2ADZA

Solution structure of the joined ph domain of alpha1-syntrophin
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
178
structure length
178
Chain Sequence
ASGRRAPRTGLLELRCGAGSGAGGERWQRVLLSLAEDALTVSPADGEPGPEPEPAQLNGAAEPGAAPPQLPEALLLQREVSPYFKNSAGGTSVGWDSPPASPLQRQPSSPGPQPRNLSEAKHVSLKMAYVSRRCTPTDPEPRYLEICAADGQDAVFLRAKDEASARSWAGAIQAQIGT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding
molecule keywords Alpha-1-syntrophin
publication title Structure of the split PH domain and distinct lipid-binding properties of the PH-PDZ supramodule of alpha-syntrophin
pubmed doi rcsb
source organism Mus musculus
total genus 11
structure length 178
sequence length 178
ec nomenclature
pdb deposition date 2005-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18012 PH_17 PH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2adzA01
4Z2NA 2L1CA 2P0HA 2YS3A 5LONB 1QQGA 2RSGA 4B6HA 2Y8GA 2QKMA 3O96A 5DHAB 1M7EA 1WJMA 2DTCA 2J0MA 5DHFB 3GYOA 1EGXA 1WVHA 2ZPYA 4NSWA 3F0WA 2DYQA 3TFMA 3ML4A 5HE2A 5D3WA 2J0KA 4IFSA 2COFA 1NU2A 1UPQA 1I2HA 1U2BA 1FHOA 4HB2B 1EAZA 3QBVB 1ZM0A 2COCA 2P8VA 2RUKB 5DIFB 1K5DB 1P3RA 2DA0A 3KY9A 1Y5OA 3PP2A 3KSYA 1FHWA 2DHIA 4TYZA 5C6RA 1XCGA 1AWEA 5C79A 2COAA 1WGUA 2D9YA 1X86A 5FI1A 2DFKA 1SGHA 2I5FA 1KZ7A 3PEGA 3ODXA 1RRPB 3ODOA 2RVBB 2EMTA 4DX90 4GZUA 1ZSQA 4HDQA 1WG7A 2H7DA 4EJNA 1ISNA 1MIZB 4MK0A 2AL6A 4Z2MB 2YT1A 4F7GA 3BINA 2ELAA 2PZ1A 3RCPA 3HW2B 5JP4A 1XKEA 2Z0PA 2DHKA 2VRWB 3MDBC 1FB8A 1FGZA 2ELBA 4MY6A 4CYEA 1IRSA 2K2JA 1I7AA 1NI2A 1Z87A 3PVUA 1XODA 4HDOA 5EFXA 2VSZA 3FSSA 4HATB 3D8DA 2I1JA 2L2IA 3DXCA 1ZC3B 4HB3B 5HE1A 3VIAA 3DXEA 2EMSA 3WYFB 1H10A 4F7HA 2KGXB 5KQ1A 1QC6A 4D0NB 2G35A 3T06A 2X18A 2E2XA 4L6EA 4YONA 5D27A 2LULA 4EMOA 2BCJA 4ZRIA 2K00A 2Z0OA 4TKNA 5CLLB 2EJ8A 1DROA 5KQ4A 3SNHA 2MFQA 3NSUA 3PVLA 4K2PA 1MIXA 5D3YA 4MT7A 1BTNA 1ZVRA 2D9ZA 2FJLA 1Q67A 2GJYA 2CY5A 4KAXB 2N23A 1X1FA 3DXDA 1P6SA 2Z0QA 5JHHA 3SYXA 1BAKA 3ODWA 2GCJA 4HAVB 4WSFA 1V61A 2AEHA 2GCLA 3BJIA 4A6HA 3D8EA 4A6FB 4HAUB 1GC6A 3PVWA 1NTYA 5J3TA 4HB4B 4GPTB 4DX8A 2GS0A 1ZC4B 1XD4A 1U5GA 2I1KA 2QKLA 1LB1A 1UEFA 3ULCA 4PQ0A 4DBBA 5GOWB 4HAZB 5D3VA 3TVVA 1MK7B 5HE3A 3AU5A 2M38A 2N0YA 2LOZA 5FI0A 1V89A 1NTVA 4GN1A 3KRXA 2YS1A 1Y19B 1KI1B 3HQCA 3TCAA 4WJ7A 3HK0A 4KHAA 2D9XA 1DYNA 3SV1A 2YRYA 3CXBB 4KVGB 3SO6A 2YVCA 2UZRA 1RJ2A 2LG1A 1AQCA 1XR0B 2MDXA 2DX1A 3FEHA 1OY2A 1WGQA 2DKPA 2ROVA 2V76A 3QIJA 1X1GA 4XWXA 2DX5A 4KHOA 3U8ZA 3MPXA 3SUZA 1U27A 2J0JA 2D4QA 1PLSA 1MK9B 5C5BA 2OQBA 3A8PA 5C16A 1MPHA 3PZDA 4F7UP 3ZDTA 3TW1A 5CLQB 4ZRKA 2YF0A 5J3QA 2W2XC 2IFSA 3KZ1A 1UNPA 1GC7A 4YL8A 1V5MA 4IAPA 4CHMA 1U29A 1OMWA 4GMXB 2HTHB 2CODA 2LOXA 4NY0A 3A8QA 2YT0A 2DN6A 1E5WA 1TXDA 1U5EA 2Y8FA 3UZTA 1FHXA 1KZGA 3P6AA 1X11A 5DH9B 1XX0A 1OQNA 5J3YA 3A98B 3IVFA 1K5GB 2CRFA 3WA0A 3F5RA 5L81A 2XQNM 1EF1A 5JHGA 4EKUA 1V5PA 4IOYX 1B55A 4Y94A 1V88A 3TO1A 2RGNB 2KCJA 4K2OA 2ROZB 4C0AA 3VOQA 5HE0A 1W1GA 2YS5A 1DBHA 2D10A 1W1DA 4K17A 2ADZA 2J59M 1GG3A 1V5UA 4DXAB 1FGYA 1BTKA 2JP2A 2R0DA 1TJ6A 3M1IB 1X05A 2NZ8B 3P7ZA 2H7EA 3OANA 3PG7A 2DLWA 2P0FA 2D9WA 1FOEA 1DDVA 3PSCA 2DYNA 1PFJA 2W2WA 1MAIA 2Q13A 3AU4A 1WJ1A 3QWMA 1DDWA 3AJ4A 2CAYA 3G9WA 2UVMA 1U5FA 3GYPA 5DI9B 1UPRA 3ULBA 2D2QA 1M7RA 3KRWA 1UNRA 1J0WA 1P5TA 2Y7BA 4A6KA 4K81A 4CHJA 5C5BB 1EVHA 1PMSA 4A6FA 2R09A 2HE7A 4H8SA 2M14A 3CIKA 3FM8C 4ZRJA 2NMBA 5KCVA 2RLOA 4A5KA 5JLJB 4GMVA 1UNQA 2UZSA 2I5CA 2VKIA 3D8FA 2LYDA 4PNKA 4P7IA 2DHJA 2IYBA 1W1HA 1H4RA 2EC1A 1N3HA 2K2UA 3LJUX 2D11A 3ZVRA 1BWNA 1LW3A 2MKRA 3X23A 2KUPA 4HAWB 4HAYB 4HB0B 4GXBA 4BBKA 2RNRB 2YSZA 4WVFB 2CY4A 1U5DA 4HAXB 2LKOA 1TQZA 1SHCA 2W2XD 1J19A 2P0DA 2OTXA 3U7DA 3N7CA 5LOPB 4HHVA 5D3XA 1DDMA 2MWNB 3V5WA 1MKEA 2DKQA 2D9VA 4KHBB 1FAOA 1WI1A
chains in the Genus database with same CATH superfamily
4Z2NA 2L1CA 2P0HA 2YS3A 5LONB 1QQGA 2RSGA 4B6HA 2Y8GA 4QJ4B 2QKMA 4GNKB 3O96A 5DHAB 1M7EA 1WJMA 2DTCA 2J0MA 5DHFB 3GYOA 1EGXA 1WVHA 2ZPYA 4NSWA 3F0WA 2DYQA 2FJUB 3TFMA 3ML4A 5HE2A 5D3WA 2J0KA 4IFSA 2GUMA 2KUQA 2COFA 1NU2A 1UPQA 1I2HA 1U2BA 1FHOA 4HB2B 1EAZA 3QBVB 1ZM0A 2COCA 2P8VA 2RUKB 5DIFB 1K5DB 1P3RA 2DA0A 3KY9A 5IRSA 1Y5OA 3PP2A 3KSYA 1FHWA 2DHIA 4TYZA 5C6RA 1XCGA 3NW8A 1AWEA 5C79A 4L1RA 2COAA 1WGUA 2D9YA 1X86A 5FI1A 2DFKA 1SGHA 2I5FA 1KZ7A 1MI1A 3PEGA 3ODXA 1RRPB 3B77A 3ODOA 2RVBB 2EMTA 4DX90 4GZUA 1ZSQA 4HDQA 1WG7A 2H7DA 2KR0A 4EJNA 1ISNA 1MIZB 4MK0A 2AL6A 4Z2MB 2YT1A 4F7GA 3BINA 2ELAA 2PZ1A 3RCPA 3HW2B 5JP4A 1XKEA 2Z0PA 2DHKA 2VRWB 3MDBC 1FB8A 1FGZA 2ELBA 4MY6A 4CYEA 1IRSA 5I2SA 2K2JA 1I7AA 1NI2A 2Z4DA 1Z87A 3PVUA 1XODA 4HDOA 5EFXA 2VSZA 3FSSA 4HATB 3D8DA 3NWDA 2I1JA 2L2IA 3DXCA 1ZC3B 4HB3B 5HE1A 4OT1A 3VIAA 3DXEA 2EMSA 3WYFB 1H10A 4F7HA 2KGXB 5KQ1A 1QC6A 4D0NB 2G35A 3T06A 2X18A 2E2XA 4QXAB 4L6EA 4YONA 5D27A 3U12A 2LULA 4EMOA 2BCJA 4ZRIA 2K00A 2Z0OA 4TKNA 5CLLB 2EJ8A 1DROA 5KQ4A 3SNHA 2MFQA 3NSUA 3PVLA 4K2PA 2RRFA 1MIXA 5D3YA 4MT7A 1BTNA 1ZVRA 2D9ZA 2FJLA 1Q67A 2GJYA 2CY5A 4KAXB 2N23A 1X1FA 3DXDA 1P6SA 2Z0QA 5JHHA 3SYXA 1BAKA 3ODWA 2GCJA 4HAVB 4OSNA 4WSFA 1V61A 2AEHA 2GCLA 3BJIA 4A6HA 3D8EA 4A6FB 3NWAA 4HAUB 5LG4B 1GC6A 3PVWA 1NTYA 5J3TA 4HB4B 4GPTB 4DX8A 2GS0A 1ZC4B 1XD4A 1U5GA 2I1KA 2QKLA 1LB1A 1UEFA 3ULCA 4PQ0A 4DBBA 5GOWB 4HAZB 5D3VA 3TVVA 1MK7B 5HE3A 2KIGA 2YT2A 3AU5A 2M38A 2N0YA 2LOZA 5FI0A 1V89A 4HSIA 1NTVA 4GN1A 3KRXA 2YS1A 1Y19B 1KI1B 3HIEA 3HQCA 3TCAA 4WJ7A 2Z14A 3HK0A 4KHAA 2D9XA 1DYNA 3SV1A 2YRYA 4CSQA 3CXBB 1T77A 4KVGB 3SO6A 2YVCA 2UZRA 5M4YB 1RJ2A 2LG1A 1AQCA 1XR0B 2MDXA 2DX1A 3FEHA 5I2MA 1OY2A 1WGQA 2DKPA 2ROVA 2V76A 3QIJA 1X1GA 4XWXA 2DX5A 4KHOA 3U8ZA 3MPXA 3SUZA 1U27A 2J0JA 2D4QA 1PLSA 1MK9B 2ZKMX 5C5BA 2OQBA 3A8PA 5C16A 1MPHA 3A58A 3PZDA 4F7UP 3ZDTA 3TW1A 5CLQB 4ZRKA 2YF0A 5J3QA 2W2XC 2IFSA 3KZ1A 4DIXA 1UNPA 2KIEA 1GC7A 4YL8A 4GOUA 1V5MA 4IAPA 4CHMA 1U29A 1OMWA 4GMXB 2HTHB 2CODA 2LOXA 3DCXA 4NY0A 3A8QA 2YT0A 2DN6A 1E5WA 1TXDA 1U5EA 2Y8FA 3UZTA 1FHXA 1KZGA 3P6AA 1X11A 5DH9B 1XX0A 1OQNA 5J3YA 3A98B 2Z59A 3IVFA 1K5GB 2CRFA 3WA0A 3F5RA 5L81A 2XQNM 1EF1A 5JHGA 4EKUA 1V5PA 4IOYX 3OHMB 1B55A 4Y94A 1V88A 3TO1A 2RGNB 2KCJA 4K2OA 2K49A 2ROZB 4C0AA 3VOQA 5HE0A 4QJ5B 1W1GA 2NBVA 2R2YA 2YS5A 1DBHA 2D10A 1W1DA 4K17A 2ADZA 2J59M 1GG3A 1V5UA 4DXAB 1FGYA 1BTKA 2JP2A 2R0DA 1TJ6A 3M1IB 1X05A 2NZ8B 4KHBA 3P7ZA 2H7EA 4QJ3B 3OANA 3FVCA 3PG7A 2DLWA 1ZYIA 2P0FA 2D9WA 1FOEA 1DDVA 3PSCA 2DYNA 4D6WA 1PFJA 2W2WA 1MAIA 2Q13A 3AU4A 1WJ1A 3QWMA 2Z13A 1DDWA 3AJ4A 2CAYA 3G9WA 2UVMA 1U5FA 3GYPA 5DI9B 1UPRA 3ULBA 2D2QA 1M7RA 3KRWA 1UNRA 1J0WA 1P5TA 2Y7BA 4A6KA 4K81A 4CHJA 5C5BB 1EVHA 1PMSA 4A6FA 2R09A 2HE7A 4H8SA 2M14A 3CIKA 3FM8C 4ZRJA 2NMBA 5KCVA 2RLOA 4A5KA 3NWFA 5JLJB 4GMVA 1UNQA 2UZSA 2I5CA 2VKIA 3D8FA 2LYDA 4PNKA 4P7IA 2DHJA 2IYBA 1W1HA 1H4RA 2EC1A 1N3HA 2K2UA 3LJUX 2D11A 3ZVRA 1BWNA 1LW3A 2MKRA 3X23A 2KUPA 4HAWB 4HAYB 4HB0B 2K8EA 4GXBA 4BBKA 2RNRB 2YSZA 4WVFB 2CY4A 1U5DA 4HAXB 3HSAA 2LKOA 1TQZA 1SHCA 2W2XD 1J19A 2P0DA 2OTXA 3U7DA 3N7CA 5LOPB 4HHVA 5D3XA 1DDMA 2MWNB 3V5WA 1MKEA 2DKQA 2D9VA 4KHBB 1FAOA 1WI1A
chains in the Genus database with same CATH topology
4Z2NA 2L1CA 2P0HA 2YS3A 5LONB 1QQGA 2RSGA 4B6HA 2Y8GA 2QKMA 3O96A 5DHAB 1M7EA 1WJMA 2DTCA 2J0MA 5DHFB 3GYOA 1EGXA 1WVHA 2ZPYA 4NSWA 3F0WA 2DYQA 3TFMA 3ML4A 5HE2A 5D3WA 2J0KA 4IFSA 2COFA 1NU2A 1UPQA 1I2HA 1U2BA 1FHOA 4HB2B 1EAZA 3QBVB 1ZM0A 2COCA 2P8VA 2RUKB 5DIFB 1K5DB 1P3RA 2DA0A 3KY9A 1Y5OA 3PP2A 3KSYA 1FHWA 2DHIA 4TYZA 5C6RA 1XCGA 1AWEA 5C79A 2COAA 1WGUA 2D9YA 1X86A 5FI1A 2DFKA 1SGHA 2I5FA 1KZ7A 3PEGA 3ODXA 1RRPB 3ODOA 2RVBB 2EMTA 4DX90 4GZUA 1ZSQA 4HDQA 1WG7A 2H7DA 4EJNA 1ISNA 1MIZB 4MK0A 2AL6A 4Z2MB 2YT1A 4F7GA 3BINA 2ELAA 2PZ1A 3RCPA 3HW2B 5JP4A 1XKEA 2Z0PA 2DHKA 2VRWB 3MDBC 1FB8A 1FGZA 2ELBA 4MY6A 4CYEA 1IRSA 2K2JA 1I7AA 1NI2A 1Z87A 3PVUA 1XODA 4HDOA 5EFXA 2VSZA 3FSSA 4HATB 3D8DA 2I1JA 2L2IA 3DXCA 1ZC3B 4HB3B 5HE1A 3VIAA 3DXEA 2EMSA 3WYFB 1H10A 4F7HA 2KGXB 5KQ1A 1QC6A 4D0NB 2G35A 3T06A 2X18A 2E2XA 4L6EA 4YONA 5D27A 2LULA 4EMOA 2BCJA 4ZRIA 2K00A 2Z0OA 4TKNA 5CLLB 2EJ8A 1DROA 5KQ4A 3SNHA 2MFQA 3NSUA 3PVLA 4K2PA 1MIXA 5D3YA 4MT7A 1BTNA 1ZVRA 2D9ZA 2FJLA 1Q67A 2GJYA 2CY5A 4KAXB 2N23A 1X1FA 3DXDA 1P6SA 2Z0QA 5JHHA 3SYXA 1BAKA 3ODWA 2GCJA 4HAVB 4WSFA 1V61A 2AEHA 2GCLA 3BJIA 4A6HA 3D8EA 4A6FB 4HAUB 1GC6A 3PVWA 1NTYA 5J3TA 4HB4B 4GPTB 4DX8A 2GS0A 1ZC4B 1XD4A 1U5GA 2I1KA 2QKLA 1LB1A 1UEFA 3ULCA 4PQ0A 4DBBA 5GOWB 4HAZB 5D3VA 3TVVA 1MK7B 5HE3A 3AU5A 2M38A 2N0YA 2LOZA 5FI0A 1V89A 1NTVA 4GN1A 3KRXA 2YS1A 1Y19B 1KI1B 3HQCA 3TCAA 4WJ7A 3HK0A 4KHAA 2D9XA 1DYNA 3SV1A 2YRYA 3CXBB 4KVGB 3SO6A 2YVCA 2UZRA 1RJ2A 2LG1A 1AQCA 1XR0B 2MDXA 2DX1A 3FEHA 1OY2A 1WGQA 2DKPA 2ROVA 2V76A 3QIJA 1X1GA 4XWXA 2DX5A 4KHOA 3U8ZA 3MPXA 3SUZA 1U27A 2J0JA 2D4QA 1PLSA 1MK9B 5C5BA 2OQBA 3A8PA 5C16A 1MPHA 3PZDA 4F7UP 3ZDTA 3TW1A 5CLQB 4ZRKA 2YF0A 5J3QA 2W2XC 2IFSA 3KZ1A 1UNPA 1GC7A 4YL8A 1V5MA 4IAPA 4CHMA 1U29A 1OMWA 4GMXB 2HTHB 2CODA 2LOXA 4NY0A 3A8QA 2YT0A 2DN6A 1E5WA 1TXDA 1U5EA 2Y8FA 3UZTA 1FHXA 1KZGA 3P6AA 1X11A 5DH9B 1XX0A 1OQNA 5J3YA 3A98B 3IVFA 1K5GB 2CRFA 3WA0A 3F5RA 5L81A 2XQNM 1EF1A 5JHGA 4EKUA 1V5PA 4IOYX 1B55A 4Y94A 1V88A 3TO1A 2RGNB 2KCJA 4K2OA 2ROZB 4C0AA 3VOQA 5HE0A 1W1GA 2YS5A 1DBHA 2D10A 1W1DA 4K17A 2ADZA 2J59M 1GG3A 1V5UA 4DXAB 1FGYA 1BTKA 2JP2A 2R0DA 1TJ6A 3M1IB 1X05A 2NZ8B 3P7ZA 2H7EA 3OANA 3PG7A 2DLWA 2P0FA 2D9WA 1FOEA 1DDVA 3PSCA 2DYNA 1PFJA 2W2WA 1MAIA 2Q13A 3AU4A 1WJ1A 3QWMA 1DDWA 3AJ4A 2CAYA 3G9WA 2UVMA 1U5FA 3GYPA 5DI9B 1UPRA 3ULBA 2D2QA 1M7RA 3KRWA 1UNRA 1J0WA 1P5TA 2Y7BA 4A6KA 4K81A 4CHJA 5C5BB 1EVHA 1PMSA 4A6FA 2R09A 2HE7A 4H8SA 2M14A 3CIKA 3FM8C 4ZRJA 2NMBA 5KCVA 2RLOA 4A5KA 5JLJB 4GMVA 1UNQA 2UZSA 2I5CA 2VKIA 3D8FA 2LYDA 4PNKA 4P7IA 2DHJA 2IYBA 1W1HA 1H4RA 2EC1A 1N3HA 2K2UA 3LJUX 2D11A 3ZVRA 1BWNA 1LW3A 2MKRA 3X23A 2KUPA 4HAWB 4HAYB 4HB0B 4GXBA 4BBKA 2RNRB 2YSZA 4WVFB 2CY4A 1U5DA 4HAXB 2LKOA 1TQZA 1SHCA 2W2XD 1J19A 2P0DA 2OTXA 3U7DA 3N7CA 5LOPB 4HHVA 5D3XA 1DDMA 2MWNB 3V5WA 1MKEA 2DKQA 2D9VA 4KHBB 1FAOA 1WI1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Z2N A;  2L1C A;  2P0H A;  2YS3 A;  5LON B;  1QQG A;  2RSG A;  4B6H A;  2Y8G A;  2QKM A;  3O96 A;  5DHA B;  1M7E A;  1WJM A;  2DTC A;  2J0M A;  5DHF B;  3GYO A;  1EGX A;  1WVH A;  2ZPY A;  4NSW A;  3F0W A;  2DYQ A;  3TFM A;  3ML4 A;  5HE2 A;  5D3W A;  2J0K A;  4IFS A;  2COF A;  1NU2 A;  1UPQ A;  1I2H A;  1U2B A;  1FHO A;  4HB2 B;  1EAZ A;  3QBV B;  1ZM0 A;  2COC A;  2P8V A;  2RUK B;  5DIF B;  1K5D B;  1P3R A;  2DA0 A;  3KY9 A;  1Y5O A;  3PP2 A;  3KSY A;  1FHW A;  2DHI A;  4TYZ A;  5C6R A;  1XCG A;  1AWE A;  5C79 A;  2COA A;  1WGU A;  2D9Y A;  1X86 A;  5FI1 A;  2DFK A;  1SGH A;  2I5F A;  1KZ7 A;  3PEG A;  3ODX A;  1RRP B;  3ODO A;  2RVB B;  2EMT A;  4DX9 0;  4GZU A;  1ZSQ A;  4HDQ A;  1WG7 A;  2H7D A;  4EJN A;  1ISN A;  1MIZ B;  4MK0 A;  2AL6 A;  4Z2M B;  2YT1 A;  4F7G A;  3BIN A;  2ELA A;  2PZ1 A;  3RCP A;  3HW2 B;  5JP4 A;  1XKE A;  2Z0P A;  2DHK A;  2VRW B;  3MDB C;  1FB8 A;  1FGZ A;  2ELB A;  4MY6 A;  4CYE A;  1IRS A;  2K2J A;  1I7A A;  1NI2 A;  1Z87 A;  3PVU A;  1XOD A;  4HDO A;  5EFX A;  2VSZ A;  3FSS A;  4HAT B;  3D8D A;  2I1J A;  2L2I A;  3DXC A;  1ZC3 B;  4HB3 B;  5HE1 A;  3VIA A;  3DXE A;  2EMS A;  3WYF B;  1H10 A;  4F7H A;  2KGX B;  5KQ1 A;  1QC6 A;  4D0N B;  2G35 A;  3T06 A;  2X18 A;  2E2X A;  4L6E A;  4YON A;  5D27 A;  2LUL A;  4EMO A;  2BCJ A;  4ZRI A;  2K00 A;  2Z0O A;  4TKN A;  5CLL B;  2EJ8 A;  1DRO A;  5KQ4 A;  3SNH A;  2MFQ A;  3NSU A;  3PVL A;  4K2P A;  1MIX A;  5D3Y A;  4MT7 A;  1BTN A;  1ZVR A;  2D9Z A;  2FJL A;  1Q67 A;  2GJY A;  2CY5 A;  4KAX B;  2N23 A;  1X1F A;  3DXD A;  1P6S A;  2Z0Q A;  5JHH A;  3SYX A;  1BAK A;  3ODW A;  2GCJ A;  4HAV B;  4WSF A;  1V61 A;  2AEH A;  2GCL A;  3BJI A;  4A6H A;  3D8E A;  4A6F B;  4HAU B;  1GC6 A;  3PVW A;  1NTY A;  5J3T A;  4HB4 B;  4GPT B;  4DX8 A;  2GS0 A;  1ZC4 B;  1XD4 A;  1U5G A;  2I1K A;  2QKL A;  1LB1 A;  1UEF A;  3ULC A;  4PQ0 A;  4DBB A;  5GOW B;  4HAZ B;  5D3V A;  3TVV A;  1MK7 B;  5HE3 A;  3AU5 A;  2M38 A;  2N0Y A;  2LOZ A;  5FI0 A;  1V89 A;  1NTV A;  4GN1 A;  3KRX A;  2YS1 A;  1Y19 B;  1KI1 B;  3HQC A;  3TCA A;  4WJ7 A;  3HK0 A;  4KHA A;  2D9X A;  1DYN A;  3SV1 A;  2YRY A;  3CXB B;  4KVG B;  3SO6 A;  2YVC A;  2UZR A;  1RJ2 A;  2LG1 A;  1AQC A;  1XR0 B;  2MDX A;  2DX1 A;  3FEH A;  1OY2 A;  1WGQ A;  2DKP A;  2ROV A;  2V76 A;  3QIJ A;  1X1G A;  4XWX A;  2DX5 A;  4KHO A;  3U8Z A;  3MPX A;  3SUZ A;  1U27 A;  2J0J A;  2D4Q A;  1PLS A;  1MK9 B;  5C5B A;  2OQB A;  3A8P A;  5C16 A;  1MPH A;  3PZD A;  4F7U P;  3ZDT A;  3TW1 A;  5CLQ B;  4ZRK A;  2YF0 A;  5J3Q A;  2W2X C;  2IFS A;  3KZ1 A;  1UNP A;  1GC7 A;  4YL8 A;  1V5M A;  4IAP A;  4CHM A;  1U29 A;  1OMW A;  4GMX B;  2HTH B;  2COD A;  2LOX A;  4NY0 A;  3A8Q A;  2YT0 A;  2DN6 A;  1E5W A;  1TXD A;  1U5E A;  2Y8F A;  3UZT A;  1FHX A;  1KZG A;  3P6A A;  1X11 A;  5DH9 B;  1XX0 A;  1OQN A;  5J3Y A;  3A98 B;  3IVF A;  1K5G B;  2CRF A;  3WA0 A;  3F5R A;  5L81 A;  2XQN M;  1EF1 A;  5JHG A;  4EKU A;  1V5P A;  4IOY X;  1B55 A;  4Y94 A;  1V88 A;  3TO1 A;  2RGN B;  2KCJ A;  4K2O A;  2ROZ B;  4C0A A;  3VOQ A;  5HE0 A;  1W1G A;  2YS5 A;  1DBH A;  2D10 A;  1W1D A;  4K17 A;  2ADZ A;  2J59 M;  1GG3 A;  1V5U A;  4DXA B;  1FGY A;  1BTK A;  2JP2 A;  2R0D A;  1TJ6 A;  3M1I B;  1X05 A;  2NZ8 B;  3P7Z A;  2H7E A;  3OAN A;  3PG7 A;  2DLW A;  2P0F A;  2D9W A;  1FOE A;  1DDV A;  3PSC A;  2DYN A;  1PFJ A;  2W2W A;  1MAI A;  2Q13 A;  3AU4 A;  1WJ1 A;  3QWM A;  1DDW A;  3AJ4 A;  2CAY A;  3G9W A;  2UVM A;  1U5F A;  3GYP A;  5DI9 B;  1UPR A;  3ULB A;  2D2Q A;  1M7R A;  3KRW A;  1UNR A;  1J0W A;  1P5T A;  2Y7B A;  4A6K A;  4K81 A;  4CHJ A;  5C5B B;  1EVH A;  1PMS A;  4A6F A;  2R09 A;  2HE7 A;  4H8S A;  2M14 A;  3CIK A;  3FM8 C;  4ZRJ A;  2NMB A;  5KCV A;  2RLO A;  4A5K A;  5JLJ B;  4GMV A;  1UNQ A;  2UZS A;  2I5C A;  2VKI A;  3D8F A;  2LYD A;  4PNK A;  4P7I A;  2DHJ A;  2IYB A;  1W1H A;  1H4R A;  2EC1 A;  1N3H A;  2K2U A;  3LJU X;  2D11 A;  3ZVR A;  1BWN A;  1LW3 A;  2MKR A;  3X23 A;  2KUP A;  4HAW B;  4HAY B;  4HB0 B;  4GXB A;  4BBK A;  2RNR B;  2YSZ A;  4WVF B;  2CY4 A;  1U5D A;  4HAX B;  2LKO A;  1TQZ A;  1SHC A;  2W2X D;  1J19 A;  2P0D A;  2OTX A;  3U7D A;  3N7C A;  5LOP B;  4HHV A;  5D3X A;  1DDM A;  2MWN B;  3V5W A;  1MKE A;  2DKQ A;  2D9V A;  4KHB B;  1FAO A;  1WI1 A; 
#chains in the Genus database with same CATH topology
 4Z2N A;  2L1C A;  2P0H A;  2YS3 A;  5LON B;  1QQG A;  2RSG A;  4B6H A;  2Y8G A;  4QJ4 B;  2QKM A;  4GNK B;  3O96 A;  5DHA B;  1M7E A;  1WJM A;  2DTC A;  2J0M A;  5DHF B;  3GYO A;  1EGX A;  1WVH A;  2ZPY A;  4NSW A;  3F0W A;  2DYQ A;  2FJU B;  3TFM A;  3ML4 A;  5HE2 A;  5D3W A;  2J0K A;  4IFS A;  2GUM A;  2KUQ A;  2COF A;  1NU2 A;  1UPQ A;  1I2H A;  1U2B A;  1FHO A;  4HB2 B;  1EAZ A;  3QBV B;  1ZM0 A;  2COC A;  2P8V A;  2RUK B;  5DIF B;  1K5D B;  1P3R A;  2DA0 A;  3KY9 A;  5IRS A;  1Y5O A;  3PP2 A;  3KSY A;  1FHW A;  2DHI A;  4TYZ A;  5C6R A;  1XCG A;  3NW8 A;  1AWE A;  5C79 A;  4L1R A;  2COA A;  1WGU A;  2D9Y A;  1X86 A;  5FI1 A;  2DFK A;  1SGH A;  2I5F A;  1KZ7 A;  1MI1 A;  3PEG A;  3ODX A;  1RRP B;  3B77 A;  3ODO A;  2RVB B;  2EMT A;  4DX9 0;  4GZU A;  1ZSQ A;  4HDQ A;  1WG7 A;  2H7D A;  2KR0 A;  4EJN A;  1ISN A;  1MIZ B;  4MK0 A;  2AL6 A;  4Z2M B;  2YT1 A;  4F7G A;  3BIN A;  2ELA A;  2PZ1 A;  3RCP A;  3HW2 B;  5JP4 A;  1XKE A;  2Z0P A;  2DHK A;  2VRW B;  3MDB C;  1FB8 A;  1FGZ A;  2ELB A;  4MY6 A;  4CYE A;  1IRS A;  5I2S A;  2K2J A;  1I7A A;  1NI2 A;  2Z4D A;  1Z87 A;  3PVU A;  1XOD A;  4HDO A;  5EFX A;  2VSZ A;  3FSS A;  4HAT B;  3D8D A;  3NWD A;  2I1J A;  2L2I A;  3DXC A;  1ZC3 B;  4HB3 B;  5HE1 A;  4OT1 A;  3VIA A;  3DXE A;  2EMS A;  3WYF B;  1H10 A;  4F7H A;  2KGX B;  5KQ1 A;  1QC6 A;  4D0N B;  2G35 A;  3T06 A;  2X18 A;  2E2X A;  4QXA B;  4L6E A;  4YON A;  5D27 A;  3U12 A;  2LUL A;  4EMO A;  2BCJ A;  4ZRI A;  2K00 A;  2Z0O A;  4TKN A;  5CLL B;  2EJ8 A;  1DRO A;  5KQ4 A;  3SNH A;  2MFQ A;  3NSU A;  3PVL A;  4K2P A;  2RRF A;  1MIX A;  5D3Y A;  4MT7 A;  1BTN A;  1ZVR A;  2D9Z A;  2FJL A;  1Q67 A;  2GJY A;  2CY5 A;  4KAX B;  2N23 A;  1X1F A;  3DXD A;  1P6S A;  2Z0Q A;  5JHH A;  3SYX A;  1BAK A;  3ODW A;  2GCJ A;  4HAV B;  4OSN A;  4WSF A;  1V61 A;  2AEH A;  2GCL A;  3BJI A;  4A6H A;  3D8E A;  4A6F B;  3NWA A;  4HAU B;  5LG4 B;  1GC6 A;  3PVW A;  1NTY A;  5J3T A;  4HB4 B;  4GPT B;  4DX8 A;  2GS0 A;  1ZC4 B;  1XD4 A;  1U5G A;  2I1K A;  2QKL A;  1LB1 A;  1UEF A;  3ULC A;  4PQ0 A;  4DBB A;  5GOW B;  4HAZ B;  5D3V A;  3TVV A;  1MK7 B;  5HE3 A;  2KIG A;  2YT2 A;  3AU5 A;  2M38 A;  2N0Y A;  2LOZ A;  5FI0 A;  1V89 A;  4HSI A;  1NTV A;  4GN1 A;  3KRX A;  2YS1 A;  1Y19 B;  1KI1 B;  3HIE A;  3HQC A;  3TCA A;  4WJ7 A;  2Z14 A;  3HK0 A;  4KHA A;  2D9X A;  1DYN A;  3SV1 A;  2YRY A;  4CSQ A;  3CXB B;  1T77 A;  4KVG B;  3SO6 A;  2YVC A;  2UZR A;  5M4Y B;  1RJ2 A;  2LG1 A;  1AQC A;  1XR0 B;  2MDX A;  2DX1 A;  3FEH A;  5I2M A;  1OY2 A;  1WGQ A;  2DKP A;  2ROV A;  2V76 A;  3QIJ A;  1X1G A;  4XWX A;  2DX5 A;  4KHO A;  3U8Z A;  3MPX A;  3SUZ A;  1U27 A;  2J0J A;  2D4Q A;  1PLS A;  1MK9 B;  2ZKM X;  5C5B A;  2OQB A;  3A8P A;  5C16 A;  1MPH A;  3A58 A;  3PZD A;  4F7U P;  3ZDT A;  3TW1 A;  5CLQ B;  4ZRK A;  2YF0 A;  5J3Q A;  2W2X C;  2IFS A;  3KZ1 A;  4DIX A;  1UNP A;  2KIE A;  1GC7 A;  4YL8 A;  4GOU A;  1V5M A;  4IAP A;  4CHM A;  1U29 A;  1OMW A;  4GMX B;  2HTH B;  2COD A;  2LOX A;  3DCX A;  4NY0 A;  3A8Q A;  2YT0 A;  2DN6 A;  1E5W A;  1TXD A;  1U5E A;  2Y8F A;  3UZT A;  1FHX A;  1KZG A;  3P6A A;  1X11 A;  5DH9 B;  1XX0 A;  1OQN A;  5J3Y A;  3A98 B;  2Z59 A;  3IVF A;  1K5G B;  2CRF A;  3WA0 A;  3F5R A;  5L81 A;  2XQN M;  1EF1 A;  5JHG A;  4EKU A;  1V5P A;  4IOY X;  3OHM B;  1B55 A;  4Y94 A;  1V88 A;  3TO1 A;  2RGN B;  2KCJ A;  4K2O A;  2K49 A;  2ROZ B;  4C0A A;  3VOQ A;  5HE0 A;  4QJ5 B;  1W1G A;  2NBV A;  2R2Y A;  2YS5 A;  1DBH A;  2D10 A;  1W1D A;  4K17 A;  2ADZ A;  2J59 M;  1GG3 A;  1V5U A;  4DXA B;  1FGY A;  1BTK A;  2JP2 A;  2R0D A;  1TJ6 A;  3M1I B;  1X05 A;  2NZ8 B;  4KHB A;  3P7Z A;  2H7E A;  4QJ3 B;  3OAN A;  3FVC A;  3PG7 A;  2DLW A;  1ZYI A;  2P0F A;  2D9W A;  1FOE A;  1DDV A;  3PSC A;  2DYN A;  4D6W A;  1PFJ A;  2W2W A;  1MAI A;  2Q13 A;  3AU4 A;  1WJ1 A;  3QWM A;  2Z13 A;  1DDW A;  3AJ4 A;  2CAY A;  3G9W A;  2UVM A;  1U5F A;  3GYP A;  5DI9 B;  1UPR A;  3ULB A;  2D2Q A;  1M7R A;  3KRW A;  1UNR A;  1J0W A;  1P5T A;  2Y7B A;  4A6K A;  4K81 A;  4CHJ A;  5C5B B;  1EVH A;  1PMS A;  4A6F A;  2R09 A;  2HE7 A;  4H8S A;  2M14 A;  3CIK A;  3FM8 C;  4ZRJ A;  2NMB A;  5KCV A;  2RLO A;  4A5K A;  3NWF A;  5JLJ B;  4GMV A;  1UNQ A;  2UZS A;  2I5C A;  2VKI A;  3D8F A;  2LYD A;  4PNK A;  4P7I A;  2DHJ A;  2IYB A;  1W1H A;  1H4R A;  2EC1 A;  1N3H A;  2K2U A;  3LJU X;  2D11 A;  3ZVR A;  1BWN A;  1LW3 A;  2MKR A;  3X23 A;  2KUP A;  4HAW B;  4HAY B;  4HB0 B;  2K8E A;  4GXB A;  4BBK A;  2RNR B;  2YSZ A;  4WVF B;  2CY4 A;  1U5D A;  4HAX B;  3HSA A;  2LKO A;  1TQZ A;  1SHC A;  2W2X D;  1J19 A;  2P0D A;  2OTX A;  3U7D A;  3N7C A;  5LOP B;  4HHV A;  5D3X A;  1DDM A;  2MWN B;  3V5W A;  1MKE A;  2DKQ A;  2D9V A;  4KHB B;  1FAO A;  1WI1 A; 
#chains in the Genus database with same CATH homology
 4Z2N A;  2L1C A;  2P0H A;  2YS3 A;  5LON B;  1QQG A;  2RSG A;  4B6H A;  2Y8G A;  2QKM A;  3O96 A;  5DHA B;  1M7E A;  1WJM A;  2DTC A;  2J0M A;  5DHF B;  3GYO A;  1EGX A;  1WVH A;  2ZPY A;  4NSW A;  3F0W A;  2DYQ A;  3TFM A;  3ML4 A;  5HE2 A;  5D3W A;  2J0K A;  4IFS A;  2COF A;  1NU2 A;  1UPQ A;  1I2H A;  1U2B A;  1FHO A;  4HB2 B;  1EAZ A;  3QBV B;  1ZM0 A;  2COC A;  2P8V A;  2RUK B;  5DIF B;  1K5D B;  1P3R A;  2DA0 A;  3KY9 A;  1Y5O A;  3PP2 A;  3KSY A;  1FHW A;  2DHI A;  4TYZ A;  5C6R A;  1XCG A;  1AWE A;  5C79 A;  2COA A;  1WGU A;  2D9Y A;  1X86 A;  5FI1 A;  2DFK A;  1SGH A;  2I5F A;  1KZ7 A;  3PEG A;  3ODX A;  1RRP B;  3ODO A;  2RVB B;  2EMT A;  4DX9 0;  4GZU A;  1ZSQ A;  4HDQ A;  1WG7 A;  2H7D A;  4EJN A;  1ISN A;  1MIZ B;  4MK0 A;  2AL6 A;  4Z2M B;  2YT1 A;  4F7G A;  3BIN A;  2ELA A;  2PZ1 A;  3RCP A;  3HW2 B;  5JP4 A;  1XKE A;  2Z0P A;  2DHK A;  2VRW B;  3MDB C;  1FB8 A;  1FGZ A;  2ELB A;  4MY6 A;  4CYE A;  1IRS A;  2K2J A;  1I7A A;  1NI2 A;  1Z87 A;  3PVU A;  1XOD A;  4HDO A;  5EFX A;  2VSZ A;  3FSS A;  4HAT B;  3D8D A;  2I1J A;  2L2I A;  3DXC A;  1ZC3 B;  4HB3 B;  5HE1 A;  3VIA A;  3DXE A;  2EMS A;  3WYF B;  1H10 A;  4F7H A;  2KGX B;  5KQ1 A;  1QC6 A;  4D0N B;  2G35 A;  3T06 A;  2X18 A;  2E2X A;  4L6E A;  4YON A;  5D27 A;  2LUL A;  4EMO A;  2BCJ A;  4ZRI A;  2K00 A;  2Z0O A;  4TKN A;  5CLL B;  2EJ8 A;  1DRO A;  5KQ4 A;  3SNH A;  2MFQ A;  3NSU A;  3PVL A;  4K2P A;  1MIX A;  5D3Y A;  4MT7 A;  1BTN A;  1ZVR A;  2D9Z A;  2FJL A;  1Q67 A;  2GJY A;  2CY5 A;  4KAX B;  2N23 A;  1X1F A;  3DXD A;  1P6S A;  2Z0Q A;  5JHH A;  3SYX A;  1BAK A;  3ODW A;  2GCJ A;  4HAV B;  4WSF A;  1V61 A;  2AEH A;  2GCL A;  3BJI A;  4A6H A;  3D8E A;  4A6F B;  4HAU B;  1GC6 A;  3PVW A;  1NTY A;  5J3T A;  4HB4 B;  4GPT B;  4DX8 A;  2GS0 A;  1ZC4 B;  1XD4 A;  1U5G A;  2I1K A;  2QKL A;  1LB1 A;  1UEF A;  3ULC A;  4PQ0 A;  4DBB A;  5GOW B;  4HAZ B;  5D3V A;  3TVV A;  1MK7 B;  5HE3 A;  3AU5 A;  2M38 A;  2N0Y A;  2LOZ A;  5FI0 A;  1V89 A;  1NTV A;  4GN1 A;  3KRX A;  2YS1 A;  1Y19 B;  1KI1 B;  3HQC A;  3TCA A;  4WJ7 A;  3HK0 A;  4KHA A;  2D9X A;  1DYN A;  3SV1 A;  2YRY A;  3CXB B;  4KVG B;  3SO6 A;  2YVC A;  2UZR A;  1RJ2 A;  2LG1 A;  1AQC A;  1XR0 B;  2MDX A;  2DX1 A;  3FEH A;  1OY2 A;  1WGQ A;  2DKP A;  2ROV A;  2V76 A;  3QIJ A;  1X1G A;  4XWX A;  2DX5 A;  4KHO A;  3U8Z A;  3MPX A;  3SUZ A;  1U27 A;  2J0J A;  2D4Q A;  1PLS A;  1MK9 B;  5C5B A;  2OQB A;  3A8P A;  5C16 A;  1MPH A;  3PZD A;  4F7U P;  3ZDT A;  3TW1 A;  5CLQ B;  4ZRK A;  2YF0 A;  5J3Q A;  2W2X C;  2IFS A;  3KZ1 A;  1UNP A;  1GC7 A;  4YL8 A;  1V5M A;  4IAP A;  4CHM A;  1U29 A;  1OMW A;  4GMX B;  2HTH B;  2COD A;  2LOX A;  4NY0 A;  3A8Q A;  2YT0 A;  2DN6 A;  1E5W A;  1TXD A;  1U5E A;  2Y8F A;  3UZT A;  1FHX A;  1KZG A;  3P6A A;  1X11 A;  5DH9 B;  1XX0 A;  1OQN A;  5J3Y A;  3A98 B;  3IVF A;  1K5G B;  2CRF A;  3WA0 A;  3F5R A;  5L81 A;  2XQN M;  1EF1 A;  5JHG A;  4EKU A;  1V5P A;  4IOY X;  1B55 A;  4Y94 A;  1V88 A;  3TO1 A;  2RGN B;  2KCJ A;  4K2O A;  2ROZ B;  4C0A A;  3VOQ A;  5HE0 A;  1W1G A;  2YS5 A;  1DBH A;  2D10 A;  1W1D A;  4K17 A;  2ADZ A;  2J59 M;  1GG3 A;  1V5U A;  4DXA B;  1FGY A;  1BTK A;  2JP2 A;  2R0D A;  1TJ6 A;  3M1I B;  1X05 A;  2NZ8 B;  3P7Z A;  2H7E A;  3OAN A;  3PG7 A;  2DLW A;  2P0F A;  2D9W A;  1FOE A;  1DDV A;  3PSC A;  2DYN A;  1PFJ A;  2W2W A;  1MAI A;  2Q13 A;  3AU4 A;  1WJ1 A;  3QWM A;  1DDW A;  3AJ4 A;  2CAY A;  3G9W A;  2UVM A;  1U5F A;  3GYP A;  5DI9 B;  1UPR A;  3ULB A;  2D2Q A;  1M7R A;  3KRW A;  1UNR A;  1J0W A;  1P5T A;  2Y7B A;  4A6K A;  4K81 A;  4CHJ A;  5C5B B;  1EVH A;  1PMS A;  4A6F A;  2R09 A;  2HE7 A;  4H8S A;  2M14 A;  3CIK A;  3FM8 C;  4ZRJ A;  2NMB A;  5KCV A;  2RLO A;  4A5K A;  5JLJ B;  4GMV A;  1UNQ A;  2UZS A;  2I5C A;  2VKI A;  3D8F A;  2LYD A;  4PNK A;  4P7I A;  2DHJ A;  2IYB A;  1W1H A;  1H4R A;  2EC1 A;  1N3H A;  2K2U A;  3LJU X;  2D11 A;  3ZVR A;  1BWN A;  1LW3 A;  2MKR A;  3X23 A;  2KUP A;  4HAW B;  4HAY B;  4HB0 B;  4GXB A;  4BBK A;  2RNR B;  2YSZ A;  4WVF B;  2CY4 A;  1U5D A;  4HAX B;  2LKO A;  1TQZ A;  1SHC A;  2W2X D;  1J19 A;  2P0D A;  2OTX A;  3U7D A;  3N7C A;  5LOP B;  4HHV A;  5D3X A;  1DDM A;  2MWN B;  3V5W A;  1MKE A;  2DKQ A;  2D9V A;  4KHB B;  1FAO A;  1WI1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...