5J3YA

Crystal structure of s. pombe dcp2:dcp1 mrna decapping complex
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
126
structure length
126
Chain Sequence
PHMEDENILRNAVNLQVLKFHYPEIESIIDIASHVAVYQFDVGSQKWLKTSIEGTFFLVKDQRARVGYVILNRNSPENLYLFINHPSNVHLVDRYLIHRTENQHVVGLWMFDPNDMSRIFNIVKES
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the Dcp2-Dcp1 mRNA-decapping complex in the activated conformation.
pubmed doi rcsb
source organism Schizosaccharomyces pombe (strain 972 / atcc 24843)
molecule tags Hydrolase
molecule keywords mRNA-decapping enzyme subunit 1
total genus 32
structure length 126
sequence length 126
chains with identical sequence C
ec nomenclature
pdb deposition date 2016-03-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06058 DCP1 Dcp1-like decapping family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 5j3yA00
3X23A 3ULBA 3AU5A 2KUPA 1DDWA 1UEFA 5D3XA 2H7EA 2K00A 2YRYA 2Z0QA 2DLWA 5J3TA 1BTKA 2NMBA 3ODXA 2P0HA 4GMXB 1RJ2A 2COFA 1X11A 2DX5A 3ULCA 3P6AA 1WJMA 4ZRJA 1DYNA 1GC7A 2NZ8B 3AJ4A 1NI2A 5CLQB 3VOQA 3QWMA 1PFJA 3N7CA 4K2OA 1XX0A 3U8ZA 1V5PA 2KCJA 1DROA 2W2XC 2DKPA 4B6HA 3FSSA 4CHJA 4A5KA 1LW3A 2YT1A 5C5BB 1PLSA 3D8DA 3UZTA 3SUZA 3PG7A 1KZGA 3P7ZA 1UNQA 4K17A 3ODWA 2Y8FA 3DXCA 4KHOA 1P3RA 2I5FA 1Y5OA 2R09A 3IVFA 1OQNA 1UNPA 1AWEA 3M1IB 3SNHA 4KVGB 1ZC3B 2LKOA 1UPQA 5LONB 1V5UA 2LOZA 1FHWA 2IFSA 4DXAB 5HE2A 4YL8A 3MPXA 4P7IA 1GG3A 1WG7A 3T06A 2RVBB 2YT0A 2DHJA 4EMOA 4HAUB 4GZUA 2M14A 1MPHA 1ISNA 1M7EA 5JHHA 2BCJA 3PVUA 2D9XA 3WYFB 4GPTB 2ELAA 2W2WA 4TYZA 3MDBC 1EVHA 1V89A 1MIZB 2YVCA 1K5DB 1WGUA 2DFKA 2EMTA 1UNRA 1U2BA 2RLOA 2I5CA 3SO6A 1ZM0A 3PP2A 3SV1A 1ZVRA 3HW2B 1FAOA 2G35A 4ZRIA 5C5BA 4IAPA 3KRXA 5DHAB 1Z87A 5DHFB 4MY6A 4CHMA 1BTNA 3TW1A 2QKMA 3OANA 3DXEA 4HAYB 4Z2NA 2Y8GA 2DHKA 4KHAA 2YS1A 5EFXA 1FGYA 4HB0B 2D11A 3F0WA 2H7DA 2ADZA 1NTVA 3F5RA 5D3VA 1FHOA 5D3YA 2K2JA 2Z0PA 4HHVA 5L81A 1RRPB 4KAXB 2GS0A 3ODOA 1XD4A 3GYPA 2QKLA 2EMSA 5FI1A 4GXBA 1EGXA 2RNRB 3PVLA 3SYXA 2HE7A 4GN1A 1NTYA 3PVWA 1N3HA 4D0NB 4DX90 3DXDA 3PZDA 2D2QA 1U5DA 1TQZA 5LOPB 2YS3A 1QQGA 1MIXA 4DX8A 1V5MA 5JP4A 2J0JA 4DBBA 2D9WA 1X1FA 2Y7BA 3ML4A 3FEHA 5C16A 4MK0A 4WSFA 1GC6A 5D27A 4WJ7A 5J3YA 2EJ8A 1BAKA 4EKUA 2Q13A 2R0DA 2DYNA 5HE1A 1NU2A 2P0DA 1V61A 2L2IA 4F7UP 2YF0A 1X86A 2PZ1A 3KSYA 2RUKB 2RGNB 4ZRKA 2CODA 3KY9A 1FB8A 4IOYX 1W1DA 4TKNA 4IFSA 2Z0OA 3A98B 1WJ1A 3CXBB 2CAYA 4Y94A 4K81A 4HATB 4YONA 3ZVRA 2V76A 5C79A 2GJYA 3V5WA 3VIAA 3HK0A 4XWXA 1UPRA 2ZPYA 2DYQA 1J19A 5JLJB 2UZSA 2J0KA 2DKQA 2CRFA 2HTHB 2J0MA 1AQCA 2D9VA 2MWNB 2KGXB 2JP2A 3FM8C 2K2UA 1Y19B 2L1CA 4HAZB 3TCAA 2W2XD 1WVHA 2MKRA 5J3QA 5FI0A 1MAIA 1XR0B 2EC1A 1H10A 2N0YA 1XCGA 3PSCA 4HB4B 1V88A 4HAWB 1K5GB 1MK7B 3ZDTA 5CLLB 2RSGA 2DHIA 2CY4A 5HE3A 4HB2B 4PQ0A 1KZ7A 5C6RA 4BBKA 1E5WA 2DTCA 4HB3B 1FOEA 1I7AA 1KI1B 1DDMA 2E2XA 3U7DA 2VRWB 2YS5A 2MFQA 4NSWA 1ZSQA 1ZC4B 1MK9B 3CIKA 4A6FB 4EJNA 2COCA 1DBHA 1SGHA 1BWNA 2P8VA 1DDVA 2GCJA 4NY0A 4HAVB 2AEHA 3A8QA 4GMVA 1Q67A 1U27A 3HQCA 2D10A 5DI9B 3BJIA 1LB1A 2COAA 5DIFB 1WI1A 2LYDA 4Z2MB 2LULA 4A6KA 3NSUA 4F7HA 5JHGA 1U5GA 2YSZA 4PNKA 2VSZA 4HAXB 2P0FA 4HDOA 3QBVB 1I2HA 1IRSA 1SHCA 3TVVA 1QC6A 3BINA 1M7RA 2D4QA 1OMWA 5D3WA 2FJLA 5HE0A 2ROVA 1OY2A 1TXDA 3GYOA 1B55A 1U5FA 4L6EA 4A6HA 4KHBB 4MT7A 2LG1A 3RCPA 1TJ6A 1W1GA 2I1KA 2D9YA 1U29A 3PEGA 3A8PA 2XQNM 3O96A 2OQBA 2UZRA 2D9ZA 2J59M 2N23A 2I1JA 1FHXA 2M38A 4F7GA 3AU4A 3WA0A 1W1HA 2DN6A 2VKIA 1P6SA 1J0WA 2DX1A 2GCLA 2IYBA 3D8EA 3G9WA 4A6FA 1FGZA 1PMSA 1U5EA 3TO1A 1P5TA 1X1GA 1EAZA 3QIJA 1X05A 1XODA 3LJUX 3TFMA 4CYEA 3D8FA 5GOWB 4WVFB 1H4RA 3KRWA 1WGQA 2OTXA 2LOXA 4K2PA 2MDXA 2AL6A 4H8SA 1MKEA 5KQ4A 3KZ1A 5KQ1A 1XKEA 2CY5A 2DA0A 2UVMA 5KCVA 1EF1A 5DH9B 2ROZB 4HDQA 4C0AA 2ELBA 2X18A
chains in the Genus database with same CATH superfamily
3X23A 3ULBA 3AU5A 2KUPA 1DDWA 1UEFA 3NWAA 2H7EA 2K00A 2YRYA 2Z0QA 5D3XA 2DLWA 5J3TA 1BTKA 2NMBA 3A58A 5M4YB 3ODXA 2P0HA 2RRFA 4GMXB 1RJ2A 2COFA 1X11A 2DX5A 2KR0A 4DIXA 3ULCA 3P6AA 1WJMA 4ZRJA 1DYNA 1GC7A 2NZ8B 3AJ4A 1NI2A 5CLQB 3VOQA 3NWFA 3QWMA 1PFJA 3N7CA 4K2OA 1XX0A 3U8ZA 1V5PA 2KCJA 1DROA 2W2XC 2DKPA 3OHMB 4B6HA 3FSSA 4CHJA 4A5KA 1LW3A 2YT1A 5C5BB 1PLSA 3D8DA 3UZTA 3SUZA 3PG7A 1KZGA 3P7ZA 1UNQA 4K17A 2Z13A 3ODWA 2Y8FA 3DXCA 4KHOA 1P3RA 2I5FA 4KHBA 1Y5OA 2R09A 3IVFA 1OQNA 2Z4DA 4GNKB 1UNPA 1AWEA 3M1IB 3SNHA 2ZKMX 4KVGB 1ZC3B 3NW8A 2LKOA 1UPQA 5LONB 1V5UA 2LOZA 1FHWA 2IFSA 4DXAB 5HE2A 4YL8A 3MPXA 4P7IA 1GG3A 1WG7A 3T06A 2RVBB 2YT0A 2Z59A 2DHJA 4EMOA 4HAUB 4GZUA 2M14A 1MPHA 1ISNA 1M7EA 3B77A 5JHHA 2BCJA 3PVUA 2D9XA 3WYFB 4GPTB 2ELAA 2W2WA 4TYZA 3MDBC 1EVHA 1V89A 3HIEA 1MIZB 2YVCA 1K5DB 1WGUA 2DFKA 2K49A 2EMTA 1UNRA 2NBVA 3NWDA 1U2BA 2RLOA 2I5CA 3SO6A 1ZM0A 3PP2A 3SV1A 1ZVRA 3HW2B 1FAOA 2G35A 4ZRIA 5C5BA 4IAPA 3KRXA 5DHAB 1Z87A 5DHFB 4MY6A 4CHMA 1BTNA 3TW1A 2QKMA 3OANA 3DXEA 4HAYB 4Z2NA 2Y8GA 2DHKA 4KHAA 2YS1A 5EFXA 1FGYA 4HB0B 2D11A 3F0WA 2H7DA 2ADZA 1NTVA 3F5RA 5D3VA 1FHOA 5D3YA 2K2JA 2Z0PA 4HHVA 5L81A 1RRPB 4KAXB 2GS0A 3ODOA 1XD4A 3GYPA 2QKLA 2EMSA 2GUMA 5FI1A 4GXBA 1EGXA 2RNRB 3PVLA 3SYXA 2HE7A 4GN1A 1NTYA 3PVWA 1N3HA 4D0NB 4DX90 3DXDA 3PZDA 2D2QA 1U5DA 1TQZA 5LOPB 2YS3A 1QQGA 2FJUB 1MIXA 4DX8A 1V5MA 2R2YA 5JP4A 2J0JA 4DBBA 2D9WA 4HSIA 1X1FA 2Y7BA 3ML4A 3FEHA 5C16A 4MK0A 4WSFA 1GC6A 5D27A 4WJ7A 5J3YA 2EJ8A 1BAKA 4EKUA 2Q13A 2R0DA 4QXAB 2DYNA 5HE1A 1MI1A 1NU2A 2P0DA 1V61A 2L2IA 4F7UP 2YF0A 1X86A 2PZ1A 3KSYA 2RUKB 4CSQA 2RGNB 4ZRKA 2CODA 3KY9A 1FB8A 4IOYX 1W1DA 4TKNA 4IFSA 2Z0OA 3A98B 1WJ1A 3CXBB 2CAYA 4Y94A 4K81A 4HATB 4YONA 3ZVRA 2V76A 5C79A 5I2SA 2GJYA 3V5WA 3VIAA 3HK0A 4XWXA 1UPRA 2ZPYA 2DYQA 1J19A 5JLJB 2UZSA 2J0KA 2DKQA 2CRFA 2HTHB 2J0MA 1AQCA 2D9VA 5IRSA 2MWNB 2KGXB 2JP2A 3FM8C 2K2UA 5I2MA 1Y19B 2L1CA 4HAZB 3TCAA 2W2XD 1WVHA 2MKRA 5J3QA 5FI0A 1MAIA 1T77A 1XR0B 1H10A 2EC1A 2N0YA 3FVCA 1XCGA 3PSCA 1V88A 4HB4B 4HAWB 1K5GB 1MK7B 3ZDTA 5CLLB 2RSGA 2DHIA 2CY4A 5HE3A 4HB2B 4PQ0A 1KZ7A 5C6RA 4BBKA 1E5WA 2DTCA 4HB3B 1FOEA 1I7AA 5LG4B 1KI1B 1DDMA 2E2XA 3U7DA 2VRWB 2Z14A 2YS5A 2MFQA 4NSWA 1ZSQA 1ZC4B 1MK9B 2KIGA 3CIKA 4A6FB 4EJNA 2COCA 1DBHA 1SGHA 1BWNA 2P8VA 1DDVA 2GCJA 4NY0A 2KUQA 2AEHA 4HAVB 3A8QA 4GMVA 1Q67A 1U27A 3HQCA 2D10A 5DI9B 3BJIA 1LB1A 3HSAA 2COAA 5DIFB 1WI1A 2LYDA 4Z2MB 2LULA 4A6KA 3NSUA 4F7HA 5JHGA 1U5GA 2YSZA 4PNKA 2VSZA 4HAXB 2P0FA 4QJ5B 4HDOA 3QBVB 1I2HA 1IRSA 1SHCA 4QJ4B 3TVVA 1QC6A 3BINA 1M7RA 2D4QA 1OMWA 5D3WA 2FJLA 5HE0A 2YT2A 2ROVA 1OY2A 1TXDA 3GYOA 1B55A 1U5FA 4L6EA 4A6HA 4KHBB 4MT7A 2LG1A 3RCPA 1TJ6A 1W1GA 2I1KA 2D9YA 4OSNA 1U29A 3PEGA 3A8PA 2XQNM 3DCXA 3O96A 2OQBA 2UZRA 4GOUA 2D9ZA 2J59M 2N23A 2I1JA 1FHXA 2M38A 4F7GA 3AU4A 3WA0A 1W1HA 2DN6A 2VKIA 1P6SA 1J0WA 2DX1A 2GCLA 2KIEA 2IYBA 3D8EA 3G9WA 4QJ3B 4A6FA 3U12A 1FGZA 1PMSA 1U5EA 3TO1A 4OT1A 1P5TA 1X1GA 1EAZA 3QIJA 1X05A 1XODA 3LJUX 3TFMA 4CYEA 3D8FA 4L1RA 4WVFB 5GOWB 1H4RA 3KRWA 4D6WA 1WGQA 2OTXA 2LOXA 4K2PA 2MDXA 2AL6A 4H8SA 1MKEA 5KQ4A 3KZ1A 5KQ1A 1XKEA 2CY5A 2DA0A 2UVMA 5KCVA 1EF1A 5DH9B 2ROZB 4HDQA 4C0AA 1ZYIA 2ELBA 2X18A 2K8EA
chains in the Genus database with same CATH topology
3X23A 3ULBA 3AU5A 2KUPA 1DDWA 1UEFA 5D3XA 2H7EA 2K00A 2YRYA 2Z0QA 2DLWA 5J3TA 1BTKA 2NMBA 3ODXA 2P0HA 4GMXB 1RJ2A 2COFA 1X11A 2DX5A 3ULCA 3P6AA 1WJMA 4ZRJA 1DYNA 1GC7A 2NZ8B 3AJ4A 1NI2A 5CLQB 3VOQA 3QWMA 1PFJA 3N7CA 4K2OA 1XX0A 3U8ZA 1V5PA 2KCJA 1DROA 2W2XC 2DKPA 4B6HA 3FSSA 4CHJA 4A5KA 1LW3A 2YT1A 5C5BB 1PLSA 3D8DA 3UZTA 3SUZA 3PG7A 1KZGA 3P7ZA 1UNQA 4K17A 3ODWA 2Y8FA 3DXCA 4KHOA 1P3RA 2I5FA 1Y5OA 2R09A 3IVFA 1OQNA 1UNPA 1AWEA 3M1IB 3SNHA 4KVGB 1ZC3B 2LKOA 1UPQA 5LONB 1V5UA 2LOZA 1FHWA 2IFSA 4DXAB 5HE2A 4YL8A 3MPXA 4P7IA 1GG3A 1WG7A 3T06A 2RVBB 2YT0A 2DHJA 4EMOA 4HAUB 4GZUA 2M14A 1MPHA 1ISNA 1M7EA 5JHHA 2BCJA 3PVUA 2D9XA 3WYFB 4GPTB 2ELAA 2W2WA 4TYZA 3MDBC 1EVHA 1V89A 1MIZB 2YVCA 1K5DB 1WGUA 2DFKA 2EMTA 1UNRA 1U2BA 2RLOA 2I5CA 3SO6A 1ZM0A 3PP2A 3SV1A 1ZVRA 3HW2B 1FAOA 2G35A 4ZRIA 5C5BA 4IAPA 3KRXA 5DHAB 1Z87A 5DHFB 4MY6A 4CHMA 1BTNA 3TW1A 2QKMA 3OANA 3DXEA 4HAYB 4Z2NA 2Y8GA 2DHKA 4KHAA 2YS1A 5EFXA 1FGYA 4HB0B 2D11A 3F0WA 2H7DA 2ADZA 1NTVA 3F5RA 5D3VA 1FHOA 5D3YA 2K2JA 2Z0PA 4HHVA 5L81A 1RRPB 4KAXB 2GS0A 3ODOA 1XD4A 3GYPA 2QKLA 2EMSA 5FI1A 4GXBA 1EGXA 2RNRB 3PVLA 3SYXA 2HE7A 4GN1A 1NTYA 3PVWA 1N3HA 4D0NB 4DX90 3DXDA 3PZDA 2D2QA 1U5DA 1TQZA 5LOPB 2YS3A 1QQGA 1MIXA 4DX8A 1V5MA 5JP4A 2J0JA 4DBBA 2D9WA 1X1FA 2Y7BA 3ML4A 3FEHA 5C16A 4MK0A 4WSFA 1GC6A 5D27A 4WJ7A 5J3YA 2EJ8A 1BAKA 4EKUA 2Q13A 2R0DA 2DYNA 5HE1A 1NU2A 2P0DA 1V61A 2L2IA 4F7UP 2YF0A 1X86A 2PZ1A 3KSYA 2RUKB 2RGNB 4ZRKA 2CODA 3KY9A 1FB8A 4IOYX 1W1DA 4TKNA 4IFSA 2Z0OA 3A98B 1WJ1A 3CXBB 2CAYA 4Y94A 4K81A 4HATB 4YONA 3ZVRA 2V76A 5C79A 2GJYA 3V5WA 3VIAA 3HK0A 4XWXA 1UPRA 2ZPYA 2DYQA 1J19A 5JLJB 2UZSA 2J0KA 2DKQA 2CRFA 2HTHB 2J0MA 1AQCA 2D9VA 2MWNB 2KGXB 2JP2A 3FM8C 2K2UA 1Y19B 2L1CA 4HAZB 3TCAA 2W2XD 1WVHA 2MKRA 5J3QA 5FI0A 1MAIA 1XR0B 2EC1A 1H10A 2N0YA 1XCGA 3PSCA 4HB4B 1V88A 4HAWB 1K5GB 1MK7B 3ZDTA 5CLLB 2RSGA 2DHIA 2CY4A 5HE3A 4HB2B 4PQ0A 1KZ7A 5C6RA 4BBKA 1E5WA 2DTCA 4HB3B 1FOEA 1I7AA 1KI1B 1DDMA 2E2XA 3U7DA 2VRWB 2YS5A 2MFQA 4NSWA 1ZSQA 1ZC4B 1MK9B 3CIKA 4A6FB 4EJNA 2COCA 1DBHA 1SGHA 1BWNA 2P8VA 1DDVA 2GCJA 4NY0A 4HAVB 2AEHA 3A8QA 4GMVA 1Q67A 1U27A 3HQCA 2D10A 5DI9B 3BJIA 1LB1A 2COAA 5DIFB 1WI1A 2LYDA 4Z2MB 2LULA 4A6KA 3NSUA 4F7HA 5JHGA 1U5GA 2YSZA 4PNKA 2VSZA 4HAXB 2P0FA 4HDOA 3QBVB 1I2HA 1IRSA 1SHCA 3TVVA 1QC6A 3BINA 1M7RA 2D4QA 1OMWA 5D3WA 2FJLA 5HE0A 2ROVA 1OY2A 1TXDA 3GYOA 1B55A 1U5FA 4L6EA 4A6HA 4KHBB 4MT7A 2LG1A 3RCPA 1TJ6A 1W1GA 2I1KA 2D9YA 1U29A 3PEGA 3A8PA 2XQNM 3O96A 2OQBA 2UZRA 2D9ZA 2J59M 2N23A 2I1JA 1FHXA 2M38A 4F7GA 3AU4A 3WA0A 1W1HA 2DN6A 2VKIA 1P6SA 1J0WA 2DX1A 2GCLA 2IYBA 3D8EA 3G9WA 4A6FA 1FGZA 1PMSA 1U5EA 3TO1A 1P5TA 1X1GA 1EAZA 3QIJA 1X05A 1XODA 3LJUX 3TFMA 4CYEA 3D8FA 5GOWB 4WVFB 1H4RA 3KRWA 1WGQA 2OTXA 2LOXA 4K2PA 2MDXA 2AL6A 4H8SA 1MKEA 5KQ4A 3KZ1A 5KQ1A 1XKEA 2CY5A 2DA0A 2UVMA 5KCVA 1EF1A 5DH9B 2ROZB 4HDQA 4C0AA 2ELBA 2X18A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3X23 A;  3ULB A;  3AU5 A;  2KUP A;  1DDW A;  1UEF A;  5D3X A;  2H7E A;  2K00 A;  2YRY A;  2Z0Q A;  2DLW A;  5J3T A;  1BTK A;  2NMB A;  3ODX A;  2P0H A;  4GMX B;  1RJ2 A;  2COF A;  1X11 A;  2DX5 A;  3ULC A;  3P6A A;  1WJM A;  4ZRJ A;  1DYN A;  1GC7 A;  2NZ8 B;  3AJ4 A;  1NI2 A;  5CLQ B;  3VOQ A;  3QWM A;  1PFJ A;  3N7C A;  4K2O A;  1XX0 A;  3U8Z A;  1V5P A;  2KCJ A;  1DRO A;  2W2X C;  2DKP A;  4B6H A;  3FSS A;  4CHJ A;  4A5K A;  1LW3 A;  2YT1 A;  5C5B B;  1PLS A;  3D8D A;  3UZT A;  3SUZ A;  3PG7 A;  1KZG A;  3P7Z A;  1UNQ A;  4K17 A;  3ODW A;  2Y8F A;  3DXC A;  4KHO A;  1P3R A;  2I5F A;  1Y5O A;  2R09 A;  3IVF A;  1OQN A;  1UNP A;  1AWE A;  3M1I B;  3SNH A;  4KVG B;  1ZC3 B;  2LKO A;  1UPQ A;  5LON B;  1V5U A;  2LOZ A;  1FHW A;  2IFS A;  4DXA B;  5HE2 A;  4YL8 A;  3MPX A;  4P7I A;  1GG3 A;  1WG7 A;  3T06 A;  2RVB B;  2YT0 A;  2DHJ A;  4EMO A;  4HAU B;  4GZU A;  2M14 A;  1MPH A;  1ISN A;  1M7E A;  5JHH A;  2BCJ A;  3PVU A;  2D9X A;  3WYF B;  4GPT B;  2ELA A;  2W2W A;  4TYZ A;  3MDB C;  1EVH A;  1V89 A;  1MIZ B;  2YVC A;  1K5D B;  1WGU A;  2DFK A;  2EMT A;  1UNR A;  1U2B A;  2RLO A;  2I5C A;  3SO6 A;  1ZM0 A;  3PP2 A;  3SV1 A;  1ZVR A;  3HW2 B;  1FAO A;  2G35 A;  4ZRI A;  5C5B A;  4IAP A;  3KRX A;  5DHA B;  1Z87 A;  5DHF B;  4MY6 A;  4CHM A;  1BTN A;  3TW1 A;  2QKM A;  3OAN A;  3DXE A;  4HAY B;  4Z2N A;  2Y8G A;  2DHK A;  4KHA A;  2YS1 A;  5EFX A;  1FGY A;  4HB0 B;  2D11 A;  3F0W A;  2H7D A;  2ADZ A;  1NTV A;  3F5R A;  5D3V A;  1FHO A;  5D3Y A;  2K2J A;  2Z0P A;  4HHV A;  5L81 A;  1RRP B;  4KAX B;  2GS0 A;  3ODO A;  1XD4 A;  3GYP A;  2QKL A;  2EMS A;  5FI1 A;  4GXB A;  1EGX A;  2RNR B;  3PVL A;  3SYX A;  2HE7 A;  4GN1 A;  1NTY A;  3PVW A;  1N3H A;  4D0N B;  4DX9 0;  3DXD A;  3PZD A;  2D2Q A;  1U5D A;  1TQZ A;  5LOP B;  2YS3 A;  1QQG A;  1MIX A;  4DX8 A;  1V5M A;  5JP4 A;  2J0J A;  4DBB A;  2D9W A;  1X1F A;  2Y7B A;  3ML4 A;  3FEH A;  5C16 A;  4MK0 A;  4WSF A;  1GC6 A;  5D27 A;  4WJ7 A;  5J3Y A;  2EJ8 A;  1BAK A;  4EKU A;  2Q13 A;  2R0D A;  2DYN A;  5HE1 A;  1NU2 A;  2P0D A;  1V61 A;  2L2I A;  4F7U P;  2YF0 A;  1X86 A;  2PZ1 A;  3KSY A;  2RUK B;  2RGN B;  4ZRK A;  2COD A;  3KY9 A;  1FB8 A;  4IOY X;  1W1D A;  4TKN A;  4IFS A;  2Z0O A;  3A98 B;  1WJ1 A;  3CXB B;  2CAY A;  4Y94 A;  4K81 A;  4HAT B;  4YON A;  3ZVR A;  2V76 A;  5C79 A;  2GJY A;  3V5W A;  3VIA A;  3HK0 A;  4XWX A;  1UPR A;  2ZPY A;  2DYQ A;  1J19 A;  5JLJ B;  2UZS A;  2J0K A;  2DKQ A;  2CRF A;  2HTH B;  2J0M A;  1AQC A;  2D9V A;  2MWN B;  2KGX B;  2JP2 A;  3FM8 C;  2K2U A;  1Y19 B;  2L1C A;  4HAZ B;  3TCA A;  2W2X D;  1WVH A;  2MKR A;  5J3Q A;  5FI0 A;  1MAI A;  1XR0 B;  2EC1 A;  1H10 A;  2N0Y A;  1XCG A;  3PSC A;  4HB4 B;  1V88 A;  4HAW B;  1K5G B;  1MK7 B;  3ZDT A;  5CLL B;  2RSG A;  2DHI A;  2CY4 A;  5HE3 A;  4HB2 B;  4PQ0 A;  1KZ7 A;  5C6R A;  4BBK A;  1E5W A;  2DTC A;  4HB3 B;  1FOE A;  1I7A A;  1KI1 B;  1DDM A;  2E2X A;  3U7D A;  2VRW B;  2YS5 A;  2MFQ A;  4NSW A;  1ZSQ A;  1ZC4 B;  1MK9 B;  3CIK A;  4A6F B;  4EJN A;  2COC A;  1DBH A;  1SGH A;  1BWN A;  2P8V A;  1DDV A;  2GCJ A;  4NY0 A;  4HAV B;  2AEH A;  3A8Q A;  4GMV A;  1Q67 A;  1U27 A;  3HQC A;  2D10 A;  5DI9 B;  3BJI A;  1LB1 A;  2COA A;  5DIF B;  1WI1 A;  2LYD A;  4Z2M B;  2LUL A;  4A6K A;  3NSU A;  4F7H A;  5JHG A;  1U5G A;  2YSZ A;  4PNK A;  2VSZ A;  4HAX B;  2P0F A;  4HDO A;  3QBV B;  1I2H A;  1IRS A;  1SHC A;  3TVV A;  1QC6 A;  3BIN A;  1M7R A;  2D4Q A;  1OMW A;  5D3W A;  2FJL A;  5HE0 A;  2ROV A;  1OY2 A;  1TXD A;  3GYO A;  1B55 A;  1U5F A;  4L6E A;  4A6H A;  4KHB B;  4MT7 A;  2LG1 A;  3RCP A;  1TJ6 A;  1W1G A;  2I1K A;  2D9Y A;  1U29 A;  3PEG A;  3A8P A;  2XQN M;  3O96 A;  2OQB A;  2UZR A;  2D9Z A;  2J59 M;  2N23 A;  2I1J A;  1FHX A;  2M38 A;  4F7G A;  3AU4 A;  3WA0 A;  1W1H A;  2DN6 A;  2VKI A;  1P6S A;  1J0W A;  2DX1 A;  2GCL A;  2IYB A;  3D8E A;  3G9W A;  4A6F A;  1FGZ A;  1PMS A;  1U5E A;  3TO1 A;  1P5T A;  1X1G A;  1EAZ A;  3QIJ A;  1X05 A;  1XOD A;  3LJU X;  3TFM A;  4CYE A;  3D8F A;  5GOW B;  4WVF B;  1H4R A;  3KRW A;  1WGQ A;  2OTX A;  2LOX A;  4K2P A;  2MDX A;  2AL6 A;  4H8S A;  1MKE A;  5KQ4 A;  3KZ1 A;  5KQ1 A;  1XKE A;  2CY5 A;  2DA0 A;  2UVM A;  5KCV A;  1EF1 A;  5DH9 B;  2ROZ B;  4HDQ A;  4C0A A;  2ELB A;  2X18 A; 
#chains in the Genus database with same CATH topology
 3X23 A;  3ULB A;  3AU5 A;  2KUP A;  1DDW A;  1UEF A;  3NWA A;  2H7E A;  2K00 A;  2YRY A;  2Z0Q A;  5D3X A;  2DLW A;  5J3T A;  1BTK A;  2NMB A;  3A58 A;  5M4Y B;  3ODX A;  2P0H A;  2RRF A;  4GMX B;  1RJ2 A;  2COF A;  1X11 A;  2DX5 A;  2KR0 A;  4DIX A;  3ULC A;  3P6A A;  1WJM A;  4ZRJ A;  1DYN A;  1GC7 A;  2NZ8 B;  3AJ4 A;  1NI2 A;  5CLQ B;  3VOQ A;  3NWF A;  3QWM A;  1PFJ A;  3N7C A;  4K2O A;  1XX0 A;  3U8Z A;  1V5P A;  2KCJ A;  1DRO A;  2W2X C;  2DKP A;  3OHM B;  4B6H A;  3FSS A;  4CHJ A;  4A5K A;  1LW3 A;  2YT1 A;  5C5B B;  1PLS A;  3D8D A;  3UZT A;  3SUZ A;  3PG7 A;  1KZG A;  3P7Z A;  1UNQ A;  4K17 A;  2Z13 A;  3ODW A;  2Y8F A;  3DXC A;  4KHO A;  1P3R A;  2I5F A;  4KHB A;  1Y5O A;  2R09 A;  3IVF A;  1OQN A;  2Z4D A;  4GNK B;  1UNP A;  1AWE A;  3M1I B;  3SNH A;  2ZKM X;  4KVG B;  1ZC3 B;  3NW8 A;  2LKO A;  1UPQ A;  5LON B;  1V5U A;  2LOZ A;  1FHW A;  2IFS A;  4DXA B;  5HE2 A;  4YL8 A;  3MPX A;  4P7I A;  1GG3 A;  1WG7 A;  3T06 A;  2RVB B;  2YT0 A;  2Z59 A;  2DHJ A;  4EMO A;  4HAU B;  4GZU A;  2M14 A;  1MPH A;  1ISN A;  1M7E A;  3B77 A;  5JHH A;  2BCJ A;  3PVU A;  2D9X A;  3WYF B;  4GPT B;  2ELA A;  2W2W A;  4TYZ A;  3MDB C;  1EVH A;  1V89 A;  3HIE A;  1MIZ B;  2YVC A;  1K5D B;  1WGU A;  2DFK A;  2K49 A;  2EMT A;  1UNR A;  2NBV A;  3NWD A;  1U2B A;  2RLO A;  2I5C A;  3SO6 A;  1ZM0 A;  3PP2 A;  3SV1 A;  1ZVR A;  3HW2 B;  1FAO A;  2G35 A;  4ZRI A;  5C5B A;  4IAP A;  3KRX A;  5DHA B;  1Z87 A;  5DHF B;  4MY6 A;  4CHM A;  1BTN A;  3TW1 A;  2QKM A;  3OAN A;  3DXE A;  4HAY B;  4Z2N A;  2Y8G A;  2DHK A;  4KHA A;  2YS1 A;  5EFX A;  1FGY A;  4HB0 B;  2D11 A;  3F0W A;  2H7D A;  2ADZ A;  1NTV A;  3F5R A;  5D3V A;  1FHO A;  5D3Y A;  2K2J A;  2Z0P A;  4HHV A;  5L81 A;  1RRP B;  4KAX B;  2GS0 A;  3ODO A;  1XD4 A;  3GYP A;  2QKL A;  2EMS A;  2GUM A;  5FI1 A;  4GXB A;  1EGX A;  2RNR B;  3PVL A;  3SYX A;  2HE7 A;  4GN1 A;  1NTY A;  3PVW A;  1N3H A;  4D0N B;  4DX9 0;  3DXD A;  3PZD A;  2D2Q A;  1U5D A;  1TQZ A;  5LOP B;  2YS3 A;  1QQG A;  2FJU B;  1MIX A;  4DX8 A;  1V5M A;  2R2Y A;  5JP4 A;  2J0J A;  4DBB A;  2D9W A;  4HSI A;  1X1F A;  2Y7B A;  3ML4 A;  3FEH A;  5C16 A;  4MK0 A;  4WSF A;  1GC6 A;  5D27 A;  4WJ7 A;  5J3Y A;  2EJ8 A;  1BAK A;  4EKU A;  2Q13 A;  2R0D A;  4QXA B;  2DYN A;  5HE1 A;  1MI1 A;  1NU2 A;  2P0D A;  1V61 A;  2L2I A;  4F7U P;  2YF0 A;  1X86 A;  2PZ1 A;  3KSY A;  2RUK B;  4CSQ A;  2RGN B;  4ZRK A;  2COD A;  3KY9 A;  1FB8 A;  4IOY X;  1W1D A;  4TKN A;  4IFS A;  2Z0O A;  3A98 B;  1WJ1 A;  3CXB B;  2CAY A;  4Y94 A;  4K81 A;  4HAT B;  4YON A;  3ZVR A;  2V76 A;  5C79 A;  5I2S A;  2GJY A;  3V5W A;  3VIA A;  3HK0 A;  4XWX A;  1UPR A;  2ZPY A;  2DYQ A;  1J19 A;  5JLJ B;  2UZS A;  2J0K A;  2DKQ A;  2CRF A;  2HTH B;  2J0M A;  1AQC A;  2D9V A;  5IRS A;  2MWN B;  2KGX B;  2JP2 A;  3FM8 C;  2K2U A;  5I2M A;  1Y19 B;  2L1C A;  4HAZ B;  3TCA A;  2W2X D;  1WVH A;  2MKR A;  5J3Q A;  5FI0 A;  1MAI A;  1T77 A;  1XR0 B;  1H10 A;  2EC1 A;  2N0Y A;  3FVC A;  1XCG A;  3PSC A;  1V88 A;  4HB4 B;  4HAW B;  1K5G B;  1MK7 B;  3ZDT A;  5CLL B;  2RSG A;  2DHI A;  2CY4 A;  5HE3 A;  4HB2 B;  4PQ0 A;  1KZ7 A;  5C6R A;  4BBK A;  1E5W A;  2DTC A;  4HB3 B;  1FOE A;  1I7A A;  5LG4 B;  1KI1 B;  1DDM A;  2E2X A;  3U7D A;  2VRW B;  2Z14 A;  2YS5 A;  2MFQ A;  4NSW A;  1ZSQ A;  1ZC4 B;  1MK9 B;  2KIG A;  3CIK A;  4A6F B;  4EJN A;  2COC A;  1DBH A;  1SGH A;  1BWN A;  2P8V A;  1DDV A;  2GCJ A;  4NY0 A;  2KUQ A;  2AEH A;  4HAV B;  3A8Q A;  4GMV A;  1Q67 A;  1U27 A;  3HQC A;  2D10 A;  5DI9 B;  3BJI A;  1LB1 A;  3HSA A;  2COA A;  5DIF B;  1WI1 A;  2LYD A;  4Z2M B;  2LUL A;  4A6K A;  3NSU A;  4F7H A;  5JHG A;  1U5G A;  2YSZ A;  4PNK A;  2VSZ A;  4HAX B;  2P0F A;  4QJ5 B;  4HDO A;  3QBV B;  1I2H A;  1IRS A;  1SHC A;  4QJ4 B;  3TVV A;  1QC6 A;  3BIN A;  1M7R A;  2D4Q A;  1OMW A;  5D3W A;  2FJL A;  5HE0 A;  2YT2 A;  2ROV A;  1OY2 A;  1TXD A;  3GYO A;  1B55 A;  1U5F A;  4L6E A;  4A6H A;  4KHB B;  4MT7 A;  2LG1 A;  3RCP A;  1TJ6 A;  1W1G A;  2I1K A;  2D9Y A;  4OSN A;  1U29 A;  3PEG A;  3A8P A;  2XQN M;  3DCX A;  3O96 A;  2OQB A;  2UZR A;  4GOU A;  2D9Z A;  2J59 M;  2N23 A;  2I1J A;  1FHX A;  2M38 A;  4F7G A;  3AU4 A;  3WA0 A;  1W1H A;  2DN6 A;  2VKI A;  1P6S A;  1J0W A;  2DX1 A;  2GCL A;  2KIE A;  2IYB A;  3D8E A;  3G9W A;  4QJ3 B;  4A6F A;  3U12 A;  1FGZ A;  1PMS A;  1U5E A;  3TO1 A;  4OT1 A;  1P5T A;  1X1G A;  1EAZ A;  3QIJ A;  1X05 A;  1XOD A;  3LJU X;  3TFM A;  4CYE A;  3D8F A;  4L1R A;  4WVF B;  5GOW B;  1H4R A;  3KRW A;  4D6W A;  1WGQ A;  2OTX A;  2LOX A;  4K2P A;  2MDX A;  2AL6 A;  4H8S A;  1MKE A;  5KQ4 A;  3KZ1 A;  5KQ1 A;  1XKE A;  2CY5 A;  2DA0 A;  2UVM A;  5KCV A;  1EF1 A;  5DH9 B;  2ROZ B;  4HDQ A;  4C0A A;  1ZYI A;  2ELB A;  2X18 A;  2K8E A; 
#chains in the Genus database with same CATH homology
 3X23 A;  3ULB A;  3AU5 A;  2KUP A;  1DDW A;  1UEF A;  5D3X A;  2H7E A;  2K00 A;  2YRY A;  2Z0Q A;  2DLW A;  5J3T A;  1BTK A;  2NMB A;  3ODX A;  2P0H A;  4GMX B;  1RJ2 A;  2COF A;  1X11 A;  2DX5 A;  3ULC A;  3P6A A;  1WJM A;  4ZRJ A;  1DYN A;  1GC7 A;  2NZ8 B;  3AJ4 A;  1NI2 A;  5CLQ B;  3VOQ A;  3QWM A;  1PFJ A;  3N7C A;  4K2O A;  1XX0 A;  3U8Z A;  1V5P A;  2KCJ A;  1DRO A;  2W2X C;  2DKP A;  4B6H A;  3FSS A;  4CHJ A;  4A5K A;  1LW3 A;  2YT1 A;  5C5B B;  1PLS A;  3D8D A;  3UZT A;  3SUZ A;  3PG7 A;  1KZG A;  3P7Z A;  1UNQ A;  4K17 A;  3ODW A;  2Y8F A;  3DXC A;  4KHO A;  1P3R A;  2I5F A;  1Y5O A;  2R09 A;  3IVF A;  1OQN A;  1UNP A;  1AWE A;  3M1I B;  3SNH A;  4KVG B;  1ZC3 B;  2LKO A;  1UPQ A;  5LON B;  1V5U A;  2LOZ A;  1FHW A;  2IFS A;  4DXA B;  5HE2 A;  4YL8 A;  3MPX A;  4P7I A;  1GG3 A;  1WG7 A;  3T06 A;  2RVB B;  2YT0 A;  2DHJ A;  4EMO A;  4HAU B;  4GZU A;  2M14 A;  1MPH A;  1ISN A;  1M7E A;  5JHH A;  2BCJ A;  3PVU A;  2D9X A;  3WYF B;  4GPT B;  2ELA A;  2W2W A;  4TYZ A;  3MDB C;  1EVH A;  1V89 A;  1MIZ B;  2YVC A;  1K5D B;  1WGU A;  2DFK A;  2EMT A;  1UNR A;  1U2B A;  2RLO A;  2I5C A;  3SO6 A;  1ZM0 A;  3PP2 A;  3SV1 A;  1ZVR A;  3HW2 B;  1FAO A;  2G35 A;  4ZRI A;  5C5B A;  4IAP A;  3KRX A;  5DHA B;  1Z87 A;  5DHF B;  4MY6 A;  4CHM A;  1BTN A;  3TW1 A;  2QKM A;  3OAN A;  3DXE A;  4HAY B;  4Z2N A;  2Y8G A;  2DHK A;  4KHA A;  2YS1 A;  5EFX A;  1FGY A;  4HB0 B;  2D11 A;  3F0W A;  2H7D A;  2ADZ A;  1NTV A;  3F5R A;  5D3V A;  1FHO A;  5D3Y A;  2K2J A;  2Z0P A;  4HHV A;  5L81 A;  1RRP B;  4KAX B;  2GS0 A;  3ODO A;  1XD4 A;  3GYP A;  2QKL A;  2EMS A;  5FI1 A;  4GXB A;  1EGX A;  2RNR B;  3PVL A;  3SYX A;  2HE7 A;  4GN1 A;  1NTY A;  3PVW A;  1N3H A;  4D0N B;  4DX9 0;  3DXD A;  3PZD A;  2D2Q A;  1U5D A;  1TQZ A;  5LOP B;  2YS3 A;  1QQG A;  1MIX A;  4DX8 A;  1V5M A;  5JP4 A;  2J0J A;  4DBB A;  2D9W A;  1X1F A;  2Y7B A;  3ML4 A;  3FEH A;  5C16 A;  4MK0 A;  4WSF A;  1GC6 A;  5D27 A;  4WJ7 A;  5J3Y A;  2EJ8 A;  1BAK A;  4EKU A;  2Q13 A;  2R0D A;  2DYN A;  5HE1 A;  1NU2 A;  2P0D A;  1V61 A;  2L2I A;  4F7U P;  2YF0 A;  1X86 A;  2PZ1 A;  3KSY A;  2RUK B;  2RGN B;  4ZRK A;  2COD A;  3KY9 A;  1FB8 A;  4IOY X;  1W1D A;  4TKN A;  4IFS A;  2Z0O A;  3A98 B;  1WJ1 A;  3CXB B;  2CAY A;  4Y94 A;  4K81 A;  4HAT B;  4YON A;  3ZVR A;  2V76 A;  5C79 A;  2GJY A;  3V5W A;  3VIA A;  3HK0 A;  4XWX A;  1UPR A;  2ZPY A;  2DYQ A;  1J19 A;  5JLJ B;  2UZS A;  2J0K A;  2DKQ A;  2CRF A;  2HTH B;  2J0M A;  1AQC A;  2D9V A;  2MWN B;  2KGX B;  2JP2 A;  3FM8 C;  2K2U A;  1Y19 B;  2L1C A;  4HAZ B;  3TCA A;  2W2X D;  1WVH A;  2MKR A;  5J3Q A;  5FI0 A;  1MAI A;  1XR0 B;  2EC1 A;  1H10 A;  2N0Y A;  1XCG A;  3PSC A;  4HB4 B;  1V88 A;  4HAW B;  1K5G B;  1MK7 B;  3ZDT A;  5CLL B;  2RSG A;  2DHI A;  2CY4 A;  5HE3 A;  4HB2 B;  4PQ0 A;  1KZ7 A;  5C6R A;  4BBK A;  1E5W A;  2DTC A;  4HB3 B;  1FOE A;  1I7A A;  1KI1 B;  1DDM A;  2E2X A;  3U7D A;  2VRW B;  2YS5 A;  2MFQ A;  4NSW A;  1ZSQ A;  1ZC4 B;  1MK9 B;  3CIK A;  4A6F B;  4EJN A;  2COC A;  1DBH A;  1SGH A;  1BWN A;  2P8V A;  1DDV A;  2GCJ A;  4NY0 A;  4HAV B;  2AEH A;  3A8Q A;  4GMV A;  1Q67 A;  1U27 A;  3HQC A;  2D10 A;  5DI9 B;  3BJI A;  1LB1 A;  2COA A;  5DIF B;  1WI1 A;  2LYD A;  4Z2M B;  2LUL A;  4A6K A;  3NSU A;  4F7H A;  5JHG A;  1U5G A;  2YSZ A;  4PNK A;  2VSZ A;  4HAX B;  2P0F A;  4HDO A;  3QBV B;  1I2H A;  1IRS A;  1SHC A;  3TVV A;  1QC6 A;  3BIN A;  1M7R A;  2D4Q A;  1OMW A;  5D3W A;  2FJL A;  5HE0 A;  2ROV A;  1OY2 A;  1TXD A;  3GYO A;  1B55 A;  1U5F A;  4L6E A;  4A6H A;  4KHB B;  4MT7 A;  2LG1 A;  3RCP A;  1TJ6 A;  1W1G A;  2I1K A;  2D9Y A;  1U29 A;  3PEG A;  3A8P A;  2XQN M;  3O96 A;  2OQB A;  2UZR A;  2D9Z A;  2J59 M;  2N23 A;  2I1J A;  1FHX A;  2M38 A;  4F7G A;  3AU4 A;  3WA0 A;  1W1H A;  2DN6 A;  2VKI A;  1P6S A;  1J0W A;  2DX1 A;  2GCL A;  2IYB A;  3D8E A;  3G9W A;  4A6F A;  1FGZ A;  1PMS A;  1U5E A;  3TO1 A;  1P5T A;  1X1G A;  1EAZ A;  3QIJ A;  1X05 A;  1XOD A;  3LJU X;  3TFM A;  4CYE A;  3D8F A;  5GOW B;  4WVF B;  1H4R A;  3KRW A;  1WGQ A;  2OTX A;  2LOX A;  4K2P A;  2MDX A;  2AL6 A;  4H8S A;  1MKE A;  5KQ4 A;  3KZ1 A;  5KQ1 A;  1XKE A;  2CY5 A;  2DA0 A;  2UVM A;  5KCV A;  1EF1 A;  5DH9 B;  2ROZ B;  4HDQ A;  4C0A A;  2ELB A;  2X18 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...