5J3YA

Crystal structure of s. pombe dcp2:dcp1 mrna decapping complex
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
126
structure length
126
Chain Sequence
PHMEDENILRNAVNLQVLKFHYPEIESIIDIASHVAVYQFDVGSQKWLKTSIEGTFFLVKDQRARVGYVILNRNSPENLYLFINHPSNVHLVDRYLIHRTENQHVVGLWMFDPNDMSRIFNIVKES
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords mRNA-decapping enzyme subunit 1
publication title Structure of the Dcp2-Dcp1 mRNA-decapping complex in the activated conformation.
pubmed doi rcsb
source organism Schizosaccharomyces pombe (strain 972 / atcc 24843)
total genus 32
structure length 126
sequence length 126
chains with identical sequence C
ec nomenclature
pdb deposition date 2016-03-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06058 DCP1 Dcp1-like decapping family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 5j3yA00
1XKEA 1U29A 1BWNA 1AWEA 4K2OA 2N0YA 4K17A 4A6HA 2YSZA 4ZRIA 2N23A 3P7ZA 2EJ8A 5HE3A 1M7RA 2DLWA 1KI1B 2COCA 4HB2B 2HTHB 2ZPYA 2LG1A 1UPRA 3UZTA 3QWMA 2CY4A 1FAOA 2LYDA 5HE2A 2DA0A 3P6AA 1V89A 1MK7B 3KRXA 1OY2A 1WGUA 2Z0QA 5D3WA 2OTXA 3KRWA 2CODA 3HW2B 3DXDA 1XX0A 4IAPA 1P6SA 2LKOA 3HQCA 1EAZA 3D8EA 4HAUB 5C16A 4F7HA 3VOQA 5D3VA 3GYPA 4Z2MB 2H7DA 2COAA 2IFSA 2D2QA 2I5CA 1PMSA 1UNQA 3IVFA 1WJMA 1FB8A 5DHFB 2G35A 3GYOA 2RUKB 5LOPB 4NSWA 1WJ1A 1K5DB 1OQNA 2D4QA 2P0FA 2R0DA 3LJUX 5D3YA 4HDOA 2GS0A 1AQCA 1NU2A 4IFSA 3PVUA 2XQNM 4HAZB 1XCGA 3ML4A 3CIKA 3VIAA 4HB3B 1V61A 3AU5A 1GC7A 2Y8GA 3SO6A 1UNRA 1BTKA 2ELAA 1Y5OA 3TCAA 2LULA 2Y8FA 2DYNA 1J0WA 4HB0B 4DXAB 5DH9B 1X1GA 2AL6A 1I2HA 3F0WA 1DDMA 1MK9B 4KHBB 2EMTA 3KSYA 3V5WA 3DXCA 1W1DA 2FJLA 1FGYA 3FSSA 2YT1A 3ODOA 1UPQA 4CYEA 2YT0A 1Z87A 3BINA 2HE7A 2YRYA 3U8ZA 2RLOA 4GPTB 2D9ZA 5JHHA 4KHAA 1TXDA 3OANA 4B6HA 5CLLB 1I7AA 3DXEA 3G9WA 5KQ1A 4WSFA 2CRFA 5JHGA 1QQGA 2VSZA 3A8QA 3WYFB 5J3YA 3HK0A 1DROA 2I1KA 5C79A 5GOWB 5C5BB 3AJ4A 3ODXA 3PP2A 3PG7A 3SNHA 2UZRA 2UVMA 4KAXB 2RVBB 4HAVB 1Q67A 2YVCA 1XD4A 4YONA 4TKNA 4KVGB 3SV1A 4BBKA 1TJ6A 1V5MA 5C5BA 1RJ2A 1Y19B 2D10A 4XWXA 2EMSA 2OQBA 2DHKA 1P3RA 1UEFA 1ISNA 2LOXA 4C0AA 4TYZA 1WGQA 1XR0B 1ZSQA 2GJYA 1SGHA 2VKIA 4GMXB 2YS1A 1GC6A 1DDVA 5EFXA 3AU4A 3FEHA 4EKUA 1MKEA 2D9XA 2E2XA 1U5EA 2CAYA 2NMBA 2R09A 2GCJA 4H8SA 2YF0A 1BTNA 1P5TA 5DI9B 3TO1A 4HAXB 2KUPA 1NI2A 1EF1A 1U5DA 4HAWB 1MPHA 4A6FB 1V88A 5JP4A 1KZ7A 3KZ1A 2K2UA 2LOZA 1V5PA 1X05A 1EVHA 4DX90 2D11A 3D8FA 2P0DA 5D27A 4WJ7A 1EGXA 3PEGA 5HE1A 2YS3A 3O96A 3KY9A 2BCJA 3MPXA 3A98B 2DKQA 5J3QA 3QIJA 4Z2NA 4A6FA 1MIZB 4WVFB 1K5GB 4HHVA 5HE0A 3PSCA 5JLJB 1V5UA 3T06A 2DX1A 1FOEA 4IOYX 3ZVRA 1WVHA 3NSUA 4DX8A 1U5FA 2D9VA 1GG3A 1B55A 2QKLA 2AEHA 2J0MA 2P0HA 1LB1A 4K2PA 2MKRA 3N7CA 2Y7BA 2I1JA 3U7DA 1MIXA 1NTVA 4KHOA 2Z0PA 4HAYB 4EJNA 4A6KA 1OMWA 2M38A 5DHAB 3TFMA 2DKPA 2KGXB 2M14A 1IRSA 1QC6A 4HDQA 2X18A 5J3TA 3QBVB 4DBBA 2Z0OA 5FI0A 2QKMA 4YL8A 1WI1A 1U27A 1BAKA 3ULCA 3WA0A 2MDXA 4PQ0A 2YS5A 4L6EA 3RCPA 1M7EA 2UZSA 3SYXA 1DDWA 2DX5A 4F7UP 2JP2A 3A8PA 3FM8C 1RRPB 2J59M 1W1HA 4CHMA 1X1FA 3CXBB 1PLSA 4F7GA 5D3XA 4GZUA 4P7IA 1U2BA 3SUZA 2VRWB 5FI1A 2RGNB 3PZDA 2ELBA 2DYQA 2H7EA 4HATB 2NZ8B 4HB4B 1N3HA 4MT7A 3M1IB 3PVLA 4MK0A 1U5GA 1X86A 2P8VA 2V76A 1DBHA 3MDBC 1J19A 1W1GA 4A5KA 2EC1A 1XODA 1FHOA 2I5FA 2DTCA 1ZC4B 3ZDTA 4CHJA 2J0KA 2K00A 1MAIA 4ZRKA 4EMOA 4D0NB 2RSGA 4Y94A 1X11A 4K81A 2ROVA 2CY5A 2W2WA 3TW1A 5L81A 2DHIA 2L1CA 5LONB 1ZC3B 2COFA 1NTYA 3ULBA 2J0JA 1WG7A 3ODWA 1H10A 2Q13A 3PVWA 5C6RA 2L2IA 2MWNB 2IYBA 3BJIA 4PNKA 5CLQB 2W2XD 2D9YA 2RNRB 1KZGA 1H4RA 2D9WA 5KCVA 1FHWA 1UNPA 2PZ1A 2GCLA 2W2XC 4GMVA 1DYNA 2DN6A 3D8DA 3F5RA 5KQ4A 2K2JA 2DHJA 4MY6A 1PFJA 4ZRJA 1FGZA 1LW3A 2DFKA 2ROZB 4GN1A 3TVVA 5DIFB 1ZM0A 1E5WA 2MFQA 3X23A 1TQZA 2ADZA 1ZVRA 4NY0A 2KCJA 1FHXA 4GXBA 1SHCA
chains in the Genus database with same CATH superfamily
1XKEA 2FJUB 2YT2A 1U29A 1BWNA 3FVCA 1AWEA 4K2OA 2N0YA 4K17A 4A6HA 2YSZA 4ZRIA 2N23A 3P7ZA 2EJ8A 5HE3A 1M7RA 2DLWA 4QJ3B 1KI1B 2COCA 4HB2B 2HTHB 2ZPYA 2LG1A 1UPRA 3UZTA 3QWMA 2CY4A 1FAOA 2LYDA 5HE2A 2DA0A 3P6AA 1V89A 1MK7B 3KRXA 3NWFA 1OY2A 1WGUA 2Z0QA 5D3WA 2OTXA 3KRWA 2CODA 3HW2B 3DXDA 1XX0A 4IAPA 2Z4DA 1P6SA 2LKOA 3HQCA 2Z14A 1EAZA 3D8EA 4HAUB 5C16A 4F7HA 3VOQA 5D3VA 3GYPA 4Z2MB 2H7DA 2COAA 2IFSA 2D2QA 2I5CA 1PMSA 1UNQA 3IVFA 1WJMA 1FB8A 5DHFB 2G35A 3GYOA 2RUKB 5LOPB 4NSWA 2NBVA 1WJ1A 4QJ4B 1K5DB 1OQNA 2D4QA 2P0FA 2R0DA 3LJUX 5D3YA 4HDOA 2GS0A 1AQCA 1NU2A 4IFSA 3PVUA 2XQNM 4HAZB 1XCGA 3ML4A 3CIKA 3VIAA 4HB3B 1V61A 3AU5A 1GC7A 2Y8GA 3SO6A 1UNRA 1BTKA 2ELAA 1Y5OA 3TCAA 2LULA 2Y8FA 2DYNA 1J0WA 4HB0B 4DXAB 5DH9B 1X1GA 2AL6A 1I2HA 3F0WA 1DDMA 1MK9B 4KHBB 2EMTA 3KSYA 3V5WA 3DXCA 1W1DA 2FJLA 1FGYA 3FSSA 2YT1A 3ODOA 1UPQA 2KUQA 4CYEA 2YT0A 1Z87A 3BINA 2HE7A 2YRYA 3U8ZA 2RLOA 4GPTB 2D9ZA 5JHHA 4KHAA 1TXDA 3OANA 4B6HA 5CLLB 1I7AA 3DXEA 3G9WA 4KHBA 5KQ1A 4WSFA 2CRFA 4OT1A 5JHGA 1QQGA 2Z59A 2VSZA 3A8QA 3WYFB 5J3YA 3HK0A 1DROA 2I1KA 5C79A 5GOWB 5C5BB 3AJ4A 3ODXA 3PP2A 3PG7A 3SNHA 2UZRA 2UVMA 4KAXB 2RVBB 4HAVB 1Q67A 2GUMA 2YVCA 1XD4A 4HSIA 2KIGA 4YONA 4TKNA 4KVGB 3SV1A 4BBKA 1TJ6A 1V5MA 5C5BA 1RJ2A 1Y19B 2D10A 4XWXA 2EMSA 2OQBA 4QJ5B 2DHKA 1P3RA 1UEFA 1ISNA 2LOXA 4C0AA 4TYZA 1WGQA 5M4YB 1XR0B 1ZSQA 2GJYA 1SGHA 2VKIA 4GMXB 2YS1A 1GC6A 1DDVA 5EFXA 3AU4A 3FEHA 4EKUA 1MKEA 2D9XA 2Z13A 3HSAA 4L1RA 2E2XA 1U5EA 2CAYA 2NMBA 2R09A 2GCJA 4H8SA 2YF0A 1BTNA 1P5TA 5DI9B 3TO1A 4HAXB 2KUPA 1NI2A 1EF1A 5LG4B 1U5DA 4HAWB 1MPHA 4A6FB 1V88A 5JP4A 1KZ7A 3KZ1A 2K2UA 2LOZA 1V5PA 1X05A 1EVHA 4DX90 2D11A 3D8FA 2P0DA 4QXAB 5D27A 4WJ7A 1EGXA 3PEGA 1T77A 5HE1A 2YS3A 3O96A 3KY9A 2BCJA 3MPXA 3A98B 2DKQA 5J3QA 3QIJA 4Z2NA 4A6FA 1MIZB 4WVFB 1K5GB 5I2SA 4HHVA 5HE0A 3PSCA 4CSQA 5JLJB 1V5UA 1MI1A 3T06A 2RRFA 2DX1A 1FOEA 4GNKB 4IOYX 3ZVRA 1WVHA 3B77A 3NSUA 4DX8A 1U5FA 2D9VA 1GG3A 1B55A 2QKLA 2AEHA 2J0MA 2P0HA 1LB1A 4K2PA 2MKRA 3N7CA 2Y7BA 2I1JA 3U7DA 1MIXA 1NTVA 2KR0A 4KHOA 2Z0PA 4HAYB 4EJNA 4A6KA 1OMWA 2M38A 5DHAB 3TFMA 2DKPA 2KGXB 2M14A 1IRSA 1QC6A 4HDQA 2X18A 3NWDA 5J3TA 3QBVB 4DBBA 3HIEA 2Z0OA 5FI0A 2QKMA 4YL8A 1WI1A 1U27A 1BAKA 3ULCA 3WA0A 2MDXA 4PQ0A 2YS5A 4L6EA 3RCPA 1M7EA 2UZSA 3SYXA 1DDWA 2DX5A 4F7UP 2JP2A 3A8PA 3FM8C 1RRPB 2J59M 1W1HA 4CHMA 1X1FA 3CXBB 1PLSA 4F7GA 3A58A 5D3XA 4GZUA 4P7IA 1U2BA 3SUZA 2VRWB 5FI1A 2RGNB 3PZDA 2ELBA 2DYQA 2H7EA 3OHMB 2NZ8B 4HATB 1N3HA 4HB4B 4MT7A 3M1IB 2KIEA 3PVLA 4MK0A 1U5GA 1X86A 2P8VA 2V76A 1DBHA 3MDBC 1J19A 2R2YA 1W1GA 4A5KA 5I2MA 2EC1A 1XODA 1FHOA 2I5FA 3DCXA 2DTCA 1ZC4B 3ZDTA 4CHJA 2J0KA 2K00A 1MAIA 4ZRKA 4EMOA 3U12A 4D0NB 2RSGA 4Y94A 1X11A 4K81A 2ROVA 2CY5A 2W2WA 3TW1A 4DIXA 5L81A 2DHIA 2L1CA 5LONB 1ZC3B 2COFA 1NTYA 3ULBA 2J0JA 1WG7A 4D6WA 4GOUA 3ODWA 1H10A 2Q13A 3PVWA 5C6RA 2L2IA 2MWNB 2IYBA 3BJIA 4PNKA 5CLQB 2K8EA 2W2XD 5IRSA 2D9YA 2RNRB 1KZGA 1H4RA 2D9WA 5KCVA 1FHWA 1UNPA 2K49A 3NWAA 2PZ1A 2GCLA 2W2XC 4GMVA 1DYNA 4OSNA 2DN6A 3D8DA 3F5RA 5KQ4A 2K2JA 2DHJA 4MY6A 1PFJA 4ZRJA 2ZKMX 1FGZA 3NW8A 1LW3A 2DFKA 2ROZB 4GN1A 3TVVA 5DIFB 1ZM0A 1E5WA 2MFQA 3X23A 1TQZA 2ADZA 1ZVRA 4NY0A 2KCJA 1FHXA 4GXBA 1ZYIA 1SHCA
chains in the Genus database with same CATH topology
1XKEA 1U29A 1BWNA 1AWEA 4K2OA 2N0YA 4K17A 4A6HA 2YSZA 4ZRIA 2N23A 3P7ZA 2EJ8A 5HE3A 1M7RA 2DLWA 1KI1B 2COCA 4HB2B 2HTHB 2ZPYA 2LG1A 1UPRA 3UZTA 3QWMA 2CY4A 1FAOA 2LYDA 5HE2A 2DA0A 3P6AA 1V89A 1MK7B 3KRXA 1OY2A 1WGUA 2Z0QA 5D3WA 2OTXA 3KRWA 2CODA 3HW2B 3DXDA 1XX0A 4IAPA 1P6SA 2LKOA 3HQCA 1EAZA 3D8EA 4HAUB 5C16A 4F7HA 3VOQA 5D3VA 3GYPA 4Z2MB 2H7DA 2COAA 2IFSA 2D2QA 2I5CA 1PMSA 1UNQA 3IVFA 1WJMA 1FB8A 5DHFB 2G35A 3GYOA 2RUKB 5LOPB 4NSWA 1WJ1A 1K5DB 1OQNA 2D4QA 2P0FA 2R0DA 3LJUX 5D3YA 4HDOA 2GS0A 1AQCA 1NU2A 4IFSA 3PVUA 2XQNM 4HAZB 1XCGA 3ML4A 3CIKA 3VIAA 4HB3B 1V61A 3AU5A 1GC7A 2Y8GA 3SO6A 1UNRA 1BTKA 2ELAA 1Y5OA 3TCAA 2LULA 2Y8FA 2DYNA 1J0WA 4HB0B 4DXAB 5DH9B 1X1GA 2AL6A 1I2HA 3F0WA 1DDMA 1MK9B 4KHBB 2EMTA 3KSYA 3V5WA 3DXCA 1W1DA 2FJLA 1FGYA 3FSSA 2YT1A 3ODOA 1UPQA 4CYEA 2YT0A 1Z87A 3BINA 2HE7A 2YRYA 3U8ZA 2RLOA 4GPTB 2D9ZA 5JHHA 4KHAA 1TXDA 3OANA 4B6HA 5CLLB 1I7AA 3DXEA 3G9WA 5KQ1A 4WSFA 2CRFA 5JHGA 1QQGA 2VSZA 3A8QA 3WYFB 5J3YA 3HK0A 1DROA 2I1KA 5C79A 5GOWB 5C5BB 3AJ4A 3ODXA 3PP2A 3PG7A 3SNHA 2UZRA 2UVMA 4KAXB 2RVBB 4HAVB 1Q67A 2YVCA 1XD4A 4YONA 4TKNA 4KVGB 3SV1A 4BBKA 1TJ6A 1V5MA 5C5BA 1RJ2A 1Y19B 2D10A 4XWXA 2EMSA 2OQBA 2DHKA 1P3RA 1UEFA 1ISNA 2LOXA 4C0AA 4TYZA 1WGQA 1XR0B 1ZSQA 2GJYA 1SGHA 2VKIA 4GMXB 2YS1A 1GC6A 1DDVA 5EFXA 3AU4A 3FEHA 4EKUA 1MKEA 2D9XA 2E2XA 1U5EA 2CAYA 2NMBA 2R09A 2GCJA 4H8SA 2YF0A 1BTNA 1P5TA 5DI9B 3TO1A 4HAXB 2KUPA 1NI2A 1EF1A 1U5DA 4HAWB 1MPHA 4A6FB 1V88A 5JP4A 1KZ7A 3KZ1A 2K2UA 2LOZA 1V5PA 1X05A 1EVHA 4DX90 2D11A 3D8FA 2P0DA 5D27A 4WJ7A 1EGXA 3PEGA 5HE1A 2YS3A 3O96A 3KY9A 2BCJA 3MPXA 3A98B 2DKQA 5J3QA 3QIJA 4Z2NA 4A6FA 1MIZB 4WVFB 1K5GB 4HHVA 5HE0A 3PSCA 5JLJB 1V5UA 3T06A 2DX1A 1FOEA 4IOYX 3ZVRA 1WVHA 3NSUA 4DX8A 1U5FA 2D9VA 1GG3A 1B55A 2QKLA 2AEHA 2J0MA 2P0HA 1LB1A 4K2PA 2MKRA 3N7CA 2Y7BA 2I1JA 3U7DA 1MIXA 1NTVA 4KHOA 2Z0PA 4HAYB 4EJNA 4A6KA 1OMWA 2M38A 5DHAB 3TFMA 2DKPA 2KGXB 2M14A 1IRSA 1QC6A 4HDQA 2X18A 5J3TA 3QBVB 4DBBA 2Z0OA 5FI0A 2QKMA 4YL8A 1WI1A 1U27A 1BAKA 3ULCA 3WA0A 2MDXA 4PQ0A 2YS5A 4L6EA 3RCPA 1M7EA 2UZSA 3SYXA 1DDWA 2DX5A 4F7UP 2JP2A 3A8PA 3FM8C 1RRPB 2J59M 1W1HA 4CHMA 1X1FA 3CXBB 1PLSA 4F7GA 5D3XA 4GZUA 4P7IA 1U2BA 3SUZA 2VRWB 5FI1A 2RGNB 3PZDA 2ELBA 2DYQA 2H7EA 4HATB 2NZ8B 4HB4B 1N3HA 4MT7A 3M1IB 3PVLA 4MK0A 1U5GA 1X86A 2P8VA 2V76A 1DBHA 3MDBC 1J19A 1W1GA 4A5KA 2EC1A 1XODA 1FHOA 2I5FA 2DTCA 1ZC4B 3ZDTA 4CHJA 2J0KA 2K00A 1MAIA 4ZRKA 4EMOA 4D0NB 2RSGA 4Y94A 1X11A 4K81A 2ROVA 2CY5A 2W2WA 3TW1A 5L81A 2DHIA 2L1CA 5LONB 1ZC3B 2COFA 1NTYA 3ULBA 2J0JA 1WG7A 3ODWA 1H10A 2Q13A 3PVWA 5C6RA 2L2IA 2MWNB 2IYBA 3BJIA 4PNKA 5CLQB 2W2XD 2D9YA 2RNRB 1KZGA 1H4RA 2D9WA 5KCVA 1FHWA 1UNPA 2PZ1A 2GCLA 2W2XC 4GMVA 1DYNA 2DN6A 3D8DA 3F5RA 5KQ4A 2K2JA 2DHJA 4MY6A 1PFJA 4ZRJA 1FGZA 1LW3A 2DFKA 2ROZB 4GN1A 3TVVA 5DIFB 1ZM0A 1E5WA 2MFQA 3X23A 1TQZA 2ADZA 1ZVRA 4NY0A 2KCJA 1FHXA 4GXBA 1SHCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XKE A;  1U29 A;  1BWN A;  1AWE A;  4K2O A;  2N0Y A;  4K17 A;  4A6H A;  2YSZ A;  4ZRI A;  2N23 A;  3P7Z A;  2EJ8 A;  5HE3 A;  1M7R A;  2DLW A;  1KI1 B;  2COC A;  4HB2 B;  2HTH B;  2ZPY A;  2LG1 A;  1UPR A;  3UZT A;  3QWM A;  2CY4 A;  1FAO A;  2LYD A;  5HE2 A;  2DA0 A;  3P6A A;  1V89 A;  1MK7 B;  3KRX A;  1OY2 A;  1WGU A;  2Z0Q A;  5D3W A;  2OTX A;  3KRW A;  2COD A;  3HW2 B;  3DXD A;  1XX0 A;  4IAP A;  1P6S A;  2LKO A;  3HQC A;  1EAZ A;  3D8E A;  4HAU B;  5C16 A;  4F7H A;  3VOQ A;  5D3V A;  3GYP A;  4Z2M B;  2H7D A;  2COA A;  2IFS A;  2D2Q A;  2I5C A;  1PMS A;  1UNQ A;  3IVF A;  1WJM A;  1FB8 A;  5DHF B;  2G35 A;  3GYO A;  2RUK B;  5LOP B;  4NSW A;  1WJ1 A;  1K5D B;  1OQN A;  2D4Q A;  2P0F A;  2R0D A;  3LJU X;  5D3Y A;  4HDO A;  2GS0 A;  1AQC A;  1NU2 A;  4IFS A;  3PVU A;  2XQN M;  4HAZ B;  1XCG A;  3ML4 A;  3CIK A;  3VIA A;  4HB3 B;  1V61 A;  3AU5 A;  1GC7 A;  2Y8G A;  3SO6 A;  1UNR A;  1BTK A;  2ELA A;  1Y5O A;  3TCA A;  2LUL A;  2Y8F A;  2DYN A;  1J0W A;  4HB0 B;  4DXA B;  5DH9 B;  1X1G A;  2AL6 A;  1I2H A;  3F0W A;  1DDM A;  1MK9 B;  4KHB B;  2EMT A;  3KSY A;  3V5W A;  3DXC A;  1W1D A;  2FJL A;  1FGY A;  3FSS A;  2YT1 A;  3ODO A;  1UPQ A;  4CYE A;  2YT0 A;  1Z87 A;  3BIN A;  2HE7 A;  2YRY A;  3U8Z A;  2RLO A;  4GPT B;  2D9Z A;  5JHH A;  4KHA A;  1TXD A;  3OAN A;  4B6H A;  5CLL B;  1I7A A;  3DXE A;  3G9W A;  5KQ1 A;  4WSF A;  2CRF A;  5JHG A;  1QQG A;  2VSZ A;  3A8Q A;  3WYF B;  5J3Y A;  3HK0 A;  1DRO A;  2I1K A;  5C79 A;  5GOW B;  5C5B B;  3AJ4 A;  3ODX A;  3PP2 A;  3PG7 A;  3SNH A;  2UZR A;  2UVM A;  4KAX B;  2RVB B;  4HAV B;  1Q67 A;  2YVC A;  1XD4 A;  4YON A;  4TKN A;  4KVG B;  3SV1 A;  4BBK A;  1TJ6 A;  1V5M A;  5C5B A;  1RJ2 A;  1Y19 B;  2D10 A;  4XWX A;  2EMS A;  2OQB A;  2DHK A;  1P3R A;  1UEF A;  1ISN A;  2LOX A;  4C0A A;  4TYZ A;  1WGQ A;  1XR0 B;  1ZSQ A;  2GJY A;  1SGH A;  2VKI A;  4GMX B;  2YS1 A;  1GC6 A;  1DDV A;  5EFX A;  3AU4 A;  3FEH A;  4EKU A;  1MKE A;  2D9X A;  2E2X A;  1U5E A;  2CAY A;  2NMB A;  2R09 A;  2GCJ A;  4H8S A;  2YF0 A;  1BTN A;  1P5T A;  5DI9 B;  3TO1 A;  4HAX B;  2KUP A;  1NI2 A;  1EF1 A;  1U5D A;  4HAW B;  1MPH A;  4A6F B;  1V88 A;  5JP4 A;  1KZ7 A;  3KZ1 A;  2K2U A;  2LOZ A;  1V5P A;  1X05 A;  1EVH A;  4DX9 0;  2D11 A;  3D8F A;  2P0D A;  5D27 A;  4WJ7 A;  1EGX A;  3PEG A;  5HE1 A;  2YS3 A;  3O96 A;  3KY9 A;  2BCJ A;  3MPX A;  3A98 B;  2DKQ A;  5J3Q A;  3QIJ A;  4Z2N A;  4A6F A;  1MIZ B;  4WVF B;  1K5G B;  4HHV A;  5HE0 A;  3PSC A;  5JLJ B;  1V5U A;  3T06 A;  2DX1 A;  1FOE A;  4IOY X;  3ZVR A;  1WVH A;  3NSU A;  4DX8 A;  1U5F A;  2D9V A;  1GG3 A;  1B55 A;  2QKL A;  2AEH A;  2J0M A;  2P0H A;  1LB1 A;  4K2P A;  2MKR A;  3N7C A;  2Y7B A;  2I1J A;  3U7D A;  1MIX A;  1NTV A;  4KHO A;  2Z0P A;  4HAY B;  4EJN A;  4A6K A;  1OMW A;  2M38 A;  5DHA B;  3TFM A;  2DKP A;  2KGX B;  2M14 A;  1IRS A;  1QC6 A;  4HDQ A;  2X18 A;  5J3T A;  3QBV B;  4DBB A;  2Z0O A;  5FI0 A;  2QKM A;  4YL8 A;  1WI1 A;  1U27 A;  1BAK A;  3ULC A;  3WA0 A;  2MDX A;  4PQ0 A;  2YS5 A;  4L6E A;  3RCP A;  1M7E A;  2UZS A;  3SYX A;  1DDW A;  2DX5 A;  4F7U P;  2JP2 A;  3A8P A;  3FM8 C;  1RRP B;  2J59 M;  1W1H A;  4CHM A;  1X1F A;  3CXB B;  1PLS A;  4F7G A;  5D3X A;  4GZU A;  4P7I A;  1U2B A;  3SUZ A;  2VRW B;  5FI1 A;  2RGN B;  3PZD A;  2ELB A;  2DYQ A;  2H7E A;  4HAT B;  2NZ8 B;  4HB4 B;  1N3H A;  4MT7 A;  3M1I B;  3PVL A;  4MK0 A;  1U5G A;  1X86 A;  2P8V A;  2V76 A;  1DBH A;  3MDB C;  1J19 A;  1W1G A;  4A5K A;  2EC1 A;  1XOD A;  1FHO A;  2I5F A;  2DTC A;  1ZC4 B;  3ZDT A;  4CHJ A;  2J0K A;  2K00 A;  1MAI A;  4ZRK A;  4EMO A;  4D0N B;  2RSG A;  4Y94 A;  1X11 A;  4K81 A;  2ROV A;  2CY5 A;  2W2W A;  3TW1 A;  5L81 A;  2DHI A;  2L1C A;  5LON B;  1ZC3 B;  2COF A;  1NTY A;  3ULB A;  2J0J A;  1WG7 A;  3ODW A;  1H10 A;  2Q13 A;  3PVW A;  5C6R A;  2L2I A;  2MWN B;  2IYB A;  3BJI A;  4PNK A;  5CLQ B;  2W2X D;  2D9Y A;  2RNR B;  1KZG A;  1H4R A;  2D9W A;  5KCV A;  1FHW A;  1UNP A;  2PZ1 A;  2GCL A;  2W2X C;  4GMV A;  1DYN A;  2DN6 A;  3D8D A;  3F5R A;  5KQ4 A;  2K2J A;  2DHJ A;  4MY6 A;  1PFJ A;  4ZRJ A;  1FGZ A;  1LW3 A;  2DFK A;  2ROZ B;  4GN1 A;  3TVV A;  5DIF B;  1ZM0 A;  1E5W A;  2MFQ A;  3X23 A;  1TQZ A;  2ADZ A;  1ZVR A;  4NY0 A;  2KCJ A;  1FHX A;  4GXB A;  1SHC A; 
#chains in the Genus database with same CATH topology
 1XKE A;  2FJU B;  2YT2 A;  1U29 A;  1BWN A;  3FVC A;  1AWE A;  4K2O A;  2N0Y A;  4K17 A;  4A6H A;  2YSZ A;  4ZRI A;  2N23 A;  3P7Z A;  2EJ8 A;  5HE3 A;  1M7R A;  2DLW A;  4QJ3 B;  1KI1 B;  2COC A;  4HB2 B;  2HTH B;  2ZPY A;  2LG1 A;  1UPR A;  3UZT A;  3QWM A;  2CY4 A;  1FAO A;  2LYD A;  5HE2 A;  2DA0 A;  3P6A A;  1V89 A;  1MK7 B;  3KRX A;  3NWF A;  1OY2 A;  1WGU A;  2Z0Q A;  5D3W A;  2OTX A;  3KRW A;  2COD A;  3HW2 B;  3DXD A;  1XX0 A;  4IAP A;  2Z4D A;  1P6S A;  2LKO A;  3HQC A;  2Z14 A;  1EAZ A;  3D8E A;  4HAU B;  5C16 A;  4F7H A;  3VOQ A;  5D3V A;  3GYP A;  4Z2M B;  2H7D A;  2COA A;  2IFS A;  2D2Q A;  2I5C A;  1PMS A;  1UNQ A;  3IVF A;  1WJM A;  1FB8 A;  5DHF B;  2G35 A;  3GYO A;  2RUK B;  5LOP B;  4NSW A;  2NBV A;  1WJ1 A;  4QJ4 B;  1K5D B;  1OQN A;  2D4Q A;  2P0F A;  2R0D A;  3LJU X;  5D3Y A;  4HDO A;  2GS0 A;  1AQC A;  1NU2 A;  4IFS A;  3PVU A;  2XQN M;  4HAZ B;  1XCG A;  3ML4 A;  3CIK A;  3VIA A;  4HB3 B;  1V61 A;  3AU5 A;  1GC7 A;  2Y8G A;  3SO6 A;  1UNR A;  1BTK A;  2ELA A;  1Y5O A;  3TCA A;  2LUL A;  2Y8F A;  2DYN A;  1J0W A;  4HB0 B;  4DXA B;  5DH9 B;  1X1G A;  2AL6 A;  1I2H A;  3F0W A;  1DDM A;  1MK9 B;  4KHB B;  2EMT A;  3KSY A;  3V5W A;  3DXC A;  1W1D A;  2FJL A;  1FGY A;  3FSS A;  2YT1 A;  3ODO A;  1UPQ A;  2KUQ A;  4CYE A;  2YT0 A;  1Z87 A;  3BIN A;  2HE7 A;  2YRY A;  3U8Z A;  2RLO A;  4GPT B;  2D9Z A;  5JHH A;  4KHA A;  1TXD A;  3OAN A;  4B6H A;  5CLL B;  1I7A A;  3DXE A;  3G9W A;  4KHB A;  5KQ1 A;  4WSF A;  2CRF A;  4OT1 A;  5JHG A;  1QQG A;  2Z59 A;  2VSZ A;  3A8Q A;  3WYF B;  5J3Y A;  3HK0 A;  1DRO A;  2I1K A;  5C79 A;  5GOW B;  5C5B B;  3AJ4 A;  3ODX A;  3PP2 A;  3PG7 A;  3SNH A;  2UZR A;  2UVM A;  4KAX B;  2RVB B;  4HAV B;  1Q67 A;  2GUM A;  2YVC A;  1XD4 A;  4HSI A;  2KIG A;  4YON A;  4TKN A;  4KVG B;  3SV1 A;  4BBK A;  1TJ6 A;  1V5M A;  5C5B A;  1RJ2 A;  1Y19 B;  2D10 A;  4XWX A;  2EMS A;  2OQB A;  4QJ5 B;  2DHK A;  1P3R A;  1UEF A;  1ISN A;  2LOX A;  4C0A A;  4TYZ A;  1WGQ A;  5M4Y B;  1XR0 B;  1ZSQ A;  2GJY A;  1SGH A;  2VKI A;  4GMX B;  2YS1 A;  1GC6 A;  1DDV A;  5EFX A;  3AU4 A;  3FEH A;  4EKU A;  1MKE A;  2D9X A;  2Z13 A;  3HSA A;  4L1R A;  2E2X A;  1U5E A;  2CAY A;  2NMB A;  2R09 A;  2GCJ A;  4H8S A;  2YF0 A;  1BTN A;  1P5T A;  5DI9 B;  3TO1 A;  4HAX B;  2KUP A;  1NI2 A;  1EF1 A;  5LG4 B;  1U5D A;  4HAW B;  1MPH A;  4A6F B;  1V88 A;  5JP4 A;  1KZ7 A;  3KZ1 A;  2K2U A;  2LOZ A;  1V5P A;  1X05 A;  1EVH A;  4DX9 0;  2D11 A;  3D8F A;  2P0D A;  4QXA B;  5D27 A;  4WJ7 A;  1EGX A;  3PEG A;  1T77 A;  5HE1 A;  2YS3 A;  3O96 A;  3KY9 A;  2BCJ A;  3MPX A;  3A98 B;  2DKQ A;  5J3Q A;  3QIJ A;  4Z2N A;  4A6F A;  1MIZ B;  4WVF B;  1K5G B;  5I2S A;  4HHV A;  5HE0 A;  3PSC A;  4CSQ A;  5JLJ B;  1V5U A;  1MI1 A;  3T06 A;  2RRF A;  2DX1 A;  1FOE A;  4GNK B;  4IOY X;  3ZVR A;  1WVH A;  3B77 A;  3NSU A;  4DX8 A;  1U5F A;  2D9V A;  1GG3 A;  1B55 A;  2QKL A;  2AEH A;  2J0M A;  2P0H A;  1LB1 A;  4K2P A;  2MKR A;  3N7C A;  2Y7B A;  2I1J A;  3U7D A;  1MIX A;  1NTV A;  2KR0 A;  4KHO A;  2Z0P A;  4HAY B;  4EJN A;  4A6K A;  1OMW A;  2M38 A;  5DHA B;  3TFM A;  2DKP A;  2KGX B;  2M14 A;  1IRS A;  1QC6 A;  4HDQ A;  2X18 A;  3NWD A;  5J3T A;  3QBV B;  4DBB A;  3HIE A;  2Z0O A;  5FI0 A;  2QKM A;  4YL8 A;  1WI1 A;  1U27 A;  1BAK A;  3ULC A;  3WA0 A;  2MDX A;  4PQ0 A;  2YS5 A;  4L6E A;  3RCP A;  1M7E A;  2UZS A;  3SYX A;  1DDW A;  2DX5 A;  4F7U P;  2JP2 A;  3A8P A;  3FM8 C;  1RRP B;  2J59 M;  1W1H A;  4CHM A;  1X1F A;  3CXB B;  1PLS A;  4F7G A;  3A58 A;  5D3X A;  4GZU A;  4P7I A;  1U2B A;  3SUZ A;  2VRW B;  5FI1 A;  2RGN B;  3PZD A;  2ELB A;  2DYQ A;  2H7E A;  3OHM B;  2NZ8 B;  4HAT B;  1N3H A;  4HB4 B;  4MT7 A;  3M1I B;  2KIE A;  3PVL A;  4MK0 A;  1U5G A;  1X86 A;  2P8V A;  2V76 A;  1DBH A;  3MDB C;  1J19 A;  2R2Y A;  1W1G A;  4A5K A;  5I2M A;  2EC1 A;  1XOD A;  1FHO A;  2I5F A;  3DCX A;  2DTC A;  1ZC4 B;  3ZDT A;  4CHJ A;  2J0K A;  2K00 A;  1MAI A;  4ZRK A;  4EMO A;  3U12 A;  4D0N B;  2RSG A;  4Y94 A;  1X11 A;  4K81 A;  2ROV A;  2CY5 A;  2W2W A;  3TW1 A;  4DIX A;  5L81 A;  2DHI A;  2L1C A;  5LON B;  1ZC3 B;  2COF A;  1NTY A;  3ULB A;  2J0J A;  1WG7 A;  4D6W A;  4GOU A;  3ODW A;  1H10 A;  2Q13 A;  3PVW A;  5C6R A;  2L2I A;  2MWN B;  2IYB A;  3BJI A;  4PNK A;  5CLQ B;  2K8E A;  2W2X D;  5IRS A;  2D9Y A;  2RNR B;  1KZG A;  1H4R A;  2D9W A;  5KCV A;  1FHW A;  1UNP A;  2K49 A;  3NWA A;  2PZ1 A;  2GCL A;  2W2X C;  4GMV A;  1DYN A;  4OSN A;  2DN6 A;  3D8D A;  3F5R A;  5KQ4 A;  2K2J A;  2DHJ A;  4MY6 A;  1PFJ A;  4ZRJ A;  2ZKM X;  1FGZ A;  3NW8 A;  1LW3 A;  2DFK A;  2ROZ B;  4GN1 A;  3TVV A;  5DIF B;  1ZM0 A;  1E5W A;  2MFQ A;  3X23 A;  1TQZ A;  2ADZ A;  1ZVR A;  4NY0 A;  2KCJ A;  1FHX A;  4GXB A;  1ZYI A;  1SHC A; 
#chains in the Genus database with same CATH homology
 1XKE A;  1U29 A;  1BWN A;  1AWE A;  4K2O A;  2N0Y A;  4K17 A;  4A6H A;  2YSZ A;  4ZRI A;  2N23 A;  3P7Z A;  2EJ8 A;  5HE3 A;  1M7R A;  2DLW A;  1KI1 B;  2COC A;  4HB2 B;  2HTH B;  2ZPY A;  2LG1 A;  1UPR A;  3UZT A;  3QWM A;  2CY4 A;  1FAO A;  2LYD A;  5HE2 A;  2DA0 A;  3P6A A;  1V89 A;  1MK7 B;  3KRX A;  1OY2 A;  1WGU A;  2Z0Q A;  5D3W A;  2OTX A;  3KRW A;  2COD A;  3HW2 B;  3DXD A;  1XX0 A;  4IAP A;  1P6S A;  2LKO A;  3HQC A;  1EAZ A;  3D8E A;  4HAU B;  5C16 A;  4F7H A;  3VOQ A;  5D3V A;  3GYP A;  4Z2M B;  2H7D A;  2COA A;  2IFS A;  2D2Q A;  2I5C A;  1PMS A;  1UNQ A;  3IVF A;  1WJM A;  1FB8 A;  5DHF B;  2G35 A;  3GYO A;  2RUK B;  5LOP B;  4NSW A;  1WJ1 A;  1K5D B;  1OQN A;  2D4Q A;  2P0F A;  2R0D A;  3LJU X;  5D3Y A;  4HDO A;  2GS0 A;  1AQC A;  1NU2 A;  4IFS A;  3PVU A;  2XQN M;  4HAZ B;  1XCG A;  3ML4 A;  3CIK A;  3VIA A;  4HB3 B;  1V61 A;  3AU5 A;  1GC7 A;  2Y8G A;  3SO6 A;  1UNR A;  1BTK A;  2ELA A;  1Y5O A;  3TCA A;  2LUL A;  2Y8F A;  2DYN A;  1J0W A;  4HB0 B;  4DXA B;  5DH9 B;  1X1G A;  2AL6 A;  1I2H A;  3F0W A;  1DDM A;  1MK9 B;  4KHB B;  2EMT A;  3KSY A;  3V5W A;  3DXC A;  1W1D A;  2FJL A;  1FGY A;  3FSS A;  2YT1 A;  3ODO A;  1UPQ A;  4CYE A;  2YT0 A;  1Z87 A;  3BIN A;  2HE7 A;  2YRY A;  3U8Z A;  2RLO A;  4GPT B;  2D9Z A;  5JHH A;  4KHA A;  1TXD A;  3OAN A;  4B6H A;  5CLL B;  1I7A A;  3DXE A;  3G9W A;  5KQ1 A;  4WSF A;  2CRF A;  5JHG A;  1QQG A;  2VSZ A;  3A8Q A;  3WYF B;  5J3Y A;  3HK0 A;  1DRO A;  2I1K A;  5C79 A;  5GOW B;  5C5B B;  3AJ4 A;  3ODX A;  3PP2 A;  3PG7 A;  3SNH A;  2UZR A;  2UVM A;  4KAX B;  2RVB B;  4HAV B;  1Q67 A;  2YVC A;  1XD4 A;  4YON A;  4TKN A;  4KVG B;  3SV1 A;  4BBK A;  1TJ6 A;  1V5M A;  5C5B A;  1RJ2 A;  1Y19 B;  2D10 A;  4XWX A;  2EMS A;  2OQB A;  2DHK A;  1P3R A;  1UEF A;  1ISN A;  2LOX A;  4C0A A;  4TYZ A;  1WGQ A;  1XR0 B;  1ZSQ A;  2GJY A;  1SGH A;  2VKI A;  4GMX B;  2YS1 A;  1GC6 A;  1DDV A;  5EFX A;  3AU4 A;  3FEH A;  4EKU A;  1MKE A;  2D9X A;  2E2X A;  1U5E A;  2CAY A;  2NMB A;  2R09 A;  2GCJ A;  4H8S A;  2YF0 A;  1BTN A;  1P5T A;  5DI9 B;  3TO1 A;  4HAX B;  2KUP A;  1NI2 A;  1EF1 A;  1U5D A;  4HAW B;  1MPH A;  4A6F B;  1V88 A;  5JP4 A;  1KZ7 A;  3KZ1 A;  2K2U A;  2LOZ A;  1V5P A;  1X05 A;  1EVH A;  4DX9 0;  2D11 A;  3D8F A;  2P0D A;  5D27 A;  4WJ7 A;  1EGX A;  3PEG A;  5HE1 A;  2YS3 A;  3O96 A;  3KY9 A;  2BCJ A;  3MPX A;  3A98 B;  2DKQ A;  5J3Q A;  3QIJ A;  4Z2N A;  4A6F A;  1MIZ B;  4WVF B;  1K5G B;  4HHV A;  5HE0 A;  3PSC A;  5JLJ B;  1V5U A;  3T06 A;  2DX1 A;  1FOE A;  4IOY X;  3ZVR A;  1WVH A;  3NSU A;  4DX8 A;  1U5F A;  2D9V A;  1GG3 A;  1B55 A;  2QKL A;  2AEH A;  2J0M A;  2P0H A;  1LB1 A;  4K2P A;  2MKR A;  3N7C A;  2Y7B A;  2I1J A;  3U7D A;  1MIX A;  1NTV A;  4KHO A;  2Z0P A;  4HAY B;  4EJN A;  4A6K A;  1OMW A;  2M38 A;  5DHA B;  3TFM A;  2DKP A;  2KGX B;  2M14 A;  1IRS A;  1QC6 A;  4HDQ A;  2X18 A;  5J3T A;  3QBV B;  4DBB A;  2Z0O A;  5FI0 A;  2QKM A;  4YL8 A;  1WI1 A;  1U27 A;  1BAK A;  3ULC A;  3WA0 A;  2MDX A;  4PQ0 A;  2YS5 A;  4L6E A;  3RCP A;  1M7E A;  2UZS A;  3SYX A;  1DDW A;  2DX5 A;  4F7U P;  2JP2 A;  3A8P A;  3FM8 C;  1RRP B;  2J59 M;  1W1H A;  4CHM A;  1X1F A;  3CXB B;  1PLS A;  4F7G A;  5D3X A;  4GZU A;  4P7I A;  1U2B A;  3SUZ A;  2VRW B;  5FI1 A;  2RGN B;  3PZD A;  2ELB A;  2DYQ A;  2H7E A;  4HAT B;  2NZ8 B;  4HB4 B;  1N3H A;  4MT7 A;  3M1I B;  3PVL A;  4MK0 A;  1U5G A;  1X86 A;  2P8V A;  2V76 A;  1DBH A;  3MDB C;  1J19 A;  1W1G A;  4A5K A;  2EC1 A;  1XOD A;  1FHO A;  2I5F A;  2DTC A;  1ZC4 B;  3ZDT A;  4CHJ A;  2J0K A;  2K00 A;  1MAI A;  4ZRK A;  4EMO A;  4D0N B;  2RSG A;  4Y94 A;  1X11 A;  4K81 A;  2ROV A;  2CY5 A;  2W2W A;  3TW1 A;  5L81 A;  2DHI A;  2L1C A;  5LON B;  1ZC3 B;  2COF A;  1NTY A;  3ULB A;  2J0J A;  1WG7 A;  3ODW A;  1H10 A;  2Q13 A;  3PVW A;  5C6R A;  2L2I A;  2MWN B;  2IYB A;  3BJI A;  4PNK A;  5CLQ B;  2W2X D;  2D9Y A;  2RNR B;  1KZG A;  1H4R A;  2D9W A;  5KCV A;  1FHW A;  1UNP A;  2PZ1 A;  2GCL A;  2W2X C;  4GMV A;  1DYN A;  2DN6 A;  3D8D A;  3F5R A;  5KQ4 A;  2K2J A;  2DHJ A;  4MY6 A;  1PFJ A;  4ZRJ A;  1FGZ A;  1LW3 A;  2DFK A;  2ROZ B;  4GN1 A;  3TVV A;  5DIF B;  1ZM0 A;  1E5W A;  2MFQ A;  3X23 A;  1TQZ A;  2ADZ A;  1ZVR A;  4NY0 A;  2KCJ A;  1FHX A;  4GXB A;  1SHC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...