2ADZA

Solution structure of the joined ph domain of alpha1-syntrophin
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
178
structure length
178
Chain Sequence
b'ASGRRAPRTGLLELRCGAGSGAGGERWQRVLLSLAEDALTVSPADGEPGPEPEPAQLNGAAEPGAAPPQLPEALLLQREVSPYFKNSAGGTSVGWDSPPASPLQRQPSSPGPQPRNLSEAKHVSLKMAYVSRRCTPTDPEPRYLEICAADGQDAVFLRAKDEASARSWAGAIQAQIGT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Alpha-1-syntrophin
publication title Structure of the split PH domain and distinct lipid-binding properties of the PH-PDZ supramodule of alpha-syntrophin
pubmed doi rcsb
source organism Mus musculus
molecule tags Protein binding
total genus 11
structure length 178
sequence length 178
ec nomenclature
pdb deposition date 2005-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18012 PH_17 PH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2adzA01
5C5BB 3A8QA 2P0DA 3N7CA 4CHJA 4DX90 2RUKB 4GN1A 1WVHA 1DDWA 4IFSA 2UZSA 5JHHA 1MKEA 2RVBB 4WJ7A 4GZUA 1AWEA 3F5RA 4HAXB 1BTKA 2UZRA 3AU4A 4YL8A 2HE7A 5JHGA 5GOWB 2P8VA 4K2OA 1ZC4B 1GC6A 3GYOA 2HTHB 2RGNB 3M1IB 1X05A 2RLOA 2W2WA 3U7DA 4ZRJA 1Q67A 2ZPYA 2M38A 5DI9B 1I2HA 4HAVB 3A8PA 1KI1B 1GG3A 2D9YA 2YSZA 1QQGA 1H4RA 3RCPA 5C16A 2LYDA 4HB4B 2VRWB 2YT1A 2CAYA 1BAKA 1EVHA 1XR0B 3QIJA 1XKEA 3VIAA 5FI0A 4Y94A 2YRYA 1WGQA 4A6FB 4MT7A 1J0WA 1KZ7A 2Z0PA 4HATB 2GJYA 3TW1A 3KRXA 3T06A 3DXCA 1EGXA 2YS3A 3ZDTA 2V76A 5KCVA 2UVMA 4HAWB 1AQCA 2R0DA 2XQNM 5KQ1A 2J0KA 4PQ0A 2COAA 4HB3B 4Z2NA 1P3RA 3IVFA 2ELAA 2DHIA 2MWNB 2DYNA 4F7HA 4EJNA 1Y19B 2D9ZA 2QKMA 1N3HA 1P5TA 1WG7A 4WSFA 4HHVA 5D3YA 3P6AA 3AJ4A 4KHBB 4WVFB 5D3XA 3KZ1A 1MPHA 2ADZA 2VKIA 2K2UA 4GXBA 4HAZB 1XD4A 1B55A 4GMXB 5D3VA 2RSGA 2DLWA 1WJ1A 3G9WA 5JLJB 3DXDA 3P7ZA 1Y5OA 2EC1A 4A5KA 2DX5A 2DTCA 5D27A 3TVVA 1U5GA 1E5WA 4EKUA 1H10A 2L2IA 3ULCA 4IAPA 2E2XA 4GMVA 3KSYA 2I1JA 4HDOA 4DX8A 3PVUA 4KHAA 1RJ2A 2DKQA 2Y8FA 5HE2A 5FI1A 3UZTA 1X1FA 3BINA 3TCAA 2GCLA 4HDQA 5L81A 2DYQA 2D4QA 2KCJA 2J0MA 2Z0OA 4BBKA 2LOZA 2LULA 2DX1A 1EF1A 1W1HA 3PSCA 1M7EA 4K17A 2ROZB 4CHMA 2I5FA 2AL6A 1DROA 2IFSA 1NI2A 1WI1A 2GS0A 2N0YA 5KQ4A 2YVCA 3FSSA 2DFKA 2P0HA 3AU5A 4C0AA 1WJMA 4NSWA 1GC7A 3ODWA 2K00A 4HB2B 2YS5A 2ROVA 4F7UP 1FHWA 2N23A 3A98B 2G35A 3TO1A 1EAZA 3DXEA 3SV1A 2P0FA 4A6KA 1V88A 5JP4A 1DYNA 1MK9B 1ZVRA 2MFQA 4P7IA 3X23A 5C5BA 2Y8GA 1U5FA 1XODA 4XWXA 1V5PA 1ZM0A 3V5WA 1BTNA 1OMWA 3GYPA 1XX0A 5DH9B 3VOQA 1P6SA 2IYBA 3MDBC 2Z0QA 3D8DA 4K2PA 5HE3A 2MDXA 2EJ8A 3WA0A 3F0WA 3PP2A 2FJLA 2YF0A 4TYZA 3FM8C 2DKPA 1UNRA 5J3YA 5D3WA 2COFA 2Y7BA 5LOPB 2YT0A 1X86A 2OTXA 1V61A 2ELBA 2X18A 2BCJA 4HB0B 3ZVRA 2DN6A 3KRWA 1SGHA 1DBHA 1U5EA 1V5MA 3CIKA 3ODXA 5DIFB 1J19A 4ZRKA 2D9WA 3PG7A 2AEHA 1RRPB 4GPTB 3O96A 2I1KA 3PVLA 1UEFA 1KZGA 2R09A 2YS1A 3OANA 4HAUB 3WYFB 5EFXA 1OY2A 2CY5A 4ZRIA 1I7AA 1V89A 4DBBA 1ZSQA 2D11A 2QKLA 1XCGA 1QC6A 4IOYX 2RNRB 3BJIA 1PFJA 3PZDA 2CY4A 2J59M 3PVWA 4DXAB 2PZ1A 1MIXA 1FGZA 1K5DB 2GCJA 4Z2MB 2LG1A 3SUZA 5DHAB 1WGUA 2DHKA 1BWNA 5C79A 5HE1A 1M7RA 1W1GA 3SYXA 1W1DA 3SO6A 3TFMA 5C6RA 4KAXB 1PMSA 2H7DA 2M14A 2MKRA 1FB8A 2LKOA 3SNHA 5CLLB 2D10A 2LOXA 2COCA 1SHCA 1UPRA 5J3TA 2OQBA 5LONB 4YONA 2W2XC 1LW3A 1FAOA 1DDMA 4L6EA 2CRFA 3HK0A 1UNQA 4TKNA 2VSZA 2NZ8B 1FOEA 1LB1A 1FHXA 4CYEA 2JP2A 5CLQB 2EMSA 3D8EA 3NSUA 2Q13A 1MIZB 1TJ6A 3QBVB 2H7EA 1MAIA 2I5CA 5J3QA 2D9VA 1MK7B 4NY0A 1UPQA 3HW2B 1U5DA 1U27A 2CODA 3CXBB 3KY9A 2J0JA 2KUPA 2D2QA 2EMTA 3FEHA 3ODOA 1K5GB 1TQZA 1X1GA 1FGYA 3HQCA 3LJUX 1NTYA 4K81A 1Z87A 4PNKA 1TXDA 1NTVA 2KGXB 4B6HA 4MY6A 1NU2A 5HE0A 3D8FA 4H8SA 4KHOA 2K2JA 2NMBA 1IRSA 3MPXA 4D0NB 2D9XA 4KVGB 3QWMA 3PEGA 1U29A 1UNPA 4EMOA 3ULBA 3ML4A 1U2BA 4MK0A 4F7GA 2L1CA 1FHOA 3U8ZA 1PLSA 1ISNA 2W2XD 5DHFB 4A6HA 2DA0A 1ZC3B 4HAYB 1V5UA 2DHJA 1DDVA 1X11A 4A6FA 1OQNA
chains in the Genus database with same CATH superfamily
5C5BB 3A8QA 2P0DA 4DIXA 3N7CA 4CHJA 3DCXA 4DX90 2RUKB 4GN1A 1WVHA 1DDWA 4IFSA 2UZSA 5JHHA 1MKEA 2RVBB 4WJ7A 4GZUA 1AWEA 3F5RA 4HAXB 1BTKA 2K8EA 2UZRA 3AU4A 4YL8A 2HE7A 5JHGA 5GOWB 2P8VA 4K2OA 1ZC4B 1GC6A 3GYOA 2HTHB 2RRFA 2RGNB 4HSIA 3M1IB 1X05A 5I2MA 2RLOA 2W2WA 3U7DA 4ZRJA 1Q67A 2ZPYA 3NWAA 2M38A 5DI9B 1I2HA 4HAVB 3A8PA 1KI1B 1GG3A 2D9YA 2YSZA 1QQGA 1H4RA 3RCPA 5C16A 2KUQA 2LYDA 4HB4B 2VRWB 2YT1A 2CAYA 1BAKA 5M4YB 1EVHA 1XR0B 3QIJA 1XKEA 3VIAA 5FI0A 4Y94A 2YRYA 1WGQA 4A6FB 4MT7A 1J0WA 1KZ7A 2Z0PA 4HATB 2GJYA 3TW1A 3KRXA 3T06A 3HSAA 3DXCA 1EGXA 2YS3A 4OT1A 3ZDTA 2V76A 2FJUB 5KCVA 2UVMA 4HAWB 1AQCA 2R0DA 2XQNM 5KQ1A 2J0KA 4PQ0A 2COAA 3NWFA 4HB3B 4Z2NA 1P3RA 3IVFA 2ELAA 2DHIA 2ZKMX 2MWNB 2DYNA 4F7HA 4EJNA 1Y19B 2D9ZA 4GOUA 2QKMA 1N3HA 1P5TA 1WG7A 4WSFA 4HHVA 5D3YA 3P6AA 4D6WA 3AJ4A 2Z59A 4KHBB 4WVFB 5D3XA 3KZ1A 1MPHA 2ADZA 2VKIA 2K2UA 4GXBA 4HAZB 1XD4A 1B55A 4GMXB 5D3VA 2RSGA 2DLWA 1WJ1A 3G9WA 5JLJB 3DXDA 3P7ZA 1Y5OA 2EC1A 4A5KA 2DX5A 2DTCA 5D27A 3TVVA 1U5GA 1E5WA 4EKUA 1H10A 2L2IA 3ULCA 4IAPA 2E2XA 4GMVA 3KSYA 2I1JA 3NW8A 4HDOA 4DX8A 3PVUA 4KHAA 1RJ2A 4QJ4B 2DKQA 2Y8FA 5HE2A 5FI1A 3UZTA 3OHMB 1X1FA 3BINA 3TCAA 2GCLA 4HDQA 5L81A 2DYQA 2D4QA 2KCJA 2J0MA 2Z0OA 4BBKA 2LOZA 2LULA 5LG4B 2DX1A 2Z4DA 1EF1A 1W1HA 3PSCA 5I2SA 1M7EA 4K17A 1MI1A 2ROZB 4CHMA 2I5FA 2AL6A 1DROA 2IFSA 1NI2A 1WI1A 2GS0A 2N0YA 5KQ4A 2YVCA 3FSSA 2DFKA 2P0HA 3AU5A 4C0AA 1WJMA 4NSWA 1GC7A 3ODWA 2K00A 4HB2B 2YS5A 2ROVA 4GNKB 4F7UP 1FHWA 2N23A 2NBVA 3A98B 4QXAB 2G35A 3TO1A 1EAZA 3DXEA 3SV1A 2P0FA 4A6KA 1V88A 5JP4A 1DYNA 1MK9B 1ZVRA 2MFQA 4P7IA 3X23A 5C5BA 2Y8GA 2R2YA 1U5FA 1XODA 4XWXA 1V5PA 1ZM0A 3V5WA 1BTNA 1OMWA 3GYPA 1XX0A 5DH9B 3VOQA 1P6SA 2K49A 5IRSA 2IYBA 3MDBC 2Z0QA 3D8DA 4K2PA 5HE3A 2MDXA 2EJ8A 3WA0A 3F0WA 3PP2A 2FJLA 2YF0A 2Z14A 4TYZA 3FM8C 2DKPA 1UNRA 5J3YA 5D3WA 2COFA 2Y7BA 5LOPB 2YT0A 1X86A 2OTXA 4CSQA 1V61A 2ELBA 2X18A 2BCJA 1ZYIA 4HB0B 3ZVRA 2DN6A 3KRWA 1SGHA 2GUMA 1DBHA 1U5EA 1V5MA 3CIKA 3ODXA 5DIFB 1J19A 4ZRKA 2D9WA 3PG7A 2AEHA 1RRPB 4GPTB 3O96A 2I1KA 3PVLA 1UEFA 1KZGA 2R09A 2YS1A 3B77A 3OANA 4HAUB 3WYFB 5EFXA 1OY2A 2CY5A 4ZRIA 1I7AA 1V89A 4DBBA 1ZSQA 3A58A 2D11A 2QKLA 1XCGA 1QC6A 4IOYX 2RNRB 3BJIA 3HIEA 1PFJA 3PZDA 4QJ3B 2CY4A 2J59M 3PVWA 4DXAB 2PZ1A 1MIXA 1FGZA 1K5DB 1T77A 2YT2A 2GCJA 4Z2MB 2LG1A 3SUZA 5DHAB 1WGUA 2DHKA 1BWNA 5C79A 5HE1A 1M7RA 1W1GA 3SYXA 1W1DA 3SO6A 3TFMA 5C6RA 4KAXB 1PMSA 2H7DA 2M14A 2MKRA 3NWDA 2KIEA 1FB8A 2LKOA 3SNHA 5CLLB 3U12A 2D10A 2LOXA 2COCA 1SHCA 1UPRA 5J3TA 2OQBA 5LONB 4YONA 4L1RA 2W2XC 1LW3A 1FAOA 1DDMA 4L6EA 2CRFA 4KHBA 3HK0A 1UNQA 4TKNA 2VSZA 2NZ8B 2Z13A 1FOEA 1LB1A 1FHXA 2KIGA 4CYEA 2JP2A 5CLQB 2EMSA 3D8EA 2KR0A 3NSUA 2Q13A 1MIZB 1TJ6A 3QBVB 2H7EA 1MAIA 2I5CA 5J3QA 2D9VA 1MK7B 4NY0A 1UPQA 3HW2B 1U5DA 1U27A 2CODA 3CXBB 3KY9A 2J0JA 2KUPA 2D2QA 2EMTA 4QJ5B 3FEHA 3ODOA 1K5GB 1TQZA 1X1GA 1FGYA 3HQCA 3LJUX 1NTYA 4K81A 1Z87A 4PNKA 1TXDA 1NTVA 2KGXB 4B6HA 4MY6A 1NU2A 5HE0A 3D8FA 4H8SA 4KHOA 4OSNA 2K2JA 2NMBA 1IRSA 3MPXA 4D0NB 2D9XA 4KVGB 3QWMA 3PEGA 1U29A 1UNPA 4EMOA 3ULBA 3ML4A 1U2BA 4MK0A 4F7GA 2L1CA 1FHOA 3U8ZA 1PLSA 1ISNA 2W2XD 3FVCA 5DHFB 4A6HA 2DA0A 1ZC3B 4HAYB 1V5UA 2DHJA 1DDVA 1X11A 4A6FA 1OQNA
chains in the Genus database with same CATH topology
5C5BB 3A8QA 2P0DA 3N7CA 4CHJA 4DX90 2RUKB 4GN1A 1WVHA 1DDWA 4IFSA 2UZSA 5JHHA 1MKEA 2RVBB 4WJ7A 4GZUA 1AWEA 3F5RA 4HAXB 1BTKA 2UZRA 3AU4A 4YL8A 2HE7A 5JHGA 5GOWB 2P8VA 4K2OA 1ZC4B 1GC6A 3GYOA 2HTHB 2RGNB 3M1IB 1X05A 2RLOA 2W2WA 3U7DA 4ZRJA 1Q67A 2ZPYA 2M38A 5DI9B 1I2HA 4HAVB 3A8PA 1KI1B 1GG3A 2D9YA 2YSZA 1QQGA 1H4RA 3RCPA 5C16A 2LYDA 4HB4B 2VRWB 2YT1A 2CAYA 1BAKA 1EVHA 1XR0B 3QIJA 1XKEA 3VIAA 5FI0A 4Y94A 2YRYA 1WGQA 4A6FB 4MT7A 1J0WA 1KZ7A 2Z0PA 4HATB 2GJYA 3TW1A 3KRXA 3T06A 3DXCA 1EGXA 2YS3A 3ZDTA 2V76A 5KCVA 2UVMA 4HAWB 1AQCA 2R0DA 2XQNM 5KQ1A 2J0KA 4PQ0A 2COAA 4HB3B 4Z2NA 1P3RA 3IVFA 2ELAA 2DHIA 2MWNB 2DYNA 4F7HA 4EJNA 1Y19B 2D9ZA 2QKMA 1N3HA 1P5TA 1WG7A 4WSFA 4HHVA 5D3YA 3P6AA 3AJ4A 4KHBB 4WVFB 5D3XA 3KZ1A 1MPHA 2ADZA 2VKIA 2K2UA 4GXBA 4HAZB 1XD4A 1B55A 4GMXB 5D3VA 2RSGA 2DLWA 1WJ1A 3G9WA 5JLJB 3DXDA 3P7ZA 1Y5OA 2EC1A 4A5KA 2DX5A 2DTCA 5D27A 3TVVA 1U5GA 1E5WA 4EKUA 1H10A 2L2IA 3ULCA 4IAPA 2E2XA 4GMVA 3KSYA 2I1JA 4HDOA 4DX8A 3PVUA 4KHAA 1RJ2A 2DKQA 2Y8FA 5HE2A 5FI1A 3UZTA 1X1FA 3BINA 3TCAA 2GCLA 4HDQA 5L81A 2DYQA 2D4QA 2KCJA 2J0MA 2Z0OA 4BBKA 2LOZA 2LULA 2DX1A 1EF1A 1W1HA 3PSCA 1M7EA 4K17A 2ROZB 4CHMA 2I5FA 2AL6A 1DROA 2IFSA 1NI2A 1WI1A 2GS0A 2N0YA 5KQ4A 2YVCA 3FSSA 2DFKA 2P0HA 3AU5A 4C0AA 1WJMA 4NSWA 1GC7A 3ODWA 2K00A 4HB2B 2YS5A 2ROVA 4F7UP 1FHWA 2N23A 3A98B 2G35A 3TO1A 1EAZA 3DXEA 3SV1A 2P0FA 4A6KA 1V88A 5JP4A 1DYNA 1MK9B 1ZVRA 2MFQA 4P7IA 3X23A 5C5BA 2Y8GA 1U5FA 1XODA 4XWXA 1V5PA 1ZM0A 3V5WA 1BTNA 1OMWA 3GYPA 1XX0A 5DH9B 3VOQA 1P6SA 2IYBA 3MDBC 2Z0QA 3D8DA 4K2PA 5HE3A 2MDXA 2EJ8A 3WA0A 3F0WA 3PP2A 2FJLA 2YF0A 4TYZA 3FM8C 2DKPA 1UNRA 5J3YA 5D3WA 2COFA 2Y7BA 5LOPB 2YT0A 1X86A 2OTXA 1V61A 2ELBA 2X18A 2BCJA 4HB0B 3ZVRA 2DN6A 3KRWA 1SGHA 1DBHA 1U5EA 1V5MA 3CIKA 3ODXA 5DIFB 1J19A 4ZRKA 2D9WA 3PG7A 2AEHA 1RRPB 4GPTB 3O96A 2I1KA 3PVLA 1UEFA 1KZGA 2R09A 2YS1A 3OANA 4HAUB 3WYFB 5EFXA 1OY2A 2CY5A 4ZRIA 1I7AA 1V89A 4DBBA 1ZSQA 2D11A 2QKLA 1XCGA 1QC6A 4IOYX 2RNRB 3BJIA 1PFJA 3PZDA 2CY4A 2J59M 3PVWA 4DXAB 2PZ1A 1MIXA 1FGZA 1K5DB 2GCJA 4Z2MB 2LG1A 3SUZA 5DHAB 1WGUA 2DHKA 1BWNA 5C79A 5HE1A 1M7RA 1W1GA 3SYXA 1W1DA 3SO6A 3TFMA 5C6RA 4KAXB 1PMSA 2H7DA 2M14A 2MKRA 1FB8A 2LKOA 3SNHA 5CLLB 2D10A 2LOXA 2COCA 1SHCA 1UPRA 5J3TA 2OQBA 5LONB 4YONA 2W2XC 1LW3A 1FAOA 1DDMA 4L6EA 2CRFA 3HK0A 1UNQA 4TKNA 2VSZA 2NZ8B 1FOEA 1LB1A 1FHXA 4CYEA 2JP2A 5CLQB 2EMSA 3D8EA 3NSUA 2Q13A 1MIZB 1TJ6A 3QBVB 2H7EA 1MAIA 2I5CA 5J3QA 2D9VA 1MK7B 4NY0A 1UPQA 3HW2B 1U5DA 1U27A 2CODA 3CXBB 3KY9A 2J0JA 2KUPA 2D2QA 2EMTA 3FEHA 3ODOA 1K5GB 1TQZA 1X1GA 1FGYA 3HQCA 3LJUX 1NTYA 4K81A 1Z87A 4PNKA 1TXDA 1NTVA 2KGXB 4B6HA 4MY6A 1NU2A 5HE0A 3D8FA 4H8SA 4KHOA 2K2JA 2NMBA 1IRSA 3MPXA 4D0NB 2D9XA 4KVGB 3QWMA 3PEGA 1U29A 1UNPA 4EMOA 3ULBA 3ML4A 1U2BA 4MK0A 4F7GA 2L1CA 1FHOA 3U8ZA 1PLSA 1ISNA 2W2XD 5DHFB 4A6HA 2DA0A 1ZC3B 4HAYB 1V5UA 2DHJA 1DDVA 1X11A 4A6FA 1OQNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5C5B B;  3A8Q A;  2P0D A;  3N7C A;  4CHJ A;  4DX9 0;  2RUK B;  4GN1 A;  1WVH A;  1DDW A;  4IFS A;  2UZS A;  5JHH A;  1MKE A;  2RVB B;  4WJ7 A;  4GZU A;  1AWE A;  3F5R A;  4HAX B;  1BTK A;  2UZR A;  3AU4 A;  4YL8 A;  2HE7 A;  5JHG A;  5GOW B;  2P8V A;  4K2O A;  1ZC4 B;  1GC6 A;  3GYO A;  2HTH B;  2RGN B;  3M1I B;  1X05 A;  2RLO A;  2W2W A;  3U7D A;  4ZRJ A;  1Q67 A;  2ZPY A;  2M38 A;  5DI9 B;  1I2H A;  4HAV B;  3A8P A;  1KI1 B;  1GG3 A;  2D9Y A;  2YSZ A;  1QQG A;  1H4R A;  3RCP A;  5C16 A;  2LYD A;  4HB4 B;  2VRW B;  2YT1 A;  2CAY A;  1BAK A;  1EVH A;  1XR0 B;  3QIJ A;  1XKE A;  3VIA A;  5FI0 A;  4Y94 A;  2YRY A;  1WGQ A;  4A6F B;  4MT7 A;  1J0W A;  1KZ7 A;  2Z0P A;  4HAT B;  2GJY A;  3TW1 A;  3KRX A;  3T06 A;  3DXC A;  1EGX A;  2YS3 A;  3ZDT A;  2V76 A;  5KCV A;  2UVM A;  4HAW B;  1AQC A;  2R0D A;  2XQN M;  5KQ1 A;  2J0K A;  4PQ0 A;  2COA A;  4HB3 B;  4Z2N A;  1P3R A;  3IVF A;  2ELA A;  2DHI A;  2MWN B;  2DYN A;  4F7H A;  4EJN A;  1Y19 B;  2D9Z A;  2QKM A;  1N3H A;  1P5T A;  1WG7 A;  4WSF A;  4HHV A;  5D3Y A;  3P6A A;  3AJ4 A;  4KHB B;  4WVF B;  5D3X A;  3KZ1 A;  1MPH A;  2ADZ A;  2VKI A;  2K2U A;  4GXB A;  4HAZ B;  1XD4 A;  1B55 A;  4GMX B;  5D3V A;  2RSG A;  2DLW A;  1WJ1 A;  3G9W A;  5JLJ B;  3DXD A;  3P7Z A;  1Y5O A;  2EC1 A;  4A5K A;  2DX5 A;  2DTC A;  5D27 A;  3TVV A;  1U5G A;  1E5W A;  4EKU A;  1H10 A;  2L2I A;  3ULC A;  4IAP A;  2E2X A;  4GMV A;  3KSY A;  2I1J A;  4HDO A;  4DX8 A;  3PVU A;  4KHA A;  1RJ2 A;  2DKQ A;  2Y8F A;  5HE2 A;  5FI1 A;  3UZT A;  1X1F A;  3BIN A;  3TCA A;  2GCL A;  4HDQ A;  5L81 A;  2DYQ A;  2D4Q A;  2KCJ A;  2J0M A;  2Z0O A;  4BBK A;  2LOZ A;  2LUL A;  2DX1 A;  1EF1 A;  1W1H A;  3PSC A;  1M7E A;  4K17 A;  2ROZ B;  4CHM A;  2I5F A;  2AL6 A;  1DRO A;  2IFS A;  1NI2 A;  1WI1 A;  2GS0 A;  2N0Y A;  5KQ4 A;  2YVC A;  3FSS A;  2DFK A;  2P0H A;  3AU5 A;  4C0A A;  1WJM A;  4NSW A;  1GC7 A;  3ODW A;  2K00 A;  4HB2 B;  2YS5 A;  2ROV A;  4F7U P;  1FHW A;  2N23 A;  3A98 B;  2G35 A;  3TO1 A;  1EAZ A;  3DXE A;  3SV1 A;  2P0F A;  4A6K A;  1V88 A;  5JP4 A;  1DYN A;  1MK9 B;  1ZVR A;  2MFQ A;  4P7I A;  3X23 A;  5C5B A;  2Y8G A;  1U5F A;  1XOD A;  4XWX A;  1V5P A;  1ZM0 A;  3V5W A;  1BTN A;  1OMW A;  3GYP A;  1XX0 A;  5DH9 B;  3VOQ A;  1P6S A;  2IYB A;  3MDB C;  2Z0Q A;  3D8D A;  4K2P A;  5HE3 A;  2MDX A;  2EJ8 A;  3WA0 A;  3F0W A;  3PP2 A;  2FJL A;  2YF0 A;  4TYZ A;  3FM8 C;  2DKP A;  1UNR A;  5J3Y A;  5D3W A;  2COF A;  2Y7B A;  5LOP B;  2YT0 A;  1X86 A;  2OTX A;  1V61 A;  2ELB A;  2X18 A;  2BCJ A;  4HB0 B;  3ZVR A;  2DN6 A;  3KRW A;  1SGH A;  1DBH A;  1U5E A;  1V5M A;  3CIK A;  3ODX A;  5DIF B;  1J19 A;  4ZRK A;  2D9W A;  3PG7 A;  2AEH A;  1RRP B;  4GPT B;  3O96 A;  2I1K A;  3PVL A;  1UEF A;  1KZG A;  2R09 A;  2YS1 A;  3OAN A;  4HAU B;  3WYF B;  5EFX A;  1OY2 A;  2CY5 A;  4ZRI A;  1I7A A;  1V89 A;  4DBB A;  1ZSQ A;  2D11 A;  2QKL A;  1XCG A;  1QC6 A;  4IOY X;  2RNR B;  3BJI A;  1PFJ A;  3PZD A;  2CY4 A;  2J59 M;  3PVW A;  4DXA B;  2PZ1 A;  1MIX A;  1FGZ A;  1K5D B;  2GCJ A;  4Z2M B;  2LG1 A;  3SUZ A;  5DHA B;  1WGU A;  2DHK A;  1BWN A;  5C79 A;  5HE1 A;  1M7R A;  1W1G A;  3SYX A;  1W1D A;  3SO6 A;  3TFM A;  5C6R A;  4KAX B;  1PMS A;  2H7D A;  2M14 A;  2MKR A;  1FB8 A;  2LKO A;  3SNH A;  5CLL B;  2D10 A;  2LOX A;  2COC A;  1SHC A;  1UPR A;  5J3T A;  2OQB A;  5LON B;  4YON A;  2W2X C;  1LW3 A;  1FAO A;  1DDM A;  4L6E A;  2CRF A;  3HK0 A;  1UNQ A;  4TKN A;  2VSZ A;  2NZ8 B;  1FOE A;  1LB1 A;  1FHX A;  4CYE A;  2JP2 A;  5CLQ B;  2EMS A;  3D8E A;  3NSU A;  2Q13 A;  1MIZ B;  1TJ6 A;  3QBV B;  2H7E A;  1MAI A;  2I5C A;  5J3Q A;  2D9V A;  1MK7 B;  4NY0 A;  1UPQ A;  3HW2 B;  1U5D A;  1U27 A;  2COD A;  3CXB B;  3KY9 A;  2J0J A;  2KUP A;  2D2Q A;  2EMT A;  3FEH A;  3ODO A;  1K5G B;  1TQZ A;  1X1G A;  1FGY A;  3HQC A;  3LJU X;  1NTY A;  4K81 A;  1Z87 A;  4PNK A;  1TXD A;  1NTV A;  2KGX B;  4B6H A;  4MY6 A;  1NU2 A;  5HE0 A;  3D8F A;  4H8S A;  4KHO A;  2K2J A;  2NMB A;  1IRS A;  3MPX A;  4D0N B;  2D9X A;  4KVG B;  3QWM A;  3PEG A;  1U29 A;  1UNP A;  4EMO A;  3ULB A;  3ML4 A;  1U2B A;  4MK0 A;  4F7G A;  2L1C A;  1FHO A;  3U8Z A;  1PLS A;  1ISN A;  2W2X D;  5DHF B;  4A6H A;  2DA0 A;  1ZC3 B;  4HAY B;  1V5U A;  2DHJ A;  1DDV A;  1X11 A;  4A6F A;  1OQN A; 
#chains in the Genus database with same CATH topology
 5C5B B;  3A8Q A;  2P0D A;  4DIX A;  3N7C A;  4CHJ A;  3DCX A;  4DX9 0;  2RUK B;  4GN1 A;  1WVH A;  1DDW A;  4IFS A;  2UZS A;  5JHH A;  1MKE A;  2RVB B;  4WJ7 A;  4GZU A;  1AWE A;  3F5R A;  4HAX B;  1BTK A;  2K8E A;  2UZR A;  3AU4 A;  4YL8 A;  2HE7 A;  5JHG A;  5GOW B;  2P8V A;  4K2O A;  1ZC4 B;  1GC6 A;  3GYO A;  2HTH B;  2RRF A;  2RGN B;  4HSI A;  3M1I B;  1X05 A;  5I2M A;  2RLO A;  2W2W A;  3U7D A;  4ZRJ A;  1Q67 A;  2ZPY A;  3NWA A;  2M38 A;  5DI9 B;  1I2H A;  4HAV B;  3A8P A;  1KI1 B;  1GG3 A;  2D9Y A;  2YSZ A;  1QQG A;  1H4R A;  3RCP A;  5C16 A;  2KUQ A;  2LYD A;  4HB4 B;  2VRW B;  2YT1 A;  2CAY A;  1BAK A;  5M4Y B;  1EVH A;  1XR0 B;  3QIJ A;  1XKE A;  3VIA A;  5FI0 A;  4Y94 A;  2YRY A;  1WGQ A;  4A6F B;  4MT7 A;  1J0W A;  1KZ7 A;  2Z0P A;  4HAT B;  2GJY A;  3TW1 A;  3KRX A;  3T06 A;  3HSA A;  3DXC A;  1EGX A;  2YS3 A;  4OT1 A;  3ZDT A;  2V76 A;  2FJU B;  5KCV A;  2UVM A;  4HAW B;  1AQC A;  2R0D A;  2XQN M;  5KQ1 A;  2J0K A;  4PQ0 A;  2COA A;  3NWF A;  4HB3 B;  4Z2N A;  1P3R A;  3IVF A;  2ELA A;  2DHI A;  2ZKM X;  2MWN B;  2DYN A;  4F7H A;  4EJN A;  1Y19 B;  2D9Z A;  4GOU A;  2QKM A;  1N3H A;  1P5T A;  1WG7 A;  4WSF A;  4HHV A;  5D3Y A;  3P6A A;  4D6W A;  3AJ4 A;  2Z59 A;  4KHB B;  4WVF B;  5D3X A;  3KZ1 A;  1MPH A;  2ADZ A;  2VKI A;  2K2U A;  4GXB A;  4HAZ B;  1XD4 A;  1B55 A;  4GMX B;  5D3V A;  2RSG A;  2DLW A;  1WJ1 A;  3G9W A;  5JLJ B;  3DXD A;  3P7Z A;  1Y5O A;  2EC1 A;  4A5K A;  2DX5 A;  2DTC A;  5D27 A;  3TVV A;  1U5G A;  1E5W A;  4EKU A;  1H10 A;  2L2I A;  3ULC A;  4IAP A;  2E2X A;  4GMV A;  3KSY A;  2I1J A;  3NW8 A;  4HDO A;  4DX8 A;  3PVU A;  4KHA A;  1RJ2 A;  4QJ4 B;  2DKQ A;  2Y8F A;  5HE2 A;  5FI1 A;  3UZT A;  3OHM B;  1X1F A;  3BIN A;  3TCA A;  2GCL A;  4HDQ A;  5L81 A;  2DYQ A;  2D4Q A;  2KCJ A;  2J0M A;  2Z0O A;  4BBK A;  2LOZ A;  2LUL A;  5LG4 B;  2DX1 A;  2Z4D A;  1EF1 A;  1W1H A;  3PSC A;  5I2S A;  1M7E A;  4K17 A;  1MI1 A;  2ROZ B;  4CHM A;  2I5F A;  2AL6 A;  1DRO A;  2IFS A;  1NI2 A;  1WI1 A;  2GS0 A;  2N0Y A;  5KQ4 A;  2YVC A;  3FSS A;  2DFK A;  2P0H A;  3AU5 A;  4C0A A;  1WJM A;  4NSW A;  1GC7 A;  3ODW A;  2K00 A;  4HB2 B;  2YS5 A;  2ROV A;  4GNK B;  4F7U P;  1FHW A;  2N23 A;  2NBV A;  3A98 B;  4QXA B;  2G35 A;  3TO1 A;  1EAZ A;  3DXE A;  3SV1 A;  2P0F A;  4A6K A;  1V88 A;  5JP4 A;  1DYN A;  1MK9 B;  1ZVR A;  2MFQ A;  4P7I A;  3X23 A;  5C5B A;  2Y8G A;  2R2Y A;  1U5F A;  1XOD A;  4XWX A;  1V5P A;  1ZM0 A;  3V5W A;  1BTN A;  1OMW A;  3GYP A;  1XX0 A;  5DH9 B;  3VOQ A;  1P6S A;  2K49 A;  5IRS A;  2IYB A;  3MDB C;  2Z0Q A;  3D8D A;  4K2P A;  5HE3 A;  2MDX A;  2EJ8 A;  3WA0 A;  3F0W A;  3PP2 A;  2FJL A;  2YF0 A;  2Z14 A;  4TYZ A;  3FM8 C;  2DKP A;  1UNR A;  5J3Y A;  5D3W A;  2COF A;  2Y7B A;  5LOP B;  2YT0 A;  1X86 A;  2OTX A;  4CSQ A;  1V61 A;  2ELB A;  2X18 A;  2BCJ A;  1ZYI A;  4HB0 B;  3ZVR A;  2DN6 A;  3KRW A;  1SGH A;  2GUM A;  1DBH A;  1U5E A;  1V5M A;  3CIK A;  3ODX A;  5DIF B;  1J19 A;  4ZRK A;  2D9W A;  3PG7 A;  2AEH A;  1RRP B;  4GPT B;  3O96 A;  2I1K A;  3PVL A;  1UEF A;  1KZG A;  2R09 A;  2YS1 A;  3B77 A;  3OAN A;  4HAU B;  3WYF B;  5EFX A;  1OY2 A;  2CY5 A;  4ZRI A;  1I7A A;  1V89 A;  4DBB A;  1ZSQ A;  3A58 A;  2D11 A;  2QKL A;  1XCG A;  1QC6 A;  4IOY X;  2RNR B;  3BJI A;  3HIE A;  1PFJ A;  3PZD A;  4QJ3 B;  2CY4 A;  2J59 M;  3PVW A;  4DXA B;  2PZ1 A;  1MIX A;  1FGZ A;  1K5D B;  1T77 A;  2YT2 A;  2GCJ A;  4Z2M B;  2LG1 A;  3SUZ A;  5DHA B;  1WGU A;  2DHK A;  1BWN A;  5C79 A;  5HE1 A;  1M7R A;  1W1G A;  3SYX A;  1W1D A;  3SO6 A;  3TFM A;  5C6R A;  4KAX B;  1PMS A;  2H7D A;  2M14 A;  2MKR A;  3NWD A;  2KIE A;  1FB8 A;  2LKO A;  3SNH A;  5CLL B;  3U12 A;  2D10 A;  2LOX A;  2COC A;  1SHC A;  1UPR A;  5J3T A;  2OQB A;  5LON B;  4YON A;  4L1R A;  2W2X C;  1LW3 A;  1FAO A;  1DDM A;  4L6E A;  2CRF A;  4KHB A;  3HK0 A;  1UNQ A;  4TKN A;  2VSZ A;  2NZ8 B;  2Z13 A;  1FOE A;  1LB1 A;  1FHX A;  2KIG A;  4CYE A;  2JP2 A;  5CLQ B;  2EMS A;  3D8E A;  2KR0 A;  3NSU A;  2Q13 A;  1MIZ B;  1TJ6 A;  3QBV B;  2H7E A;  1MAI A;  2I5C A;  5J3Q A;  2D9V A;  1MK7 B;  4NY0 A;  1UPQ A;  3HW2 B;  1U5D A;  1U27 A;  2COD A;  3CXB B;  3KY9 A;  2J0J A;  2KUP A;  2D2Q A;  2EMT A;  4QJ5 B;  3FEH A;  3ODO A;  1K5G B;  1TQZ A;  1X1G A;  1FGY A;  3HQC A;  3LJU X;  1NTY A;  4K81 A;  1Z87 A;  4PNK A;  1TXD A;  1NTV A;  2KGX B;  4B6H A;  4MY6 A;  1NU2 A;  5HE0 A;  3D8F A;  4H8S A;  4KHO A;  4OSN A;  2K2J A;  2NMB A;  1IRS A;  3MPX A;  4D0N B;  2D9X A;  4KVG B;  3QWM A;  3PEG A;  1U29 A;  1UNP A;  4EMO A;  3ULB A;  3ML4 A;  1U2B A;  4MK0 A;  4F7G A;  2L1C A;  1FHO A;  3U8Z A;  1PLS A;  1ISN A;  2W2X D;  3FVC A;  5DHF B;  4A6H A;  2DA0 A;  1ZC3 B;  4HAY B;  1V5U A;  2DHJ A;  1DDV A;  1X11 A;  4A6F A;  1OQN A; 
#chains in the Genus database with same CATH homology
 5C5B B;  3A8Q A;  2P0D A;  3N7C A;  4CHJ A;  4DX9 0;  2RUK B;  4GN1 A;  1WVH A;  1DDW A;  4IFS A;  2UZS A;  5JHH A;  1MKE A;  2RVB B;  4WJ7 A;  4GZU A;  1AWE A;  3F5R A;  4HAX B;  1BTK A;  2UZR A;  3AU4 A;  4YL8 A;  2HE7 A;  5JHG A;  5GOW B;  2P8V A;  4K2O A;  1ZC4 B;  1GC6 A;  3GYO A;  2HTH B;  2RGN B;  3M1I B;  1X05 A;  2RLO A;  2W2W A;  3U7D A;  4ZRJ A;  1Q67 A;  2ZPY A;  2M38 A;  5DI9 B;  1I2H A;  4HAV B;  3A8P A;  1KI1 B;  1GG3 A;  2D9Y A;  2YSZ A;  1QQG A;  1H4R A;  3RCP A;  5C16 A;  2LYD A;  4HB4 B;  2VRW B;  2YT1 A;  2CAY A;  1BAK A;  1EVH A;  1XR0 B;  3QIJ A;  1XKE A;  3VIA A;  5FI0 A;  4Y94 A;  2YRY A;  1WGQ A;  4A6F B;  4MT7 A;  1J0W A;  1KZ7 A;  2Z0P A;  4HAT B;  2GJY A;  3TW1 A;  3KRX A;  3T06 A;  3DXC A;  1EGX A;  2YS3 A;  3ZDT A;  2V76 A;  5KCV A;  2UVM A;  4HAW B;  1AQC A;  2R0D A;  2XQN M;  5KQ1 A;  2J0K A;  4PQ0 A;  2COA A;  4HB3 B;  4Z2N A;  1P3R A;  3IVF A;  2ELA A;  2DHI A;  2MWN B;  2DYN A;  4F7H A;  4EJN A;  1Y19 B;  2D9Z A;  2QKM A;  1N3H A;  1P5T A;  1WG7 A;  4WSF A;  4HHV A;  5D3Y A;  3P6A A;  3AJ4 A;  4KHB B;  4WVF B;  5D3X A;  3KZ1 A;  1MPH A;  2ADZ A;  2VKI A;  2K2U A;  4GXB A;  4HAZ B;  1XD4 A;  1B55 A;  4GMX B;  5D3V A;  2RSG A;  2DLW A;  1WJ1 A;  3G9W A;  5JLJ B;  3DXD A;  3P7Z A;  1Y5O A;  2EC1 A;  4A5K A;  2DX5 A;  2DTC A;  5D27 A;  3TVV A;  1U5G A;  1E5W A;  4EKU A;  1H10 A;  2L2I A;  3ULC A;  4IAP A;  2E2X A;  4GMV A;  3KSY A;  2I1J A;  4HDO A;  4DX8 A;  3PVU A;  4KHA A;  1RJ2 A;  2DKQ A;  2Y8F A;  5HE2 A;  5FI1 A;  3UZT A;  1X1F A;  3BIN A;  3TCA A;  2GCL A;  4HDQ A;  5L81 A;  2DYQ A;  2D4Q A;  2KCJ A;  2J0M A;  2Z0O A;  4BBK A;  2LOZ A;  2LUL A;  2DX1 A;  1EF1 A;  1W1H A;  3PSC A;  1M7E A;  4K17 A;  2ROZ B;  4CHM A;  2I5F A;  2AL6 A;  1DRO A;  2IFS A;  1NI2 A;  1WI1 A;  2GS0 A;  2N0Y A;  5KQ4 A;  2YVC A;  3FSS A;  2DFK A;  2P0H A;  3AU5 A;  4C0A A;  1WJM A;  4NSW A;  1GC7 A;  3ODW A;  2K00 A;  4HB2 B;  2YS5 A;  2ROV A;  4F7U P;  1FHW A;  2N23 A;  3A98 B;  2G35 A;  3TO1 A;  1EAZ A;  3DXE A;  3SV1 A;  2P0F A;  4A6K A;  1V88 A;  5JP4 A;  1DYN A;  1MK9 B;  1ZVR A;  2MFQ A;  4P7I A;  3X23 A;  5C5B A;  2Y8G A;  1U5F A;  1XOD A;  4XWX A;  1V5P A;  1ZM0 A;  3V5W A;  1BTN A;  1OMW A;  3GYP A;  1XX0 A;  5DH9 B;  3VOQ A;  1P6S A;  2IYB A;  3MDB C;  2Z0Q A;  3D8D A;  4K2P A;  5HE3 A;  2MDX A;  2EJ8 A;  3WA0 A;  3F0W A;  3PP2 A;  2FJL A;  2YF0 A;  4TYZ A;  3FM8 C;  2DKP A;  1UNR A;  5J3Y A;  5D3W A;  2COF A;  2Y7B A;  5LOP B;  2YT0 A;  1X86 A;  2OTX A;  1V61 A;  2ELB A;  2X18 A;  2BCJ A;  4HB0 B;  3ZVR A;  2DN6 A;  3KRW A;  1SGH A;  1DBH A;  1U5E A;  1V5M A;  3CIK A;  3ODX A;  5DIF B;  1J19 A;  4ZRK A;  2D9W A;  3PG7 A;  2AEH A;  1RRP B;  4GPT B;  3O96 A;  2I1K A;  3PVL A;  1UEF A;  1KZG A;  2R09 A;  2YS1 A;  3OAN A;  4HAU B;  3WYF B;  5EFX A;  1OY2 A;  2CY5 A;  4ZRI A;  1I7A A;  1V89 A;  4DBB A;  1ZSQ A;  2D11 A;  2QKL A;  1XCG A;  1QC6 A;  4IOY X;  2RNR B;  3BJI A;  1PFJ A;  3PZD A;  2CY4 A;  2J59 M;  3PVW A;  4DXA B;  2PZ1 A;  1MIX A;  1FGZ A;  1K5D B;  2GCJ A;  4Z2M B;  2LG1 A;  3SUZ A;  5DHA B;  1WGU A;  2DHK A;  1BWN A;  5C79 A;  5HE1 A;  1M7R A;  1W1G A;  3SYX A;  1W1D A;  3SO6 A;  3TFM A;  5C6R A;  4KAX B;  1PMS A;  2H7D A;  2M14 A;  2MKR A;  1FB8 A;  2LKO A;  3SNH A;  5CLL B;  2D10 A;  2LOX A;  2COC A;  1SHC A;  1UPR A;  5J3T A;  2OQB A;  5LON B;  4YON A;  2W2X C;  1LW3 A;  1FAO A;  1DDM A;  4L6E A;  2CRF A;  3HK0 A;  1UNQ A;  4TKN A;  2VSZ A;  2NZ8 B;  1FOE A;  1LB1 A;  1FHX A;  4CYE A;  2JP2 A;  5CLQ B;  2EMS A;  3D8E A;  3NSU A;  2Q13 A;  1MIZ B;  1TJ6 A;  3QBV B;  2H7E A;  1MAI A;  2I5C A;  5J3Q A;  2D9V A;  1MK7 B;  4NY0 A;  1UPQ A;  3HW2 B;  1U5D A;  1U27 A;  2COD A;  3CXB B;  3KY9 A;  2J0J A;  2KUP A;  2D2Q A;  2EMT A;  3FEH A;  3ODO A;  1K5G B;  1TQZ A;  1X1G A;  1FGY A;  3HQC A;  3LJU X;  1NTY A;  4K81 A;  1Z87 A;  4PNK A;  1TXD A;  1NTV A;  2KGX B;  4B6H A;  4MY6 A;  1NU2 A;  5HE0 A;  3D8F A;  4H8S A;  4KHO A;  2K2J A;  2NMB A;  1IRS A;  3MPX A;  4D0N B;  2D9X A;  4KVG B;  3QWM A;  3PEG A;  1U29 A;  1UNP A;  4EMO A;  3ULB A;  3ML4 A;  1U2B A;  4MK0 A;  4F7G A;  2L1C A;  1FHO A;  3U8Z A;  1PLS A;  1ISN A;  2W2X D;  5DHF B;  4A6H A;  2DA0 A;  1ZC3 B;  4HAY B;  1V5U A;  2DHJ A;  1DDV A;  1X11 A;  4A6F A;  1OQN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...