2EMT A;  2RNR B;  4HDQ A;  4EKU A;  5CLQ B;  4WJ7 A;  1I2H A;  2MDX A;  2VKI A;  4CHM A;  4NY0 A;  2VRW B;  2N23 A;  3O96 A;  3TCA A;  1OQN A;  2K00 A;  3DXD A;  2D4Q A;  1NTY A;  1UNP A;  1W1D A;  1NI2 A;  2EC1 A;  4F7G A;  2DA0 A;  5DHA B;  4HB2 B;  1MPH A;  2QKL A;  2Y7B A;  2JP2 A;  1PFJ A;  1WG7 A;  5LON B;  2RUK B;  1FHX A;  1TQZ A;  2D11 A;  5HE1 A;  1X1G A;  1XD4 A;  2CAY A;  5J3Q A;  3D8F A;  4WVF B;  3TVV A;  4F7H A;  1XR0 B;  3ULC A;  5DIF B;  3MPX A;  3GYP A;  1M7R A;  3ODW A;  1DYN A;  2IFS A;  1KI1 B;  3G9W A;  5DHF B;  2Z0Q A;  2K2U A;  3SV1 A;  5HE3 A;  4C0A A;  2J59 M;  3ODX A;  2DHJ A;  4A6H A;  1X11 A;  2HE7 A;  1UNQ A;  3VOQ A;  1FB8 A;  1UPR A;  3UZT A;  5DI9 B;  3X23 A;  5GOW B;  4F7U P;  2P8V A;  3NSU A;  1U29 A;  3TO1 A;  3QWM A;  1MIZ B;  2X18 A;  1BTN A;  3IVF A;  2COA A;  2R09 A;  2IYB A;  1BAK A;  1B55 A;  4KAX B;  4EJN A;  1MKE A;  4TKN A;  4ZRI A;  1XOD A;  1Y5O A;  2ROZ B;  1X86 A;  1W1G A;  4MT7 A;  3DXC A;  5FI1 A;  1KZG A;  1Y19 B;  1UPQ A;  2RGN B;  1FHO A;  2UZR A;  4HAW B;  4K2P A;  3A8Q A;  4Z2M B;  2YS5 A;  5JP4 A;  3SO6 A;  2COC A;  4A6F B;  1AQC A;  4KHA A;  1TXD A;  4HB0 B;  1U2B A;  3GYO A;  5JHH A;  3TW1 A;  3QIJ A;  2NZ8 B;  2N0Y A;  4L6E A;  2DX5 A;  2L2I A;  1MIX A;  3F0W A;  4HAU B;  2G35 A;  2ROV A;  1UNR A;  2GCJ A;  2P0F A;  2Y8F A;  2I5C A;  2CY5 A;  2J0K A;  3SNH A;  3M1I B;  1FAO A;  2E2X A;  2DYN A;  1WGQ A;  4GZU A;  1P6S A;  3OAN A;  1U5F A;  1ZC4 B;  4EMO A;  2DX1 A;  1KZ7 A;  3KY9 A;  1RRP B;  2HTH B;  2LOX A;  3DXE A;  3MDB C;  4BBK A;  1X1F A;  1EAZ A;  2J0M A;  2D9Z A;  1DBH A;  1X05 A;  4D0N B;  2UVM A;  1V5U A;  3BIN A;  3PVW A;  1E5W A;  3D8D A;  4IAP A;  3N7C A;  2MKR A;  1U5D A;  4HHV A;  2CRF A;  3KRW A;  4GMV A;  1SGH A;  2VSZ A;  3U8Z A;  1DDV A;  1U5G A;  5EFX A;  3U7D A;  2D9W A;  1U27 A;  1BTK A;  2YSZ A;  3T06 A;  1J0W A;  4A6K A;  2Z0P A;  1OY2 A;  5JLJ B;  1M7E A;  2D9Y A;  5D3Y A;  2I5F A;  1EGX A;  2QKM A;  1DDM A;  2YF0 A;  4YL8 A;  4K17 A;  2Z0O A;  2GS0 A;  2GCL A;  3WYF B;  5C16 A;  3FSS A;  5D3X A;  2DKP A;  3FM8 C;  1GC7 A;  2LG1 A;  3ZVR A;  1OMW A;  1SHC A;  5HE2 A;  4YON A;  2AL6 A;  2KUP A;  5L81 A;  1V61 A;  3F5R A;  1J19 A;  4KVG B;  1ZM0 A;  2W2X D;  5KCV A;  2OTX A;  3SUZ A;  3PVL A;  1P5T A;  3KRX A;  1WVH A;  2L1C A;  1H4R A;  2D2Q A;  2YT0 A;  4XWX A;  3KSY A;  1ZC3 B;  2DLW A;  2Y8G A;  4ZRJ A;  2Q13 A;  2YS1 A;  1FGZ A;  2RVB B;  1XCG A;  4DX9 0;  4KHB B;  4A6F A;  3PSC A;  5C5B A;  2YT1 A;  3AU4 A;  2DKQ A;  2MWN B;  1BWN A;  1DRO A;  2ELA A;  4PQ0 A;  2BCJ A;  4HAY B;  1P3R A;  1WJM A;  3PZD A;  3HQC A;  2KGX B;  1MK9 B;  2YRY A;  3AU5 A;  5C5B B;  2DYQ A;  2PZ1 A;  4K2O A;  5JHG A;  1W1H A;  1XKE A;  2EJ8 A;  2DN6 A;  1Z87 A;  2K2J A;  2ADZ A;  3ML4 A;  5HE0 A;  1IRS A;  3FEH A;  3LJU X;  2J0J A;  4A5K A;  3TFM A;  1QQG A;  2CY4 A;  2R0D A;  4GXB A;  3V5W A;  1EVH A;  4WSF A;  2XQN M;  4ZRK A;  4P7I A;  3RCP A;  1Q67 A;  3SYX A;  1ISN A;  4Y94 A;  4DBB A;  4HDO A;  2D10 A;  3HK0 A;  5D3W A;  5LOP B;  2EMS A;  1ZVR A;  4DXA B;  4B6H A;  1FGY A;  4H8S A;  2I1J A;  5C6R A;  4K81 A;  2H7D A;  4NSW A;  1K5D B;  1MK7 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...