2ADZA

Solution structure of the joined ph domain of alpha1-syntrophin
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
178
structure length
178
Chain Sequence
ASGRRAPRTGLLELRCGAGSGAGGERWQRVLLSLAEDALTVSPADGEPGPEPEPAQLNGAAEPGAAPPQLPEALLLQREVSPYFKNSAGGTSVGWDSPPASPLQRQPSSPGPQPRNLSEAKHVSLKMAYVSRRCTPTDPEPRYLEICAADGQDAVFLRAKDEASARSWAGAIQAQIGT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the split PH domain and distinct lipid-binding properties of the PH-PDZ supramodule of alpha-syntrophin
pubmed doi rcsb
source organism Mus musculus
molecule tags Protein binding
molecule keywords Alpha-1-syntrophin
total genus 11
structure length 178
sequence length 178
ec nomenclature
pdb deposition date 2005-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18012 PH_17 PH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2adzA01
2DKQA 3SO6A 1KZGA 5DHFB 3PEGA 3A8PA 4PQ0A 3PP2A 1FGYA 2CAYA 4MK0A 5C16A 2I5CA 5HE3A 1V5UA 2YT0A 5C79A 2N0YA 2P0DA 4HB0B 2DYQA 2J59M 2UZSA 5C5BA 1TXDA 4HB4B 1EF1A 3P6AA 2Y8FA 1FB8A 1OY2A 1BAKA 1WVHA 4TKNA 5JHGA 2DHJA 4CYEA 2ROZB 4KHOA 3FSSA 3KY9A 4IFSA 5JP4A 1DDWA 2NMBA 3M1IB 3BJIA 2JP2A 1AQCA 3ZDTA 4D0NB 1XR0B 1Q67A 2G35A 3PG7A 1I2HA 2ELAA 3QBVB 1U5EA 1XODA 2GJYA 3O96A 3TFMA 1PFJA 2I1KA 2GS0A 4WSFA 1WGUA 3HW2B 4HAXB 2H7EA 1V88A 1FGZA 2AEHA 4WVFB 2M38A 1KI1B 4BBKA 3ZVRA 1LW3A 1EAZA 1U5FA 2DTCA 2V76A 1XX0A 5HE1A 1U29A 2Q13A 2COCA 2IFSA 2N23A 1V61A 3SYXA 1LB1A 2K00A 4K2OA 1W1HA 5C6RA 5JHHA 1H10A 2LOXA 5FI0A 2YS5A 1N3HA 4A5KA 1X05A 2RSGA 2P0HA 2CY5A 1RRPB 2MFQA 5DHAB 1UNPA 3T06A 2ZPYA 1MIXA 5HE2A 4KVGB 3AJ4A 2J0KA 1DYNA 3FEHA 3VOQA 2KGXB 2MWNB 1UNQA 2EMTA 3WA0A 1FHWA 1KZ7A 2RLOA 4CHMA 3UZTA 2EMSA 3PVUA 4A6HA 3TCAA 3VIAA 4GMXB 1J19A 2LKOA 5DIFB 1GC7A 3PZDA 3LJUX 4KHAA 2W2XD 5D3VA 1DDVA 2COFA 1DBHA 3SV1A 3D8FA 2YVCA 4CHJA 1Y19B 2QKLA 2D9WA 3ODWA 5D3YA 2ROVA 4A6FB 3TO1A 1ZVRA 4DX90 3FM8C 2YRYA 3P7ZA 2D9ZA 1MIZB 1M7EA 1PMSA 1BTKA 1FHXA 5L81A 4DX8A 4XWXA 1P3RA 5CLLB 5D27A 4GPTB 2BCJA 4K81A 4ZRKA 5D3WA 3RCPA 1U5DA 3TVVA 1P6SA 3BINA 3F0WA 3OANA 3MDBC 1B55A 4HAYB 2IYBA 4HAVB 1M7RA 4MY6A 5FI1A 2LYDA 3PSCA 1J0WA 1V89A 3ULBA 2GCLA 2QKMA 1FOEA 2DX5A 4L6EA 2RGNB 2I1JA 2CODA 2DKPA 4KAXB 1RJ2A 1SGHA 1TQZA 2LOZA 1NTYA 4ZRJA 1ZC4B 4A6KA 2ELBA 1PLSA 2XQNM 3A98B 1V5MA 1WI1A 4PNKA 1NU2A 1SHCA 3ODOA 4HAUB 1MKEA 2YF0A 3HK0A 4P7IA 1BTNA 4EMOA 4DBBA 1W1GA 1X1GA 4HDOA 4F7HA 1X11A 5DH9B 1MAIA 2OQBA 2P0FA 3SUZA 1ZM0A 4GXBA 2Y7BA 4IOYX 2MDXA 5C5BB 2D10A 3GYOA 3NSUA 1QC6A 5D3XA 1UPRA 5KCVA 2AL6A 4HAWB 2CRFA 3KSYA 3QIJA 1BWNA 4ZRIA 1WJ1A 2NZ8B 2YS1A 2EC1A 2X18A 5LONB 1W1DA 1ZSQA 2R09A 1U27A 2D9XA 1XCGA 3HQCA 2DX1A 2DHIA 3D8EA 1Z87A 3F5RA 1IRSA 5JLJB 2UZRA 1DDMA 2R0DA 4NY0A 1P5TA 4H8SA 2VKIA 3SNHA 4WJ7A 4F7GA 1UEFA 2DHKA 1QQGA 2YS3A 1X86A 4GZUA 3GYPA 2M14A 2Y8GA 5J3YA 1MPHA 1Y5OA 2YSZA 3PVLA 3X23A 3D8DA 2VSZA 4F7UP 3WYFB 1FAOA 2D2QA 4B6HA 4IAPA 1XD4A 2RNRB 4DXAB 3KRWA 3DXCA 4HB3B 1MK7B 2RVBB 3A8QA 2PZ1A 3AU4A 5EFXA 2H7DA 3CIKA 4YL8A 2LULA 2HTHB 5J3QA 2L2IA 1U5GA 2D11A 4MT7A 2KUPA 1H4RA 2P8VA 3ULCA 2RUKB 1U2BA 4Y94A 2I5FA 2J0JA 1I7AA 3CXBB 4HB2B 2DFKA 1UNRA 1NI2A 2Z0PA 4GMVA 2CY4A 2K2JA 2OTXA 2DN6A 4Z2NA 3QWMA 1EGXA 2Z0QA 1MK9B 2HE7A 2VRWB 1K5DB 2DLWA 1FHOA 2COAA 2Z0OA 2MKRA 2DYNA 4K2PA 1TJ6A 2L1CA 4HATB 3KZ1A 3KRXA 2D9VA 1ISNA 1K5GB 2W2XC 1V5PA 4A6FA 2D4QA 3TW1A 2LG1A 4KHBB 3U7DA 4HHVA 4EKUA 2EJ8A 1WG7A 1NTVA 3N7CA 3AU5A 3IVFA 3DXDA 3MPXA 2FJLA 1E5WA 3ODXA 1ZC3B 3ML4A 2J0MA 2ADZA 5DI9B 3V5WA 1AWEA 1GG3A 1OQNA 1EVHA 3G9WA 4NSWA 1OMWA 2KCJA 5J3TA 4Z2MB 2D9YA 5LOPB 1X1FA 2K2UA 4HAZB 1UPQA 4K17A 3PVWA 5KQ1A 3DXEA 1GC6A 4YONA 1DROA 4GN1A 1WGQA 2DA0A 2YT1A 4HDQA 4C0AA 1WJMA 5GOWB 5KQ4A 2E2XA 5CLQB 2W2WA 4TYZA 2UVMA 2GCJA 4EJNA 1XKEA 5HE0A 3U8ZA
chains in the Genus database with same CATH superfamily
2DKQA 3SO6A 1KZGA 5DHFB 3PEGA 3A8PA 4PQ0A 3PP2A 2ZKMX 4HSIA 1FGYA 2CAYA 4MK0A 5C16A 2I5CA 4OT1A 5HE3A 2KIEA 1V5UA 2YT0A 5C79A 2N0YA 2P0DA 4HB0B 2DYQA 2J59M 2UZSA 5C5BA 1TXDA 4HB4B 1EF1A 3P6AA 2Y8FA 1FB8A 1OY2A 1BAKA 1WVHA 4TKNA 5JHGA 2DHJA 4CYEA 2ROZB 4KHOA 3FSSA 3KY9A 4IFSA 5JP4A 1DDWA 2NBVA 2NMBA 3M1IB 2KIGA 3BJIA 2JP2A 1AQCA 3ZDTA 4D0NB 1XR0B 1Q67A 2G35A 3PG7A 1I2HA 2ELAA 3QBVB 1U5EA 1XODA 2GJYA 3O96A 3TFMA 1PFJA 2I1KA 2GS0A 4WSFA 1WGUA 3HW2B 4HAXB 2H7EA 1V88A 1FGZA 2AEHA 4WVFB 2Z4DA 2K8EA 2M38A 1KI1B 4BBKA 3ZVRA 1LW3A 1EAZA 1U5FA 2DTCA 2V76A 1XX0A 5HE1A 1U29A 2Q13A 4GOUA 2COCA 3DCXA 2IFSA 2N23A 1V61A 3SYXA 3HSAA 1LB1A 2K00A 4K2OA 1W1HA 5I2SA 5C6RA 5JHHA 1H10A 2LOXA 5FI0A 1ZYIA 2YS5A 1N3HA 3FVCA 4A5KA 1X05A 2RSGA 2P0HA 2CY5A 1RRPB 2MFQA 5DHAB 1UNPA 3T06A 2ZPYA 2Z59A 1MIXA 5HE2A 4QXAB 4KVGB 3AJ4A 2J0KA 1DYNA 3FEHA 3VOQA 2KGXB 2MWNB 1UNQA 2EMTA 4QJ4B 3WA0A 1FHWA 1KZ7A 2RLOA 4CHMA 3UZTA 2EMSA 3PVUA 4A6HA 3TCAA 3VIAA 4GMXB 1J19A 2LKOA 2KUQA 5DIFB 1GC7A 3PZDA 3LJUX 4KHAA 2W2XD 5D3VA 1DDVA 2COFA 1DBHA 3SV1A 3D8FA 2YVCA 4CHJA 1Y19B 2QKLA 2D9WA 3ODWA 5D3YA 2ROVA 4A6FB 3TO1A 1ZVRA 4DX90 3FM8C 2YRYA 3P7ZA 2D9ZA 1MIZB 1M7EA 1PMSA 1BTKA 1FHXA 5L81A 4DX8A 4XWXA 1P3RA 5CLLB 5D27A 4GPTB 2BCJA 4K81A 4ZRKA 3B77A 5D3WA 3RCPA 1U5DA 3TVVA 1P6SA 3BINA 3F0WA 3HIEA 3OANA 3MDBC 1B55A 4HAYB 2Z14A 2IYBA 4HAVB 2GUMA 1M7RA 3NW8A 2YT2A 4MY6A 5FI1A 2LYDA 5IRSA 3PSCA 4QJ5B 1J0WA 1V89A 3ULBA 2GCLA 2QKMA 1FOEA 2DX5A 4L6EA 2RGNB 2I1JA 2CODA 2DKPA 4KAXB 1RJ2A 1SGHA 1TQZA 2LOZA 1NTYA 4ZRJA 1ZC4B 4A6KA 2FJUB 2ELBA 1PLSA 2XQNM 3A98B 1V5MA 1WI1A 4PNKA 1NU2A 1SHCA 3ODOA 4HAUB 4QJ3B 1MKEA 2YF0A 3NWFA 3HK0A 4P7IA 5LG4B 1BTNA 4EMOA 4DBBA 1W1GA 1X1GA 4HDOA 4F7HA 1X11A 5DH9B 1MAIA 2OQBA 2P0FA 3SUZA 1ZM0A 4GXBA 2Y7BA 4IOYX 2MDXA 5C5BB 2D10A 3GYOA 3NSUA 1QC6A 5D3XA 1UPRA 5KCVA 2AL6A 4HAWB 2CRFA 3KSYA 3QIJA 1BWNA 4ZRIA 1WJ1A 3NWAA 2NZ8B 2YS1A 2EC1A 2X18A 3NWDA 5LONB 4KHBA 1W1DA 1ZSQA 2R09A 1U27A 2D9XA 4OSNA 1XCGA 3HQCA 2DX1A 2DHIA 3D8EA 4DIXA 1Z87A 3F5RA 1IRSA 5JLJB 2UZRA 1DDMA 2R0DA 4NY0A 1P5TA 4H8SA 2VKIA 3SNHA 4WJ7A 4F7GA 1UEFA 2DHKA 1QQGA 2YS3A 1X86A 4GZUA 3GYPA 2M14A 2Y8GA 5J3YA 1MPHA 1Y5OA 2YSZA 3PVLA 3X23A 3D8DA 2VSZA 4F7UP 3WYFB 1FAOA 2D2QA 4B6HA 1T77A 4IAPA 1XD4A 2RNRB 4DXAB 3KRWA 3DXCA 4HB3B 1MK7B 2RVBB 3A8QA 4L1RA 2PZ1A 3AU4A 5EFXA 2H7DA 3CIKA 4YL8A 2LULA 2HTHB 5J3QA 2L2IA 1U5GA 2D11A 4MT7A 2R2YA 2KUPA 1H4RA 4D6WA 2P8VA 3ULCA 2RUKB 4CSQA 1U2BA 4Y94A 2I5FA 2J0JA 1I7AA 3CXBB 4HB2B 2DFKA 1UNRA 1NI2A 2Z0PA 4GMVA 2CY4A 2K2JA 2KR0A 2OTXA 2DN6A 4Z2NA 3QWMA 3U12A 1EGXA 2Z0QA 1MK9B 2HE7A 2VRWB 1K5DB 2DLWA 1FHOA 2COAA 2Z0OA 2MKRA 2DYNA 4K2PA 1TJ6A 2L1CA 3OHMB 4HATB 3KZ1A 3KRXA 2D9VA 3A58A 1ISNA 1K5GB 2W2XC 1V5PA 4A6FA 2D4QA 3TW1A 2LG1A 4KHBB 3U7DA 4HHVA 4EKUA 2EJ8A 1WG7A 1NTVA 3N7CA 3AU5A 3IVFA 3DXDA 3MPXA 1MI1A 2FJLA 1E5WA 3ODXA 1ZC3B 3ML4A 2J0MA 2ADZA 5DI9B 3V5WA 2Z13A 1AWEA 1GG3A 1OQNA 1EVHA 3G9WA 4NSWA 1OMWA 2KCJA 5J3TA 4Z2MB 2D9YA 5LOPB 1X1FA 2K2UA 4HAZB 1UPQA 2K49A 4K17A 2RRFA 3PVWA 5KQ1A 3DXEA 1GC6A 4YONA 1DROA 4GN1A 1WGQA 2DA0A 2YT1A 4HDQA 4C0AA 1WJMA 5GOWB 5KQ4A 2E2XA 5CLQB 2W2WA 4GNKB 4TYZA 2UVMA 2GCJA 4EJNA 1XKEA 5I2MA 5HE0A 5M4YB 3U8ZA
chains in the Genus database with same CATH topology
2DKQA 3SO6A 1KZGA 5DHFB 3PEGA 3A8PA 4PQ0A 3PP2A 1FGYA 2CAYA 4MK0A 5C16A 2I5CA 5HE3A 1V5UA 2YT0A 5C79A 2N0YA 2P0DA 4HB0B 2DYQA 2J59M 2UZSA 5C5BA 1TXDA 4HB4B 1EF1A 3P6AA 2Y8FA 1FB8A 1OY2A 1BAKA 1WVHA 4TKNA 5JHGA 2DHJA 4CYEA 2ROZB 4KHOA 3FSSA 3KY9A 4IFSA 5JP4A 1DDWA 2NMBA 3M1IB 3BJIA 2JP2A 1AQCA 3ZDTA 4D0NB 1XR0B 1Q67A 2G35A 3PG7A 1I2HA 2ELAA 3QBVB 1U5EA 1XODA 2GJYA 3O96A 3TFMA 1PFJA 2I1KA 2GS0A 4WSFA 1WGUA 3HW2B 4HAXB 2H7EA 1V88A 1FGZA 2AEHA 4WVFB 2M38A 1KI1B 4BBKA 3ZVRA 1LW3A 1EAZA 1U5FA 2DTCA 2V76A 1XX0A 5HE1A 1U29A 2Q13A 2COCA 2IFSA 2N23A 1V61A 3SYXA 1LB1A 2K00A 4K2OA 1W1HA 5C6RA 5JHHA 1H10A 2LOXA 5FI0A 2YS5A 1N3HA 4A5KA 1X05A 2RSGA 2P0HA 2CY5A 1RRPB 2MFQA 5DHAB 1UNPA 3T06A 2ZPYA 1MIXA 5HE2A 4KVGB 3AJ4A 2J0KA 1DYNA 3FEHA 3VOQA 2KGXB 2MWNB 1UNQA 2EMTA 3WA0A 1FHWA 1KZ7A 2RLOA 4CHMA 3UZTA 2EMSA 3PVUA 4A6HA 3TCAA 3VIAA 4GMXB 1J19A 2LKOA 5DIFB 1GC7A 3PZDA 3LJUX 4KHAA 2W2XD 5D3VA 1DDVA 2COFA 1DBHA 3SV1A 3D8FA 2YVCA 4CHJA 1Y19B 2QKLA 2D9WA 3ODWA 5D3YA 2ROVA 4A6FB 3TO1A 1ZVRA 4DX90 3FM8C 2YRYA 3P7ZA 2D9ZA 1MIZB 1M7EA 1PMSA 1BTKA 1FHXA 5L81A 4DX8A 4XWXA 1P3RA 5CLLB 5D27A 4GPTB 2BCJA 4K81A 4ZRKA 5D3WA 3RCPA 1U5DA 3TVVA 1P6SA 3BINA 3F0WA 3OANA 3MDBC 1B55A 4HAYB 2IYBA 4HAVB 1M7RA 4MY6A 5FI1A 2LYDA 3PSCA 1J0WA 1V89A 3ULBA 2GCLA 2QKMA 1FOEA 2DX5A 4L6EA 2RGNB 2I1JA 2CODA 2DKPA 4KAXB 1RJ2A 1SGHA 1TQZA 2LOZA 1NTYA 4ZRJA 1ZC4B 4A6KA 2ELBA 1PLSA 2XQNM 3A98B 1V5MA 1WI1A 4PNKA 1NU2A 1SHCA 3ODOA 4HAUB 1MKEA 2YF0A 3HK0A 4P7IA 1BTNA 4EMOA 4DBBA 1W1GA 1X1GA 4HDOA 4F7HA 1X11A 5DH9B 1MAIA 2OQBA 2P0FA 3SUZA 1ZM0A 4GXBA 2Y7BA 4IOYX 2MDXA 5C5BB 2D10A 3GYOA 3NSUA 1QC6A 5D3XA 1UPRA 5KCVA 2AL6A 4HAWB 2CRFA 3KSYA 3QIJA 1BWNA 4ZRIA 1WJ1A 2NZ8B 2YS1A 2EC1A 2X18A 5LONB 1W1DA 1ZSQA 2R09A 1U27A 2D9XA 1XCGA 3HQCA 2DX1A 2DHIA 3D8EA 1Z87A 3F5RA 1IRSA 5JLJB 2UZRA 1DDMA 2R0DA 4NY0A 1P5TA 4H8SA 2VKIA 3SNHA 4WJ7A 4F7GA 1UEFA 2DHKA 1QQGA 2YS3A 1X86A 4GZUA 3GYPA 2M14A 2Y8GA 5J3YA 1MPHA 1Y5OA 2YSZA 3PVLA 3X23A 3D8DA 2VSZA 4F7UP 3WYFB 1FAOA 2D2QA 4B6HA 4IAPA 1XD4A 2RNRB 4DXAB 3KRWA 3DXCA 4HB3B 1MK7B 2RVBB 3A8QA 2PZ1A 3AU4A 5EFXA 2H7DA 3CIKA 4YL8A 2LULA 2HTHB 5J3QA 2L2IA 1U5GA 2D11A 4MT7A 2KUPA 1H4RA 2P8VA 3ULCA 2RUKB 1U2BA 4Y94A 2I5FA 2J0JA 1I7AA 3CXBB 4HB2B 2DFKA 1UNRA 1NI2A 2Z0PA 4GMVA 2CY4A 2K2JA 2OTXA 2DN6A 4Z2NA 3QWMA 1EGXA 2Z0QA 1MK9B 2HE7A 2VRWB 1K5DB 2DLWA 1FHOA 2COAA 2Z0OA 2MKRA 2DYNA 4K2PA 1TJ6A 2L1CA 4HATB 3KZ1A 3KRXA 2D9VA 1ISNA 1K5GB 2W2XC 1V5PA 4A6FA 2D4QA 3TW1A 2LG1A 4KHBB 3U7DA 4HHVA 4EKUA 2EJ8A 1WG7A 1NTVA 3N7CA 3AU5A 3IVFA 3DXDA 3MPXA 2FJLA 1E5WA 3ODXA 1ZC3B 3ML4A 2J0MA 2ADZA 5DI9B 3V5WA 1AWEA 1GG3A 1OQNA 1EVHA 3G9WA 4NSWA 1OMWA 2KCJA 5J3TA 4Z2MB 2D9YA 5LOPB 1X1FA 2K2UA 4HAZB 1UPQA 4K17A 3PVWA 5KQ1A 3DXEA 1GC6A 4YONA 1DROA 4GN1A 1WGQA 2DA0A 2YT1A 4HDQA 4C0AA 1WJMA 5GOWB 5KQ4A 2E2XA 5CLQB 2W2WA 4TYZA 2UVMA 2GCJA 4EJNA 1XKEA 5HE0A 3U8ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DKQ A;  3SO6 A;  1KZG A;  5DHF B;  3PEG A;  3A8P A;  4PQ0 A;  3PP2 A;  1FGY A;  2CAY A;  4MK0 A;  5C16 A;  2I5C A;  5HE3 A;  1V5U A;  2YT0 A;  5C79 A;  2N0Y A;  2P0D A;  4HB0 B;  2DYQ A;  2J59 M;  2UZS A;  5C5B A;  1TXD A;  4HB4 B;  1EF1 A;  3P6A A;  2Y8F A;  1FB8 A;  1OY2 A;  1BAK A;  1WVH A;  4TKN A;  5JHG A;  2DHJ A;  4CYE A;  2ROZ B;  4KHO A;  3FSS A;  3KY9 A;  4IFS A;  5JP4 A;  1DDW A;  2NMB A;  3M1I B;  3BJI A;  2JP2 A;  1AQC A;  3ZDT A;  4D0N B;  1XR0 B;  1Q67 A;  2G35 A;  3PG7 A;  1I2H A;  2ELA A;  3QBV B;  1U5E A;  1XOD A;  2GJY A;  3O96 A;  3TFM A;  1PFJ A;  2I1K A;  2GS0 A;  4WSF A;  1WGU A;  3HW2 B;  4HAX B;  2H7E A;  1V88 A;  1FGZ A;  2AEH A;  4WVF B;  2M38 A;  1KI1 B;  4BBK A;  3ZVR A;  1LW3 A;  1EAZ A;  1U5F A;  2DTC A;  2V76 A;  1XX0 A;  5HE1 A;  1U29 A;  2Q13 A;  2COC A;  2IFS A;  2N23 A;  1V61 A;  3SYX A;  1LB1 A;  2K00 A;  4K2O A;  1W1H A;  5C6R A;  5JHH A;  1H10 A;  2LOX A;  5FI0 A;  2YS5 A;  1N3H A;  4A5K A;  1X05 A;  2RSG A;  2P0H A;  2CY5 A;  1RRP B;  2MFQ A;  5DHA B;  1UNP A;  3T06 A;  2ZPY A;  1MIX A;  5HE2 A;  4KVG B;  3AJ4 A;  2J0K A;  1DYN A;  3FEH A;  3VOQ A;  2KGX B;  2MWN B;  1UNQ A;  2EMT A;  3WA0 A;  1FHW A;  1KZ7 A;  2RLO A;  4CHM A;  3UZT A;  2EMS A;  3PVU A;  4A6H A;  3TCA A;  3VIA A;  4GMX B;  1J19 A;  2LKO A;  5DIF B;  1GC7 A;  3PZD A;  3LJU X;  4KHA A;  2W2X D;  5D3V A;  1DDV A;  2COF A;  1DBH A;  3SV1 A;  3D8F A;  2YVC A;  4CHJ A;  1Y19 B;  2QKL A;  2D9W A;  3ODW A;  5D3Y A;  2ROV A;  4A6F B;  3TO1 A;  1ZVR A;  4DX9 0;  3FM8 C;  2YRY A;  3P7Z A;  2D9Z A;  1MIZ B;  1M7E A;  1PMS A;  1BTK A;  1FHX A;  5L81 A;  4DX8 A;  4XWX A;  1P3R A;  5CLL B;  5D27 A;  4GPT B;  2BCJ A;  4K81 A;  4ZRK A;  5D3W A;  3RCP A;  1U5D A;  3TVV A;  1P6S A;  3BIN A;  3F0W A;  3OAN A;  3MDB C;  1B55 A;  4HAY B;  2IYB A;  4HAV B;  1M7R A;  4MY6 A;  5FI1 A;  2LYD A;  3PSC A;  1J0W A;  1V89 A;  3ULB A;  2GCL A;  2QKM A;  1FOE A;  2DX5 A;  4L6E A;  2RGN B;  2I1J A;  2COD A;  2DKP A;  4KAX B;  1RJ2 A;  1SGH A;  1TQZ A;  2LOZ A;  1NTY A;  4ZRJ A;  1ZC4 B;  4A6K A;  2ELB A;  1PLS A;  2XQN M;  3A98 B;  1V5M A;  1WI1 A;  4PNK A;  1NU2 A;  1SHC A;  3ODO A;  4HAU B;  1MKE A;  2YF0 A;  3HK0 A;  4P7I A;  1BTN A;  4EMO A;  4DBB A;  1W1G A;  1X1G A;  4HDO A;  4F7H A;  1X11 A;  5DH9 B;  1MAI A;  2OQB A;  2P0F A;  3SUZ A;  1ZM0 A;  4GXB A;  2Y7B A;  4IOY X;  2MDX A;  5C5B B;  2D10 A;  3GYO A;  3NSU A;  1QC6 A;  5D3X A;  1UPR A;  5KCV A;  2AL6 A;  4HAW B;  2CRF A;  3KSY A;  3QIJ A;  1BWN A;  4ZRI A;  1WJ1 A;  2NZ8 B;  2YS1 A;  2EC1 A;  2X18 A;  5LON B;  1W1D A;  1ZSQ A;  2R09 A;  1U27 A;  2D9X A;  1XCG A;  3HQC A;  2DX1 A;  2DHI A;  3D8E A;  1Z87 A;  3F5R A;  1IRS A;  5JLJ B;  2UZR A;  1DDM A;  2R0D A;  4NY0 A;  1P5T A;  4H8S A;  2VKI A;  3SNH A;  4WJ7 A;  4F7G A;  1UEF A;  2DHK A;  1QQG A;  2YS3 A;  1X86 A;  4GZU A;  3GYP A;  2M14 A;  2Y8G A;  5J3Y A;  1MPH A;  1Y5O A;  2YSZ A;  3PVL A;  3X23 A;  3D8D A;  2VSZ A;  4F7U P;  3WYF B;  1FAO A;  2D2Q A;  4B6H A;  4IAP A;  1XD4 A;  2RNR B;  4DXA B;  3KRW A;  3DXC A;  4HB3 B;  1MK7 B;  2RVB B;  3A8Q A;  2PZ1 A;  3AU4 A;  5EFX A;  2H7D A;  3CIK A;  4YL8 A;  2LUL A;  2HTH B;  5J3Q A;  2L2I A;  1U5G A;  2D11 A;  4MT7 A;  2KUP A;  1H4R A;  2P8V A;  3ULC A;  2RUK B;  1U2B A;  4Y94 A;  2I5F A;  2J0J A;  1I7A A;  3CXB B;  4HB2 B;  2DFK A;  1UNR A;  1NI2 A;  2Z0P A;  4GMV A;  2CY4 A;  2K2J A;  2OTX A;  2DN6 A;  4Z2N A;  3QWM A;  1EGX A;  2Z0Q A;  1MK9 B;  2HE7 A;  2VRW B;  1K5D B;  2DLW A;  1FHO A;  2COA A;  2Z0O A;  2MKR A;  2DYN A;  4K2P A;  1TJ6 A;  2L1C A;  4HAT B;  3KZ1 A;  3KRX A;  2D9V A;  1ISN A;  1K5G B;  2W2X C;  1V5P A;  4A6F A;  2D4Q A;  3TW1 A;  2LG1 A;  4KHB B;  3U7D A;  4HHV A;  4EKU A;  2EJ8 A;  1WG7 A;  1NTV A;  3N7C A;  3AU5 A;  3IVF A;  3DXD A;  3MPX A;  2FJL A;  1E5W A;  3ODX A;  1ZC3 B;  3ML4 A;  2J0M A;  2ADZ A;  5DI9 B;  3V5W A;  1AWE A;  1GG3 A;  1OQN A;  1EVH A;  3G9W A;  4NSW A;  1OMW A;  2KCJ A;  5J3T A;  4Z2M B;  2D9Y A;  5LOP B;  1X1F A;  2K2U A;  4HAZ B;  1UPQ A;  4K17 A;  3PVW A;  5KQ1 A;  3DXE A;  1GC6 A;  4YON A;  1DRO A;  4GN1 A;  1WGQ A;  2DA0 A;  2YT1 A;  4HDQ A;  4C0A A;  1WJM A;  5GOW B;  5KQ4 A;  2E2X A;  5CLQ B;  2W2W A;  4TYZ A;  2UVM A;  2GCJ A;  4EJN A;  1XKE A;  5HE0 A;  3U8Z A; 
#chains in the Genus database with same CATH topology
 2DKQ A;  3SO6 A;  1KZG A;  5DHF B;  3PEG A;  3A8P A;  4PQ0 A;  3PP2 A;  2ZKM X;  4HSI A;  1FGY A;  2CAY A;  4MK0 A;  5C16 A;  2I5C A;  4OT1 A;  5HE3 A;  2KIE A;  1V5U A;  2YT0 A;  5C79 A;  2N0Y A;  2P0D A;  4HB0 B;  2DYQ A;  2J59 M;  2UZS A;  5C5B A;  1TXD A;  4HB4 B;  1EF1 A;  3P6A A;  2Y8F A;  1FB8 A;  1OY2 A;  1BAK A;  1WVH A;  4TKN A;  5JHG A;  2DHJ A;  4CYE A;  2ROZ B;  4KHO A;  3FSS A;  3KY9 A;  4IFS A;  5JP4 A;  1DDW A;  2NBV A;  2NMB A;  3M1I B;  2KIG A;  3BJI A;  2JP2 A;  1AQC A;  3ZDT A;  4D0N B;  1XR0 B;  1Q67 A;  2G35 A;  3PG7 A;  1I2H A;  2ELA A;  3QBV B;  1U5E A;  1XOD A;  2GJY A;  3O96 A;  3TFM A;  1PFJ A;  2I1K A;  2GS0 A;  4WSF A;  1WGU A;  3HW2 B;  4HAX B;  2H7E A;  1V88 A;  1FGZ A;  2AEH A;  4WVF B;  2Z4D A;  2K8E A;  2M38 A;  1KI1 B;  4BBK A;  3ZVR A;  1LW3 A;  1EAZ A;  1U5F A;  2DTC A;  2V76 A;  1XX0 A;  5HE1 A;  1U29 A;  2Q13 A;  4GOU A;  2COC A;  3DCX A;  2IFS A;  2N23 A;  1V61 A;  3SYX A;  3HSA A;  1LB1 A;  2K00 A;  4K2O A;  1W1H A;  5I2S A;  5C6R A;  5JHH A;  1H10 A;  2LOX A;  5FI0 A;  1ZYI A;  2YS5 A;  1N3H A;  3FVC A;  4A5K A;  1X05 A;  2RSG A;  2P0H A;  2CY5 A;  1RRP B;  2MFQ A;  5DHA B;  1UNP A;  3T06 A;  2ZPY A;  2Z59 A;  1MIX A;  5HE2 A;  4QXA B;  4KVG B;  3AJ4 A;  2J0K A;  1DYN A;  3FEH A;  3VOQ A;  2KGX B;  2MWN B;  1UNQ A;  2EMT A;  4QJ4 B;  3WA0 A;  1FHW A;  1KZ7 A;  2RLO A;  4CHM A;  3UZT A;  2EMS A;  3PVU A;  4A6H A;  3TCA A;  3VIA A;  4GMX B;  1J19 A;  2LKO A;  2KUQ A;  5DIF B;  1GC7 A;  3PZD A;  3LJU X;  4KHA A;  2W2X D;  5D3V A;  1DDV A;  2COF A;  1DBH A;  3SV1 A;  3D8F A;  2YVC A;  4CHJ A;  1Y19 B;  2QKL A;  2D9W A;  3ODW A;  5D3Y A;  2ROV A;  4A6F B;  3TO1 A;  1ZVR A;  4DX9 0;  3FM8 C;  2YRY A;  3P7Z A;  2D9Z A;  1MIZ B;  1M7E A;  1PMS A;  1BTK A;  1FHX A;  5L81 A;  4DX8 A;  4XWX A;  1P3R A;  5CLL B;  5D27 A;  4GPT B;  2BCJ A;  4K81 A;  4ZRK A;  3B77 A;  5D3W A;  3RCP A;  1U5D A;  3TVV A;  1P6S A;  3BIN A;  3F0W A;  3HIE A;  3OAN A;  3MDB C;  1B55 A;  4HAY B;  2Z14 A;  2IYB A;  4HAV B;  2GUM A;  1M7R A;  3NW8 A;  2YT2 A;  4MY6 A;  5FI1 A;  2LYD A;  5IRS A;  3PSC A;  4QJ5 B;  1J0W A;  1V89 A;  3ULB A;  2GCL A;  2QKM A;  1FOE A;  2DX5 A;  4L6E A;  2RGN B;  2I1J A;  2COD A;  2DKP A;  4KAX B;  1RJ2 A;  1SGH A;  1TQZ A;  2LOZ A;  1NTY A;  4ZRJ A;  1ZC4 B;  4A6K A;  2FJU B;  2ELB A;  1PLS A;  2XQN M;  3A98 B;  1V5M A;  1WI1 A;  4PNK A;  1NU2 A;  1SHC A;  3ODO A;  4HAU B;  4QJ3 B;  1MKE A;  2YF0 A;  3NWF A;  3HK0 A;  4P7I A;  5LG4 B;  1BTN A;  4EMO A;  4DBB A;  1W1G A;  1X1G A;  4HDO A;  4F7H A;  1X11 A;  5DH9 B;  1MAI A;  2OQB A;  2P0F A;  3SUZ A;  1ZM0 A;  4GXB A;  2Y7B A;  4IOY X;  2MDX A;  5C5B B;  2D10 A;  3GYO A;  3NSU A;  1QC6 A;  5D3X A;  1UPR A;  5KCV A;  2AL6 A;  4HAW B;  2CRF A;  3KSY A;  3QIJ A;  1BWN A;  4ZRI A;  1WJ1 A;  3NWA A;  2NZ8 B;  2YS1 A;  2EC1 A;  2X18 A;  3NWD A;  5LON B;  4KHB A;  1W1D A;  1ZSQ A;  2R09 A;  1U27 A;  2D9X A;  4OSN A;  1XCG A;  3HQC A;  2DX1 A;  2DHI A;  3D8E A;  4DIX A;  1Z87 A;  3F5R A;  1IRS A;  5JLJ B;  2UZR A;  1DDM A;  2R0D A;  4NY0 A;  1P5T A;  4H8S A;  2VKI A;  3SNH A;  4WJ7 A;  4F7G A;  1UEF A;  2DHK A;  1QQG A;  2YS3 A;  1X86 A;  4GZU A;  3GYP A;  2M14 A;  2Y8G A;  5J3Y A;  1MPH A;  1Y5O A;  2YSZ A;  3PVL A;  3X23 A;  3D8D A;  2VSZ A;  4F7U P;  3WYF B;  1FAO A;  2D2Q A;  4B6H A;  1T77 A;  4IAP A;  1XD4 A;  2RNR B;  4DXA B;  3KRW A;  3DXC A;  4HB3 B;  1MK7 B;  2RVB B;  3A8Q A;  4L1R A;  2PZ1 A;  3AU4 A;  5EFX A;  2H7D A;  3CIK A;  4YL8 A;  2LUL A;  2HTH B;  5J3Q A;  2L2I A;  1U5G A;  2D11 A;  4MT7 A;  2R2Y A;  2KUP A;  1H4R A;  4D6W A;  2P8V A;  3ULC A;  2RUK B;  4CSQ A;  1U2B A;  4Y94 A;  2I5F A;  2J0J A;  1I7A A;  3CXB B;  4HB2 B;  2DFK A;  1UNR A;  1NI2 A;  2Z0P A;  4GMV A;  2CY4 A;  2K2J A;  2KR0 A;  2OTX A;  2DN6 A;  4Z2N A;  3QWM A;  3U12 A;  1EGX A;  2Z0Q A;  1MK9 B;  2HE7 A;  2VRW B;  1K5D B;  2DLW A;  1FHO A;  2COA A;  2Z0O A;  2MKR A;  2DYN A;  4K2P A;  1TJ6 A;  2L1C A;  3OHM B;  4HAT B;  3KZ1 A;  3KRX A;  2D9V A;  3A58 A;  1ISN A;  1K5G B;  2W2X C;  1V5P A;  4A6F A;  2D4Q A;  3TW1 A;  2LG1 A;  4KHB B;  3U7D A;  4HHV A;  4EKU A;  2EJ8 A;  1WG7 A;  1NTV A;  3N7C A;  3AU5 A;  3IVF A;  3DXD A;  3MPX A;  1MI1 A;  2FJL A;  1E5W A;  3ODX A;  1ZC3 B;  3ML4 A;  2J0M A;  2ADZ A;  5DI9 B;  3V5W A;  2Z13 A;  1AWE A;  1GG3 A;  1OQN A;  1EVH A;  3G9W A;  4NSW A;  1OMW A;  2KCJ A;  5J3T A;  4Z2M B;  2D9Y A;  5LOP B;  1X1F A;  2K2U A;  4HAZ B;  1UPQ A;  2K49 A;  4K17 A;  2RRF A;  3PVW A;  5KQ1 A;  3DXE A;  1GC6 A;  4YON A;  1DRO A;  4GN1 A;  1WGQ A;  2DA0 A;  2YT1 A;  4HDQ A;  4C0A A;  1WJM A;  5GOW B;  5KQ4 A;  2E2X A;  5CLQ B;  2W2W A;  4GNK B;  4TYZ A;  2UVM A;  2GCJ A;  4EJN A;  1XKE A;  5I2M A;  5HE0 A;  5M4Y B;  3U8Z A; 
#chains in the Genus database with same CATH homology
 2DKQ A;  3SO6 A;  1KZG A;  5DHF B;  3PEG A;  3A8P A;  4PQ0 A;  3PP2 A;  1FGY A;  2CAY A;  4MK0 A;  5C16 A;  2I5C A;  5HE3 A;  1V5U A;  2YT0 A;  5C79 A;  2N0Y A;  2P0D A;  4HB0 B;  2DYQ A;  2J59 M;  2UZS A;  5C5B A;  1TXD A;  4HB4 B;  1EF1 A;  3P6A A;  2Y8F A;  1FB8 A;  1OY2 A;  1BAK A;  1WVH A;  4TKN A;  5JHG A;  2DHJ A;  4CYE A;  2ROZ B;  4KHO A;  3FSS A;  3KY9 A;  4IFS A;  5JP4 A;  1DDW A;  2NMB A;  3M1I B;  3BJI A;  2JP2 A;  1AQC A;  3ZDT A;  4D0N B;  1XR0 B;  1Q67 A;  2G35 A;  3PG7 A;  1I2H A;  2ELA A;  3QBV B;  1U5E A;  1XOD A;  2GJY A;  3O96 A;  3TFM A;  1PFJ A;  2I1K A;  2GS0 A;  4WSF A;  1WGU A;  3HW2 B;  4HAX B;  2H7E A;  1V88 A;  1FGZ A;  2AEH A;  4WVF B;  2M38 A;  1KI1 B;  4BBK A;  3ZVR A;  1LW3 A;  1EAZ A;  1U5F A;  2DTC A;  2V76 A;  1XX0 A;  5HE1 A;  1U29 A;  2Q13 A;  2COC A;  2IFS A;  2N23 A;  1V61 A;  3SYX A;  1LB1 A;  2K00 A;  4K2O A;  1W1H A;  5C6R A;  5JHH A;  1H10 A;  2LOX A;  5FI0 A;  2YS5 A;  1N3H A;  4A5K A;  1X05 A;  2RSG A;  2P0H A;  2CY5 A;  1RRP B;  2MFQ A;  5DHA B;  1UNP A;  3T06 A;  2ZPY A;  1MIX A;  5HE2 A;  4KVG B;  3AJ4 A;  2J0K A;  1DYN A;  3FEH A;  3VOQ A;  2KGX B;  2MWN B;  1UNQ A;  2EMT A;  3WA0 A;  1FHW A;  1KZ7 A;  2RLO A;  4CHM A;  3UZT A;  2EMS A;  3PVU A;  4A6H A;  3TCA A;  3VIA A;  4GMX B;  1J19 A;  2LKO A;  5DIF B;  1GC7 A;  3PZD A;  3LJU X;  4KHA A;  2W2X D;  5D3V A;  1DDV A;  2COF A;  1DBH A;  3SV1 A;  3D8F A;  2YVC A;  4CHJ A;  1Y19 B;  2QKL A;  2D9W A;  3ODW A;  5D3Y A;  2ROV A;  4A6F B;  3TO1 A;  1ZVR A;  4DX9 0;  3FM8 C;  2YRY A;  3P7Z A;  2D9Z A;  1MIZ B;  1M7E A;  1PMS A;  1BTK A;  1FHX A;  5L81 A;  4DX8 A;  4XWX A;  1P3R A;  5CLL B;  5D27 A;  4GPT B;  2BCJ A;  4K81 A;  4ZRK A;  5D3W A;  3RCP A;  1U5D A;  3TVV A;  1P6S A;  3BIN A;  3F0W A;  3OAN A;  3MDB C;  1B55 A;  4HAY B;  2IYB A;  4HAV B;  1M7R A;  4MY6 A;  5FI1 A;  2LYD A;  3PSC A;  1J0W A;  1V89 A;  3ULB A;  2GCL A;  2QKM A;  1FOE A;  2DX5 A;  4L6E A;  2RGN B;  2I1J A;  2COD A;  2DKP A;  4KAX B;  1RJ2 A;  1SGH A;  1TQZ A;  2LOZ A;  1NTY A;  4ZRJ A;  1ZC4 B;  4A6K A;  2ELB A;  1PLS A;  2XQN M;  3A98 B;  1V5M A;  1WI1 A;  4PNK A;  1NU2 A;  1SHC A;  3ODO A;  4HAU B;  1MKE A;  2YF0 A;  3HK0 A;  4P7I A;  1BTN A;  4EMO A;  4DBB A;  1W1G A;  1X1G A;  4HDO A;  4F7H A;  1X11 A;  5DH9 B;  1MAI A;  2OQB A;  2P0F A;  3SUZ A;  1ZM0 A;  4GXB A;  2Y7B A;  4IOY X;  2MDX A;  5C5B B;  2D10 A;  3GYO A;  3NSU A;  1QC6 A;  5D3X A;  1UPR A;  5KCV A;  2AL6 A;  4HAW B;  2CRF A;  3KSY A;  3QIJ A;  1BWN A;  4ZRI A;  1WJ1 A;  2NZ8 B;  2YS1 A;  2EC1 A;  2X18 A;  5LON B;  1W1D A;  1ZSQ A;  2R09 A;  1U27 A;  2D9X A;  1XCG A;  3HQC A;  2DX1 A;  2DHI A;  3D8E A;  1Z87 A;  3F5R A;  1IRS A;  5JLJ B;  2UZR A;  1DDM A;  2R0D A;  4NY0 A;  1P5T A;  4H8S A;  2VKI A;  3SNH A;  4WJ7 A;  4F7G A;  1UEF A;  2DHK A;  1QQG A;  2YS3 A;  1X86 A;  4GZU A;  3GYP A;  2M14 A;  2Y8G A;  5J3Y A;  1MPH A;  1Y5O A;  2YSZ A;  3PVL A;  3X23 A;  3D8D A;  2VSZ A;  4F7U P;  3WYF B;  1FAO A;  2D2Q A;  4B6H A;  4IAP A;  1XD4 A;  2RNR B;  4DXA B;  3KRW A;  3DXC A;  4HB3 B;  1MK7 B;  2RVB B;  3A8Q A;  2PZ1 A;  3AU4 A;  5EFX A;  2H7D A;  3CIK A;  4YL8 A;  2LUL A;  2HTH B;  5J3Q A;  2L2I A;  1U5G A;  2D11 A;  4MT7 A;  2KUP A;  1H4R A;  2P8V A;  3ULC A;  2RUK B;  1U2B A;  4Y94 A;  2I5F A;  2J0J A;  1I7A A;  3CXB B;  4HB2 B;  2DFK A;  1UNR A;  1NI2 A;  2Z0P A;  4GMV A;  2CY4 A;  2K2J A;  2OTX A;  2DN6 A;  4Z2N A;  3QWM A;  1EGX A;  2Z0Q A;  1MK9 B;  2HE7 A;  2VRW B;  1K5D B;  2DLW A;  1FHO A;  2COA A;  2Z0O A;  2MKR A;  2DYN A;  4K2P A;  1TJ6 A;  2L1C A;  4HAT B;  3KZ1 A;  3KRX A;  2D9V A;  1ISN A;  1K5G B;  2W2X C;  1V5P A;  4A6F A;  2D4Q A;  3TW1 A;  2LG1 A;  4KHB B;  3U7D A;  4HHV A;  4EKU A;  2EJ8 A;  1WG7 A;  1NTV A;  3N7C A;  3AU5 A;  3IVF A;  3DXD A;  3MPX A;  2FJL A;  1E5W A;  3ODX A;  1ZC3 B;  3ML4 A;  2J0M A;  2ADZ A;  5DI9 B;  3V5W A;  1AWE A;  1GG3 A;  1OQN A;  1EVH A;  3G9W A;  4NSW A;  1OMW A;  2KCJ A;  5J3T A;  4Z2M B;  2D9Y A;  5LOP B;  1X1F A;  2K2U A;  4HAZ B;  1UPQ A;  4K17 A;  3PVW A;  5KQ1 A;  3DXE A;  1GC6 A;  4YON A;  1DRO A;  4GN1 A;  1WGQ A;  2DA0 A;  2YT1 A;  4HDQ A;  4C0A A;  1WJM A;  5GOW B;  5KQ4 A;  2E2X A;  5CLQ B;  2W2W A;  4TYZ A;  2UVM A;  2GCJ A;  4EJN A;  1XKE A;  5HE0 A;  3U8Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...