5J3YA

Crystal structure of s. pombe dcp2:dcp1 mrna decapping complex
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
126
structure length
126
Chain Sequence
b'PHMEDENILRNAVNLQVLKFHYPEIESIIDIASHVAVYQFDVGSQKWLKTSIEGTFFLVKDQRARVGYVILNRNSPENLYLFINHPSNVHLVDRYLIHRTENQHVVGLWMFDPNDMSRIFNIVKES'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords mRNA-decapping enzyme subunit 1
publication title Structure of the Dcp2-Dcp1 mRNA-decapping complex in the activated conformation.
pubmed doi rcsb
source organism Schizosaccharomyces pombe (strain 972 / atcc 24843)
molecule tags Hydrolase
total genus 32
structure length 126
sequence length 126
chains with identical sequence C
ec nomenclature
pdb deposition date 2016-03-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06058 DCP1 Dcp1-like decapping family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 5j3yA00
2N0YA 1X1FA 3QBVB 1XKEA 4A6FB 2DKPA 2LYDA 4GPTB 2V76A 5L81A 4L6EA 2J0JA 1XD4A 3AJ4A 3BINA 2D9VA 2IYBA 1LB1A 2D11A 4GZUA 1X11A 4HDOA 1NTYA 2VSZA 5CLLB 1ZSQA 3SYXA 1FHXA 1UPQA 2ROZB 2P8VA 4EKUA 4ZRKA 2CY5A 3CXBB 1U27A 3A8PA 3FM8C 3MDBC 3QWMA 4A6HA 1P5TA 1X05A 3A98B 3D8EA 4WVFB 2QKMA 4ZRJA 4K81A 2DLWA 2K2UA 4DBBA 1FGYA 1I2HA 3AU5A 1UPRA 1MK7B 2D9ZA 3A8QA 2COAA 1UEFA 2DYNA 2DFKA 2E2XA 3FSSA 3ZDTA 2ELBA 5J3QA 2DHJA 1QC6A 5JHGA 2W2XD 4GMVA 1K5DB 2DA0A 3AU4A 1V61A 5KCVA 2YVCA 2RGNB 5JP4A 5KQ4A 5FI1A 1NU2A 2J59M 5HE2A 5LOPB 5CLQB 2LOXA 3TO1A 4IFSA 1WI1A 2DX5A 3SNHA 2GS0A 1UNRA 4GXBA 2D2QA 3HW2B 1OQNA 1FAOA 1RRPB 2UVMA 2MDXA 3U8ZA 3T06A 2K00A 2YRYA 1Y5OA 4P7IA 4YONA 5D3WA 2DX1A 1OY2A 5J3YA 2I1KA 1Q67A 1DYNA 3N7CA 3M1IB 3UZTA 2D9XA 2PZ1A 2AEHA 2YT0A 3CIKA 4DX8A 4KHAA 3D8DA 2Y8GA 3TCAA 4TYZA 1U29A 2QKLA 1PFJA 2DHIA 2Y8FA 1FOEA 4HAUB 3GYOA 3HQCA 1P6SA 2KCJA 3MPXA 2M14A 2GJYA 1MIZB 4DX90 2HTHB 2ROVA 4WJ7A 1ZVRA 1SHCA 4MT7A 2LKOA 1WVHA 2R0DA 1WGQA 1KZ7A 4XWXA 2COFA 2UZSA 4GN1A 2Y7BA 3TW1A 2H7DA 5DIFB 1XR0B 3PP2A 3ODWA 2H7EA 4PQ0A 2RSGA 1U5DA 3PSCA 2KGXB 3ODXA 2X18A 5D3YA 4D0NB 2Z0OA 3O96A 1H4RA 2HE7A 5DI9B 4CHMA 1FGZA 1J0WA 2EMTA 2M38A 3TFMA 5C16A 4A5KA 4HATB 4HAXB 3D8FA 2LOZA 2I1JA 1BWNA 4HB4B 3FEHA 3IVFA 2L1CA 4HB0B 3KRWA 2J0KA 2MKRA 1V5UA 2YS3A 1FB8A 2LG1A 3GYPA 5HE3A 1XX0A 4TKNA 1DDMA 2ELAA 2EC1A 1EF1A 1V89A 2J0MA 3WYFB 2I5FA 5DHAB 2OTXA 4B6HA 2N23A 1NTVA 1U5EA 2Q13A 2KUPA 4KVGB 3VOQA 4NY0A 1RJ2A 4CHJA 1TQZA 4K2OA 4CYEA 2COCA 4MY6A 2MFQA 1EVHA 1K5GB 2ZPYA 3ULBA 2EMSA 1X1GA 1X86A 1BAKA 2LULA 3ODOA 5DH9B 1W1GA 3QIJA 2RUKB 3TVVA 1U5FA 1DBHA 2CODA 3X23A 1DROA 5D3XA 3DXDA 4HB2B 4HAWB 5D27A 4C0AA 1V5PA 2Z0QA 4YL8A 4HDQA 5HE1A 3SO6A 1FHWA 1PMSA 3LJUX 1U5GA 4KHBB 3SUZA 3V5WA 2K2JA 1MK9B 3ULCA 3KZ1A 2NZ8B 2FJLA 2P0FA 4IAPA 3G9WA 4IOYX 1XCGA 1QQGA 2D9WA 3WA0A 4F7GA 3DXEA 1ZC4B 1ZC3B 1SGHA 3PVUA 2YS5A 3P6AA 4H8SA 1ISNA 2XQNM 2RNRB 2W2WA 3PVLA 1Y19B 2W2XC 1MAIA 2MWNB 2VKIA 4Z2MB 2G35A 1Z87A 3SV1A 1MKEA 1FHOA 2RVBB 1E5WA 3ML4A 2P0HA 5JHHA 1W1DA 2Z0PA 3BJIA 4HHVA 2AL6A 1J19A 5DHFB 4NSWA 4ZRIA 2D4QA 4KAXB 1LW3A 3VIAA 2JP2A 4HB3B 3OANA 1M7EA 1KZGA 3PVWA 5HE0A 4DXAB 1EGXA 5LONB 2DYQA 2GCLA 5FI0A 1ZM0A 3PG7A 1IRSA 3KRXA 4F7UP 3KY9A 2NMBA 3U7DA 5KQ1A 4A6KA 1WJ1A 4WSFA 4PNKA 1OMWA 3ZVRA 2RLOA 1I7AA 2DKQA 2GCJA 1EAZA 2D9YA 1AQCA 2L2IA 1U2BA 5C5BA 2DHKA 2YT1A 4K2PA 2CAYA 3RCPA 1GC7A 3F0WA 2YF0A 3NSUA 3HK0A 2D10A 4A6FA 1V5MA 2R09A 4BBKA 1DDWA 1WG7A 1AWEA 4Z2NA 1TXDA 2OQBA 2P0DA 2BCJA 5D3VA 2DTCA 1MPHA 4KHOA 2VRWB 1BTKA 5C6RA 4K17A 1WJMA 1P3RA 2IFSA 3DXCA 5EFXA 2UZRA 4HAVB 3P7ZA 4MK0A 1V88A 2I5CA 1KI1B 4F7HA 2DN6A 1XODA 1B55A 3KSYA 1GC6A 1H10A 3PEGA 5J3TA 1W1HA 4EMOA 1WGUA 1DDVA 3PZDA 1BTNA 2YSZA 4GMXB 2CY4A 4EJNA 1UNQA 1PLSA 1UNPA 1N3HA 1MIXA 4Y94A 2YS1A 5C79A 3F5RA 1GG3A 4HAZB 5GOWB 1NI2A 2EJ8A 2CRFA 5C5BB 4HAYB 5JLJB 2ADZA 1TJ6A 1M7RA
chains in the Genus database with same CATH superfamily
2N0YA 1X1FA 3QBVB 1XKEA 4A6FB 2DKPA 2LYDA 4GPTB 2Z59A 2V76A 5L81A 4L6EA 2J0JA 1XD4A 2KR0A 3AJ4A 3BINA 2D9VA 2IYBA 3DCXA 1LB1A 2D11A 4GZUA 1X11A 4HDOA 1NTYA 2VSZA 5CLLB 1ZSQA 3SYXA 1FHXA 1UPQA 2ROZB 2P8VA 4KHBA 4EKUA 4ZRKA 4HSIA 2CY5A 3CXBB 2K49A 1U27A 3A8PA 3FM8C 3MDBC 3QWMA 4A6HA 1P5TA 1X05A 3A98B 3D8EA 4WVFB 2QKMA 4ZRJA 4K81A 2DLWA 2K2UA 4DBBA 1FGYA 1I2HA 3AU5A 1UPRA 1MK7B 2D9ZA 3A8QA 2COAA 1UEFA 2DYNA 2DFKA 2E2XA 2Z4DA 3FSSA 3ZDTA 2ELBA 5J3QA 2DHJA 1QC6A 5JHGA 2W2XD 4GMVA 1K5DB 2DA0A 3AU4A 1V61A 5KCVA 2YVCA 2RGNB 5JP4A 5KQ4A 5FI1A 1NU2A 2J59M 5HE2A 5LOPB 5CLQB 2LOXA 2NBVA 3TO1A 5LG4B 4IFSA 1WI1A 2DX5A 3SNHA 2GS0A 1UNRA 4GXBA 2D2QA 3HW2B 1OQNA 1FAOA 1RRPB 2UVMA 2MDXA 3U8ZA 3T06A 2K00A 2YRYA 1Y5OA 4P7IA 4YONA 5D3WA 2DX1A 2ZKMX 1OY2A 5J3YA 2I1KA 1Q67A 1DYNA 3N7CA 3M1IB 3UZTA 2D9XA 2PZ1A 2AEHA 2YT0A 3CIKA 4DX8A 4KHAA 3D8DA 2Y8GA 2KIEA 3TCAA 1ZYIA 4TYZA 1U29A 2QKLA 1PFJA 2DHIA 2K8EA 2Y8FA 1FOEA 4HAUB 3GYOA 3HQCA 1P6SA 2KCJA 3MPXA 2M14A 2GJYA 2KIGA 1MIZB 4DX90 2HTHB 2ROVA 4WJ7A 1ZVRA 1SHCA 4MT7A 2LKOA 1WVHA 2R0DA 1WGQA 1KZ7A 4XWXA 2COFA 3NW8A 2UZSA 4GN1A 2Y7BA 3TW1A 2H7DA 5DIFB 1XR0B 4GOUA 3PP2A 3ODWA 2H7EA 4PQ0A 2RSGA 1U5DA 3PSCA 2KGXB 3ODXA 2X18A 5D3YA 4D0NB 2Z0OA 3NWDA 3O96A 1H4RA 2HE7A 5DI9B 4CHMA 1FGZA 1J0WA 2EMTA 2M38A 3TFMA 5C16A 4A5KA 4HATB 4HAXB 3D8FA 2LOZA 2I1JA 1BWNA 4HB4B 3FEHA 3IVFA 2L1CA 4HB0B 3KRWA 2J0KA 2MKRA 1V5UA 2YS3A 1FB8A 2LG1A 3GYPA 5HE3A 1XX0A 4TKNA 1DDMA 2ELAA 2EC1A 1EF1A 1V89A 3B77A 3HIEA 2J0MA 3WYFB 2I5FA 5DHAB 2OTXA 4B6HA 2N23A 1NTVA 1U5EA 2Q13A 2KUPA 4KVGB 3VOQA 4NY0A 1RJ2A 1MI1A 4CHJA 1TQZA 4K2OA 4CYEA 2COCA 4MY6A 2MFQA 3HSAA 1EVHA 1K5GB 2ZPYA 3ULBA 3NWAA 2EMSA 1X1GA 1X86A 1BAKA 2LULA 3ODOA 5DH9B 1W1GA 3QIJA 2RUKB 3TVVA 1U5FA 1DBHA 2KUQA 2CODA 3X23A 1DROA 5I2SA 5D3XA 3DXDA 4HB2B 4HAWB 5D27A 4C0AA 4QJ4B 1V5PA 2Z0QA 4YL8A 4HDQA 5HE1A 3SO6A 2Z13A 1FHWA 1PMSA 3LJUX 1U5GA 4KHBB 3SUZA 3V5WA 2K2JA 1MK9B 3ULCA 3KZ1A 2NZ8B 2FJLA 2P0FA 4IAPA 4DIXA 3G9WA 4IOYX 1XCGA 4QJ3B 1QQGA 2D9WA 3WA0A 4F7GA 3DXEA 1ZC4B 1ZC3B 1SGHA 3U12A 3PVUA 2YS5A 3P6AA 4H8SA 1ISNA 2XQNM 2RNRB 2W2WA 3PVLA 1Y19B 3NWFA 2W2XC 1MAIA 2MWNB 2VKIA 4Z2MB 5M4YB 2G35A 1Z87A 3SV1A 1MKEA 4D6WA 1FHOA 2RVBB 1E5WA 3ML4A 2P0HA 5JHHA 1W1DA 2Z0PA 3BJIA 4HHVA 2AL6A 1J19A 5DHFB 4NSWA 4ZRIA 2D4QA 4KAXB 1LW3A 3VIAA 2JP2A 4HB3B 3OANA 4QJ5B 1M7EA 1KZGA 3PVWA 5HE0A 4DXAB 1EGXA 5LONB 2DYQA 2GCLA 5FI0A 1ZM0A 3PG7A 4L1RA 1IRSA 3KRXA 4F7UP 3KY9A 2NMBA 3U7DA 5KQ1A 4A6KA 1WJ1A 4WSFA 4PNKA 1OMWA 4CSQA 3ZVRA 2RLOA 1I7AA 3OHMB 2DKQA 2GCJA 1EAZA 2D9YA 1AQCA 2L2IA 4GNKB 1U2BA 5C5BA 2Z14A 2DHKA 2YT1A 4K2PA 2CAYA 3RCPA 1GC7A 3F0WA 2YF0A 3NSUA 4OT1A 2YT2A 3HK0A 2D10A 4A6FA 1V5MA 2R09A 2FJUB 2R2YA 4BBKA 1DDWA 5I2MA 1WG7A 1AWEA 4Z2NA 1TXDA 2OQBA 2P0DA 2BCJA 5D3VA 2DTCA 3FVCA 1MPHA 4KHOA 2VRWB 1BTKA 5IRSA 5C6RA 4K17A 1WJMA 1P3RA 3A58A 2IFSA 3DXCA 5EFXA 2UZRA 4HAVB 3P7ZA 4MK0A 1V88A 2I5CA 1KI1B 4F7HA 2DN6A 1XODA 1B55A 3KSYA 4QXAB 1GC6A 1H10A 3PEGA 5J3TA 1W1HA 4EMOA 1WGUA 1DDVA 3PZDA 2GUMA 1BTNA 2YSZA 4GMXB 2CY4A 4EJNA 1UNQA 1PLSA 1UNPA 1N3HA 1MIXA 4Y94A 2YS1A 5C79A 3F5RA 1GG3A 4HAZB 5GOWB 2RRFA 1NI2A 2EJ8A 2CRFA 5C5BB 4HAYB 4OSNA 5JLJB 2ADZA 1TJ6A 1T77A 1M7RA
chains in the Genus database with same CATH topology
2N0YA 1X1FA 3QBVB 1XKEA 4A6FB 2DKPA 2LYDA 4GPTB 2V76A 5L81A 4L6EA 2J0JA 1XD4A 3AJ4A 3BINA 2D9VA 2IYBA 1LB1A 2D11A 4GZUA 1X11A 4HDOA 1NTYA 2VSZA 5CLLB 1ZSQA 3SYXA 1FHXA 1UPQA 2ROZB 2P8VA 4EKUA 4ZRKA 2CY5A 3CXBB 1U27A 3A8PA 3FM8C 3MDBC 3QWMA 4A6HA 1P5TA 1X05A 3A98B 3D8EA 4WVFB 2QKMA 4ZRJA 4K81A 2DLWA 2K2UA 4DBBA 1FGYA 1I2HA 3AU5A 1UPRA 1MK7B 2D9ZA 3A8QA 2COAA 1UEFA 2DYNA 2DFKA 2E2XA 3FSSA 3ZDTA 2ELBA 5J3QA 2DHJA 1QC6A 5JHGA 2W2XD 4GMVA 1K5DB 2DA0A 3AU4A 1V61A 5KCVA 2YVCA 2RGNB 5JP4A 5KQ4A 5FI1A 1NU2A 2J59M 5HE2A 5LOPB 5CLQB 2LOXA 3TO1A 4IFSA 1WI1A 2DX5A 3SNHA 2GS0A 1UNRA 4GXBA 2D2QA 3HW2B 1OQNA 1FAOA 1RRPB 2UVMA 2MDXA 3U8ZA 3T06A 2K00A 2YRYA 1Y5OA 4P7IA 4YONA 5D3WA 2DX1A 1OY2A 5J3YA 2I1KA 1Q67A 1DYNA 3N7CA 3M1IB 3UZTA 2D9XA 2PZ1A 2AEHA 2YT0A 3CIKA 4DX8A 4KHAA 3D8DA 2Y8GA 3TCAA 4TYZA 1U29A 2QKLA 1PFJA 2DHIA 2Y8FA 1FOEA 4HAUB 3GYOA 3HQCA 1P6SA 2KCJA 3MPXA 2M14A 2GJYA 1MIZB 4DX90 2HTHB 2ROVA 4WJ7A 1ZVRA 1SHCA 4MT7A 2LKOA 1WVHA 2R0DA 1WGQA 1KZ7A 4XWXA 2COFA 2UZSA 4GN1A 2Y7BA 3TW1A 2H7DA 5DIFB 1XR0B 3PP2A 3ODWA 2H7EA 4PQ0A 2RSGA 1U5DA 3PSCA 2KGXB 3ODXA 2X18A 5D3YA 4D0NB 2Z0OA 3O96A 1H4RA 2HE7A 5DI9B 4CHMA 1FGZA 1J0WA 2EMTA 2M38A 3TFMA 5C16A 4A5KA 4HATB 4HAXB 3D8FA 2LOZA 2I1JA 1BWNA 4HB4B 3FEHA 3IVFA 2L1CA 4HB0B 3KRWA 2J0KA 2MKRA 1V5UA 2YS3A 1FB8A 2LG1A 3GYPA 5HE3A 1XX0A 4TKNA 1DDMA 2ELAA 2EC1A 1EF1A 1V89A 2J0MA 3WYFB 2I5FA 5DHAB 2OTXA 4B6HA 2N23A 1NTVA 1U5EA 2Q13A 2KUPA 4KVGB 3VOQA 4NY0A 1RJ2A 4CHJA 1TQZA 4K2OA 4CYEA 2COCA 4MY6A 2MFQA 1EVHA 1K5GB 2ZPYA 3ULBA 2EMSA 1X1GA 1X86A 1BAKA 2LULA 3ODOA 5DH9B 1W1GA 3QIJA 2RUKB 3TVVA 1U5FA 1DBHA 2CODA 3X23A 1DROA 5D3XA 3DXDA 4HB2B 4HAWB 5D27A 4C0AA 1V5PA 2Z0QA 4YL8A 4HDQA 5HE1A 3SO6A 1FHWA 1PMSA 3LJUX 1U5GA 4KHBB 3SUZA 3V5WA 2K2JA 1MK9B 3ULCA 3KZ1A 2NZ8B 2FJLA 2P0FA 4IAPA 3G9WA 4IOYX 1XCGA 1QQGA 2D9WA 3WA0A 4F7GA 3DXEA 1ZC4B 1ZC3B 1SGHA 3PVUA 2YS5A 3P6AA 4H8SA 1ISNA 2XQNM 2RNRB 2W2WA 3PVLA 1Y19B 2W2XC 1MAIA 2MWNB 2VKIA 4Z2MB 2G35A 1Z87A 3SV1A 1MKEA 1FHOA 2RVBB 1E5WA 3ML4A 2P0HA 5JHHA 1W1DA 2Z0PA 3BJIA 4HHVA 2AL6A 1J19A 5DHFB 4NSWA 4ZRIA 2D4QA 4KAXB 1LW3A 3VIAA 2JP2A 4HB3B 3OANA 1M7EA 1KZGA 3PVWA 5HE0A 4DXAB 1EGXA 5LONB 2DYQA 2GCLA 5FI0A 1ZM0A 3PG7A 1IRSA 3KRXA 4F7UP 3KY9A 2NMBA 3U7DA 5KQ1A 4A6KA 1WJ1A 4WSFA 4PNKA 1OMWA 3ZVRA 2RLOA 1I7AA 2DKQA 2GCJA 1EAZA 2D9YA 1AQCA 2L2IA 1U2BA 5C5BA 2DHKA 2YT1A 4K2PA 2CAYA 3RCPA 1GC7A 3F0WA 2YF0A 3NSUA 3HK0A 2D10A 4A6FA 1V5MA 2R09A 4BBKA 1DDWA 1WG7A 1AWEA 4Z2NA 1TXDA 2OQBA 2P0DA 2BCJA 5D3VA 2DTCA 1MPHA 4KHOA 2VRWB 1BTKA 5C6RA 4K17A 1WJMA 1P3RA 2IFSA 3DXCA 5EFXA 2UZRA 4HAVB 3P7ZA 4MK0A 1V88A 2I5CA 1KI1B 4F7HA 2DN6A 1XODA 1B55A 3KSYA 1GC6A 1H10A 3PEGA 5J3TA 1W1HA 4EMOA 1WGUA 1DDVA 3PZDA 1BTNA 2YSZA 4GMXB 2CY4A 4EJNA 1UNQA 1PLSA 1UNPA 1N3HA 1MIXA 4Y94A 2YS1A 5C79A 3F5RA 1GG3A 4HAZB 5GOWB 1NI2A 2EJ8A 2CRFA 5C5BB 4HAYB 5JLJB 2ADZA 1TJ6A 1M7RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2N0Y A;  1X1F A;  3QBV B;  1XKE A;  4A6F B;  2DKP A;  2LYD A;  4GPT B;  2V76 A;  5L81 A;  4L6E A;  2J0J A;  1XD4 A;  3AJ4 A;  3BIN A;  2D9V A;  2IYB A;  1LB1 A;  2D11 A;  4GZU A;  1X11 A;  4HDO A;  1NTY A;  2VSZ A;  5CLL B;  1ZSQ A;  3SYX A;  1FHX A;  1UPQ A;  2ROZ B;  2P8V A;  4EKU A;  4ZRK A;  2CY5 A;  3CXB B;  1U27 A;  3A8P A;  3FM8 C;  3MDB C;  3QWM A;  4A6H A;  1P5T A;  1X05 A;  3A98 B;  3D8E A;  4WVF B;  2QKM A;  4ZRJ A;  4K81 A;  2DLW A;  2K2U A;  4DBB A;  1FGY A;  1I2H A;  3AU5 A;  1UPR A;  1MK7 B;  2D9Z A;  3A8Q A;  2COA A;  1UEF A;  2DYN A;  2DFK A;  2E2X A;  3FSS A;  3ZDT A;  2ELB A;  5J3Q A;  2DHJ A;  1QC6 A;  5JHG A;  2W2X D;  4GMV A;  1K5D B;  2DA0 A;  3AU4 A;  1V61 A;  5KCV A;  2YVC A;  2RGN B;  5JP4 A;  5KQ4 A;  5FI1 A;  1NU2 A;  2J59 M;  5HE2 A;  5LOP B;  5CLQ B;  2LOX A;  3TO1 A;  4IFS A;  1WI1 A;  2DX5 A;  3SNH A;  2GS0 A;  1UNR A;  4GXB A;  2D2Q A;  3HW2 B;  1OQN A;  1FAO A;  1RRP B;  2UVM A;  2MDX A;  3U8Z A;  3T06 A;  2K00 A;  2YRY A;  1Y5O A;  4P7I A;  4YON A;  5D3W A;  2DX1 A;  1OY2 A;  5J3Y A;  2I1K A;  1Q67 A;  1DYN A;  3N7C A;  3M1I B;  3UZT A;  2D9X A;  2PZ1 A;  2AEH A;  2YT0 A;  3CIK A;  4DX8 A;  4KHA A;  3D8D A;  2Y8G A;  3TCA A;  4TYZ A;  1U29 A;  2QKL A;  1PFJ A;  2DHI A;  2Y8F A;  1FOE A;  4HAU B;  3GYO A;  3HQC A;  1P6S A;  2KCJ A;  3MPX A;  2M14 A;  2GJY A;  1MIZ B;  4DX9 0;  2HTH B;  2ROV A;  4WJ7 A;  1ZVR A;  1SHC A;  4MT7 A;  2LKO A;  1WVH A;  2R0D A;  1WGQ A;  1KZ7 A;  4XWX A;  2COF A;  2UZS A;  4GN1 A;  2Y7B A;  3TW1 A;  2H7D A;  5DIF B;  1XR0 B;  3PP2 A;  3ODW A;  2H7E A;  4PQ0 A;  2RSG A;  1U5D A;  3PSC A;  2KGX B;  3ODX A;  2X18 A;  5D3Y A;  4D0N B;  2Z0O A;  3O96 A;  1H4R A;  2HE7 A;  5DI9 B;  4CHM A;  1FGZ A;  1J0W A;  2EMT A;  2M38 A;  3TFM A;  5C16 A;  4A5K A;  4HAT B;  4HAX B;  3D8F A;  2LOZ A;  2I1J A;  1BWN A;  4HB4 B;  3FEH A;  3IVF A;  2L1C A;  4HB0 B;  3KRW A;  2J0K A;  2MKR A;  1V5U A;  2YS3 A;  1FB8 A;  2LG1 A;  3GYP A;  5HE3 A;  1XX0 A;  4TKN A;  1DDM A;  2ELA A;  2EC1 A;  1EF1 A;  1V89 A;  2J0M A;  3WYF B;  2I5F A;  5DHA B;  2OTX A;  4B6H A;  2N23 A;  1NTV A;  1U5E A;  2Q13 A;  2KUP A;  4KVG B;  3VOQ A;  4NY0 A;  1RJ2 A;  4CHJ A;  1TQZ A;  4K2O A;  4CYE A;  2COC A;  4MY6 A;  2MFQ A;  1EVH A;  1K5G B;  2ZPY A;  3ULB A;  2EMS A;  1X1G A;  1X86 A;  1BAK A;  2LUL A;  3ODO A;  5DH9 B;  1W1G A;  3QIJ A;  2RUK B;  3TVV A;  1U5F A;  1DBH A;  2COD A;  3X23 A;  1DRO A;  5D3X A;  3DXD A;  4HB2 B;  4HAW B;  5D27 A;  4C0A A;  1V5P A;  2Z0Q A;  4YL8 A;  4HDQ A;  5HE1 A;  3SO6 A;  1FHW A;  1PMS A;  3LJU X;  1U5G A;  4KHB B;  3SUZ A;  3V5W A;  2K2J A;  1MK9 B;  3ULC A;  3KZ1 A;  2NZ8 B;  2FJL A;  2P0F A;  4IAP A;  3G9W A;  4IOY X;  1XCG A;  1QQG A;  2D9W A;  3WA0 A;  4F7G A;  3DXE A;  1ZC4 B;  1ZC3 B;  1SGH A;  3PVU A;  2YS5 A;  3P6A A;  4H8S A;  1ISN A;  2XQN M;  2RNR B;  2W2W A;  3PVL A;  1Y19 B;  2W2X C;  1MAI A;  2MWN B;  2VKI A;  4Z2M B;  2G35 A;  1Z87 A;  3SV1 A;  1MKE A;  1FHO A;  2RVB B;  1E5W A;  3ML4 A;  2P0H A;  5JHH A;  1W1D A;  2Z0P A;  3BJI A;  4HHV A;  2AL6 A;  1J19 A;  5DHF B;  4NSW A;  4ZRI A;  2D4Q A;  4KAX B;  1LW3 A;  3VIA A;  2JP2 A;  4HB3 B;  3OAN A;  1M7E A;  1KZG A;  3PVW A;  5HE0 A;  4DXA B;  1EGX A;  5LON B;  2DYQ A;  2GCL A;  5FI0 A;  1ZM0 A;  3PG7 A;  1IRS A;  3KRX A;  4F7U P;  3KY9 A;  2NMB A;  3U7D A;  5KQ1 A;  4A6K A;  1WJ1 A;  4WSF A;  4PNK A;  1OMW A;  3ZVR A;  2RLO A;  1I7A A;  2DKQ A;  2GCJ A;  1EAZ A;  2D9Y A;  1AQC A;  2L2I A;  1U2B A;  5C5B A;  2DHK A;  2YT1 A;  4K2P A;  2CAY A;  3RCP A;  1GC7 A;  3F0W A;  2YF0 A;  3NSU A;  3HK0 A;  2D10 A;  4A6F A;  1V5M A;  2R09 A;  4BBK A;  1DDW A;  1WG7 A;  1AWE A;  4Z2N A;  1TXD A;  2OQB A;  2P0D A;  2BCJ A;  5D3V A;  2DTC A;  1MPH A;  4KHO A;  2VRW B;  1BTK A;  5C6R A;  4K17 A;  1WJM A;  1P3R A;  2IFS A;  3DXC A;  5EFX A;  2UZR A;  4HAV B;  3P7Z A;  4MK0 A;  1V88 A;  2I5C A;  1KI1 B;  4F7H A;  2DN6 A;  1XOD A;  1B55 A;  3KSY A;  1GC6 A;  1H10 A;  3PEG A;  5J3T A;  1W1H A;  4EMO A;  1WGU A;  1DDV A;  3PZD A;  1BTN A;  2YSZ A;  4GMX B;  2CY4 A;  4EJN A;  1UNQ A;  1PLS A;  1UNP A;  1N3H A;  1MIX A;  4Y94 A;  2YS1 A;  5C79 A;  3F5R A;  1GG3 A;  4HAZ B;  5GOW B;  1NI2 A;  2EJ8 A;  2CRF A;  5C5B B;  4HAY B;  5JLJ B;  2ADZ A;  1TJ6 A;  1M7R A; 
#chains in the Genus database with same CATH topology
 2N0Y A;  1X1F A;  3QBV B;  1XKE A;  4A6F B;  2DKP A;  2LYD A;  4GPT B;  2Z59 A;  2V76 A;  5L81 A;  4L6E A;  2J0J A;  1XD4 A;  2KR0 A;  3AJ4 A;  3BIN A;  2D9V A;  2IYB A;  3DCX A;  1LB1 A;  2D11 A;  4GZU A;  1X11 A;  4HDO A;  1NTY A;  2VSZ A;  5CLL B;  1ZSQ A;  3SYX A;  1FHX A;  1UPQ A;  2ROZ B;  2P8V A;  4KHB A;  4EKU A;  4ZRK A;  4HSI A;  2CY5 A;  3CXB B;  2K49 A;  1U27 A;  3A8P A;  3FM8 C;  3MDB C;  3QWM A;  4A6H A;  1P5T A;  1X05 A;  3A98 B;  3D8E A;  4WVF B;  2QKM A;  4ZRJ A;  4K81 A;  2DLW A;  2K2U A;  4DBB A;  1FGY A;  1I2H A;  3AU5 A;  1UPR A;  1MK7 B;  2D9Z A;  3A8Q A;  2COA A;  1UEF A;  2DYN A;  2DFK A;  2E2X A;  2Z4D A;  3FSS A;  3ZDT A;  2ELB A;  5J3Q A;  2DHJ A;  1QC6 A;  5JHG A;  2W2X D;  4GMV A;  1K5D B;  2DA0 A;  3AU4 A;  1V61 A;  5KCV A;  2YVC A;  2RGN B;  5JP4 A;  5KQ4 A;  5FI1 A;  1NU2 A;  2J59 M;  5HE2 A;  5LOP B;  5CLQ B;  2LOX A;  2NBV A;  3TO1 A;  5LG4 B;  4IFS A;  1WI1 A;  2DX5 A;  3SNH A;  2GS0 A;  1UNR A;  4GXB A;  2D2Q A;  3HW2 B;  1OQN A;  1FAO A;  1RRP B;  2UVM A;  2MDX A;  3U8Z A;  3T06 A;  2K00 A;  2YRY A;  1Y5O A;  4P7I A;  4YON A;  5D3W A;  2DX1 A;  2ZKM X;  1OY2 A;  5J3Y A;  2I1K A;  1Q67 A;  1DYN A;  3N7C A;  3M1I B;  3UZT A;  2D9X A;  2PZ1 A;  2AEH A;  2YT0 A;  3CIK A;  4DX8 A;  4KHA A;  3D8D A;  2Y8G A;  2KIE A;  3TCA A;  1ZYI A;  4TYZ A;  1U29 A;  2QKL A;  1PFJ A;  2DHI A;  2K8E A;  2Y8F A;  1FOE A;  4HAU B;  3GYO A;  3HQC A;  1P6S A;  2KCJ A;  3MPX A;  2M14 A;  2GJY A;  2KIG A;  1MIZ B;  4DX9 0;  2HTH B;  2ROV A;  4WJ7 A;  1ZVR A;  1SHC A;  4MT7 A;  2LKO A;  1WVH A;  2R0D A;  1WGQ A;  1KZ7 A;  4XWX A;  2COF A;  3NW8 A;  2UZS A;  4GN1 A;  2Y7B A;  3TW1 A;  2H7D A;  5DIF B;  1XR0 B;  4GOU A;  3PP2 A;  3ODW A;  2H7E A;  4PQ0 A;  2RSG A;  1U5D A;  3PSC A;  2KGX B;  3ODX A;  2X18 A;  5D3Y A;  4D0N B;  2Z0O A;  3NWD A;  3O96 A;  1H4R A;  2HE7 A;  5DI9 B;  4CHM A;  1FGZ A;  1J0W A;  2EMT A;  2M38 A;  3TFM A;  5C16 A;  4A5K A;  4HAT B;  4HAX B;  3D8F A;  2LOZ A;  2I1J A;  1BWN A;  4HB4 B;  3FEH A;  3IVF A;  2L1C A;  4HB0 B;  3KRW A;  2J0K A;  2MKR A;  1V5U A;  2YS3 A;  1FB8 A;  2LG1 A;  3GYP A;  5HE3 A;  1XX0 A;  4TKN A;  1DDM A;  2ELA A;  2EC1 A;  1EF1 A;  1V89 A;  3B77 A;  3HIE A;  2J0M A;  3WYF B;  2I5F A;  5DHA B;  2OTX A;  4B6H A;  2N23 A;  1NTV A;  1U5E A;  2Q13 A;  2KUP A;  4KVG B;  3VOQ A;  4NY0 A;  1RJ2 A;  1MI1 A;  4CHJ A;  1TQZ A;  4K2O A;  4CYE A;  2COC A;  4MY6 A;  2MFQ A;  3HSA A;  1EVH A;  1K5G B;  2ZPY A;  3ULB A;  3NWA A;  2EMS A;  1X1G A;  1X86 A;  1BAK A;  2LUL A;  3ODO A;  5DH9 B;  1W1G A;  3QIJ A;  2RUK B;  3TVV A;  1U5F A;  1DBH A;  2KUQ A;  2COD A;  3X23 A;  1DRO A;  5I2S A;  5D3X A;  3DXD A;  4HB2 B;  4HAW B;  5D27 A;  4C0A A;  4QJ4 B;  1V5P A;  2Z0Q A;  4YL8 A;  4HDQ A;  5HE1 A;  3SO6 A;  2Z13 A;  1FHW A;  1PMS A;  3LJU X;  1U5G A;  4KHB B;  3SUZ A;  3V5W A;  2K2J A;  1MK9 B;  3ULC A;  3KZ1 A;  2NZ8 B;  2FJL A;  2P0F A;  4IAP A;  4DIX A;  3G9W A;  4IOY X;  1XCG A;  4QJ3 B;  1QQG A;  2D9W A;  3WA0 A;  4F7G A;  3DXE A;  1ZC4 B;  1ZC3 B;  1SGH A;  3U12 A;  3PVU A;  2YS5 A;  3P6A A;  4H8S A;  1ISN A;  2XQN M;  2RNR B;  2W2W A;  3PVL A;  1Y19 B;  3NWF A;  2W2X C;  1MAI A;  2MWN B;  2VKI A;  4Z2M B;  5M4Y B;  2G35 A;  1Z87 A;  3SV1 A;  1MKE A;  4D6W A;  1FHO A;  2RVB B;  1E5W A;  3ML4 A;  2P0H A;  5JHH A;  1W1D A;  2Z0P A;  3BJI A;  4HHV A;  2AL6 A;  1J19 A;  5DHF B;  4NSW A;  4ZRI A;  2D4Q A;  4KAX B;  1LW3 A;  3VIA A;  2JP2 A;  4HB3 B;  3OAN A;  4QJ5 B;  1M7E A;  1KZG A;  3PVW A;  5HE0 A;  4DXA B;  1EGX A;  5LON B;  2DYQ A;  2GCL A;  5FI0 A;  1ZM0 A;  3PG7 A;  4L1R A;  1IRS A;  3KRX A;  4F7U P;  3KY9 A;  2NMB A;  3U7D A;  5KQ1 A;  4A6K A;  1WJ1 A;  4WSF A;  4PNK A;  1OMW A;  4CSQ A;  3ZVR A;  2RLO A;  1I7A A;  3OHM B;  2DKQ A;  2GCJ A;  1EAZ A;  2D9Y A;  1AQC A;  2L2I A;  4GNK B;  1U2B A;  5C5B A;  2Z14 A;  2DHK A;  2YT1 A;  4K2P A;  2CAY A;  3RCP A;  1GC7 A;  3F0W A;  2YF0 A;  3NSU A;  4OT1 A;  2YT2 A;  3HK0 A;  2D10 A;  4A6F A;  1V5M A;  2R09 A;  2FJU B;  2R2Y A;  4BBK A;  1DDW A;  5I2M A;  1WG7 A;  1AWE A;  4Z2N A;  1TXD A;  2OQB A;  2P0D A;  2BCJ A;  5D3V A;  2DTC A;  3FVC A;  1MPH A;  4KHO A;  2VRW B;  1BTK A;  5IRS A;  5C6R A;  4K17 A;  1WJM A;  1P3R A;  3A58 A;  2IFS A;  3DXC A;  5EFX A;  2UZR A;  4HAV B;  3P7Z A;  4MK0 A;  1V88 A;  2I5C A;  1KI1 B;  4F7H A;  2DN6 A;  1XOD A;  1B55 A;  3KSY A;  4QXA B;  1GC6 A;  1H10 A;  3PEG A;  5J3T A;  1W1H A;  4EMO A;  1WGU A;  1DDV A;  3PZD A;  2GUM A;  1BTN A;  2YSZ A;  4GMX B;  2CY4 A;  4EJN A;  1UNQ A;  1PLS A;  1UNP A;  1N3H A;  1MIX A;  4Y94 A;  2YS1 A;  5C79 A;  3F5R A;  1GG3 A;  4HAZ B;  5GOW B;  2RRF A;  1NI2 A;  2EJ8 A;  2CRF A;  5C5B B;  4HAY B;  4OSN A;  5JLJ B;  2ADZ A;  1TJ6 A;  1T77 A;  1M7R A; 
#chains in the Genus database with same CATH homology
 2N0Y A;  1X1F A;  3QBV B;  1XKE A;  4A6F B;  2DKP A;  2LYD A;  4GPT B;  2V76 A;  5L81 A;  4L6E A;  2J0J A;  1XD4 A;  3AJ4 A;  3BIN A;  2D9V A;  2IYB A;  1LB1 A;  2D11 A;  4GZU A;  1X11 A;  4HDO A;  1NTY A;  2VSZ A;  5CLL B;  1ZSQ A;  3SYX A;  1FHX A;  1UPQ A;  2ROZ B;  2P8V A;  4EKU A;  4ZRK A;  2CY5 A;  3CXB B;  1U27 A;  3A8P A;  3FM8 C;  3MDB C;  3QWM A;  4A6H A;  1P5T A;  1X05 A;  3A98 B;  3D8E A;  4WVF B;  2QKM A;  4ZRJ A;  4K81 A;  2DLW A;  2K2U A;  4DBB A;  1FGY A;  1I2H A;  3AU5 A;  1UPR A;  1MK7 B;  2D9Z A;  3A8Q A;  2COA A;  1UEF A;  2DYN A;  2DFK A;  2E2X A;  3FSS A;  3ZDT A;  2ELB A;  5J3Q A;  2DHJ A;  1QC6 A;  5JHG A;  2W2X D;  4GMV A;  1K5D B;  2DA0 A;  3AU4 A;  1V61 A;  5KCV A;  2YVC A;  2RGN B;  5JP4 A;  5KQ4 A;  5FI1 A;  1NU2 A;  2J59 M;  5HE2 A;  5LOP B;  5CLQ B;  2LOX A;  3TO1 A;  4IFS A;  1WI1 A;  2DX5 A;  3SNH A;  2GS0 A;  1UNR A;  4GXB A;  2D2Q A;  3HW2 B;  1OQN A;  1FAO A;  1RRP B;  2UVM A;  2MDX A;  3U8Z A;  3T06 A;  2K00 A;  2YRY A;  1Y5O A;  4P7I A;  4YON A;  5D3W A;  2DX1 A;  1OY2 A;  5J3Y A;  2I1K A;  1Q67 A;  1DYN A;  3N7C A;  3M1I B;  3UZT A;  2D9X A;  2PZ1 A;  2AEH A;  2YT0 A;  3CIK A;  4DX8 A;  4KHA A;  3D8D A;  2Y8G A;  3TCA A;  4TYZ A;  1U29 A;  2QKL A;  1PFJ A;  2DHI A;  2Y8F A;  1FOE A;  4HAU B;  3GYO A;  3HQC A;  1P6S A;  2KCJ A;  3MPX A;  2M14 A;  2GJY A;  1MIZ B;  4DX9 0;  2HTH B;  2ROV A;  4WJ7 A;  1ZVR A;  1SHC A;  4MT7 A;  2LKO A;  1WVH A;  2R0D A;  1WGQ A;  1KZ7 A;  4XWX A;  2COF A;  2UZS A;  4GN1 A;  2Y7B A;  3TW1 A;  2H7D A;  5DIF B;  1XR0 B;  3PP2 A;  3ODW A;  2H7E A;  4PQ0 A;  2RSG A;  1U5D A;  3PSC A;  2KGX B;  3ODX A;  2X18 A;  5D3Y A;  4D0N B;  2Z0O A;  3O96 A;  1H4R A;  2HE7 A;  5DI9 B;  4CHM A;  1FGZ A;  1J0W A;  2EMT A;  2M38 A;  3TFM A;  5C16 A;  4A5K A;  4HAT B;  4HAX B;  3D8F A;  2LOZ A;  2I1J A;  1BWN A;  4HB4 B;  3FEH A;  3IVF A;  2L1C A;  4HB0 B;  3KRW A;  2J0K A;  2MKR A;  1V5U A;  2YS3 A;  1FB8 A;  2LG1 A;  3GYP A;  5HE3 A;  1XX0 A;  4TKN A;  1DDM A;  2ELA A;  2EC1 A;  1EF1 A;  1V89 A;  2J0M A;  3WYF B;  2I5F A;  5DHA B;  2OTX A;  4B6H A;  2N23 A;  1NTV A;  1U5E A;  2Q13 A;  2KUP A;  4KVG B;  3VOQ A;  4NY0 A;  1RJ2 A;  4CHJ A;  1TQZ A;  4K2O A;  4CYE A;  2COC A;  4MY6 A;  2MFQ A;  1EVH A;  1K5G B;  2ZPY A;  3ULB A;  2EMS A;  1X1G A;  1X86 A;  1BAK A;  2LUL A;  3ODO A;  5DH9 B;  1W1G A;  3QIJ A;  2RUK B;  3TVV A;  1U5F A;  1DBH A;  2COD A;  3X23 A;  1DRO A;  5D3X A;  3DXD A;  4HB2 B;  4HAW B;  5D27 A;  4C0A A;  1V5P A;  2Z0Q A;  4YL8 A;  4HDQ A;  5HE1 A;  3SO6 A;  1FHW A;  1PMS A;  3LJU X;  1U5G A;  4KHB B;  3SUZ A;  3V5W A;  2K2J A;  1MK9 B;  3ULC A;  3KZ1 A;  2NZ8 B;  2FJL A;  2P0F A;  4IAP A;  3G9W A;  4IOY X;  1XCG A;  1QQG A;  2D9W A;  3WA0 A;  4F7G A;  3DXE A;  1ZC4 B;  1ZC3 B;  1SGH A;  3PVU A;  2YS5 A;  3P6A A;  4H8S A;  1ISN A;  2XQN M;  2RNR B;  2W2W A;  3PVL A;  1Y19 B;  2W2X C;  1MAI A;  2MWN B;  2VKI A;  4Z2M B;  2G35 A;  1Z87 A;  3SV1 A;  1MKE A;  1FHO A;  2RVB B;  1E5W A;  3ML4 A;  2P0H A;  5JHH A;  1W1D A;  2Z0P A;  3BJI A;  4HHV A;  2AL6 A;  1J19 A;  5DHF B;  4NSW A;  4ZRI A;  2D4Q A;  4KAX B;  1LW3 A;  3VIA A;  2JP2 A;  4HB3 B;  3OAN A;  1M7E A;  1KZG A;  3PVW A;  5HE0 A;  4DXA B;  1EGX A;  5LON B;  2DYQ A;  2GCL A;  5FI0 A;  1ZM0 A;  3PG7 A;  1IRS A;  3KRX A;  4F7U P;  3KY9 A;  2NMB A;  3U7D A;  5KQ1 A;  4A6K A;  1WJ1 A;  4WSF A;  4PNK A;  1OMW A;  3ZVR A;  2RLO A;  1I7A A;  2DKQ A;  2GCJ A;  1EAZ A;  2D9Y A;  1AQC A;  2L2I A;  1U2B A;  5C5B A;  2DHK A;  2YT1 A;  4K2P A;  2CAY A;  3RCP A;  1GC7 A;  3F0W A;  2YF0 A;  3NSU A;  3HK0 A;  2D10 A;  4A6F A;  1V5M A;  2R09 A;  4BBK A;  1DDW A;  1WG7 A;  1AWE A;  4Z2N A;  1TXD A;  2OQB A;  2P0D A;  2BCJ A;  5D3V A;  2DTC A;  1MPH A;  4KHO A;  2VRW B;  1BTK A;  5C6R A;  4K17 A;  1WJM A;  1P3R A;  2IFS A;  3DXC A;  5EFX A;  2UZR A;  4HAV B;  3P7Z A;  4MK0 A;  1V88 A;  2I5C A;  1KI1 B;  4F7H A;  2DN6 A;  1XOD A;  1B55 A;  3KSY A;  1GC6 A;  1H10 A;  3PEG A;  5J3T A;  1W1H A;  4EMO A;  1WGU A;  1DDV A;  3PZD A;  1BTN A;  2YSZ A;  4GMX B;  2CY4 A;  4EJN A;  1UNQ A;  1PLS A;  1UNP A;  1N3H A;  1MIX A;  4Y94 A;  2YS1 A;  5C79 A;  3F5R A;  1GG3 A;  4HAZ B;  5GOW B;  1NI2 A;  2EJ8 A;  2CRF A;  5C5B B;  4HAY B;  5JLJ B;  2ADZ A;  1TJ6 A;  1M7R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...