2ADZA

Solution structure of the joined ph domain of alpha1-syntrophin
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
178
structure length
178
Chain Sequence
ASGRRAPRTGLLELRCGAGSGAGGERWQRVLLSLAEDALTVSPADGEPGPEPEPAQLNGAAEPGAAPPQLPEALLLQREVSPYFKNSAGGTSVGWDSPPASPLQRQPSSPGPQPRNLSEAKHVSLKMAYVSRRCTPTDPEPRYLEICAADGQDAVFLRAKDEASARSWAGAIQAQIGT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Alpha-1-syntrophin
publication title Structure of the split PH domain and distinct lipid-binding properties of the PH-PDZ supramodule of alpha-syntrophin
pubmed doi rcsb
source organism Mus musculus
molecule tags Protein binding
total genus 11
structure length 178
sequence length 178
ec nomenclature
pdb deposition date 2005-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18012 PH_17 PH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2adzA01
2K00A 1DROA 1KZGA 5DH9B 4Y94A 2EC1A 2D9ZA 4DX8A 4NSWA 2J0JA 2GJYA 2GCJA 2COFA 5FI1A 2P0DA 4EJNA 2I1KA 1ZSQA 2LG1A 4GPTB 1UEFA 1EGXA 2CY4A 4Z2NA 3U8ZA 5HE1A 4A6FA 4HB2B 3VOQA 3D8DA 2EMSA 3ULCA 4HHVA 3ODWA 3AU5A 3NSUA 2J59M 2Z0OA 3RCPA 2KCJA 1XD4A 3PVUA 4K2PA 2LULA 1U5FA 3HK0A 1U5GA 2RGNB 2QKLA 2DA0A 3TCAA 4YONA 3PG7A 5D3XA 1U5EA 1V5UA 2DHKA 1NTVA 5DIFB 4A5KA 4IFSA 5LONB 4Z2MB 3MDBC 1UPQA 4EKUA 4PQ0A 2RVBB 4WSFA 2YSZA 3PSCA 1FHWA 2KGXB 2Y7BA 5HE2A 5C79A 1P5TA 1WGQA 3SNHA 4HAWB 3ODOA 2YS5A 3SV1A 2N0YA 1UNPA 4WJ7A 1DDMA 5J3TA 4KHOA 1Y19B 1BTKA 1XODA 4L6EA 2FJLA 1W1HA 1SHCA 3PVWA 2CY5A 2NMBA 3CIKA 4ZRIA 3F0WA 2L2IA 5J3QA 3P6AA 3KRXA 2Y8GA 2DHJA 4IAPA 1BTNA 2Q13A 1AQCA 1NI2A 1X86A 3PEGA 3BJIA 2DX5A 4A6KA 2D4QA 2CAYA 2I1JA 2IYBA 3N7CA 4KHBB 2JP2A 4GXBA 2YT0A 1V89A 5J3YA 5L81A 1Q67A 2HE7A 2D9WA 3TW1A 4KVGB 3TFMA 1DYNA 2YVCA 2MKRA 1OMWA 2ZPYA 2DYQA 3AU4A 2R0DA 3IVFA 1X1GA 1GG3A 4HAUB 1UNQA 5D3YA 4HDOA 1OQNA 2N23A 3TO1A 4P7IA 5KQ4A 2L1CA 2DKQA 1PMSA 4DXAB 2ADZA 1TJ6A 2DKPA 3O96A 2COAA 2IFSA 2D2QA 3FSSA 3OANA 1DBHA 2XQNM 5DI9B 1NTYA 3A8PA 1ISNA 1KI1B 2DLWA 4MK0A 2LKOA 1TXDA 5JP4A 1TQZA 3DXCA 5HE3A 4CHJA 4GMXB 1U27A 2ROZB 4HAZB 1V61A 2H7EA 3WA0A 1K5DB 3SUZA 1QQGA 1M7EA 2YRYA 3A8QA 2RNRB 1XR0B 1ZVRA 2Y8FA 4KHAA 2OQBA 2YF0A 2VRWB 4F7HA 2DFKA 1XKEA 2J0MA 3GYOA 3D8FA 1E5WA 3A98B 3D8EA 4WVFB 1H4RA 5GOWB 2LYDA 2EMTA 1P3RA 4GMVA 4A6FB 1BWNA 2D9VA 4CHMA 1B55A 4YL8A 4ZRJA 2P8VA 1PLSA 1NU2A 2I5FA 1BAKA 2AL6A 5JHGA 2X18A 4F7GA 1MKEA 2GS0A 1GC7A 5D3VA 2CODA 1X11A 4HATB 1XX0A 3G9WA 1PFJA 2LOZA 5JHHA 2UZSA 1FHXA 2V76A 1FGZA 2HTHB 3M1IB 3PZDA 2GCLA 3KZ1A 5C5BA 1I2HA 1LB1A 1IRSA 4F7UP 4TKNA 2D10A 4PNKA 4GN1A 3V5WA 1W1DA 2DN6A 4B6HA 4MY6A 1KZ7A 2OTXA 2R09A 2RLOA 3ML4A 1W1GA 2W2XC 1K5GB 3SYXA 3LJUX 4D0NB 3GYPA 2Z0PA 3PVLA 4HAVB 1DDVA 2KUPA 4IOYX 4DX90 1AWEA 1FAOA 1ZC4B 4TYZA 3P7ZA 1X05A 3ODXA 1J0WA 1N3HA 3PP2A 1J19A 5KCVA 3QBVB 1WJ1A 2G35A 1FOEA 2CRFA 3SO6A 1LW3A 2D9YA 5KQ1A 1X1FA 1Y5OA 1MAIA 1MIXA 3CXBB 4HB0B 3HW2B 4XWXA 2NZ8B 2EJ8A 2VSZA 1EVHA 4CYEA 2DHIA 4KAXB 5C6RA 2YT1A 3UZTA 4H8SA 2I5CA 1WGUA 1V88A 3HQCA 5LOPB 1EF1A 2W2WA 3MPXA 4HB3B 3AJ4A 4HB4B 4HAYB 1QC6A 4HAXB 1FHOA 3BINA 1WG7A 2MFQA 2MDXA 1U2BA 1FB8A 1OY2A 3KRWA 4MT7A 3QIJA 1GC6A 1ZC3B 4HDQA 1V5PA 3TVVA 3ZDTA 3F5RA 3FEHA 1RRPB 1Z87A 5CLQB 1MPHA 5D27A 5DHAB 3U7DA 1MIZB 4BBKA 3DXEA 2M38A 1ZM0A 2VKIA 1UPRA 2AEHA 2H7DA 2LOXA 3KSYA 2ELBA 1WJMA 4K17A 2DX1A 4ZRKA 1SGHA 3X23A 1U29A 3VIAA 2MWNB 1EAZA 1MK7B 2DTCA 3QWMA 2PZ1A 4NY0A 4K81A 5EFXA 3ULBA 3ZVRA 3FM8C 2D9XA 2Z0QA 4K2OA 4C0AA 3KY9A 2DYNA 5HE0A 2E2XA 2W2XD 4DBBA 1DDWA 2P0FA 5CLLB 1FGYA 1P6SA 2BCJA 3T06A 3DXDA 4A6HA 3WYFB 1M7RA 1U5DA 1WVHA 5D3WA 2M14A 2ROVA 2YS3A 1MK9B 2COCA 4EMOA 1V5MA 2UVMA 5DHFB 1XCGA 5C5BB 2YS1A 1RJ2A 1WI1A 5C16A 5JLJB 2J0KA 2ELAA 2D11A 1I7AA 4GZUA 2RSGA 1H10A 5FI0A 2RUKB 1UNRA 2K2UA 2P0HA 2K2JA 2QKMA 2UZRA
chains in the Genus database with same CATH superfamily
2K00A 1DROA 1KZGA 2GUMA 5DH9B 5LG4B 4Y94A 2EC1A 2D9ZA 4DX8A 4NSWA 2J0JA 2GJYA 2GCJA 2COFA 5FI1A 2P0DA 4EJNA 2I1KA 1ZSQA 2LG1A 2KIGA 4GPTB 1UEFA 1EGXA 2CY4A 4Z2NA 3U8ZA 5HE1A 4A6FA 4HB2B 3VOQA 3D8DA 2EMSA 3ULCA 4HHVA 3ODWA 3AU5A 3NSUA 2J59M 2Z0OA 3RCPA 2KCJA 1XD4A 3PVUA 4K2PA 2LULA 1U5FA 3HK0A 1U5GA 4QXAB 2RGNB 2QKLA 2DA0A 3TCAA 4YONA 3PG7A 5D3XA 1U5EA 1V5UA 2DHKA 1NTVA 5DIFB 4A5KA 4IFSA 5LONB 4Z2MB 3MDBC 1UPQA 4EKUA 4PQ0A 2RVBB 4WSFA 2YSZA 3PSCA 1FHWA 2KGXB 2Y7BA 5HE2A 5C79A 3U12A 1P5TA 1WGQA 2KR0A 3SNHA 4HAWB 3ODOA 2YS5A 3SV1A 4L1RA 2N0YA 1UNPA 4WJ7A 1DDMA 5J3TA 4KHOA 1Y19B 1BTKA 1XODA 4L6EA 2FJLA 1W1HA 1SHCA 3PVWA 2CY5A 2NMBA 3CIKA 4ZRIA 3F0WA 2L2IA 5J3QA 3P6AA 3KRXA 2Y8GA 2DHJA 4IAPA 1BTNA 2Q13A 1AQCA 1NI2A 1X86A 3PEGA 3BJIA 2DX5A 3B77A 4A6KA 2D4QA 2CAYA 2I1JA 2IYBA 3N7CA 4KHBB 2JP2A 4GXBA 2YT0A 1V89A 5J3YA 5L81A 1Q67A 2HE7A 2D9WA 3TW1A 4KVGB 3TFMA 1DYNA 2YVCA 2MKRA 1OMWA 2ZPYA 4QJ3B 2DYQA 3AU4A 2R0DA 3IVFA 1X1GA 1GG3A 4HAUB 1UNQA 5D3YA 4HDOA 1OQNA 2N23A 2Z59A 4P7IA 3TO1A 2L1CA 5KQ4A 3NWAA 2DKQA 1PMSA 4DXAB 2ADZA 1TJ6A 2DKPA 3O96A 2COAA 2Z4DA 2IFSA 2D2QA 3FSSA 3OANA 1DBHA 2XQNM 5DI9B 3OHMB 1NTYA 3A8PA 1ISNA 1KI1B 2DLWA 4MK0A 2LKOA 1TXDA 5IRSA 5JP4A 1TQZA 3DXCA 5HE3A 4CHJA 4GMXB 1U27A 2ROZB 4HAZB 1V61A 2H7EA 3WA0A 1K5DB 3DCXA 3SUZA 1QQGA 1M7EA 2YRYA 3A8QA 2RNRB 1XR0B 1ZVRA 2Y8FA 4KHAA 2OQBA 2YF0A 2VRWB 4F7HA 2DFKA 1XKEA 2J0MA 3GYOA 4DIXA 3FVCA 3D8FA 1E5WA 3A98B 3D8EA 4WVFB 1H4RA 5GOWB 2LYDA 2EMTA 1P3RA 4GMVA 3HIEA 4A6FB 1BWNA 2D9VA 4CHMA 2NBVA 1B55A 4YL8A 4ZRJA 2P8VA 1PLSA 1NU2A 2I5FA 1BAKA 2AL6A 5JHGA 2X18A 4F7GA 1MKEA 2GS0A 1GC7A 5D3VA 2ZKMX 2CODA 1X11A 4HATB 1XX0A 3G9WA 1PFJA 2LOZA 3NWFA 5JHHA 2UZSA 1FHXA 2V76A 1FGZA 2HTHB 3M1IB 3PZDA 2GCLA 3KZ1A 5C5BA 1I2HA 1LB1A 1IRSA 4F7UP 4TKNA 2D10A 4PNKA 4GN1A 3V5WA 1W1DA 2DN6A 4B6HA 4MY6A 1KZ7A 2OTXA 2R09A 2RLOA 3ML4A 1W1GA 2RRFA 2W2XC 1K5GB 3SYXA 3LJUX 4D0NB 3GYPA 2Z0PA 3PVLA 4HAVB 1DDVA 2KUPA 4IOYX 4DX90 1AWEA 1FAOA 1ZC4B 4TYZA 3P7ZA 1X05A 3ODXA 1J0WA 2K8EA 1N3HA 3PP2A 4CSQA 1J19A 5KCVA 3QBVB 1WJ1A 2G35A 1FOEA 2CRFA 2KUQA 2Z14A 3SO6A 1LW3A 2D9YA 5KQ1A 1X1FA 1Y5OA 1MAIA 5I2SA 1MIXA 3CXBB 4HB0B 3HSAA 3HW2B 4XWXA 2NZ8B 2EJ8A 2VSZA 1EVHA 4CYEA 2DHIA 4KAXB 5C6RA 2YT1A 4OT1A 4H8SA 2I5CA 1WGUA 1V88A 3UZTA 4D6WA 3HQCA 5LOPB 1EF1A 2W2WA 3MPXA 4HB3B 3AJ4A 4HB4B 4HAYB 1QC6A 4HAXB 1FHOA 3BINA 1WG7A 2MFQA 2MDXA 1U2BA 1FB8A 1OY2A 3KRWA 5M4YB 4MT7A 3QIJA 1GC6A 1ZC3B 4HDQA 1V5PA 3TVVA 3ZDTA 3F5RA 3FEHA 3NW8A 1RRPB 1MI1A 1Z87A 5CLQB 2KIEA 1MPHA 5D27A 5DHAB 3U7DA 1MIZB 4BBKA 3DXEA 2M38A 2YT2A 1ZM0A 2VKIA 1UPRA 2AEHA 2H7DA 2LOXA 3KSYA 2ELBA 4GOUA 1WJMA 4K17A 2DX1A 4ZRKA 1SGHA 3X23A 4QJ4B 1U29A 3VIAA 2MWNB 1EAZA 1MK7B 5I2MA 2DTCA 3QWMA 2PZ1A 4GNKB 4NY0A 4K81A 5EFXA 3ULBA 3ZVRA 3FM8C 2D9XA 2Z0QA 2R2YA 4K2OA 4C0AA 3KY9A 2DYNA 5HE0A 4OSNA 2E2XA 2W2XD 4DBBA 1DDWA 2P0FA 4KHBA 4QJ5B 5CLLB 1FGYA 1P6SA 2BCJA 3T06A 3DXDA 4A6HA 3WYFB 1M7RA 1U5DA 1WVHA 5D3WA 2M14A 2ROVA 2YS3A 1MK9B 2COCA 4EMOA 1V5MA 2K49A 2UVMA 5DHFB 1XCGA 5C5BB 2FJUB 2YS1A 1RJ2A 1WI1A 3NWDA 5C16A 5JLJB 2J0KA 2ELAA 2D11A 1I7AA 4GZUA 3A58A 2RSGA 1H10A 5FI0A 1ZYIA 1T77A 2RUKB 1UNRA 2K2UA 2P0HA 2K2JA 2Z13A 2QKMA 2UZRA 4HSIA
chains in the Genus database with same CATH topology
2K00A 1DROA 1KZGA 5DH9B 4Y94A 2EC1A 2D9ZA 4DX8A 4NSWA 2J0JA 2GJYA 2GCJA 2COFA 5FI1A 2P0DA 4EJNA 2I1KA 1ZSQA 2LG1A 4GPTB 1UEFA 1EGXA 2CY4A 4Z2NA 3U8ZA 5HE1A 4A6FA 4HB2B 3VOQA 3D8DA 2EMSA 3ULCA 4HHVA 3ODWA 3AU5A 3NSUA 2J59M 2Z0OA 3RCPA 2KCJA 1XD4A 3PVUA 4K2PA 2LULA 1U5FA 3HK0A 1U5GA 2RGNB 2QKLA 2DA0A 3TCAA 4YONA 3PG7A 5D3XA 1U5EA 1V5UA 2DHKA 1NTVA 5DIFB 4A5KA 4IFSA 5LONB 4Z2MB 3MDBC 1UPQA 4EKUA 4PQ0A 2RVBB 4WSFA 2YSZA 3PSCA 1FHWA 2KGXB 2Y7BA 5HE2A 5C79A 1P5TA 1WGQA 3SNHA 4HAWB 3ODOA 2YS5A 3SV1A 2N0YA 1UNPA 4WJ7A 1DDMA 5J3TA 4KHOA 1Y19B 1BTKA 1XODA 4L6EA 2FJLA 1W1HA 1SHCA 3PVWA 2CY5A 2NMBA 3CIKA 4ZRIA 3F0WA 2L2IA 5J3QA 3P6AA 3KRXA 2Y8GA 2DHJA 4IAPA 1BTNA 2Q13A 1AQCA 1NI2A 1X86A 3PEGA 3BJIA 2DX5A 4A6KA 2D4QA 2CAYA 2I1JA 2IYBA 3N7CA 4KHBB 2JP2A 4GXBA 2YT0A 1V89A 5J3YA 5L81A 1Q67A 2HE7A 2D9WA 3TW1A 4KVGB 3TFMA 1DYNA 2YVCA 2MKRA 1OMWA 2ZPYA 2DYQA 3AU4A 2R0DA 3IVFA 1X1GA 1GG3A 4HAUB 1UNQA 5D3YA 4HDOA 1OQNA 2N23A 3TO1A 4P7IA 5KQ4A 2L1CA 2DKQA 1PMSA 4DXAB 2ADZA 1TJ6A 2DKPA 3O96A 2COAA 2IFSA 2D2QA 3FSSA 3OANA 1DBHA 2XQNM 5DI9B 1NTYA 3A8PA 1ISNA 1KI1B 2DLWA 4MK0A 2LKOA 1TXDA 5JP4A 1TQZA 3DXCA 5HE3A 4CHJA 4GMXB 1U27A 2ROZB 4HAZB 1V61A 2H7EA 3WA0A 1K5DB 3SUZA 1QQGA 1M7EA 2YRYA 3A8QA 2RNRB 1XR0B 1ZVRA 2Y8FA 4KHAA 2OQBA 2YF0A 2VRWB 4F7HA 2DFKA 1XKEA 2J0MA 3GYOA 3D8FA 1E5WA 3A98B 3D8EA 4WVFB 1H4RA 5GOWB 2LYDA 2EMTA 1P3RA 4GMVA 4A6FB 1BWNA 2D9VA 4CHMA 1B55A 4YL8A 4ZRJA 2P8VA 1PLSA 1NU2A 2I5FA 1BAKA 2AL6A 5JHGA 2X18A 4F7GA 1MKEA 2GS0A 1GC7A 5D3VA 2CODA 1X11A 4HATB 1XX0A 3G9WA 1PFJA 2LOZA 5JHHA 2UZSA 1FHXA 2V76A 1FGZA 2HTHB 3M1IB 3PZDA 2GCLA 3KZ1A 5C5BA 1I2HA 1LB1A 1IRSA 4F7UP 4TKNA 2D10A 4PNKA 4GN1A 3V5WA 1W1DA 2DN6A 4B6HA 4MY6A 1KZ7A 2OTXA 2R09A 2RLOA 3ML4A 1W1GA 2W2XC 1K5GB 3SYXA 3LJUX 4D0NB 3GYPA 2Z0PA 3PVLA 4HAVB 1DDVA 2KUPA 4IOYX 4DX90 1AWEA 1FAOA 1ZC4B 4TYZA 3P7ZA 1X05A 3ODXA 1J0WA 1N3HA 3PP2A 1J19A 5KCVA 3QBVB 1WJ1A 2G35A 1FOEA 2CRFA 3SO6A 1LW3A 2D9YA 5KQ1A 1X1FA 1Y5OA 1MAIA 1MIXA 3CXBB 4HB0B 3HW2B 4XWXA 2NZ8B 2EJ8A 2VSZA 1EVHA 4CYEA 2DHIA 4KAXB 5C6RA 2YT1A 3UZTA 4H8SA 2I5CA 1WGUA 1V88A 3HQCA 5LOPB 1EF1A 2W2WA 3MPXA 4HB3B 3AJ4A 4HB4B 4HAYB 1QC6A 4HAXB 1FHOA 3BINA 1WG7A 2MFQA 2MDXA 1U2BA 1FB8A 1OY2A 3KRWA 4MT7A 3QIJA 1GC6A 1ZC3B 4HDQA 1V5PA 3TVVA 3ZDTA 3F5RA 3FEHA 1RRPB 1Z87A 5CLQB 1MPHA 5D27A 5DHAB 3U7DA 1MIZB 4BBKA 3DXEA 2M38A 1ZM0A 2VKIA 1UPRA 2AEHA 2H7DA 2LOXA 3KSYA 2ELBA 1WJMA 4K17A 2DX1A 4ZRKA 1SGHA 3X23A 1U29A 3VIAA 2MWNB 1EAZA 1MK7B 2DTCA 3QWMA 2PZ1A 4NY0A 4K81A 5EFXA 3ULBA 3ZVRA 3FM8C 2D9XA 2Z0QA 4K2OA 4C0AA 3KY9A 2DYNA 5HE0A 2E2XA 2W2XD 4DBBA 1DDWA 2P0FA 5CLLB 1FGYA 1P6SA 2BCJA 3T06A 3DXDA 4A6HA 3WYFB 1M7RA 1U5DA 1WVHA 5D3WA 2M14A 2ROVA 2YS3A 1MK9B 2COCA 4EMOA 1V5MA 2UVMA 5DHFB 1XCGA 5C5BB 2YS1A 1RJ2A 1WI1A 5C16A 5JLJB 2J0KA 2ELAA 2D11A 1I7AA 4GZUA 2RSGA 1H10A 5FI0A 2RUKB 1UNRA 2K2UA 2P0HA 2K2JA 2QKMA 2UZRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2K00 A;  1DRO A;  1KZG A;  5DH9 B;  4Y94 A;  2EC1 A;  2D9Z A;  4DX8 A;  4NSW A;  2J0J A;  2GJY A;  2GCJ A;  2COF A;  5FI1 A;  2P0D A;  4EJN A;  2I1K A;  1ZSQ A;  2LG1 A;  4GPT B;  1UEF A;  1EGX A;  2CY4 A;  4Z2N A;  3U8Z A;  5HE1 A;  4A6F A;  4HB2 B;  3VOQ A;  3D8D A;  2EMS A;  3ULC A;  4HHV A;  3ODW A;  3AU5 A;  3NSU A;  2J59 M;  2Z0O A;  3RCP A;  2KCJ A;  1XD4 A;  3PVU A;  4K2P A;  2LUL A;  1U5F A;  3HK0 A;  1U5G A;  2RGN B;  2QKL A;  2DA0 A;  3TCA A;  4YON A;  3PG7 A;  5D3X A;  1U5E A;  1V5U A;  2DHK A;  1NTV A;  5DIF B;  4A5K A;  4IFS A;  5LON B;  4Z2M B;  3MDB C;  1UPQ A;  4EKU A;  4PQ0 A;  2RVB B;  4WSF A;  2YSZ A;  3PSC A;  1FHW A;  2KGX B;  2Y7B A;  5HE2 A;  5C79 A;  1P5T A;  1WGQ A;  3SNH A;  4HAW B;  3ODO A;  2YS5 A;  3SV1 A;  2N0Y A;  1UNP A;  4WJ7 A;  1DDM A;  5J3T A;  4KHO A;  1Y19 B;  1BTK A;  1XOD A;  4L6E A;  2FJL A;  1W1H A;  1SHC A;  3PVW A;  2CY5 A;  2NMB A;  3CIK A;  4ZRI A;  3F0W A;  2L2I A;  5J3Q A;  3P6A A;  3KRX A;  2Y8G A;  2DHJ A;  4IAP A;  1BTN A;  2Q13 A;  1AQC A;  1NI2 A;  1X86 A;  3PEG A;  3BJI A;  2DX5 A;  4A6K A;  2D4Q A;  2CAY A;  2I1J A;  2IYB A;  3N7C A;  4KHB B;  2JP2 A;  4GXB A;  2YT0 A;  1V89 A;  5J3Y A;  5L81 A;  1Q67 A;  2HE7 A;  2D9W A;  3TW1 A;  4KVG B;  3TFM A;  1DYN A;  2YVC A;  2MKR A;  1OMW A;  2ZPY A;  2DYQ A;  3AU4 A;  2R0D A;  3IVF A;  1X1G A;  1GG3 A;  4HAU B;  1UNQ A;  5D3Y A;  4HDO A;  1OQN A;  2N23 A;  3TO1 A;  4P7I A;  5KQ4 A;  2L1C A;  2DKQ A;  1PMS A;  4DXA B;  2ADZ A;  1TJ6 A;  2DKP A;  3O96 A;  2COA A;  2IFS A;  2D2Q A;  3FSS A;  3OAN A;  1DBH A;  2XQN M;  5DI9 B;  1NTY A;  3A8P A;  1ISN A;  1KI1 B;  2DLW A;  4MK0 A;  2LKO A;  1TXD A;  5JP4 A;  1TQZ A;  3DXC A;  5HE3 A;  4CHJ A;  4GMX B;  1U27 A;  2ROZ B;  4HAZ B;  1V61 A;  2H7E A;  3WA0 A;  1K5D B;  3SUZ A;  1QQG A;  1M7E A;  2YRY A;  3A8Q A;  2RNR B;  1XR0 B;  1ZVR A;  2Y8F A;  4KHA A;  2OQB A;  2YF0 A;  2VRW B;  4F7H A;  2DFK A;  1XKE A;  2J0M A;  3GYO A;  3D8F A;  1E5W A;  3A98 B;  3D8E A;  4WVF B;  1H4R A;  5GOW B;  2LYD A;  2EMT A;  1P3R A;  4GMV A;  4A6F B;  1BWN A;  2D9V A;  4CHM A;  1B55 A;  4YL8 A;  4ZRJ A;  2P8V A;  1PLS A;  1NU2 A;  2I5F A;  1BAK A;  2AL6 A;  5JHG A;  2X18 A;  4F7G A;  1MKE A;  2GS0 A;  1GC7 A;  5D3V A;  2COD A;  1X11 A;  4HAT B;  1XX0 A;  3G9W A;  1PFJ A;  2LOZ A;  5JHH A;  2UZS A;  1FHX A;  2V76 A;  1FGZ A;  2HTH B;  3M1I B;  3PZD A;  2GCL A;  3KZ1 A;  5C5B A;  1I2H A;  1LB1 A;  1IRS A;  4F7U P;  4TKN A;  2D10 A;  4PNK A;  4GN1 A;  3V5W A;  1W1D A;  2DN6 A;  4B6H A;  4MY6 A;  1KZ7 A;  2OTX A;  2R09 A;  2RLO A;  3ML4 A;  1W1G A;  2W2X C;  1K5G B;  3SYX A;  3LJU X;  4D0N B;  3GYP A;  2Z0P A;  3PVL A;  4HAV B;  1DDV A;  2KUP A;  4IOY X;  4DX9 0;  1AWE A;  1FAO A;  1ZC4 B;  4TYZ A;  3P7Z A;  1X05 A;  3ODX A;  1J0W A;  1N3H A;  3PP2 A;  1J19 A;  5KCV A;  3QBV B;  1WJ1 A;  2G35 A;  1FOE A;  2CRF A;  3SO6 A;  1LW3 A;  2D9Y A;  5KQ1 A;  1X1F A;  1Y5O A;  1MAI A;  1MIX A;  3CXB B;  4HB0 B;  3HW2 B;  4XWX A;  2NZ8 B;  2EJ8 A;  2VSZ A;  1EVH A;  4CYE A;  2DHI A;  4KAX B;  5C6R A;  2YT1 A;  3UZT A;  4H8S A;  2I5C A;  1WGU A;  1V88 A;  3HQC A;  5LOP B;  1EF1 A;  2W2W A;  3MPX A;  4HB3 B;  3AJ4 A;  4HB4 B;  4HAY B;  1QC6 A;  4HAX B;  1FHO A;  3BIN A;  1WG7 A;  2MFQ A;  2MDX A;  1U2B A;  1FB8 A;  1OY2 A;  3KRW A;  4MT7 A;  3QIJ A;  1GC6 A;  1ZC3 B;  4HDQ A;  1V5P A;  3TVV A;  3ZDT A;  3F5R A;  3FEH A;  1RRP B;  1Z87 A;  5CLQ B;  1MPH A;  5D27 A;  5DHA B;  3U7D A;  1MIZ B;  4BBK A;  3DXE A;  2M38 A;  1ZM0 A;  2VKI A;  1UPR A;  2AEH A;  2H7D A;  2LOX A;  3KSY A;  2ELB A;  1WJM A;  4K17 A;  2DX1 A;  4ZRK A;  1SGH A;  3X23 A;  1U29 A;  3VIA A;  2MWN B;  1EAZ A;  1MK7 B;  2DTC A;  3QWM A;  2PZ1 A;  4NY0 A;  4K81 A;  5EFX A;  3ULB A;  3ZVR A;  3FM8 C;  2D9X A;  2Z0Q A;  4K2O A;  4C0A A;  3KY9 A;  2DYN A;  5HE0 A;  2E2X A;  2W2X D;  4DBB A;  1DDW A;  2P0F A;  5CLL B;  1FGY A;  1P6S A;  2BCJ A;  3T06 A;  3DXD A;  4A6H A;  3WYF B;  1M7R A;  1U5D A;  1WVH A;  5D3W A;  2M14 A;  2ROV A;  2YS3 A;  1MK9 B;  2COC A;  4EMO A;  1V5M A;  2UVM A;  5DHF B;  1XCG A;  5C5B B;  2YS1 A;  1RJ2 A;  1WI1 A;  5C16 A;  5JLJ B;  2J0K A;  2ELA A;  2D11 A;  1I7A A;  4GZU A;  2RSG A;  1H10 A;  5FI0 A;  2RUK B;  1UNR A;  2K2U A;  2P0H A;  2K2J A;  2QKM A;  2UZR A; 
#chains in the Genus database with same CATH topology
 2K00 A;  1DRO A;  1KZG A;  2GUM A;  5DH9 B;  5LG4 B;  4Y94 A;  2EC1 A;  2D9Z A;  4DX8 A;  4NSW A;  2J0J A;  2GJY A;  2GCJ A;  2COF A;  5FI1 A;  2P0D A;  4EJN A;  2I1K A;  1ZSQ A;  2LG1 A;  2KIG A;  4GPT B;  1UEF A;  1EGX A;  2CY4 A;  4Z2N A;  3U8Z A;  5HE1 A;  4A6F A;  4HB2 B;  3VOQ A;  3D8D A;  2EMS A;  3ULC A;  4HHV A;  3ODW A;  3AU5 A;  3NSU A;  2J59 M;  2Z0O A;  3RCP A;  2KCJ A;  1XD4 A;  3PVU A;  4K2P A;  2LUL A;  1U5F A;  3HK0 A;  1U5G A;  4QXA B;  2RGN B;  2QKL A;  2DA0 A;  3TCA A;  4YON A;  3PG7 A;  5D3X A;  1U5E A;  1V5U A;  2DHK A;  1NTV A;  5DIF B;  4A5K A;  4IFS A;  5LON B;  4Z2M B;  3MDB C;  1UPQ A;  4EKU A;  4PQ0 A;  2RVB B;  4WSF A;  2YSZ A;  3PSC A;  1FHW A;  2KGX B;  2Y7B A;  5HE2 A;  5C79 A;  3U12 A;  1P5T A;  1WGQ A;  2KR0 A;  3SNH A;  4HAW B;  3ODO A;  2YS5 A;  3SV1 A;  4L1R A;  2N0Y A;  1UNP A;  4WJ7 A;  1DDM A;  5J3T A;  4KHO A;  1Y19 B;  1BTK A;  1XOD A;  4L6E A;  2FJL A;  1W1H A;  1SHC A;  3PVW A;  2CY5 A;  2NMB A;  3CIK A;  4ZRI A;  3F0W A;  2L2I A;  5J3Q A;  3P6A A;  3KRX A;  2Y8G A;  2DHJ A;  4IAP A;  1BTN A;  2Q13 A;  1AQC A;  1NI2 A;  1X86 A;  3PEG A;  3BJI A;  2DX5 A;  3B77 A;  4A6K A;  2D4Q A;  2CAY A;  2I1J A;  2IYB A;  3N7C A;  4KHB B;  2JP2 A;  4GXB A;  2YT0 A;  1V89 A;  5J3Y A;  5L81 A;  1Q67 A;  2HE7 A;  2D9W A;  3TW1 A;  4KVG B;  3TFM A;  1DYN A;  2YVC A;  2MKR A;  1OMW A;  2ZPY A;  4QJ3 B;  2DYQ A;  3AU4 A;  2R0D A;  3IVF A;  1X1G A;  1GG3 A;  4HAU B;  1UNQ A;  5D3Y A;  4HDO A;  1OQN A;  2N23 A;  2Z59 A;  4P7I A;  3TO1 A;  2L1C A;  5KQ4 A;  3NWA A;  2DKQ A;  1PMS A;  4DXA B;  2ADZ A;  1TJ6 A;  2DKP A;  3O96 A;  2COA A;  2Z4D A;  2IFS A;  2D2Q A;  3FSS A;  3OAN A;  1DBH A;  2XQN M;  5DI9 B;  3OHM B;  1NTY A;  3A8P A;  1ISN A;  1KI1 B;  2DLW A;  4MK0 A;  2LKO A;  1TXD A;  5IRS A;  5JP4 A;  1TQZ A;  3DXC A;  5HE3 A;  4CHJ A;  4GMX B;  1U27 A;  2ROZ B;  4HAZ B;  1V61 A;  2H7E A;  3WA0 A;  1K5D B;  3DCX A;  3SUZ A;  1QQG A;  1M7E A;  2YRY A;  3A8Q A;  2RNR B;  1XR0 B;  1ZVR A;  2Y8F A;  4KHA A;  2OQB A;  2YF0 A;  2VRW B;  4F7H A;  2DFK A;  1XKE A;  2J0M A;  3GYO A;  4DIX A;  3FVC A;  3D8F A;  1E5W A;  3A98 B;  3D8E A;  4WVF B;  1H4R A;  5GOW B;  2LYD A;  2EMT A;  1P3R A;  4GMV A;  3HIE A;  4A6F B;  1BWN A;  2D9V A;  4CHM A;  2NBV A;  1B55 A;  4YL8 A;  4ZRJ A;  2P8V A;  1PLS A;  1NU2 A;  2I5F A;  1BAK A;  2AL6 A;  5JHG A;  2X18 A;  4F7G A;  1MKE A;  2GS0 A;  1GC7 A;  5D3V A;  2ZKM X;  2COD A;  1X11 A;  4HAT B;  1XX0 A;  3G9W A;  1PFJ A;  2LOZ A;  3NWF A;  5JHH A;  2UZS A;  1FHX A;  2V76 A;  1FGZ A;  2HTH B;  3M1I B;  3PZD A;  2GCL A;  3KZ1 A;  5C5B A;  1I2H A;  1LB1 A;  1IRS A;  4F7U P;  4TKN A;  2D10 A;  4PNK A;  4GN1 A;  3V5W A;  1W1D A;  2DN6 A;  4B6H A;  4MY6 A;  1KZ7 A;  2OTX A;  2R09 A;  2RLO A;  3ML4 A;  1W1G A;  2RRF A;  2W2X C;  1K5G B;  3SYX A;  3LJU X;  4D0N B;  3GYP A;  2Z0P A;  3PVL A;  4HAV B;  1DDV A;  2KUP A;  4IOY X;  4DX9 0;  1AWE A;  1FAO A;  1ZC4 B;  4TYZ A;  3P7Z A;  1X05 A;  3ODX A;  1J0W A;  2K8E A;  1N3H A;  3PP2 A;  4CSQ A;  1J19 A;  5KCV A;  3QBV B;  1WJ1 A;  2G35 A;  1FOE A;  2CRF A;  2KUQ A;  2Z14 A;  3SO6 A;  1LW3 A;  2D9Y A;  5KQ1 A;  1X1F A;  1Y5O A;  1MAI A;  5I2S A;  1MIX A;  3CXB B;  4HB0 B;  3HSA A;  3HW2 B;  4XWX A;  2NZ8 B;  2EJ8 A;  2VSZ A;  1EVH A;  4CYE A;  2DHI A;  4KAX B;  5C6R A;  2YT1 A;  4OT1 A;  4H8S A;  2I5C A;  1WGU A;  1V88 A;  3UZT A;  4D6W A;  3HQC A;  5LOP B;  1EF1 A;  2W2W A;  3MPX A;  4HB3 B;  3AJ4 A;  4HB4 B;  4HAY B;  1QC6 A;  4HAX B;  1FHO A;  3BIN A;  1WG7 A;  2MFQ A;  2MDX A;  1U2B A;  1FB8 A;  1OY2 A;  3KRW A;  5M4Y B;  4MT7 A;  3QIJ A;  1GC6 A;  1ZC3 B;  4HDQ A;  1V5P A;  3TVV A;  3ZDT A;  3F5R A;  3FEH A;  3NW8 A;  1RRP B;  1MI1 A;  1Z87 A;  5CLQ B;  2KIE A;  1MPH A;  5D27 A;  5DHA B;  3U7D A;  1MIZ B;  4BBK A;  3DXE A;  2M38 A;  2YT2 A;  1ZM0 A;  2VKI A;  1UPR A;  2AEH A;  2H7D A;  2LOX A;  3KSY A;  2ELB A;  4GOU A;  1WJM A;  4K17 A;  2DX1 A;  4ZRK A;  1SGH A;  3X23 A;  4QJ4 B;  1U29 A;  3VIA A;  2MWN B;  1EAZ A;  1MK7 B;  5I2M A;  2DTC A;  3QWM A;  2PZ1 A;  4GNK B;  4NY0 A;  4K81 A;  5EFX A;  3ULB A;  3ZVR A;  3FM8 C;  2D9X A;  2Z0Q A;  2R2Y A;  4K2O A;  4C0A A;  3KY9 A;  2DYN A;  5HE0 A;  4OSN A;  2E2X A;  2W2X D;  4DBB A;  1DDW A;  2P0F A;  4KHB A;  4QJ5 B;  5CLL B;  1FGY A;  1P6S A;  2BCJ A;  3T06 A;  3DXD A;  4A6H A;  3WYF B;  1M7R A;  1U5D A;  1WVH A;  5D3W A;  2M14 A;  2ROV A;  2YS3 A;  1MK9 B;  2COC A;  4EMO A;  1V5M A;  2K49 A;  2UVM A;  5DHF B;  1XCG A;  5C5B B;  2FJU B;  2YS1 A;  1RJ2 A;  1WI1 A;  3NWD A;  5C16 A;  5JLJ B;  2J0K A;  2ELA A;  2D11 A;  1I7A A;  4GZU A;  3A58 A;  2RSG A;  1H10 A;  5FI0 A;  1ZYI A;  1T77 A;  2RUK B;  1UNR A;  2K2U A;  2P0H A;  2K2J A;  2Z13 A;  2QKM A;  2UZR A;  4HSI A; 
#chains in the Genus database with same CATH homology
 2K00 A;  1DRO A;  1KZG A;  5DH9 B;  4Y94 A;  2EC1 A;  2D9Z A;  4DX8 A;  4NSW A;  2J0J A;  2GJY A;  2GCJ A;  2COF A;  5FI1 A;  2P0D A;  4EJN A;  2I1K A;  1ZSQ A;  2LG1 A;  4GPT B;  1UEF A;  1EGX A;  2CY4 A;  4Z2N A;  3U8Z A;  5HE1 A;  4A6F A;  4HB2 B;  3VOQ A;  3D8D A;  2EMS A;  3ULC A;  4HHV A;  3ODW A;  3AU5 A;  3NSU A;  2J59 M;  2Z0O A;  3RCP A;  2KCJ A;  1XD4 A;  3PVU A;  4K2P A;  2LUL A;  1U5F A;  3HK0 A;  1U5G A;  2RGN B;  2QKL A;  2DA0 A;  3TCA A;  4YON A;  3PG7 A;  5D3X A;  1U5E A;  1V5U A;  2DHK A;  1NTV A;  5DIF B;  4A5K A;  4IFS A;  5LON B;  4Z2M B;  3MDB C;  1UPQ A;  4EKU A;  4PQ0 A;  2RVB B;  4WSF A;  2YSZ A;  3PSC A;  1FHW A;  2KGX B;  2Y7B A;  5HE2 A;  5C79 A;  1P5T A;  1WGQ A;  3SNH A;  4HAW B;  3ODO A;  2YS5 A;  3SV1 A;  2N0Y A;  1UNP A;  4WJ7 A;  1DDM A;  5J3T A;  4KHO A;  1Y19 B;  1BTK A;  1XOD A;  4L6E A;  2FJL A;  1W1H A;  1SHC A;  3PVW A;  2CY5 A;  2NMB A;  3CIK A;  4ZRI A;  3F0W A;  2L2I A;  5J3Q A;  3P6A A;  3KRX A;  2Y8G A;  2DHJ A;  4IAP A;  1BTN A;  2Q13 A;  1AQC A;  1NI2 A;  1X86 A;  3PEG A;  3BJI A;  2DX5 A;  4A6K A;  2D4Q A;  2CAY A;  2I1J A;  2IYB A;  3N7C A;  4KHB B;  2JP2 A;  4GXB A;  2YT0 A;  1V89 A;  5J3Y A;  5L81 A;  1Q67 A;  2HE7 A;  2D9W A;  3TW1 A;  4KVG B;  3TFM A;  1DYN A;  2YVC A;  2MKR A;  1OMW A;  2ZPY A;  2DYQ A;  3AU4 A;  2R0D A;  3IVF A;  1X1G A;  1GG3 A;  4HAU B;  1UNQ A;  5D3Y A;  4HDO A;  1OQN A;  2N23 A;  3TO1 A;  4P7I A;  5KQ4 A;  2L1C A;  2DKQ A;  1PMS A;  4DXA B;  2ADZ A;  1TJ6 A;  2DKP A;  3O96 A;  2COA A;  2IFS A;  2D2Q A;  3FSS A;  3OAN A;  1DBH A;  2XQN M;  5DI9 B;  1NTY A;  3A8P A;  1ISN A;  1KI1 B;  2DLW A;  4MK0 A;  2LKO A;  1TXD A;  5JP4 A;  1TQZ A;  3DXC A;  5HE3 A;  4CHJ A;  4GMX B;  1U27 A;  2ROZ B;  4HAZ B;  1V61 A;  2H7E A;  3WA0 A;  1K5D B;  3SUZ A;  1QQG A;  1M7E A;  2YRY A;  3A8Q A;  2RNR B;  1XR0 B;  1ZVR A;  2Y8F A;  4KHA A;  2OQB A;  2YF0 A;  2VRW B;  4F7H A;  2DFK A;  1XKE A;  2J0M A;  3GYO A;  3D8F A;  1E5W A;  3A98 B;  3D8E A;  4WVF B;  1H4R A;  5GOW B;  2LYD A;  2EMT A;  1P3R A;  4GMV A;  4A6F B;  1BWN A;  2D9V A;  4CHM A;  1B55 A;  4YL8 A;  4ZRJ A;  2P8V A;  1PLS A;  1NU2 A;  2I5F A;  1BAK A;  2AL6 A;  5JHG A;  2X18 A;  4F7G A;  1MKE A;  2GS0 A;  1GC7 A;  5D3V A;  2COD A;  1X11 A;  4HAT B;  1XX0 A;  3G9W A;  1PFJ A;  2LOZ A;  5JHH A;  2UZS A;  1FHX A;  2V76 A;  1FGZ A;  2HTH B;  3M1I B;  3PZD A;  2GCL A;  3KZ1 A;  5C5B A;  1I2H A;  1LB1 A;  1IRS A;  4F7U P;  4TKN A;  2D10 A;  4PNK A;  4GN1 A;  3V5W A;  1W1D A;  2DN6 A;  4B6H A;  4MY6 A;  1KZ7 A;  2OTX A;  2R09 A;  2RLO A;  3ML4 A;  1W1G A;  2W2X C;  1K5G B;  3SYX A;  3LJU X;  4D0N B;  3GYP A;  2Z0P A;  3PVL A;  4HAV B;  1DDV A;  2KUP A;  4IOY X;  4DX9 0;  1AWE A;  1FAO A;  1ZC4 B;  4TYZ A;  3P7Z A;  1X05 A;  3ODX A;  1J0W A;  1N3H A;  3PP2 A;  1J19 A;  5KCV A;  3QBV B;  1WJ1 A;  2G35 A;  1FOE A;  2CRF A;  3SO6 A;  1LW3 A;  2D9Y A;  5KQ1 A;  1X1F A;  1Y5O A;  1MAI A;  1MIX A;  3CXB B;  4HB0 B;  3HW2 B;  4XWX A;  2NZ8 B;  2EJ8 A;  2VSZ A;  1EVH A;  4CYE A;  2DHI A;  4KAX B;  5C6R A;  2YT1 A;  3UZT A;  4H8S A;  2I5C A;  1WGU A;  1V88 A;  3HQC A;  5LOP B;  1EF1 A;  2W2W A;  3MPX A;  4HB3 B;  3AJ4 A;  4HB4 B;  4HAY B;  1QC6 A;  4HAX B;  1FHO A;  3BIN A;  1WG7 A;  2MFQ A;  2MDX A;  1U2B A;  1FB8 A;  1OY2 A;  3KRW A;  4MT7 A;  3QIJ A;  1GC6 A;  1ZC3 B;  4HDQ A;  1V5P A;  3TVV A;  3ZDT A;  3F5R A;  3FEH A;  1RRP B;  1Z87 A;  5CLQ B;  1MPH A;  5D27 A;  5DHA B;  3U7D A;  1MIZ B;  4BBK A;  3DXE A;  2M38 A;  1ZM0 A;  2VKI A;  1UPR A;  2AEH A;  2H7D A;  2LOX A;  3KSY A;  2ELB A;  1WJM A;  4K17 A;  2DX1 A;  4ZRK A;  1SGH A;  3X23 A;  1U29 A;  3VIA A;  2MWN B;  1EAZ A;  1MK7 B;  2DTC A;  3QWM A;  2PZ1 A;  4NY0 A;  4K81 A;  5EFX A;  3ULB A;  3ZVR A;  3FM8 C;  2D9X A;  2Z0Q A;  4K2O A;  4C0A A;  3KY9 A;  2DYN A;  5HE0 A;  2E2X A;  2W2X D;  4DBB A;  1DDW A;  2P0F A;  5CLL B;  1FGY A;  1P6S A;  2BCJ A;  3T06 A;  3DXD A;  4A6H A;  3WYF B;  1M7R A;  1U5D A;  1WVH A;  5D3W A;  2M14 A;  2ROV A;  2YS3 A;  1MK9 B;  2COC A;  4EMO A;  1V5M A;  2UVM A;  5DHF B;  1XCG A;  5C5B B;  2YS1 A;  1RJ2 A;  1WI1 A;  5C16 A;  5JLJ B;  2J0K A;  2ELA A;  2D11 A;  1I7A A;  4GZU A;  2RSG A;  1H10 A;  5FI0 A;  2RUK B;  1UNR A;  2K2U A;  2P0H A;  2K2J A;  2QKM A;  2UZR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...