5J3YA

Crystal structure of s. pombe dcp2:dcp1 mrna decapping complex
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
126
structure length
126
Chain Sequence
PHMEDENILRNAVNLQVLKFHYPEIESIIDIASHVAVYQFDVGSQKWLKTSIEGTFFLVKDQRARVGYVILNRNSPENLYLFINHPSNVHLVDRYLIHRTENQHVVGLWMFDPNDMSRIFNIVKES
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords mRNA-decapping enzyme subunit 1
publication title Structure of the Dcp2-Dcp1 mRNA-decapping complex in the activated conformation.
pubmed doi rcsb
source organism Schizosaccharomyces pombe (strain 972 / atcc 24843)
molecule tags Hydrolase
total genus 32
structure length 126
sequence length 126
chains with identical sequence C
ec nomenclature
pdb deposition date 2016-03-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06058 DCP1 Dcp1-like decapping family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 5j3yA00
3HQCA 1WJ1A 2YVCA 1P3RA 4MY6A 5D3XA 3UZTA 2PZ1A 2ZPYA 1Z87A 2L1CA 3D8FA 5JLJB 3ODXA 1Y19B 2I5CA 2Y8FA 2GCJA 4B6HA 2DA0A 2G35A 2OQBA 1LW3A 1U2BA 2DX5A 5JP4A 4YONA 3ODOA 2YS1A 4Y94A 2DKPA 5DH9B 1J0WA 2LKOA 2J59M 3D8DA 1N3HA 3F0WA 4CHJA 2LG1A 2MWNB 4YL8A 1X1GA 3ZVRA 1UEFA 4DXAB 2RVBB 4GPTB 3CXBB 3PVWA 5HE3A 2N0YA 2K2JA 4IOYX 5L81A 2J0KA 4WJ7A 4F7GA 1WI1A 3AU4A 1X11A 4EKUA 5KQ4A 4K2PA 2ADZA 1W1GA 1ZC3B 4MT7A 1EF1A 5CLLB 1WVHA 3AU5A 4EJNA 2YS3A 2D9WA 3KRWA 5C79A 2Z0PA 1RRPB 1K5DB 4K17A 3PEGA 4PNKA 2ROVA 1FHWA 1GG3A 1IRSA 4HAUB 1J19A 1UNRA 3VIAA 5DI9B 2W2XC 1PMSA 1MAIA 4HDQA 2I1JA 1U29A 1WGQA 2GS0A 2M14A 1Y5OA 1NTVA 1M7RA 2I1KA 4H8SA 5FI0A 2YSZA 2YRYA 5LOPB 3U7DA 4DX90 2DX1A 2BCJA 2VRWB 3TVVA 3LJUX 1UPQA 4A6FA 3QWMA 3TFMA 1NU2A 3PG7A 5D3YA 3A8PA 2HE7A 5C5BA 1FGYA 2D11A 2J0JA 2JP2A 4C0AA 2UZSA 2DFKA 2AEHA 1UPRA 4HAWB 4L6EA 4BBKA 3PP2A 1ZVRA 2P0HA 1DROA 4TYZA 2DLWA 2AL6A 1EGXA 2KCJA 1X05A 2UVMA 3TW1A 4KHOA 2IFSA 5DHAB 1V5MA 3O96A 2Q13A 3KY9A 5FI1A 4GMVA 1AQCA 2LYDA 1OQNA 2RGNB 1DDVA 2CODA 1W1HA 2QKMA 3ULBA 2CY5A 5KCVA 5HE0A 1PLSA 2MKRA 3PSCA 1WGUA 3A98B 4KAXB 2DYQA 1X1FA 2EJ8A 3WYFB 2CY4A 5HE2A 3PVUA 2X18A 2H7DA 2RUKB 5D3VA 1OY2A 1XD4A 2GCLA 2COFA 3SNHA 1BWNA 2NMBA 1BAKA 4NY0A 2DN6A 2P0DA 1RJ2A 2RNRB 2YF0A 3N7CA 5C16A 1I2HA 5D27A 1U27A 3KSYA 3D8EA 2MFQA 4DX8A 2DHJA 4HAVB 1U5EA 4KVGB 2MDXA 1ZSQA 1WJMA 3SV1A 2Y7BA 5KQ1A 1EVHA 2RLOA 1MPHA 1P5TA 4A6HA 2D9ZA 2DYNA 1V5UA 3A8QA 3DXEA 4HB4B 3SYXA 1SGHA 2E2XA 1U5GA 5LONB 2LOZA 4GXBA 5JHGA 3G9WA 4IFSA 1KI1B 4P7IA 4D0NB 3QBVB 4K2OA 1QC6A 3SO6A 1H10A 2W2WA 3HK0A 1NI2A 2COAA 4IAPA 2D9VA 2EMSA 1FAOA 2Y8GA 1DYNA 4MK0A 1EAZA 1KZ7A 3PZDA 1MK9B 1K5GB 2V76A 3TO1A 3GYPA 3FEHA 2DTCA 3U8ZA 4F7HA 2LOXA 2VKIA 4A6FB 2FJLA 2Z0OA 1U5FA 5JHHA 2L2IA 5J3QA 2HTHB 2XQNM 4HATB 2D2QA 2NZ8B 2P8VA 4NSWA 3ULCA 3SUZA 3P6AA 1LB1A 1FHXA 2D4QA 2OTXA 3ML4A 3WA0A 3OANA 1MIZB 2IYBA 1FOEA 3IVFA 4HAZB 5HE1A 3RCPA 1KZGA 4HDOA 1OMWA 1I7AA 1V61A 1TJ6A 2D10A 1MIXA 5CLQB 3AJ4A 4A6KA 2YT1A 4DBBA 2R09A 3BJIA 2K2UA 5D3WA 4GZUA 2CRFA 4KHAA 1XKEA 4CYEA 5GOWB 2DKQA 3X23A 1GC6A 4K81A 2ELBA 2J0MA 1V89A 1V88A 1TQZA 2UZRA 2W2XD 4HHVA 3T06A 1UNQA 3DXDA 4ZRKA 4Z2MB 4HAXB 3P7ZA 3HW2B 1BTKA 4HB2B 2D9YA 4WVFB 1FB8A 3M1IB 4EMOA 3MDBC 1DDMA 3F5RA 3BINA 2D9XA 3KRXA 2I5FA 2ROZB 1Q67A 1W1DA 5J3YA 1MKEA 1PFJA 4HB0B 4WSFA 2K00A 2EC1A 1FHOA 2YT0A 1TXDA 2GJYA 2RSGA 3VOQA 3V5WA 3NSUA 3PVLA 1WG7A 2H7EA 2COCA 2EMTA 2Z0QA 2YS5A 1NTYA 2CAYA 2DHKA 2LULA 2KUPA 5DIFB 4GMXB 1GC7A 1DDWA 1DBHA 1XR0B 1SHCA 3CIKA 2DHIA 2R0DA 3ODWA 4F7UP 1AWEA 1X86A 4A5KA 3MPXA 5EFXA 5DHFB 1XCGA 1XX0A 2QKLA 1ISNA 1FGZA 1QQGA 1V5PA 4ZRJA 2ELAA 1E5WA 3DXCA 2KGXB 1U5DA 4HAYB 5J3TA 1ZM0A 3TCAA 4Z2NA 1H4RA 4TKNA 1XODA 4PQ0A 3FSSA 1P6SA 4XWXA 1MK7B 2VSZA 3GYOA 4CHMA 5C6RA 4KHBB 4HB3B 5C5BB 2P0FA 2N23A 1B55A 3QIJA 3KZ1A 4ZRIA 3ZDTA 1UNPA 1ZC4B 1BTNA 4GN1A 2M38A 1M7EA 3FM8C
chains in the Genus database with same CATH superfamily
3HQCA 1WJ1A 2YVCA 1P3RA 4MY6A 5D3XA 3UZTA 2PZ1A 2ZPYA 1Z87A 2L1CA 3D8FA 5JLJB 3ODXA 1Y19B 2I5CA 2Y8FA 2GCJA 4B6HA 2DA0A 2G35A 2OQBA 4D6WA 1LW3A 1U2BA 2DX5A 5JP4A 4YONA 3ODOA 2YS1A 4Y94A 2DKPA 5DH9B 1J0WA 2LKOA 2J59M 3D8DA 1N3HA 3F0WA 4CHJA 2LG1A 2MWNB 4YL8A 1X1GA 3ZVRA 1UEFA 4DXAB 2RVBB 4GPTB 3CXBB 3PVWA 5HE3A 2N0YA 2K2JA 4IOYX 5L81A 2J0KA 4WJ7A 4F7GA 1WI1A 3AU4A 1X11A 4EKUA 5KQ4A 4K2PA 2ADZA 1W1GA 1ZC3B 4MT7A 1EF1A 5CLLB 1WVHA 3AU5A 4EJNA 2YS3A 2D9WA 3KRWA 5C79A 2Z0PA 1RRPB 1K5DB 4K17A 3PEGA 4PNKA 2ROVA 1FHWA 1GG3A 1IRSA 4HAUB 1J19A 1UNRA 3VIAA 5DI9B 2W2XC 1PMSA 1MAIA 4HDQA 2I1JA 1U29A 1WGQA 3OHMB 2GS0A 2M14A 1Y5OA 4QJ3B 1NTVA 1M7RA 4OT1A 2I1KA 4H8SA 5FI0A 2YSZA 2YRYA 2K49A 5LOPB 2Z13A 3U7DA 4DX90 2DX1A 2BCJA 2VRWB 3TVVA 3LJUX 1UPQA 4A6FA 3QWMA 3TFMA 4KHBA 1NU2A 3PG7A 5D3YA 3A8PA 2HE7A 5C5BA 1FGYA 2D11A 2J0JA 2JP2A 4C0AA 2UZSA 2DFKA 2AEHA 1UPRA 4HAWB 4L6EA 4BBKA 3PP2A 1ZVRA 2P0HA 1DROA 4TYZA 2DLWA 2AL6A 1EGXA 2KCJA 1X05A 2UVMA 3TW1A 2NBVA 4KHOA 2IFSA 5DHAB 1V5MA 3O96A 3FVCA 2Q13A 3KY9A 5FI1A 1T77A 4GMVA 1AQCA 2LYDA 1OQNA 2RGNB 1DDVA 2CODA 1W1HA 2QKMA 3ULBA 2KIGA 2CY5A 5KCVA 5HE0A 1PLSA 2MKRA 3PSCA 1WGUA 3A98B 4KAXB 2DYQA 1X1FA 2EJ8A 3WYFB 2CY4A 5HE2A 3HSAA 3PVUA 2X18A 2H7DA 2RUKB 5D3VA 1OY2A 1XD4A 2GCLA 2COFA 3SNHA 1BWNA 2NMBA 2YT2A 1BAKA 4NY0A 2DN6A 2P0DA 1RJ2A 2RNRB 5IRSA 2YF0A 3N7CA 5C16A 1I2HA 5D27A 5M4YB 1U27A 3KSYA 3D8EA 2MFQA 4DX8A 2GUMA 2DHJA 2Z14A 4HAVB 1U5EA 4KVGB 2MDXA 2Z59A 1ZSQA 1WJMA 3SV1A 2Y7BA 1ZYIA 5KQ1A 1EVHA 2RLOA 1MPHA 1P5TA 4A6HA 2D9ZA 3B77A 2DYNA 1V5UA 3A8QA 3DXEA 4HB4B 3SYXA 1SGHA 2E2XA 1U5GA 5LONB 2LOZA 2FJUB 4GXBA 5JHGA 3G9WA 5LG4B 5I2MA 4IFSA 1KI1B 4P7IA 4D0NB 3QBVB 4K2OA 5I2SA 1QC6A 3SO6A 1H10A 2W2WA 3HK0A 1NI2A 2COAA 4IAPA 4QXAB 2D9VA 2EMSA 1FAOA 2Y8GA 1DYNA 4L1RA 4MK0A 1EAZA 1KZ7A 3PZDA 1MK9B 1K5GB 2V76A 3TO1A 4QJ5B 3GYPA 3FEHA 2DTCA 3U8ZA 4F7HA 2LOXA 2VKIA 4A6FB 2FJLA 2KUQA 2Z0OA 1U5FA 2ZKMX 4DIXA 5JHHA 2L2IA 4OSNA 3HIEA 5J3QA 2HTHB 2XQNM 4HATB 2D2QA 2NZ8B 2P8VA 4NSWA 3ULCA 3SUZA 3P6AA 1LB1A 1FHXA 2D4QA 2OTXA 3ML4A 3WA0A 3OANA 1MIZB 2IYBA 1FOEA 3IVFA 4HAZB 5HE1A 3RCPA 1KZGA 4HDOA 1OMWA 1I7AA 2Z4DA 1V61A 1TJ6A 2D10A 1MIXA 5CLQB 3NW8A 3AJ4A 4A6KA 2YT1A 1MI1A 4DBBA 2R09A 3BJIA 2K2UA 5D3WA 4QJ4B 2KR0A 4GZUA 4GOUA 3NWDA 2CRFA 4KHAA 1XKEA 4CYEA 5GOWB 2DKQA 3X23A 1GC6A 4K81A 2ELBA 2J0MA 1V89A 1V88A 1TQZA 2UZRA 2W2XD 4HHVA 3T06A 1UNQA 3DXDA 4ZRKA 4Z2MB 4HAXB 3P7ZA 3HW2B 1BTKA 4HB2B 2D9YA 4WVFB 1FB8A 3M1IB 4EMOA 3MDBC 1DDMA 3F5RA 3BINA 2D9XA 3KRXA 2I5FA 2ROZB 1Q67A 1W1DA 5J3YA 1MKEA 1PFJA 4HB0B 4WSFA 2K8EA 2K00A 3A58A 2EC1A 1FHOA 2YT0A 1TXDA 2GJYA 2RSGA 3VOQA 3V5WA 3NSUA 3PVLA 1WG7A 2H7EA 2COCA 2EMTA 2Z0QA 2YS5A 2R2YA 1NTYA 4CSQA 2CAYA 2DHKA 2KIEA 2KUPA 2LULA 5DIFB 4GMXB 1GC7A 1DDWA 1DBHA 1XR0B 1SHCA 3CIKA 2DHIA 2R0DA 3ODWA 4F7UP 1AWEA 1X86A 4A5KA 3MPXA 3NWAA 5EFXA 5DHFB 1XCGA 1XX0A 2QKLA 4HSIA 1ISNA 1FGZA 1QQGA 1V5PA 4ZRJA 2ELAA 1E5WA 3DXCA 2RRFA 2KGXB 1U5DA 4HAYB 5J3TA 1ZM0A 3TCAA 4Z2NA 1H4RA 4TKNA 3U12A 1XODA 4PQ0A 3FSSA 1P6SA 4XWXA 1MK7B 2VSZA 3GYOA 4CHMA 5C6RA 4KHBB 4HB3B 5C5BB 2P0FA 2N23A 3NWFA 1B55A 3QIJA 3KZ1A 4ZRIA 3ZDTA 3DCXA 1UNPA 4GNKB 1ZC4B 1BTNA 4GN1A 2M38A 1M7EA 3FM8C
chains in the Genus database with same CATH topology
3HQCA 1WJ1A 2YVCA 1P3RA 4MY6A 5D3XA 3UZTA 2PZ1A 2ZPYA 1Z87A 2L1CA 3D8FA 5JLJB 3ODXA 1Y19B 2I5CA 2Y8FA 2GCJA 4B6HA 2DA0A 2G35A 2OQBA 1LW3A 1U2BA 2DX5A 5JP4A 4YONA 3ODOA 2YS1A 4Y94A 2DKPA 5DH9B 1J0WA 2LKOA 2J59M 3D8DA 1N3HA 3F0WA 4CHJA 2LG1A 2MWNB 4YL8A 1X1GA 3ZVRA 1UEFA 4DXAB 2RVBB 4GPTB 3CXBB 3PVWA 5HE3A 2N0YA 2K2JA 4IOYX 5L81A 2J0KA 4WJ7A 4F7GA 1WI1A 3AU4A 1X11A 4EKUA 5KQ4A 4K2PA 2ADZA 1W1GA 1ZC3B 4MT7A 1EF1A 5CLLB 1WVHA 3AU5A 4EJNA 2YS3A 2D9WA 3KRWA 5C79A 2Z0PA 1RRPB 1K5DB 4K17A 3PEGA 4PNKA 2ROVA 1FHWA 1GG3A 1IRSA 4HAUB 1J19A 1UNRA 3VIAA 5DI9B 2W2XC 1PMSA 1MAIA 4HDQA 2I1JA 1U29A 1WGQA 2GS0A 2M14A 1Y5OA 1NTVA 1M7RA 2I1KA 4H8SA 5FI0A 2YSZA 2YRYA 5LOPB 3U7DA 4DX90 2DX1A 2BCJA 2VRWB 3TVVA 3LJUX 1UPQA 4A6FA 3QWMA 3TFMA 1NU2A 3PG7A 5D3YA 3A8PA 2HE7A 5C5BA 1FGYA 2D11A 2J0JA 2JP2A 4C0AA 2UZSA 2DFKA 2AEHA 1UPRA 4HAWB 4L6EA 4BBKA 3PP2A 1ZVRA 2P0HA 1DROA 4TYZA 2DLWA 2AL6A 1EGXA 2KCJA 1X05A 2UVMA 3TW1A 4KHOA 2IFSA 5DHAB 1V5MA 3O96A 2Q13A 3KY9A 5FI1A 4GMVA 1AQCA 2LYDA 1OQNA 2RGNB 1DDVA 2CODA 1W1HA 2QKMA 3ULBA 2CY5A 5KCVA 5HE0A 1PLSA 2MKRA 3PSCA 1WGUA 3A98B 4KAXB 2DYQA 1X1FA 2EJ8A 3WYFB 2CY4A 5HE2A 3PVUA 2X18A 2H7DA 2RUKB 5D3VA 1OY2A 1XD4A 2GCLA 2COFA 3SNHA 1BWNA 2NMBA 1BAKA 4NY0A 2DN6A 2P0DA 1RJ2A 2RNRB 2YF0A 3N7CA 5C16A 1I2HA 5D27A 1U27A 3KSYA 3D8EA 2MFQA 4DX8A 2DHJA 4HAVB 1U5EA 4KVGB 2MDXA 1ZSQA 1WJMA 3SV1A 2Y7BA 5KQ1A 1EVHA 2RLOA 1MPHA 1P5TA 4A6HA 2D9ZA 2DYNA 1V5UA 3A8QA 3DXEA 4HB4B 3SYXA 1SGHA 2E2XA 1U5GA 5LONB 2LOZA 4GXBA 5JHGA 3G9WA 4IFSA 1KI1B 4P7IA 4D0NB 3QBVB 4K2OA 1QC6A 3SO6A 1H10A 2W2WA 3HK0A 1NI2A 2COAA 4IAPA 2D9VA 2EMSA 1FAOA 2Y8GA 1DYNA 4MK0A 1EAZA 1KZ7A 3PZDA 1MK9B 1K5GB 2V76A 3TO1A 3GYPA 3FEHA 2DTCA 3U8ZA 4F7HA 2LOXA 2VKIA 4A6FB 2FJLA 2Z0OA 1U5FA 5JHHA 2L2IA 5J3QA 2HTHB 2XQNM 4HATB 2D2QA 2NZ8B 2P8VA 4NSWA 3ULCA 3SUZA 3P6AA 1LB1A 1FHXA 2D4QA 2OTXA 3ML4A 3WA0A 3OANA 1MIZB 2IYBA 1FOEA 3IVFA 4HAZB 5HE1A 3RCPA 1KZGA 4HDOA 1OMWA 1I7AA 1V61A 1TJ6A 2D10A 1MIXA 5CLQB 3AJ4A 4A6KA 2YT1A 4DBBA 2R09A 3BJIA 2K2UA 5D3WA 4GZUA 2CRFA 4KHAA 1XKEA 4CYEA 5GOWB 2DKQA 3X23A 1GC6A 4K81A 2ELBA 2J0MA 1V89A 1V88A 1TQZA 2UZRA 2W2XD 4HHVA 3T06A 1UNQA 3DXDA 4ZRKA 4Z2MB 4HAXB 3P7ZA 3HW2B 1BTKA 4HB2B 2D9YA 4WVFB 1FB8A 3M1IB 4EMOA 3MDBC 1DDMA 3F5RA 3BINA 2D9XA 3KRXA 2I5FA 2ROZB 1Q67A 1W1DA 5J3YA 1MKEA 1PFJA 4HB0B 4WSFA 2K00A 2EC1A 1FHOA 2YT0A 1TXDA 2GJYA 2RSGA 3VOQA 3V5WA 3NSUA 3PVLA 1WG7A 2H7EA 2COCA 2EMTA 2Z0QA 2YS5A 1NTYA 2CAYA 2DHKA 2LULA 2KUPA 5DIFB 4GMXB 1GC7A 1DDWA 1DBHA 1XR0B 1SHCA 3CIKA 2DHIA 2R0DA 3ODWA 4F7UP 1AWEA 1X86A 4A5KA 3MPXA 5EFXA 5DHFB 1XCGA 1XX0A 2QKLA 1ISNA 1FGZA 1QQGA 1V5PA 4ZRJA 2ELAA 1E5WA 3DXCA 2KGXB 1U5DA 4HAYB 5J3TA 1ZM0A 3TCAA 4Z2NA 1H4RA 4TKNA 1XODA 4PQ0A 3FSSA 1P6SA 4XWXA 1MK7B 2VSZA 3GYOA 4CHMA 5C6RA 4KHBB 4HB3B 5C5BB 2P0FA 2N23A 1B55A 3QIJA 3KZ1A 4ZRIA 3ZDTA 1UNPA 1ZC4B 1BTNA 4GN1A 2M38A 1M7EA 3FM8C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HQC A;  1WJ1 A;  2YVC A;  1P3R A;  4MY6 A;  5D3X A;  3UZT A;  2PZ1 A;  2ZPY A;  1Z87 A;  2L1C A;  3D8F A;  5JLJ B;  3ODX A;  1Y19 B;  2I5C A;  2Y8F A;  2GCJ A;  4B6H A;  2DA0 A;  2G35 A;  2OQB A;  1LW3 A;  1U2B A;  2DX5 A;  5JP4 A;  4YON A;  3ODO A;  2YS1 A;  4Y94 A;  2DKP A;  5DH9 B;  1J0W A;  2LKO A;  2J59 M;  3D8D A;  1N3H A;  3F0W A;  4CHJ A;  2LG1 A;  2MWN B;  4YL8 A;  1X1G A;  3ZVR A;  1UEF A;  4DXA B;  2RVB B;  4GPT B;  3CXB B;  3PVW A;  5HE3 A;  2N0Y A;  2K2J A;  4IOY X;  5L81 A;  2J0K A;  4WJ7 A;  4F7G A;  1WI1 A;  3AU4 A;  1X11 A;  4EKU A;  5KQ4 A;  4K2P A;  2ADZ A;  1W1G A;  1ZC3 B;  4MT7 A;  1EF1 A;  5CLL B;  1WVH A;  3AU5 A;  4EJN A;  2YS3 A;  2D9W A;  3KRW A;  5C79 A;  2Z0P A;  1RRP B;  1K5D B;  4K17 A;  3PEG A;  4PNK A;  2ROV A;  1FHW A;  1GG3 A;  1IRS A;  4HAU B;  1J19 A;  1UNR A;  3VIA A;  5DI9 B;  2W2X C;  1PMS A;  1MAI A;  4HDQ A;  2I1J A;  1U29 A;  1WGQ A;  2GS0 A;  2M14 A;  1Y5O A;  1NTV A;  1M7R A;  2I1K A;  4H8S A;  5FI0 A;  2YSZ A;  2YRY A;  5LOP B;  3U7D A;  4DX9 0;  2DX1 A;  2BCJ A;  2VRW B;  3TVV A;  3LJU X;  1UPQ A;  4A6F A;  3QWM A;  3TFM A;  1NU2 A;  3PG7 A;  5D3Y A;  3A8P A;  2HE7 A;  5C5B A;  1FGY A;  2D11 A;  2J0J A;  2JP2 A;  4C0A A;  2UZS A;  2DFK A;  2AEH A;  1UPR A;  4HAW B;  4L6E A;  4BBK A;  3PP2 A;  1ZVR A;  2P0H A;  1DRO A;  4TYZ A;  2DLW A;  2AL6 A;  1EGX A;  2KCJ A;  1X05 A;  2UVM A;  3TW1 A;  4KHO A;  2IFS A;  5DHA B;  1V5M A;  3O96 A;  2Q13 A;  3KY9 A;  5FI1 A;  4GMV A;  1AQC A;  2LYD A;  1OQN A;  2RGN B;  1DDV A;  2COD A;  1W1H A;  2QKM A;  3ULB A;  2CY5 A;  5KCV A;  5HE0 A;  1PLS A;  2MKR A;  3PSC A;  1WGU A;  3A98 B;  4KAX B;  2DYQ A;  1X1F A;  2EJ8 A;  3WYF B;  2CY4 A;  5HE2 A;  3PVU A;  2X18 A;  2H7D A;  2RUK B;  5D3V A;  1OY2 A;  1XD4 A;  2GCL A;  2COF A;  3SNH A;  1BWN A;  2NMB A;  1BAK A;  4NY0 A;  2DN6 A;  2P0D A;  1RJ2 A;  2RNR B;  2YF0 A;  3N7C A;  5C16 A;  1I2H A;  5D27 A;  1U27 A;  3KSY A;  3D8E A;  2MFQ A;  4DX8 A;  2DHJ A;  4HAV B;  1U5E A;  4KVG B;  2MDX A;  1ZSQ A;  1WJM A;  3SV1 A;  2Y7B A;  5KQ1 A;  1EVH A;  2RLO A;  1MPH A;  1P5T A;  4A6H A;  2D9Z A;  2DYN A;  1V5U A;  3A8Q A;  3DXE A;  4HB4 B;  3SYX A;  1SGH A;  2E2X A;  1U5G A;  5LON B;  2LOZ A;  4GXB A;  5JHG A;  3G9W A;  4IFS A;  1KI1 B;  4P7I A;  4D0N B;  3QBV B;  4K2O A;  1QC6 A;  3SO6 A;  1H10 A;  2W2W A;  3HK0 A;  1NI2 A;  2COA A;  4IAP A;  2D9V A;  2EMS A;  1FAO A;  2Y8G A;  1DYN A;  4MK0 A;  1EAZ A;  1KZ7 A;  3PZD A;  1MK9 B;  1K5G B;  2V76 A;  3TO1 A;  3GYP A;  3FEH A;  2DTC A;  3U8Z A;  4F7H A;  2LOX A;  2VKI A;  4A6F B;  2FJL A;  2Z0O A;  1U5F A;  5JHH A;  2L2I A;  5J3Q A;  2HTH B;  2XQN M;  4HAT B;  2D2Q A;  2NZ8 B;  2P8V A;  4NSW A;  3ULC A;  3SUZ A;  3P6A A;  1LB1 A;  1FHX A;  2D4Q A;  2OTX A;  3ML4 A;  3WA0 A;  3OAN A;  1MIZ B;  2IYB A;  1FOE A;  3IVF A;  4HAZ B;  5HE1 A;  3RCP A;  1KZG A;  4HDO A;  1OMW A;  1I7A A;  1V61 A;  1TJ6 A;  2D10 A;  1MIX A;  5CLQ B;  3AJ4 A;  4A6K A;  2YT1 A;  4DBB A;  2R09 A;  3BJI A;  2K2U A;  5D3W A;  4GZU A;  2CRF A;  4KHA A;  1XKE A;  4CYE A;  5GOW B;  2DKQ A;  3X23 A;  1GC6 A;  4K81 A;  2ELB A;  2J0M A;  1V89 A;  1V88 A;  1TQZ A;  2UZR A;  2W2X D;  4HHV A;  3T06 A;  1UNQ A;  3DXD A;  4ZRK A;  4Z2M B;  4HAX B;  3P7Z A;  3HW2 B;  1BTK A;  4HB2 B;  2D9Y A;  4WVF B;  1FB8 A;  3M1I B;  4EMO A;  3MDB C;  1DDM A;  3F5R A;  3BIN A;  2D9X A;  3KRX A;  2I5F A;  2ROZ B;  1Q67 A;  1W1D A;  5J3Y A;  1MKE A;  1PFJ A;  4HB0 B;  4WSF A;  2K00 A;  2EC1 A;  1FHO A;  2YT0 A;  1TXD A;  2GJY A;  2RSG A;  3VOQ A;  3V5W A;  3NSU A;  3PVL A;  1WG7 A;  2H7E A;  2COC A;  2EMT A;  2Z0Q A;  2YS5 A;  1NTY A;  2CAY A;  2DHK A;  2LUL A;  2KUP A;  5DIF B;  4GMX B;  1GC7 A;  1DDW A;  1DBH A;  1XR0 B;  1SHC A;  3CIK A;  2DHI A;  2R0D A;  3ODW A;  4F7U P;  1AWE A;  1X86 A;  4A5K A;  3MPX A;  5EFX A;  5DHF B;  1XCG A;  1XX0 A;  2QKL A;  1ISN A;  1FGZ A;  1QQG A;  1V5P A;  4ZRJ A;  2ELA A;  1E5W A;  3DXC A;  2KGX B;  1U5D A;  4HAY B;  5J3T A;  1ZM0 A;  3TCA A;  4Z2N A;  1H4R A;  4TKN A;  1XOD A;  4PQ0 A;  3FSS A;  1P6S A;  4XWX A;  1MK7 B;  2VSZ A;  3GYO A;  4CHM A;  5C6R A;  4KHB B;  4HB3 B;  5C5B B;  2P0F A;  2N23 A;  1B55 A;  3QIJ A;  3KZ1 A;  4ZRI A;  3ZDT A;  1UNP A;  1ZC4 B;  1BTN A;  4GN1 A;  2M38 A;  1M7E A;  3FM8 C; 
#chains in the Genus database with same CATH topology
 3HQC A;  1WJ1 A;  2YVC A;  1P3R A;  4MY6 A;  5D3X A;  3UZT A;  2PZ1 A;  2ZPY A;  1Z87 A;  2L1C A;  3D8F A;  5JLJ B;  3ODX A;  1Y19 B;  2I5C A;  2Y8F A;  2GCJ A;  4B6H A;  2DA0 A;  2G35 A;  2OQB A;  4D6W A;  1LW3 A;  1U2B A;  2DX5 A;  5JP4 A;  4YON A;  3ODO A;  2YS1 A;  4Y94 A;  2DKP A;  5DH9 B;  1J0W A;  2LKO A;  2J59 M;  3D8D A;  1N3H A;  3F0W A;  4CHJ A;  2LG1 A;  2MWN B;  4YL8 A;  1X1G A;  3ZVR A;  1UEF A;  4DXA B;  2RVB B;  4GPT B;  3CXB B;  3PVW A;  5HE3 A;  2N0Y A;  2K2J A;  4IOY X;  5L81 A;  2J0K A;  4WJ7 A;  4F7G A;  1WI1 A;  3AU4 A;  1X11 A;  4EKU A;  5KQ4 A;  4K2P A;  2ADZ A;  1W1G A;  1ZC3 B;  4MT7 A;  1EF1 A;  5CLL B;  1WVH A;  3AU5 A;  4EJN A;  2YS3 A;  2D9W A;  3KRW A;  5C79 A;  2Z0P A;  1RRP B;  1K5D B;  4K17 A;  3PEG A;  4PNK A;  2ROV A;  1FHW A;  1GG3 A;  1IRS A;  4HAU B;  1J19 A;  1UNR A;  3VIA A;  5DI9 B;  2W2X C;  1PMS A;  1MAI A;  4HDQ A;  2I1J A;  1U29 A;  1WGQ A;  3OHM B;  2GS0 A;  2M14 A;  1Y5O A;  4QJ3 B;  1NTV A;  1M7R A;  4OT1 A;  2I1K A;  4H8S A;  5FI0 A;  2YSZ A;  2YRY A;  2K49 A;  5LOP B;  2Z13 A;  3U7D A;  4DX9 0;  2DX1 A;  2BCJ A;  2VRW B;  3TVV A;  3LJU X;  1UPQ A;  4A6F A;  3QWM A;  3TFM A;  4KHB A;  1NU2 A;  3PG7 A;  5D3Y A;  3A8P A;  2HE7 A;  5C5B A;  1FGY A;  2D11 A;  2J0J A;  2JP2 A;  4C0A A;  2UZS A;  2DFK A;  2AEH A;  1UPR A;  4HAW B;  4L6E A;  4BBK A;  3PP2 A;  1ZVR A;  2P0H A;  1DRO A;  4TYZ A;  2DLW A;  2AL6 A;  1EGX A;  2KCJ A;  1X05 A;  2UVM A;  3TW1 A;  2NBV A;  4KHO A;  2IFS A;  5DHA B;  1V5M A;  3O96 A;  3FVC A;  2Q13 A;  3KY9 A;  5FI1 A;  1T77 A;  4GMV A;  1AQC A;  2LYD A;  1OQN A;  2RGN B;  1DDV A;  2COD A;  1W1H A;  2QKM A;  3ULB A;  2KIG A;  2CY5 A;  5KCV A;  5HE0 A;  1PLS A;  2MKR A;  3PSC A;  1WGU A;  3A98 B;  4KAX B;  2DYQ A;  1X1F A;  2EJ8 A;  3WYF B;  2CY4 A;  5HE2 A;  3HSA A;  3PVU A;  2X18 A;  2H7D A;  2RUK B;  5D3V A;  1OY2 A;  1XD4 A;  2GCL A;  2COF A;  3SNH A;  1BWN A;  2NMB A;  2YT2 A;  1BAK A;  4NY0 A;  2DN6 A;  2P0D A;  1RJ2 A;  2RNR B;  5IRS A;  2YF0 A;  3N7C A;  5C16 A;  1I2H A;  5D27 A;  5M4Y B;  1U27 A;  3KSY A;  3D8E A;  2MFQ A;  4DX8 A;  2GUM A;  2DHJ A;  2Z14 A;  4HAV B;  1U5E A;  4KVG B;  2MDX A;  2Z59 A;  1ZSQ A;  1WJM A;  3SV1 A;  2Y7B A;  1ZYI A;  5KQ1 A;  1EVH A;  2RLO A;  1MPH A;  1P5T A;  4A6H A;  2D9Z A;  3B77 A;  2DYN A;  1V5U A;  3A8Q A;  3DXE A;  4HB4 B;  3SYX A;  1SGH A;  2E2X A;  1U5G A;  5LON B;  2LOZ A;  2FJU B;  4GXB A;  5JHG A;  3G9W A;  5LG4 B;  5I2M A;  4IFS A;  1KI1 B;  4P7I A;  4D0N B;  3QBV B;  4K2O A;  5I2S A;  1QC6 A;  3SO6 A;  1H10 A;  2W2W A;  3HK0 A;  1NI2 A;  2COA A;  4IAP A;  4QXA B;  2D9V A;  2EMS A;  1FAO A;  2Y8G A;  1DYN A;  4L1R A;  4MK0 A;  1EAZ A;  1KZ7 A;  3PZD A;  1MK9 B;  1K5G B;  2V76 A;  3TO1 A;  4QJ5 B;  3GYP A;  3FEH A;  2DTC A;  3U8Z A;  4F7H A;  2LOX A;  2VKI A;  4A6F B;  2FJL A;  2KUQ A;  2Z0O A;  1U5F A;  2ZKM X;  4DIX A;  5JHH A;  2L2I A;  4OSN A;  3HIE A;  5J3Q A;  2HTH B;  2XQN M;  4HAT B;  2D2Q A;  2NZ8 B;  2P8V A;  4NSW A;  3ULC A;  3SUZ A;  3P6A A;  1LB1 A;  1FHX A;  2D4Q A;  2OTX A;  3ML4 A;  3WA0 A;  3OAN A;  1MIZ B;  2IYB A;  1FOE A;  3IVF A;  4HAZ B;  5HE1 A;  3RCP A;  1KZG A;  4HDO A;  1OMW A;  1I7A A;  2Z4D A;  1V61 A;  1TJ6 A;  2D10 A;  1MIX A;  5CLQ B;  3NW8 A;  3AJ4 A;  4A6K A;  2YT1 A;  1MI1 A;  4DBB A;  2R09 A;  3BJI A;  2K2U A;  5D3W A;  4QJ4 B;  2KR0 A;  4GZU A;  4GOU A;  3NWD A;  2CRF A;  4KHA A;  1XKE A;  4CYE A;  5GOW B;  2DKQ A;  3X23 A;  1GC6 A;  4K81 A;  2ELB A;  2J0M A;  1V89 A;  1V88 A;  1TQZ A;  2UZR A;  2W2X D;  4HHV A;  3T06 A;  1UNQ A;  3DXD A;  4ZRK A;  4Z2M B;  4HAX B;  3P7Z A;  3HW2 B;  1BTK A;  4HB2 B;  2D9Y A;  4WVF B;  1FB8 A;  3M1I B;  4EMO A;  3MDB C;  1DDM A;  3F5R A;  3BIN A;  2D9X A;  3KRX A;  2I5F A;  2ROZ B;  1Q67 A;  1W1D A;  5J3Y A;  1MKE A;  1PFJ A;  4HB0 B;  4WSF A;  2K8E A;  2K00 A;  3A58 A;  2EC1 A;  1FHO A;  2YT0 A;  1TXD A;  2GJY A;  2RSG A;  3VOQ A;  3V5W A;  3NSU A;  3PVL A;  1WG7 A;  2H7E A;  2COC A;  2EMT A;  2Z0Q A;  2YS5 A;  2R2Y A;  1NTY A;  4CSQ A;  2CAY A;  2DHK A;  2KIE A;  2KUP A;  2LUL A;  5DIF B;  4GMX B;  1GC7 A;  1DDW A;  1DBH A;  1XR0 B;  1SHC A;  3CIK A;  2DHI A;  2R0D A;  3ODW A;  4F7U P;  1AWE A;  1X86 A;  4A5K A;  3MPX A;  3NWA A;  5EFX A;  5DHF B;  1XCG A;  1XX0 A;  2QKL A;  4HSI A;  1ISN A;  1FGZ A;  1QQG A;  1V5P A;  4ZRJ A;  2ELA A;  1E5W A;  3DXC A;  2RRF A;  2KGX B;  1U5D A;  4HAY B;  5J3T A;  1ZM0 A;  3TCA A;  4Z2N A;  1H4R A;  4TKN A;  3U12 A;  1XOD A;  4PQ0 A;  3FSS A;  1P6S A;  4XWX A;  1MK7 B;  2VSZ A;  3GYO A;  4CHM A;  5C6R A;  4KHB B;  4HB3 B;  5C5B B;  2P0F A;  2N23 A;  3NWF A;  1B55 A;  3QIJ A;  3KZ1 A;  4ZRI A;  3ZDT A;  3DCX A;  1UNP A;  4GNK B;  1ZC4 B;  1BTN A;  4GN1 A;  2M38 A;  1M7E A;  3FM8 C; 
#chains in the Genus database with same CATH homology
 3HQC A;  1WJ1 A;  2YVC A;  1P3R A;  4MY6 A;  5D3X A;  3UZT A;  2PZ1 A;  2ZPY A;  1Z87 A;  2L1C A;  3D8F A;  5JLJ B;  3ODX A;  1Y19 B;  2I5C A;  2Y8F A;  2GCJ A;  4B6H A;  2DA0 A;  2G35 A;  2OQB A;  1LW3 A;  1U2B A;  2DX5 A;  5JP4 A;  4YON A;  3ODO A;  2YS1 A;  4Y94 A;  2DKP A;  5DH9 B;  1J0W A;  2LKO A;  2J59 M;  3D8D A;  1N3H A;  3F0W A;  4CHJ A;  2LG1 A;  2MWN B;  4YL8 A;  1X1G A;  3ZVR A;  1UEF A;  4DXA B;  2RVB B;  4GPT B;  3CXB B;  3PVW A;  5HE3 A;  2N0Y A;  2K2J A;  4IOY X;  5L81 A;  2J0K A;  4WJ7 A;  4F7G A;  1WI1 A;  3AU4 A;  1X11 A;  4EKU A;  5KQ4 A;  4K2P A;  2ADZ A;  1W1G A;  1ZC3 B;  4MT7 A;  1EF1 A;  5CLL B;  1WVH A;  3AU5 A;  4EJN A;  2YS3 A;  2D9W A;  3KRW A;  5C79 A;  2Z0P A;  1RRP B;  1K5D B;  4K17 A;  3PEG A;  4PNK A;  2ROV A;  1FHW A;  1GG3 A;  1IRS A;  4HAU B;  1J19 A;  1UNR A;  3VIA A;  5DI9 B;  2W2X C;  1PMS A;  1MAI A;  4HDQ A;  2I1J A;  1U29 A;  1WGQ A;  2GS0 A;  2M14 A;  1Y5O A;  1NTV A;  1M7R A;  2I1K A;  4H8S A;  5FI0 A;  2YSZ A;  2YRY A;  5LOP B;  3U7D A;  4DX9 0;  2DX1 A;  2BCJ A;  2VRW B;  3TVV A;  3LJU X;  1UPQ A;  4A6F A;  3QWM A;  3TFM A;  1NU2 A;  3PG7 A;  5D3Y A;  3A8P A;  2HE7 A;  5C5B A;  1FGY A;  2D11 A;  2J0J A;  2JP2 A;  4C0A A;  2UZS A;  2DFK A;  2AEH A;  1UPR A;  4HAW B;  4L6E A;  4BBK A;  3PP2 A;  1ZVR A;  2P0H A;  1DRO A;  4TYZ A;  2DLW A;  2AL6 A;  1EGX A;  2KCJ A;  1X05 A;  2UVM A;  3TW1 A;  4KHO A;  2IFS A;  5DHA B;  1V5M A;  3O96 A;  2Q13 A;  3KY9 A;  5FI1 A;  4GMV A;  1AQC A;  2LYD A;  1OQN A;  2RGN B;  1DDV A;  2COD A;  1W1H A;  2QKM A;  3ULB A;  2CY5 A;  5KCV A;  5HE0 A;  1PLS A;  2MKR A;  3PSC A;  1WGU A;  3A98 B;  4KAX B;  2DYQ A;  1X1F A;  2EJ8 A;  3WYF B;  2CY4 A;  5HE2 A;  3PVU A;  2X18 A;  2H7D A;  2RUK B;  5D3V A;  1OY2 A;  1XD4 A;  2GCL A;  2COF A;  3SNH A;  1BWN A;  2NMB A;  1BAK A;  4NY0 A;  2DN6 A;  2P0D A;  1RJ2 A;  2RNR B;  2YF0 A;  3N7C A;  5C16 A;  1I2H A;  5D27 A;  1U27 A;  3KSY A;  3D8E A;  2MFQ A;  4DX8 A;  2DHJ A;  4HAV B;  1U5E A;  4KVG B;  2MDX A;  1ZSQ A;  1WJM A;  3SV1 A;  2Y7B A;  5KQ1 A;  1EVH A;  2RLO A;  1MPH A;  1P5T A;  4A6H A;  2D9Z A;  2DYN A;  1V5U A;  3A8Q A;  3DXE A;  4HB4 B;  3SYX A;  1SGH A;  2E2X A;  1U5G A;  5LON B;  2LOZ A;  4GXB A;  5JHG A;  3G9W A;  4IFS A;  1KI1 B;  4P7I A;  4D0N B;  3QBV B;  4K2O A;  1QC6 A;  3SO6 A;  1H10 A;  2W2W A;  3HK0 A;  1NI2 A;  2COA A;  4IAP A;  2D9V A;  2EMS A;  1FAO A;  2Y8G A;  1DYN A;  4MK0 A;  1EAZ A;  1KZ7 A;  3PZD A;  1MK9 B;  1K5G B;  2V76 A;  3TO1 A;  3GYP A;  3FEH A;  2DTC A;  3U8Z A;  4F7H A;  2LOX A;  2VKI A;  4A6F B;  2FJL A;  2Z0O A;  1U5F A;  5JHH A;  2L2I A;  5J3Q A;  2HTH B;  2XQN M;  4HAT B;  2D2Q A;  2NZ8 B;  2P8V A;  4NSW A;  3ULC A;  3SUZ A;  3P6A A;  1LB1 A;  1FHX A;  2D4Q A;  2OTX A;  3ML4 A;  3WA0 A;  3OAN A;  1MIZ B;  2IYB A;  1FOE A;  3IVF A;  4HAZ B;  5HE1 A;  3RCP A;  1KZG A;  4HDO A;  1OMW A;  1I7A A;  1V61 A;  1TJ6 A;  2D10 A;  1MIX A;  5CLQ B;  3AJ4 A;  4A6K A;  2YT1 A;  4DBB A;  2R09 A;  3BJI A;  2K2U A;  5D3W A;  4GZU A;  2CRF A;  4KHA A;  1XKE A;  4CYE A;  5GOW B;  2DKQ A;  3X23 A;  1GC6 A;  4K81 A;  2ELB A;  2J0M A;  1V89 A;  1V88 A;  1TQZ A;  2UZR A;  2W2X D;  4HHV A;  3T06 A;  1UNQ A;  3DXD A;  4ZRK A;  4Z2M B;  4HAX B;  3P7Z A;  3HW2 B;  1BTK A;  4HB2 B;  2D9Y A;  4WVF B;  1FB8 A;  3M1I B;  4EMO A;  3MDB C;  1DDM A;  3F5R A;  3BIN A;  2D9X A;  3KRX A;  2I5F A;  2ROZ B;  1Q67 A;  1W1D A;  5J3Y A;  1MKE A;  1PFJ A;  4HB0 B;  4WSF A;  2K00 A;  2EC1 A;  1FHO A;  2YT0 A;  1TXD A;  2GJY A;  2RSG A;  3VOQ A;  3V5W A;  3NSU A;  3PVL A;  1WG7 A;  2H7E A;  2COC A;  2EMT A;  2Z0Q A;  2YS5 A;  1NTY A;  2CAY A;  2DHK A;  2LUL A;  2KUP A;  5DIF B;  4GMX B;  1GC7 A;  1DDW A;  1DBH A;  1XR0 B;  1SHC A;  3CIK A;  2DHI A;  2R0D A;  3ODW A;  4F7U P;  1AWE A;  1X86 A;  4A5K A;  3MPX A;  5EFX A;  5DHF B;  1XCG A;  1XX0 A;  2QKL A;  1ISN A;  1FGZ A;  1QQG A;  1V5P A;  4ZRJ A;  2ELA A;  1E5W A;  3DXC A;  2KGX B;  1U5D A;  4HAY B;  5J3T A;  1ZM0 A;  3TCA A;  4Z2N A;  1H4R A;  4TKN A;  1XOD A;  4PQ0 A;  3FSS A;  1P6S A;  4XWX A;  1MK7 B;  2VSZ A;  3GYO A;  4CHM A;  5C6R A;  4KHB B;  4HB3 B;  5C5B B;  2P0F A;  2N23 A;  1B55 A;  3QIJ A;  3KZ1 A;  4ZRI A;  3ZDT A;  1UNP A;  1ZC4 B;  1BTN A;  4GN1 A;  2M38 A;  1M7E A;  3FM8 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...