1FGYA

Grp1 ph domain with ins(1,3,4,5)p4
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
127
structure length
127
Chain Sequence
b'TFFNPDREGWLLKLGGRVKTWKRRWFILTDNCLYYFEYTTDKEPRGIIPLENLSIREVLDPRKPNCFELYNPSHKGQVIKACKTEADGRVVEGNHVVYRISAPSPEEKEEWMKSIKASISRDPFYDM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords GRP1
publication title Structural basis of 3-phosphoinositide recognition by pleckstrin homology domains.
pubmed doi rcsb
source organism Mus musculus
molecule tags Signaling protein
total genus 23
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2000-07-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00169 PH PH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 1fgyA00
3G9WA 2I1KA 1U5DA 1V89A 5J3YA 3TO1A 2DA0A 1TJ6A 2K2UA 1OMWA 3HW2B 1U5FA 3DXCA 1DDVA 2ADZA 5CLLB 4D0NB 1UNQA 2QKMA 4HATB 3CXBB 4A6HA 1KI1B 4GMVA 1KZ7A 4NSWA 2AEHA 2EMSA 4PNKA 3SV1A 2D9VA 2YS1A 1LB1A 1M7EA 2H7DA 2J0KA 5DI9B 3M1IB 5DIFB 1V5MA 1FHXA 4TYZA 3AU4A 1FOEA 2LYDA 2EJ8A 3WA0A 1V5PA 4DBBA 4K2OA 1XCGA 5DHAB 1DBHA 4MK0A 5C5BB 5D27A 1FGYA 2Z0PA 3GYPA 4K81A 2RUKB 4ZRKA 4P7IA 3ULCA 3A98B 1RJ2A 1UEFA 4DX90 1WJMA 4EJNA 2AL6A 2HTHB 2N23A 5HE2A 2DN6A 4KAXB 5JHHA 1NI2A 1M7RA 2J0MA 1BWNA 4HAVB 3LJUX 2CODA 2GCLA 4HB2B 4EMOA 2Q13A 4KHAA 2L2IA 4HHVA 2ELBA 4WSFA 2FJLA 2D4QA 5KCVA 3PP2A 1PMSA 1AQCA 4A6KA 1KZGA 2ROVA 1WG7A 4HAYB 1WI1A 2MWNB 4EKUA 2ELAA 1RRPB 2D2QA 1TXDA 2NMBA 4H8SA 1GC6A 1W1HA 4TKNA 3DXDA 2W2XC 4F7HA 1X05A 2PZ1A 1U5EA 2L1CA 2GS0A 1H4RA 1MIXA 2LG1A 4GN1A 1U29A 1V61A 4HDOA 1QQGA 5GOWB 2CY4A 4IOYX 1PFJA 1WGQA 2P0FA 3KY9A 4DXAB 2D10A 2HE7A 2YVCA 2VKIA 2MDXA 2OTXA 3SUZA 1XX0A 4A5KA 1V88A 1Q67A 5DH9B 5HE3A 3QWMA 3TCAA 2LOXA 1I7AA 2CY5A 2YSZA 3VOQA 5JLJB 1BTNA 1P6SA 1WJ1A 2LOZA 1E5WA 1K5DB 2DHIA 2Y8FA 5DHFB 3QBVB 1EGXA 2DHKA 1TQZA 1P3RA 2ZPYA 2Z0OA 1FHOA 3BJIA 2CAYA 4CHJA 3TFMA 1BTKA 2XQNM 2M38A 4HB3B 3MPXA 4XWXA 2X18A 4YL8A 4HAUB 3AJ4A 2I1JA 2UZSA 3KRXA 4PQ0A 2H7EA 5C16A 5D3VA 4F7UP 2D9YA 3U8ZA 2COAA 4GXBA 3N7CA 2YT1A 3UZTA 1FAOA 4F7GA 1WGUA 4HAZB 5JHGA 4B6HA 3DXEA 3U7DA 3RCPA 4YONA 4Z2NA 2RGNB 1Y19B 5J3TA 4HAWB 1MAIA 3ML4A 1GC7A 1U27A 2DHJA 2KUPA 2YT0A 2DX1A 1N3HA 1ZC4B 2W2WA 4GMXB 3TVVA 2E2XA 3D8DA 1FGZA 1U5GA 2EMTA 2OQBA 3PVUA 2COCA 2LULA 2KGXB 2UZRA 4DX8A 2ROZB 3SO6A 1W1GA 1V5UA 3P7ZA 2KCJA 2DLWA 4MT7A 4ZRJA 3FEHA 1QC6A 2VRWB 1DDMA 2DX5A 3PVLA 2R0DA 2DYNA 5D3XA 2RSGA 3KSYA 2YRYA 3BINA 1UNRA 1X86A 1H10A 2GJYA 1ISNA 1UPRA 1ZSQA 2UVMA 3P6AA 1PLSA 4C0AA 3O96A 3PSCA 2IYBA 5FI1A 4HB0B 1DDWA 2RVBB 2D9ZA 5D3YA 2Y8GA 4BBKA 1XODA 1B55A 3ODXA 1J0WA 2MFQA 1EVHA 5FI0A 4A6FA 1OY2A 2QKLA 3ZVRA 1ZVRA 4CYEA 1NU2A 5C79A 2DFKA 4KVGB 1XR0B 1P5TA 3HK0A 1MK7B 3MDBC 1NTVA 1MPHA 4Z2MB 4MY6A 5HE0A 5EFXA 2W2XD 1DYNA 3TW1A 2BCJA 2COFA 3VIAA 4L6EA 1SHCA 2NZ8B 3OANA 3ODWA 3KRWA 2R09A 4WJ7A 1DROA 2D9WA 3PEGA 3PG7A 3QIJA 3HQCA 3D8EA 1U2BA 2EC1A 2M14A 3CIKA 3D8FA 3SYXA 1K5GB 1I2HA 3ZDTA 2K00A 5LONB 3IVFA 3KZ1A 4GPTB 2N0YA 1X11A 3A8QA 3X23A 1SGHA 2D9XA 3PZDA 4WVFB 2J59M 1X1FA 2Y7BA 1BAKA 4NY0A 4A6FB 2RLOA 1WVHA 1ZC3B 5L81A 2DYQA 2DKPA 1AWEA 2G35A 1W1DA 2P8VA 3V5WA 3F0WA 4HAXB 4KHOA 2V76A 3F5RA 3FM8C 3AU5A 4IAPA 3NSUA 1XKEA 2I5FA 3PVWA 2YF0A 3WYFB 3SNHA 4CHMA 5C6RA 5J3QA 2YS3A 1UNPA 3GYOA 2LKOA 5D3WA 3ULBA 3T06A 1EF1A 4HB4B 1Y5OA 4HDQA 2IFSA 2K2JA 4K2PA 4K17A 2D11A 2Z0QA 4KHBB 4Y94A 3FSSA 2CRFA 4IFSA 1ZM0A 5JP4A 2DTCA 1GG3A 1EAZA 2YS5A 5HE1A 2DKQA 5CLQB 1OQNA 5KQ4A 1J19A 2VSZA 1UPQA 1FHWA 1IRSA 2P0HA 1LW3A 3ODOA 3A8PA 1Z87A 1MK9B 1XD4A 2I5CA 1MIZB 1X1GA 5C5BA 5LOPB 5KQ1A 2JP2A 2MKRA 1FB8A 2P0DA 2RNRB 2J0JA 4ZRIA 2GCJA 1MKEA 4GZUA 1NTYA
chains in the Genus database with same CATH superfamily
3G9WA 3NWAA 2I1KA 2R2YA 1U5DA 1V89A 5J3YA 3TO1A 2DA0A 1TJ6A 2K2UA 1OMWA 3HW2B 1U5FA 3DXCA 1DDVA 2ADZA 5CLLB 4D0NB 1UNQA 2QKMA 2KIGA 4HATB 3CXBB 4A6HA 2Z4DA 1KI1B 4GMVA 1KZ7A 4NSWA 2AEHA 5I2SA 2EMSA 4PNKA 3SV1A 3NWFA 2D9VA 2YS1A 1LB1A 1M7EA 2H7DA 2J0KA 5DI9B 3M1IB 5DIFB 1V5MA 1FHXA 4TYZA 3AU4A 1FOEA 2LYDA 2EJ8A 3WA0A 1V5PA 4DBBA 5IRSA 2KUQA 4L1RA 3HSAA 4K2OA 1XCGA 5DHAB 1DBHA 4MK0A 5C5BB 5D27A 1FGYA 2Z0PA 3DCXA 3GYPA 4K81A 2RUKB 4ZRKA 4P7IA 3ULCA 3A98B 4QJ4B 1RJ2A 1UEFA 4DX90 3FVCA 4QJ5B 1WJMA 4EJNA 2AL6A 2HTHB 2N23A 5HE2A 2DN6A 4KAXB 5JHHA 1NI2A 1M7RA 2J0MA 1BWNA 4HAVB 3LJUX 2CODA 2GCLA 4HB2B 4EMOA 2Q13A 4KHAA 2L2IA 4HHVA 2ELBA 4WSFA 2FJLA 2D4QA 5KCVA 3PP2A 1PMSA 1AQCA 4A6KA 1KZGA 2ROVA 1WG7A 4HAYB 1WI1A 1T77A 2MWNB 4EKUA 2ELAA 1RRPB 2D2QA 1TXDA 2NMBA 4H8SA 1GC6A 1W1HA 1ZYIA 4TKNA 3DXDA 2W2XC 4F7HA 1X05A 2PZ1A 1U5EA 2L1CA 2GS0A 1H4RA 1MIXA 2LG1A 4GN1A 3B77A 1U29A 1V61A 4HDOA 1QQGA 5GOWB 2CY4A 4IOYX 1PFJA 1WGQA 2P0FA 3KY9A 4DXAB 2D10A 2HE7A 2YVCA 2VKIA 2MDXA 2OTXA 3SUZA 1XX0A 4A5KA 1V88A 2NBVA 1Q67A 2GUMA 5DH9B 5HE3A 3QWMA 3TCAA 2LOXA 1I7AA 2CY5A 2YSZA 3VOQA 5JLJB 1BTNA 1P6SA 1WJ1A 2LOZA 1E5WA 5I2MA 1K5DB 2DHIA 2Y8FA 5DHFB 3QBVB 1EGXA 2DHKA 1TQZA 1P3RA 2ZPYA 2Z0OA 1FHOA 3BJIA 2CAYA 4CHJA 3TFMA 1BTKA 2XQNM 2M38A 4HB3B 3MPXA 4XWXA 2X18A 4OSNA 4YL8A 5M4YB 4HAUB 2K8EA 3AJ4A 2I1JA 2UZSA 3KRXA 4PQ0A 2H7EA 5C16A 5D3VA 4F7UP 2KIEA 2D9YA 4QXAB 3U8ZA 2COAA 4GXBA 3N7CA 2YT1A 3UZTA 2ZKMX 1FAOA 4F7GA 1WGUA 4HAZB 4D6WA 4B6HA 3DXEA 5JHGA 3U7DA 3RCPA 4YONA 4Z2NA 4CSQA 2RGNB 1Y19B 5J3TA 4HAWB 1MAIA 3ML4A 1GC7A 1U27A 2DHJA 2KUPA 2YT0A 2DX1A 1N3HA 1ZC4B 2W2WA 4GMXB 3TVVA 2E2XA 3D8DA 1FGZA 1U5GA 2EMTA 2OQBA 2FJUB 3PVUA 2COCA 2LULA 2KGXB 2UZRA 4DX8A 2ROZB 3SO6A 1W1GA 1V5UA 3P7ZA 2KCJA 2DLWA 4MT7A 4ZRJA 3FEHA 2RRFA 1QC6A 2VRWB 1DDMA 2DX5A 3PVLA 2R0DA 1MI1A 2DYNA 5D3XA 2RSGA 3KSYA 2YRYA 3BINA 1UNRA 1X86A 1H10A 2GJYA 1ISNA 1UPRA 1ZSQA 2UVMA 3P6AA 1PLSA 4C0AA 3O96A 3PSCA 2IYBA 5FI1A 4HSIA 4HB0B 1DDWA 2RVBB 2D9ZA 5D3YA 2Y8GA 4BBKA 1XODA 1B55A 3ODXA 3U12A 1J0WA 2MFQA 3OHMB 1EVHA 5FI0A 4A6FA 1OY2A 2QKLA 3ZVRA 1ZVRA 4CYEA 1NU2A 4DIXA 5C79A 2DFKA 4KVGB 1XR0B 1P5TA 2KR0A 3HK0A 3A58A 2Z59A 1MK7B 3MDBC 1NTVA 1MPHA 4Z2MB 4MY6A 5HE0A 5EFXA 2W2XD 1DYNA 3TW1A 2BCJA 2COFA 3HIEA 2YT2A 4L6EA 3VIAA 1SHCA 2NZ8B 3OANA 3ODWA 3KRWA 2R09A 4WJ7A 1DROA 2D9WA 3PEGA 3PG7A 3QIJA 3HQCA 3D8EA 2K49A 1U2BA 2EC1A 2M14A 4KHBA 3CIKA 3D8FA 3SYXA 1K5GB 1I2HA 3ZDTA 2K00A 5LONB 3IVFA 3KZ1A 4GPTB 2N0YA 1X11A 3A8QA 3X23A 1SGHA 2D9XA 3PZDA 4WVFB 2J59M 1X1FA 3NW8A 2Y7BA 1BAKA 4NY0A 4A6FB 2RLOA 1WVHA 1ZC3B 5L81A 2DYQA 2Z13A 2DKPA 1AWEA 2G35A 1W1DA 2P8VA 3V5WA 3F0WA 4HAXB 4KHOA 2V76A 3F5RA 3FM8C 4OT1A 3AU5A 4IAPA 5LG4B 3NSUA 1XKEA 2I5FA 3PVWA 2YF0A 3WYFB 3SNHA 4CHMA 5C6RA 5J3QA 2YS3A 1UNPA 3GYOA 2LKOA 5D3WA 3ULBA 3T06A 1EF1A 4HB4B 1Y5OA 4HDQA 2IFSA 2K2JA 4K2PA 4K17A 2D11A 2Z0QA 4KHBB 4Y94A 3FSSA 2CRFA 4IFSA 1ZM0A 5JP4A 2DTCA 1GG3A 4QJ3B 2Z14A 1EAZA 2YS5A 5HE1A 2DKQA 5CLQB 3NWDA 1OQNA 5KQ4A 1J19A 2VSZA 1UPQA 1FHWA 1IRSA 2P0HA 1LW3A 3ODOA 3A8PA 1Z87A 1MK9B 1XD4A 2I5CA 1MIZB 1X1GA 5C5BA 5LOPB 5KQ1A 2JP2A 2MKRA 4GOUA 1FB8A 2P0DA 2RNRB 2J0JA 4ZRIA 2GCJA 1MKEA 4GNKB 4GZUA 1NTYA
chains in the Genus database with same CATH topology
3G9WA 2I1KA 1U5DA 1V89A 5J3YA 3TO1A 2DA0A 1TJ6A 2K2UA 1OMWA 3HW2B 1U5FA 3DXCA 1DDVA 2ADZA 5CLLB 4D0NB 1UNQA 2QKMA 4HATB 3CXBB 4A6HA 1KI1B 4GMVA 1KZ7A 4NSWA 2AEHA 2EMSA 4PNKA 3SV1A 2D9VA 2YS1A 1LB1A 1M7EA 2H7DA 2J0KA 5DI9B 3M1IB 5DIFB 1V5MA 1FHXA 4TYZA 3AU4A 1FOEA 2LYDA 2EJ8A 3WA0A 1V5PA 4DBBA 4K2OA 1XCGA 5DHAB 1DBHA 4MK0A 5C5BB 5D27A 1FGYA 2Z0PA 3GYPA 4K81A 2RUKB 4ZRKA 4P7IA 3ULCA 3A98B 1RJ2A 1UEFA 4DX90 1WJMA 4EJNA 2AL6A 2HTHB 2N23A 5HE2A 2DN6A 4KAXB 5JHHA 1NI2A 1M7RA 2J0MA 1BWNA 4HAVB 3LJUX 2CODA 2GCLA 4HB2B 4EMOA 2Q13A 4KHAA 2L2IA 4HHVA 2ELBA 4WSFA 2FJLA 2D4QA 5KCVA 3PP2A 1PMSA 1AQCA 4A6KA 1KZGA 2ROVA 1WG7A 4HAYB 1WI1A 2MWNB 4EKUA 2ELAA 1RRPB 2D2QA 1TXDA 2NMBA 4H8SA 1GC6A 1W1HA 4TKNA 3DXDA 2W2XC 4F7HA 1X05A 2PZ1A 1U5EA 2L1CA 2GS0A 1H4RA 1MIXA 2LG1A 4GN1A 1U29A 1V61A 4HDOA 1QQGA 5GOWB 2CY4A 4IOYX 1PFJA 1WGQA 2P0FA 3KY9A 4DXAB 2D10A 2HE7A 2YVCA 2VKIA 2MDXA 2OTXA 3SUZA 1XX0A 4A5KA 1V88A 1Q67A 5DH9B 5HE3A 3QWMA 3TCAA 2LOXA 1I7AA 2CY5A 2YSZA 3VOQA 5JLJB 1BTNA 1P6SA 1WJ1A 2LOZA 1E5WA 1K5DB 2DHIA 2Y8FA 5DHFB 3QBVB 1EGXA 2DHKA 1TQZA 1P3RA 2ZPYA 2Z0OA 1FHOA 3BJIA 2CAYA 4CHJA 3TFMA 1BTKA 2XQNM 2M38A 4HB3B 3MPXA 4XWXA 2X18A 4YL8A 4HAUB 3AJ4A 2I1JA 2UZSA 3KRXA 4PQ0A 2H7EA 5C16A 5D3VA 4F7UP 2D9YA 3U8ZA 2COAA 4GXBA 3N7CA 2YT1A 3UZTA 1FAOA 4F7GA 1WGUA 4HAZB 5JHGA 4B6HA 3DXEA 3U7DA 3RCPA 4YONA 4Z2NA 2RGNB 1Y19B 5J3TA 4HAWB 1MAIA 3ML4A 1GC7A 1U27A 2DHJA 2KUPA 2YT0A 2DX1A 1N3HA 1ZC4B 2W2WA 4GMXB 3TVVA 2E2XA 3D8DA 1FGZA 1U5GA 2EMTA 2OQBA 3PVUA 2COCA 2LULA 2KGXB 2UZRA 4DX8A 2ROZB 3SO6A 1W1GA 1V5UA 3P7ZA 2KCJA 2DLWA 4MT7A 4ZRJA 3FEHA 1QC6A 2VRWB 1DDMA 2DX5A 3PVLA 2R0DA 2DYNA 5D3XA 2RSGA 3KSYA 2YRYA 3BINA 1UNRA 1X86A 1H10A 2GJYA 1ISNA 1UPRA 1ZSQA 2UVMA 3P6AA 1PLSA 4C0AA 3O96A 3PSCA 2IYBA 5FI1A 4HB0B 1DDWA 2RVBB 2D9ZA 5D3YA 2Y8GA 4BBKA 1XODA 1B55A 3ODXA 1J0WA 2MFQA 1EVHA 5FI0A 4A6FA 1OY2A 2QKLA 3ZVRA 1ZVRA 4CYEA 1NU2A 5C79A 2DFKA 4KVGB 1XR0B 1P5TA 3HK0A 1MK7B 3MDBC 1NTVA 1MPHA 4Z2MB 4MY6A 5HE0A 5EFXA 2W2XD 1DYNA 3TW1A 2BCJA 2COFA 3VIAA 4L6EA 1SHCA 2NZ8B 3OANA 3ODWA 3KRWA 2R09A 4WJ7A 1DROA 2D9WA 3PEGA 3PG7A 3QIJA 3HQCA 3D8EA 1U2BA 2EC1A 2M14A 3CIKA 3D8FA 3SYXA 1K5GB 1I2HA 3ZDTA 2K00A 5LONB 3IVFA 3KZ1A 4GPTB 2N0YA 1X11A 3A8QA 3X23A 1SGHA 2D9XA 3PZDA 4WVFB 2J59M 1X1FA 2Y7BA 1BAKA 4NY0A 4A6FB 2RLOA 1WVHA 1ZC3B 5L81A 2DYQA 2DKPA 1AWEA 2G35A 1W1DA 2P8VA 3V5WA 3F0WA 4HAXB 4KHOA 2V76A 3F5RA 3FM8C 3AU5A 4IAPA 3NSUA 1XKEA 2I5FA 3PVWA 2YF0A 3WYFB 3SNHA 4CHMA 5C6RA 5J3QA 2YS3A 1UNPA 3GYOA 2LKOA 5D3WA 3ULBA 3T06A 1EF1A 4HB4B 1Y5OA 4HDQA 2IFSA 2K2JA 4K2PA 4K17A 2D11A 2Z0QA 4KHBB 4Y94A 3FSSA 2CRFA 4IFSA 1ZM0A 5JP4A 2DTCA 1GG3A 1EAZA 2YS5A 5HE1A 2DKQA 5CLQB 1OQNA 5KQ4A 1J19A 2VSZA 1UPQA 1FHWA 1IRSA 2P0HA 1LW3A 3ODOA 3A8PA 1Z87A 1MK9B 1XD4A 2I5CA 1MIZB 1X1GA 5C5BA 5LOPB 5KQ1A 2JP2A 2MKRA 1FB8A 2P0DA 2RNRB 2J0JA 4ZRIA 2GCJA 1MKEA 4GZUA 1NTYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3G9W A;  2I1K A;  1U5D A;  1V89 A;  5J3Y A;  3TO1 A;  2DA0 A;  1TJ6 A;  2K2U A;  1OMW A;  3HW2 B;  1U5F A;  3DXC A;  1DDV A;  2ADZ A;  5CLL B;  4D0N B;  1UNQ A;  2QKM A;  4HAT B;  3CXB B;  4A6H A;  1KI1 B;  4GMV A;  1KZ7 A;  4NSW A;  2AEH A;  2EMS A;  4PNK A;  3SV1 A;  2D9V A;  2YS1 A;  1LB1 A;  1M7E A;  2H7D A;  2J0K A;  5DI9 B;  3M1I B;  5DIF B;  1V5M A;  1FHX A;  4TYZ A;  3AU4 A;  1FOE A;  2LYD A;  2EJ8 A;  3WA0 A;  1V5P A;  4DBB A;  4K2O A;  1XCG A;  5DHA B;  1DBH A;  4MK0 A;  5C5B B;  5D27 A;  1FGY A;  2Z0P A;  3GYP A;  4K81 A;  2RUK B;  4ZRK A;  4P7I A;  3ULC A;  3A98 B;  1RJ2 A;  1UEF A;  4DX9 0;  1WJM A;  4EJN A;  2AL6 A;  2HTH B;  2N23 A;  5HE2 A;  2DN6 A;  4KAX B;  5JHH A;  1NI2 A;  1M7R A;  2J0M A;  1BWN A;  4HAV B;  3LJU X;  2COD A;  2GCL A;  4HB2 B;  4EMO A;  2Q13 A;  4KHA A;  2L2I A;  4HHV A;  2ELB A;  4WSF A;  2FJL A;  2D4Q A;  5KCV A;  3PP2 A;  1PMS A;  1AQC A;  4A6K A;  1KZG A;  2ROV A;  1WG7 A;  4HAY B;  1WI1 A;  2MWN B;  4EKU A;  2ELA A;  1RRP B;  2D2Q A;  1TXD A;  2NMB A;  4H8S A;  1GC6 A;  1W1H A;  4TKN A;  3DXD A;  2W2X C;  4F7H A;  1X05 A;  2PZ1 A;  1U5E A;  2L1C A;  2GS0 A;  1H4R A;  1MIX A;  2LG1 A;  4GN1 A;  1U29 A;  1V61 A;  4HDO A;  1QQG A;  5GOW B;  2CY4 A;  4IOY X;  1PFJ A;  1WGQ A;  2P0F A;  3KY9 A;  4DXA B;  2D10 A;  2HE7 A;  2YVC A;  2VKI A;  2MDX A;  2OTX A;  3SUZ A;  1XX0 A;  4A5K A;  1V88 A;  1Q67 A;  5DH9 B;  5HE3 A;  3QWM A;  3TCA A;  2LOX A;  1I7A A;  2CY5 A;  2YSZ A;  3VOQ A;  5JLJ B;  1BTN A;  1P6S A;  1WJ1 A;  2LOZ A;  1E5W A;  1K5D B;  2DHI A;  2Y8F A;  5DHF B;  3QBV B;  1EGX A;  2DHK A;  1TQZ A;  1P3R A;  2ZPY A;  2Z0O A;  1FHO A;  3BJI A;  2CAY A;  4CHJ A;  3TFM A;  1BTK A;  2XQN M;  2M38 A;  4HB3 B;  3MPX A;  4XWX A;  2X18 A;  4YL8 A;  4HAU B;  3AJ4 A;  2I1J A;  2UZS A;  3KRX A;  4PQ0 A;  2H7E A;  5C16 A;  5D3V A;  4F7U P;  2D9Y A;  3U8Z A;  2COA A;  4GXB A;  3N7C A;  2YT1 A;  3UZT A;  1FAO A;  4F7G A;  1WGU A;  4HAZ B;  5JHG A;  4B6H A;  3DXE A;  3U7D A;  3RCP A;  4YON A;  4Z2N A;  2RGN B;  1Y19 B;  5J3T A;  4HAW B;  1MAI A;  3ML4 A;  1GC7 A;  1U27 A;  2DHJ A;  2KUP A;  2YT0 A;  2DX1 A;  1N3H A;  1ZC4 B;  2W2W A;  4GMX B;  3TVV A;  2E2X A;  3D8D A;  1FGZ A;  1U5G A;  2EMT A;  2OQB A;  3PVU A;  2COC A;  2LUL A;  2KGX B;  2UZR A;  4DX8 A;  2ROZ B;  3SO6 A;  1W1G A;  1V5U A;  3P7Z A;  2KCJ A;  2DLW A;  4MT7 A;  4ZRJ A;  3FEH A;  1QC6 A;  2VRW B;  1DDM A;  2DX5 A;  3PVL A;  2R0D A;  2DYN A;  5D3X A;  2RSG A;  3KSY A;  2YRY A;  3BIN A;  1UNR A;  1X86 A;  1H10 A;  2GJY A;  1ISN A;  1UPR A;  1ZSQ A;  2UVM A;  3P6A A;  1PLS A;  4C0A A;  3O96 A;  3PSC A;  2IYB A;  5FI1 A;  4HB0 B;  1DDW A;  2RVB B;  2D9Z A;  5D3Y A;  2Y8G A;  4BBK A;  1XOD A;  1B55 A;  3ODX A;  1J0W A;  2MFQ A;  1EVH A;  5FI0 A;  4A6F A;  1OY2 A;  2QKL A;  3ZVR A;  1ZVR A;  4CYE A;  1NU2 A;  5C79 A;  2DFK A;  4KVG B;  1XR0 B;  1P5T A;  3HK0 A;  1MK7 B;  3MDB C;  1NTV A;  1MPH A;  4Z2M B;  4MY6 A;  5HE0 A;  5EFX A;  2W2X D;  1DYN A;  3TW1 A;  2BCJ A;  2COF A;  3VIA A;  4L6E A;  1SHC A;  2NZ8 B;  3OAN A;  3ODW A;  3KRW A;  2R09 A;  4WJ7 A;  1DRO A;  2D9W A;  3PEG A;  3PG7 A;  3QIJ A;  3HQC A;  3D8E A;  1U2B A;  2EC1 A;  2M14 A;  3CIK A;  3D8F A;  3SYX A;  1K5G B;  1I2H A;  3ZDT A;  2K00 A;  5LON B;  3IVF A;  3KZ1 A;  4GPT B;  2N0Y A;  1X11 A;  3A8Q A;  3X23 A;  1SGH A;  2D9X A;  3PZD A;  4WVF B;  2J59 M;  1X1F A;  2Y7B A;  1BAK A;  4NY0 A;  4A6F B;  2RLO A;  1WVH A;  1ZC3 B;  5L81 A;  2DYQ A;  2DKP A;  1AWE A;  2G35 A;  1W1D A;  2P8V A;  3V5W A;  3F0W A;  4HAX B;  4KHO A;  2V76 A;  3F5R A;  3FM8 C;  3AU5 A;  4IAP A;  3NSU A;  1XKE A;  2I5F A;  3PVW A;  2YF0 A;  3WYF B;  3SNH A;  4CHM A;  5C6R A;  5J3Q A;  2YS3 A;  1UNP A;  3GYO A;  2LKO A;  5D3W A;  3ULB A;  3T06 A;  1EF1 A;  4HB4 B;  1Y5O A;  4HDQ A;  2IFS A;  2K2J A;  4K2P A;  4K17 A;  2D11 A;  2Z0Q A;  4KHB B;  4Y94 A;  3FSS A;  2CRF A;  4IFS A;  1ZM0 A;  5JP4 A;  2DTC A;  1GG3 A;  1EAZ A;  2YS5 A;  5HE1 A;  2DKQ A;  5CLQ B;  1OQN A;  5KQ4 A;  1J19 A;  2VSZ A;  1UPQ A;  1FHW A;  1IRS A;  2P0H A;  1LW3 A;  3ODO A;  3A8P A;  1Z87 A;  1MK9 B;  1XD4 A;  2I5C A;  1MIZ B;  1X1G A;  5C5B A;  5LOP B;  5KQ1 A;  2JP2 A;  2MKR A;  1FB8 A;  2P0D A;  2RNR B;  2J0J A;  4ZRI A;  2GCJ A;  1MKE A;  4GZU A;  1NTY A; 
#chains in the Genus database with same CATH topology
 3G9W A;  3NWA A;  2I1K A;  2R2Y A;  1U5D A;  1V89 A;  5J3Y A;  3TO1 A;  2DA0 A;  1TJ6 A;  2K2U A;  1OMW A;  3HW2 B;  1U5F A;  3DXC A;  1DDV A;  2ADZ A;  5CLL B;  4D0N B;  1UNQ A;  2QKM A;  2KIG A;  4HAT B;  3CXB B;  4A6H A;  2Z4D A;  1KI1 B;  4GMV A;  1KZ7 A;  4NSW A;  2AEH A;  5I2S A;  2EMS A;  4PNK A;  3SV1 A;  3NWF A;  2D9V A;  2YS1 A;  1LB1 A;  1M7E A;  2H7D A;  2J0K A;  5DI9 B;  3M1I B;  5DIF B;  1V5M A;  1FHX A;  4TYZ A;  3AU4 A;  1FOE A;  2LYD A;  2EJ8 A;  3WA0 A;  1V5P A;  4DBB A;  5IRS A;  2KUQ A;  4L1R A;  3HSA A;  4K2O A;  1XCG A;  5DHA B;  1DBH A;  4MK0 A;  5C5B B;  5D27 A;  1FGY A;  2Z0P A;  3DCX A;  3GYP A;  4K81 A;  2RUK B;  4ZRK A;  4P7I A;  3ULC A;  3A98 B;  4QJ4 B;  1RJ2 A;  1UEF A;  4DX9 0;  3FVC A;  4QJ5 B;  1WJM A;  4EJN A;  2AL6 A;  2HTH B;  2N23 A;  5HE2 A;  2DN6 A;  4KAX B;  5JHH A;  1NI2 A;  1M7R A;  2J0M A;  1BWN A;  4HAV B;  3LJU X;  2COD A;  2GCL A;  4HB2 B;  4EMO A;  2Q13 A;  4KHA A;  2L2I A;  4HHV A;  2ELB A;  4WSF A;  2FJL A;  2D4Q A;  5KCV A;  3PP2 A;  1PMS A;  1AQC A;  4A6K A;  1KZG A;  2ROV A;  1WG7 A;  4HAY B;  1WI1 A;  1T77 A;  2MWN B;  4EKU A;  2ELA A;  1RRP B;  2D2Q A;  1TXD A;  2NMB A;  4H8S A;  1GC6 A;  1W1H A;  1ZYI A;  4TKN A;  3DXD A;  2W2X C;  4F7H A;  1X05 A;  2PZ1 A;  1U5E A;  2L1C A;  2GS0 A;  1H4R A;  1MIX A;  2LG1 A;  4GN1 A;  3B77 A;  1U29 A;  1V61 A;  4HDO A;  1QQG A;  5GOW B;  2CY4 A;  4IOY X;  1PFJ A;  1WGQ A;  2P0F A;  3KY9 A;  4DXA B;  2D10 A;  2HE7 A;  2YVC A;  2VKI A;  2MDX A;  2OTX A;  3SUZ A;  1XX0 A;  4A5K A;  1V88 A;  2NBV A;  1Q67 A;  2GUM A;  5DH9 B;  5HE3 A;  3QWM A;  3TCA A;  2LOX A;  1I7A A;  2CY5 A;  2YSZ A;  3VOQ A;  5JLJ B;  1BTN A;  1P6S A;  1WJ1 A;  2LOZ A;  1E5W A;  5I2M A;  1K5D B;  2DHI A;  2Y8F A;  5DHF B;  3QBV B;  1EGX A;  2DHK A;  1TQZ A;  1P3R A;  2ZPY A;  2Z0O A;  1FHO A;  3BJI A;  2CAY A;  4CHJ A;  3TFM A;  1BTK A;  2XQN M;  2M38 A;  4HB3 B;  3MPX A;  4XWX A;  2X18 A;  4OSN A;  4YL8 A;  5M4Y B;  4HAU B;  2K8E A;  3AJ4 A;  2I1J A;  2UZS A;  3KRX A;  4PQ0 A;  2H7E A;  5C16 A;  5D3V A;  4F7U P;  2KIE A;  2D9Y A;  4QXA B;  3U8Z A;  2COA A;  4GXB A;  3N7C A;  2YT1 A;  3UZT A;  2ZKM X;  1FAO A;  4F7G A;  1WGU A;  4HAZ B;  4D6W A;  4B6H A;  3DXE A;  5JHG A;  3U7D A;  3RCP A;  4YON A;  4Z2N A;  4CSQ A;  2RGN B;  1Y19 B;  5J3T A;  4HAW B;  1MAI A;  3ML4 A;  1GC7 A;  1U27 A;  2DHJ A;  2KUP A;  2YT0 A;  2DX1 A;  1N3H A;  1ZC4 B;  2W2W A;  4GMX B;  3TVV A;  2E2X A;  3D8D A;  1FGZ A;  1U5G A;  2EMT A;  2OQB A;  2FJU B;  3PVU A;  2COC A;  2LUL A;  2KGX B;  2UZR A;  4DX8 A;  2ROZ B;  3SO6 A;  1W1G A;  1V5U A;  3P7Z A;  2KCJ A;  2DLW A;  4MT7 A;  4ZRJ A;  3FEH A;  2RRF A;  1QC6 A;  2VRW B;  1DDM A;  2DX5 A;  3PVL A;  2R0D A;  1MI1 A;  2DYN A;  5D3X A;  2RSG A;  3KSY A;  2YRY A;  3BIN A;  1UNR A;  1X86 A;  1H10 A;  2GJY A;  1ISN A;  1UPR A;  1ZSQ A;  2UVM A;  3P6A A;  1PLS A;  4C0A A;  3O96 A;  3PSC A;  2IYB A;  5FI1 A;  4HSI A;  4HB0 B;  1DDW A;  2RVB B;  2D9Z A;  5D3Y A;  2Y8G A;  4BBK A;  1XOD A;  1B55 A;  3ODX A;  3U12 A;  1J0W A;  2MFQ A;  3OHM B;  1EVH A;  5FI0 A;  4A6F A;  1OY2 A;  2QKL A;  3ZVR A;  1ZVR A;  4CYE A;  1NU2 A;  4DIX A;  5C79 A;  2DFK A;  4KVG B;  1XR0 B;  1P5T A;  2KR0 A;  3HK0 A;  3A58 A;  2Z59 A;  1MK7 B;  3MDB C;  1NTV A;  1MPH A;  4Z2M B;  4MY6 A;  5HE0 A;  5EFX A;  2W2X D;  1DYN A;  3TW1 A;  2BCJ A;  2COF A;  3HIE A;  2YT2 A;  4L6E A;  3VIA A;  1SHC A;  2NZ8 B;  3OAN A;  3ODW A;  3KRW A;  2R09 A;  4WJ7 A;  1DRO A;  2D9W A;  3PEG A;  3PG7 A;  3QIJ A;  3HQC A;  3D8E A;  2K49 A;  1U2B A;  2EC1 A;  2M14 A;  4KHB A;  3CIK A;  3D8F A;  3SYX A;  1K5G B;  1I2H A;  3ZDT A;  2K00 A;  5LON B;  3IVF A;  3KZ1 A;  4GPT B;  2N0Y A;  1X11 A;  3A8Q A;  3X23 A;  1SGH A;  2D9X A;  3PZD A;  4WVF B;  2J59 M;  1X1F A;  3NW8 A;  2Y7B A;  1BAK A;  4NY0 A;  4A6F B;  2RLO A;  1WVH A;  1ZC3 B;  5L81 A;  2DYQ A;  2Z13 A;  2DKP A;  1AWE A;  2G35 A;  1W1D A;  2P8V A;  3V5W A;  3F0W A;  4HAX B;  4KHO A;  2V76 A;  3F5R A;  3FM8 C;  4OT1 A;  3AU5 A;  4IAP A;  5LG4 B;  3NSU A;  1XKE A;  2I5F A;  3PVW A;  2YF0 A;  3WYF B;  3SNH A;  4CHM A;  5C6R A;  5J3Q A;  2YS3 A;  1UNP A;  3GYO A;  2LKO A;  5D3W A;  3ULB A;  3T06 A;  1EF1 A;  4HB4 B;  1Y5O A;  4HDQ A;  2IFS A;  2K2J A;  4K2P A;  4K17 A;  2D11 A;  2Z0Q A;  4KHB B;  4Y94 A;  3FSS A;  2CRF A;  4IFS A;  1ZM0 A;  5JP4 A;  2DTC A;  1GG3 A;  4QJ3 B;  2Z14 A;  1EAZ A;  2YS5 A;  5HE1 A;  2DKQ A;  5CLQ B;  3NWD A;  1OQN A;  5KQ4 A;  1J19 A;  2VSZ A;  1UPQ A;  1FHW A;  1IRS A;  2P0H A;  1LW3 A;  3ODO A;  3A8P A;  1Z87 A;  1MK9 B;  1XD4 A;  2I5C A;  1MIZ B;  1X1G A;  5C5B A;  5LOP B;  5KQ1 A;  2JP2 A;  2MKR A;  4GOU A;  1FB8 A;  2P0D A;  2RNR B;  2J0J A;  4ZRI A;  2GCJ A;  1MKE A;  4GNK B;  4GZU A;  1NTY A; 
#chains in the Genus database with same CATH homology
 3G9W A;  2I1K A;  1U5D A;  1V89 A;  5J3Y A;  3TO1 A;  2DA0 A;  1TJ6 A;  2K2U A;  1OMW A;  3HW2 B;  1U5F A;  3DXC A;  1DDV A;  2ADZ A;  5CLL B;  4D0N B;  1UNQ A;  2QKM A;  4HAT B;  3CXB B;  4A6H A;  1KI1 B;  4GMV A;  1KZ7 A;  4NSW A;  2AEH A;  2EMS A;  4PNK A;  3SV1 A;  2D9V A;  2YS1 A;  1LB1 A;  1M7E A;  2H7D A;  2J0K A;  5DI9 B;  3M1I B;  5DIF B;  1V5M A;  1FHX A;  4TYZ A;  3AU4 A;  1FOE A;  2LYD A;  2EJ8 A;  3WA0 A;  1V5P A;  4DBB A;  4K2O A;  1XCG A;  5DHA B;  1DBH A;  4MK0 A;  5C5B B;  5D27 A;  1FGY A;  2Z0P A;  3GYP A;  4K81 A;  2RUK B;  4ZRK A;  4P7I A;  3ULC A;  3A98 B;  1RJ2 A;  1UEF A;  4DX9 0;  1WJM A;  4EJN A;  2AL6 A;  2HTH B;  2N23 A;  5HE2 A;  2DN6 A;  4KAX B;  5JHH A;  1NI2 A;  1M7R A;  2J0M A;  1BWN A;  4HAV B;  3LJU X;  2COD A;  2GCL A;  4HB2 B;  4EMO A;  2Q13 A;  4KHA A;  2L2I A;  4HHV A;  2ELB A;  4WSF A;  2FJL A;  2D4Q A;  5KCV A;  3PP2 A;  1PMS A;  1AQC A;  4A6K A;  1KZG A;  2ROV A;  1WG7 A;  4HAY B;  1WI1 A;  2MWN B;  4EKU A;  2ELA A;  1RRP B;  2D2Q A;  1TXD A;  2NMB A;  4H8S A;  1GC6 A;  1W1H A;  4TKN A;  3DXD A;  2W2X C;  4F7H A;  1X05 A;  2PZ1 A;  1U5E A;  2L1C A;  2GS0 A;  1H4R A;  1MIX A;  2LG1 A;  4GN1 A;  1U29 A;  1V61 A;  4HDO A;  1QQG A;  5GOW B;  2CY4 A;  4IOY X;  1PFJ A;  1WGQ A;  2P0F A;  3KY9 A;  4DXA B;  2D10 A;  2HE7 A;  2YVC A;  2VKI A;  2MDX A;  2OTX A;  3SUZ A;  1XX0 A;  4A5K A;  1V88 A;  1Q67 A;  5DH9 B;  5HE3 A;  3QWM A;  3TCA A;  2LOX A;  1I7A A;  2CY5 A;  2YSZ A;  3VOQ A;  5JLJ B;  1BTN A;  1P6S A;  1WJ1 A;  2LOZ A;  1E5W A;  1K5D B;  2DHI A;  2Y8F A;  5DHF B;  3QBV B;  1EGX A;  2DHK A;  1TQZ A;  1P3R A;  2ZPY A;  2Z0O A;  1FHO A;  3BJI A;  2CAY A;  4CHJ A;  3TFM A;  1BTK A;  2XQN M;  2M38 A;  4HB3 B;  3MPX A;  4XWX A;  2X18 A;  4YL8 A;  4HAU B;  3AJ4 A;  2I1J A;  2UZS A;  3KRX A;  4PQ0 A;  2H7E A;  5C16 A;  5D3V A;  4F7U P;  2D9Y A;  3U8Z A;  2COA A;  4GXB A;  3N7C A;  2YT1 A;  3UZT A;  1FAO A;  4F7G A;  1WGU A;  4HAZ B;  5JHG A;  4B6H A;  3DXE A;  3U7D A;  3RCP A;  4YON A;  4Z2N A;  2RGN B;  1Y19 B;  5J3T A;  4HAW B;  1MAI A;  3ML4 A;  1GC7 A;  1U27 A;  2DHJ A;  2KUP A;  2YT0 A;  2DX1 A;  1N3H A;  1ZC4 B;  2W2W A;  4GMX B;  3TVV A;  2E2X A;  3D8D A;  1FGZ A;  1U5G A;  2EMT A;  2OQB A;  3PVU A;  2COC A;  2LUL A;  2KGX B;  2UZR A;  4DX8 A;  2ROZ B;  3SO6 A;  1W1G A;  1V5U A;  3P7Z A;  2KCJ A;  2DLW A;  4MT7 A;  4ZRJ A;  3FEH A;  1QC6 A;  2VRW B;  1DDM A;  2DX5 A;  3PVL A;  2R0D A;  2DYN A;  5D3X A;  2RSG A;  3KSY A;  2YRY A;  3BIN A;  1UNR A;  1X86 A;  1H10 A;  2GJY A;  1ISN A;  1UPR A;  1ZSQ A;  2UVM A;  3P6A A;  1PLS A;  4C0A A;  3O96 A;  3PSC A;  2IYB A;  5FI1 A;  4HB0 B;  1DDW A;  2RVB B;  2D9Z A;  5D3Y A;  2Y8G A;  4BBK A;  1XOD A;  1B55 A;  3ODX A;  1J0W A;  2MFQ A;  1EVH A;  5FI0 A;  4A6F A;  1OY2 A;  2QKL A;  3ZVR A;  1ZVR A;  4CYE A;  1NU2 A;  5C79 A;  2DFK A;  4KVG B;  1XR0 B;  1P5T A;  3HK0 A;  1MK7 B;  3MDB C;  1NTV A;  1MPH A;  4Z2M B;  4MY6 A;  5HE0 A;  5EFX A;  2W2X D;  1DYN A;  3TW1 A;  2BCJ A;  2COF A;  3VIA A;  4L6E A;  1SHC A;  2NZ8 B;  3OAN A;  3ODW A;  3KRW A;  2R09 A;  4WJ7 A;  1DRO A;  2D9W A;  3PEG A;  3PG7 A;  3QIJ A;  3HQC A;  3D8E A;  1U2B A;  2EC1 A;  2M14 A;  3CIK A;  3D8F A;  3SYX A;  1K5G B;  1I2H A;  3ZDT A;  2K00 A;  5LON B;  3IVF A;  3KZ1 A;  4GPT B;  2N0Y A;  1X11 A;  3A8Q A;  3X23 A;  1SGH A;  2D9X A;  3PZD A;  4WVF B;  2J59 M;  1X1F A;  2Y7B A;  1BAK A;  4NY0 A;  4A6F B;  2RLO A;  1WVH A;  1ZC3 B;  5L81 A;  2DYQ A;  2DKP A;  1AWE A;  2G35 A;  1W1D A;  2P8V A;  3V5W A;  3F0W A;  4HAX B;  4KHO A;  2V76 A;  3F5R A;  3FM8 C;  3AU5 A;  4IAP A;  3NSU A;  1XKE A;  2I5F A;  3PVW A;  2YF0 A;  3WYF B;  3SNH A;  4CHM A;  5C6R A;  5J3Q A;  2YS3 A;  1UNP A;  3GYO A;  2LKO A;  5D3W A;  3ULB A;  3T06 A;  1EF1 A;  4HB4 B;  1Y5O A;  4HDQ A;  2IFS A;  2K2J A;  4K2P A;  4K17 A;  2D11 A;  2Z0Q A;  4KHB B;  4Y94 A;  3FSS A;  2CRF A;  4IFS A;  1ZM0 A;  5JP4 A;  2DTC A;  1GG3 A;  1EAZ A;  2YS5 A;  5HE1 A;  2DKQ A;  5CLQ B;  1OQN A;  5KQ4 A;  1J19 A;  2VSZ A;  1UPQ A;  1FHW A;  1IRS A;  2P0H A;  1LW3 A;  3ODO A;  3A8P A;  1Z87 A;  1MK9 B;  1XD4 A;  2I5C A;  1MIZ B;  1X1G A;  5C5B A;  5LOP B;  5KQ1 A;  2JP2 A;  2MKR A;  1FB8 A;  2P0D A;  2RNR B;  2J0J A;  4ZRI A;  2GCJ A;  1MKE A;  4GZU A;  1NTY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...