1P3RA

Crystal structure of the phosphotyrosin binding domain(ptb) of mouse disabled 1(dab1)
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
148
structure length
148
Chain Sequence
b'MEKTDEYLLARFKGDGVKYKAKLIGIDDVPDARGDKMSQDSMMKLKGMAAAGRSQGQHKQRIWVNISLSGIKIIDEKTGVIEHEHPVNKISFIARDVTDNRAFGYVCGGEGQHQFFAIKTGQQAEPLVVDLKDLFQVIYNVKKKEEDK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Disabled homolog 2
publication title Crystal structures of the Dab homology domains of mouse disabled 1 and 2.
pubmed doi rcsb
source organism Mus musculus
molecule tags Signaling protein
total genus 47
structure length 148
sequence length 148
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2003-04-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00640 PID Phosphotyrosine interaction domain (PTB/PID)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 1p3rA00
4HAXB 5HE1A 1XODA 4IAPA 2YS3A 4HDQA 2COCA 5C5BB 1WG7A 2W2XC 2D9ZA 4HB2B 3GYPA 1OMWA 3N7CA 1K5GB 5J3YA 1FGZA 1UNRA 4WSFA 1UPRA 4KHAA 4HAWB 3SV1A 1H10A 2D10A 2EJ8A 4NSWA 2I5CA 1QC6A 1X1GA 2UVMA 3ULBA 3SYXA 3CXBB 4D0NB 3DXCA 3HK0A 1I2HA 4EJNA 3TCAA 5JHHA 1EF1A 5D3XA 3GYOA 1MKEA 5EFXA 4F7HA 5C16A 1OQNA 3WYFB 2J0MA 3TFMA 2KUPA 1FOEA 5D3YA 2AL6A 2LOXA 2FJLA 2COAA 2GS0A 2YT1A 3F0WA 2M38A 4GZUA 5KQ4A 1U2BA 3PZDA 3PEGA 5C6RA 2DLWA 3KRXA 1J19A 1LB1A 3PP2A 3ZDTA 4L6EA 1X05A 3QBVB 1TQZA 1KZ7A 3V5WA 3UZTA 3F5RA 3QWMA 3ODWA 4MK0A 4DX8A 3A98B 2LG1A 4KVGB 5C5BA 1V5MA 2DHKA 3P7ZA 2DFKA 4ZRIA 1OY2A 1WVHA 2I1JA 5CLQB 5LOPB 2G35A 1XCGA 2MDXA 2CY4A 2RLOA 2IYBA 3M1IB 3BJIA 1FGYA 5HE3A 2XQNM 2DHJA 2CRFA 4ZRKA 1W1HA 2ROVA 2P0DA 4HAVB 1BAKA 1MK9B 1NTVA 5J3QA 3WA0A 2DYNA 2N0YA 1DDMA 1DDVA 2CODA 4DBBA 1J0WA 1LW3A 2YS1A 2D4QA 1GC7A 4YL8A 1U5EA 1DDWA 2KCJA 5DHAB 1MAIA 1MIZB 1X1FA 4GMVA 2GJYA 4DX90 1EGXA 5JHGA 4KHBB 3ML4A 1IRSA 4Y94A 3PVLA 2E2XA 2D2QA 2LYDA 2Z0PA 4Z2MB 2GCLA 2K2JA 2YS5A 2LULA 1MIXA 2YSZA 1MK7B 3U8ZA 2H7EA 3NSUA 4Z2NA 1U27A 2VRWB 3KRWA 4CHJA 4ZRJA 1U5DA 5HE0A 2DA0A 1EAZA 2RSGA 3DXEA 4TKNA 2CAYA 2J59M 1WI1A 4A6FB 1GG3A 4IOYX 2IFSA 1AWEA 2YF0A 1V61A 5KQ1A 3SNHA 1WJ1A 5JLJB 1RRPB 4KHOA 1ISNA 3BINA 2N23A 5L81A 2COFA 2L2IA 1FHWA 3FEHA 3VIAA 3TO1A 2I5FA 5D3VA 5FI1A 1U5GA 5DI9B 3RCPA 1PMSA 2P0FA 5DIFB 1W1DA 2YVCA 3KZ1A 2EMTA 4HAUB 2K2UA 5DH9B 1KZGA 2LKOA 5HE2A 4K17A 1Q67A 4KAXB 4P7IA 1Y5OA 4TYZA 2CY5A 1DYNA 1NI2A 4HHVA 1MPHA 2LOZA 1ZM0A 3QIJA 1X11A 2MFQA 2J0JA 4A6KA 4EMOA 1SHCA 2Z0QA 1M7EA 1I7AA 5J3TA 1GC6A 2R0DA 3P6AA 4F7GA 2QKMA 3D8FA 3FSSA 2RNRB 1BWNA 1WGUA 2D9YA 2D9WA 1AQCA 4HATB 2KGXB 4GMXB 3TVVA 2PZ1A 2H7DA 2ZPYA 2RVBB 3AU4A 2GCJA 2YT0A 4MT7A 2NZ8B 1UEFA 5DHFB 2NMBA 4YONA 4DXAB 4A6FA 4CHMA 5KCVA 2P8VA 2DHIA 4HB3B 2ROZB 4B6HA 2DTCA 1FHXA 1XX0A 3MPXA 3PSCA 2W2XD 4HAYB 4PQ0A 1BTNA 2DX1A 1WGQA 1V89A 5GOWB 1FB8A 2Y8FA 2AEHA 1ZC3B 1ZVRA 4EKUA 2YRYA 2X18A 2DX5A 3FM8C 4XWXA 3CIKA 3PVWA 2RUKB 4A5KA 2Y7BA 4A6HA 2R09A 3T06A 3IVFA 3X23A 1WJMA 4WVFB 1U5FA 4GPTB 3TW1A 4HDOA 1FHOA 2M14A 4CYEA 2UZSA 2D9XA 4MY6A 4GXBA 2JP2A 2DN6A 4HB4B 1K5DB 3ODXA 1V5UA 1Y19B 1KI1B 2V76A 1P5TA 1ZC4B 2DYQA 2DKPA 2P0HA 1PLSA 1W1GA 2Y8GA 1NU2A 1XD4A 4HB0B 3PVUA 2Q13A 2L1CA 1P3RA 3AU5A 3KSYA 4K81A 2HTHB 1QQGA 5FI0A 1FAOA 3ZVRA 4PNKA 3ODOA 3ULCA 2MWNB 2ELAA 1TJ6A 1H4RA 2DKQA 3D8DA 3D8EA 5CLLB 5C79A 1SGHA 1UNPA 3OANA 3G9WA 4GN1A 3VOQA 4H8SA 5D3WA 2Z0OA 2I1KA 4BBKA 3A8PA 3LJUX 4HAZB 1XR0B 3HQCA 1EVHA 1P6SA 1V88A 2BCJA 4K2OA 1E5WA 3A8QA 2EC1A 3KY9A 2RGNB 1PFJA 1UNQA 2QKLA 1Z87A 5LONB 3AJ4A 3DXDA 3SUZA 2VSZA 4NY0A 1BTKA 2MKRA 1B55A 4C0AA 1RJ2A 4F7UP 1NTYA 1TXDA 1M7RA 1V5PA 2K00A 2D11A 1U29A 3HW2B 1N3HA 2VKIA 1UPQA 5JP4A 2ELBA 2OTXA 3MDBC 1DROA 1X86A 2D9VA 1ZSQA 2HE7A 4IFSA 1DBHA 2UZRA 2W2WA 4K2PA 1XKEA 2ADZA 3O96A 3PG7A 5D27A 2EMSA 2J0KA 3SO6A 2OQBA 4WJ7A 3U7DA
chains in the Genus database with same CATH superfamily
4HAXB 5HE1A 1XODA 4IAPA 2YS3A 4HDQA 2COCA 3NWAA 5C5BB 1WG7A 2W2XC 2D9ZA 4HB2B 3GYPA 1OMWA 3N7CA 3U12A 1K5GB 1ZYIA 5J3YA 1FGZA 1MI1A 1UNRA 4WSFA 3HIEA 1UPRA 4KHAA 4HAWB 3SV1A 4DIXA 1H10A 2D10A 2EJ8A 4NSWA 2I5CA 1QC6A 1X1GA 2UVMA 3ULBA 3SYXA 3CXBB 2KIEA 4D0NB 3DXCA 3HK0A 1I2HA 4EJNA 3TCAA 5JHHA 1EF1A 5D3XA 3GYOA 1MKEA 5EFXA 4F7HA 5C16A 1OQNA 3WYFB 2J0MA 3TFMA 2KUPA 1FOEA 5D3YA 5M4YB 2AL6A 2LOXA 2FJLA 2COAA 2GS0A 2Z4DA 2YT1A 3F0WA 2M38A 4GZUA 5KQ4A 1U2BA 3PZDA 3PEGA 5C6RA 2R2YA 2DLWA 3KRXA 1J19A 1LB1A 3PP2A 3ZDTA 4L6EA 1X05A 3QBVB 1TQZA 1KZ7A 3V5WA 3UZTA 3F5RA 3QWMA 3ODWA 4MK0A 4DX8A 3A98B 2LG1A 4KVGB 5C5BA 1V5MA 2DHKA 3P7ZA 2DFKA 4ZRIA 1OY2A 1WVHA 2I1JA 5CLQB 5LOPB 2G35A 1XCGA 2MDXA 3NWFA 2CY4A 2RLOA 2IYBA 3M1IB 3BJIA 1FGYA 5HE3A 2XQNM 2DHJA 2CRFA 3OHMB 2Z13A 4ZRKA 1W1HA 2ROVA 2P0DA 4HAVB 1BAKA 1MK9B 1NTVA 5J3QA 2NBVA 3WA0A 2DYNA 2N0YA 1DDMA 1DDVA 2CODA 4DBBA 1J0WA 1LW3A 2YS1A 2D4QA 1GC7A 4YL8A 1U5EA 2KUQA 1DDWA 2KCJA 5DHAB 1MAIA 1MIZB 1X1FA 4GOUA 4GMVA 2GJYA 4DX90 1EGXA 2RRFA 5JHGA 4KHBB 2KIGA 3ML4A 1IRSA 4Y94A 3PVLA 2E2XA 2D2QA 2LYDA 2Z0PA 4Z2MB 2GCLA 2K2JA 2YS5A 2LULA 1MIXA 2YSZA 1MK7B 3FVCA 4OT1A 3U8ZA 2H7EA 3NSUA 4Z2NA 1U27A 2VRWB 3KRWA 4CHJA 4ZRJA 2ZKMX 1U5DA 5HE0A 2DA0A 1EAZA 2RSGA 3DXEA 4TKNA 2CAYA 5I2SA 2J59M 1WI1A 4A6FB 1GG3A 4IOYX 4QJ5B 2IFSA 1AWEA 2YF0A 2GUMA 1V61A 5KQ1A 3SNHA 1WJ1A 5JLJB 1RRPB 4KHOA 1ISNA 3BINA 2N23A 5L81A 3B77A 2COFA 2L2IA 1FHWA 3FEHA 3VIAA 3TO1A 2I5FA 5D3VA 5FI1A 3NWDA 1U5GA 5DI9B 3RCPA 1PMSA 2P0FA 5DIFB 1W1DA 2YVCA 3KZ1A 2EMTA 4HAUB 2K2UA 5DH9B 1KZGA 1T77A 2LKOA 5HE2A 4K17A 1Q67A 4KAXB 4P7IA 2Z59A 1Y5OA 4TYZA 2CY5A 1DYNA 1NI2A 4HHVA 1MPHA 2LOZA 1ZM0A 3QIJA 1X11A 2MFQA 2J0JA 4A6KA 4EMOA 4KHBA 1SHCA 2Z0QA 1M7EA 1I7AA 5I2MA 5J3TA 1GC6A 2R0DA 3P6AA 4F7GA 2QKMA 3D8FA 3FSSA 2RNRB 1BWNA 1WGUA 3DCXA 2D9YA 2D9WA 2K8EA 1AQCA 4HATB 2KGXB 4GMXB 3TVVA 2PZ1A 2H7DA 2ZPYA 2RVBB 3AU4A 2GCJA 5IRSA 2YT0A 4MT7A 2NZ8B 1UEFA 5DHFB 2NMBA 4YONA 4DXAB 4A6FA 4CHMA 5KCVA 2P8VA 2DHIA 4HB3B 2ROZB 4B6HA 2DTCA 1FHXA 1XX0A 3MPXA 3PSCA 2W2XD 4HAYB 4PQ0A 1BTNA 2DX1A 1WGQA 3HSAA 1V89A 5GOWB 4CSQA 1FB8A 2Y8FA 2AEHA 1ZC3B 1ZVRA 4EKUA 2YRYA 2X18A 2DX5A 3FM8C 4XWXA 3A58A 3CIKA 3NW8A 3PVWA 2FJUB 2RUKB 4A5KA 2Y7BA 4A6HA 2R09A 3T06A 3IVFA 3X23A 1WJMA 4GNKB 4WVFB 1U5FA 4GPTB 3TW1A 4HDOA 1FHOA 2M14A 4CYEA 2UZSA 2D9XA 4MY6A 4GXBA 2JP2A 2DN6A 4HB4B 1K5DB 3ODXA 1V5UA 1Y19B 1KI1B 2V76A 1P5TA 1ZC4B 2DYQA 2DKPA 2P0HA 1PLSA 1W1GA 2Z14A 2Y8GA 1NU2A 2K49A 1XD4A 4HB0B 3PVUA 2Q13A 2L1CA 1P3RA 3AU5A 3KSYA 4K81A 2HTHB 1QQGA 5FI0A 1FAOA 4QJ3B 3ZVRA 4PNKA 3ODOA 3ULCA 2MWNB 2ELAA 1TJ6A 4QXAB 1H4RA 2DKQA 3D8DA 3D8EA 4HSIA 4QJ4B 5CLLB 5C79A 1SGHA 1UNPA 3OANA 3G9WA 4GN1A 3VOQA 4H8SA 5D3WA 2Z0OA 2I1KA 4BBKA 3A8PA 3LJUX 4HAZB 1XR0B 3HQCA 1EVHA 1P6SA 2KR0A 1V88A 2BCJA 4K2OA 1E5WA 3A8QA 2EC1A 3KY9A 2RGNB 1PFJA 1UNQA 2QKLA 1Z87A 5LONB 3AJ4A 3DXDA 3SUZA 2VSZA 4NY0A 1BTKA 2MKRA 1B55A 2YT2A 4C0AA 1RJ2A 4F7UP 1NTYA 1TXDA 1M7RA 1V5PA 2K00A 2D11A 1U29A 3HW2B 1N3HA 2VKIA 1UPQA 5JP4A 2ELBA 2OTXA 3MDBC 4L1RA 1DROA 1X86A 4D6WA 2D9VA 1ZSQA 2HE7A 4OSNA 4IFSA 5LG4B 1DBHA 2UZRA 2W2WA 4K2PA 1XKEA 2ADZA 3O96A 3PG7A 5D27A 2EMSA 2J0KA 3SO6A 2OQBA 4WJ7A 3U7DA
chains in the Genus database with same CATH topology
4HAXB 5HE1A 1XODA 4IAPA 2YS3A 4HDQA 2COCA 5C5BB 1WG7A 2W2XC 2D9ZA 4HB2B 3GYPA 1OMWA 3N7CA 1K5GB 5J3YA 1FGZA 1UNRA 4WSFA 1UPRA 4KHAA 4HAWB 3SV1A 1H10A 2D10A 2EJ8A 4NSWA 2I5CA 1QC6A 1X1GA 2UVMA 3ULBA 3SYXA 3CXBB 4D0NB 3DXCA 3HK0A 1I2HA 4EJNA 3TCAA 5JHHA 1EF1A 5D3XA 3GYOA 1MKEA 5EFXA 4F7HA 5C16A 1OQNA 3WYFB 2J0MA 3TFMA 2KUPA 1FOEA 5D3YA 2AL6A 2LOXA 2FJLA 2COAA 2GS0A 2YT1A 3F0WA 2M38A 4GZUA 5KQ4A 1U2BA 3PZDA 3PEGA 5C6RA 2DLWA 3KRXA 1J19A 1LB1A 3PP2A 3ZDTA 4L6EA 1X05A 3QBVB 1TQZA 1KZ7A 3V5WA 3UZTA 3F5RA 3QWMA 3ODWA 4MK0A 4DX8A 3A98B 2LG1A 4KVGB 5C5BA 1V5MA 2DHKA 3P7ZA 2DFKA 4ZRIA 1OY2A 1WVHA 2I1JA 5CLQB 5LOPB 2G35A 1XCGA 2MDXA 2CY4A 2RLOA 2IYBA 3M1IB 3BJIA 1FGYA 5HE3A 2XQNM 2DHJA 2CRFA 4ZRKA 1W1HA 2ROVA 2P0DA 4HAVB 1BAKA 1MK9B 1NTVA 5J3QA 3WA0A 2DYNA 2N0YA 1DDMA 1DDVA 2CODA 4DBBA 1J0WA 1LW3A 2YS1A 2D4QA 1GC7A 4YL8A 1U5EA 1DDWA 2KCJA 5DHAB 1MAIA 1MIZB 1X1FA 4GMVA 2GJYA 4DX90 1EGXA 5JHGA 4KHBB 3ML4A 1IRSA 4Y94A 3PVLA 2E2XA 2D2QA 2LYDA 2Z0PA 4Z2MB 2GCLA 2K2JA 2YS5A 2LULA 1MIXA 2YSZA 1MK7B 3U8ZA 2H7EA 3NSUA 4Z2NA 1U27A 2VRWB 3KRWA 4CHJA 4ZRJA 1U5DA 5HE0A 2DA0A 1EAZA 2RSGA 3DXEA 4TKNA 2CAYA 2J59M 1WI1A 4A6FB 1GG3A 4IOYX 2IFSA 1AWEA 2YF0A 1V61A 5KQ1A 3SNHA 1WJ1A 5JLJB 1RRPB 4KHOA 1ISNA 3BINA 2N23A 5L81A 2COFA 2L2IA 1FHWA 3FEHA 3VIAA 3TO1A 2I5FA 5D3VA 5FI1A 1U5GA 5DI9B 3RCPA 1PMSA 2P0FA 5DIFB 1W1DA 2YVCA 3KZ1A 2EMTA 4HAUB 2K2UA 5DH9B 1KZGA 2LKOA 5HE2A 4K17A 1Q67A 4KAXB 4P7IA 1Y5OA 4TYZA 2CY5A 1DYNA 1NI2A 4HHVA 1MPHA 2LOZA 1ZM0A 3QIJA 1X11A 2MFQA 2J0JA 4A6KA 4EMOA 1SHCA 2Z0QA 1M7EA 1I7AA 5J3TA 1GC6A 2R0DA 3P6AA 4F7GA 2QKMA 3D8FA 3FSSA 2RNRB 1BWNA 1WGUA 2D9YA 2D9WA 1AQCA 4HATB 2KGXB 4GMXB 3TVVA 2PZ1A 2H7DA 2ZPYA 2RVBB 3AU4A 2GCJA 2YT0A 4MT7A 2NZ8B 1UEFA 5DHFB 2NMBA 4YONA 4DXAB 4A6FA 4CHMA 5KCVA 2P8VA 2DHIA 4HB3B 2ROZB 4B6HA 2DTCA 1FHXA 1XX0A 3MPXA 3PSCA 2W2XD 4HAYB 4PQ0A 1BTNA 2DX1A 1WGQA 1V89A 5GOWB 1FB8A 2Y8FA 2AEHA 1ZC3B 1ZVRA 4EKUA 2YRYA 2X18A 2DX5A 3FM8C 4XWXA 3CIKA 3PVWA 2RUKB 4A5KA 2Y7BA 4A6HA 2R09A 3T06A 3IVFA 3X23A 1WJMA 4WVFB 1U5FA 4GPTB 3TW1A 4HDOA 1FHOA 2M14A 4CYEA 2UZSA 2D9XA 4MY6A 4GXBA 2JP2A 2DN6A 4HB4B 1K5DB 3ODXA 1V5UA 1Y19B 1KI1B 2V76A 1P5TA 1ZC4B 2DYQA 2DKPA 2P0HA 1PLSA 1W1GA 2Y8GA 1NU2A 1XD4A 4HB0B 3PVUA 2Q13A 2L1CA 1P3RA 3AU5A 3KSYA 4K81A 2HTHB 1QQGA 5FI0A 1FAOA 3ZVRA 4PNKA 3ODOA 3ULCA 2MWNB 2ELAA 1TJ6A 1H4RA 2DKQA 3D8DA 3D8EA 5CLLB 5C79A 1SGHA 1UNPA 3OANA 3G9WA 4GN1A 3VOQA 4H8SA 5D3WA 2Z0OA 2I1KA 4BBKA 3A8PA 3LJUX 4HAZB 1XR0B 3HQCA 1EVHA 1P6SA 1V88A 2BCJA 4K2OA 1E5WA 3A8QA 2EC1A 3KY9A 2RGNB 1PFJA 1UNQA 2QKLA 1Z87A 5LONB 3AJ4A 3DXDA 3SUZA 2VSZA 4NY0A 1BTKA 2MKRA 1B55A 4C0AA 1RJ2A 4F7UP 1NTYA 1TXDA 1M7RA 1V5PA 2K00A 2D11A 1U29A 3HW2B 1N3HA 2VKIA 1UPQA 5JP4A 2ELBA 2OTXA 3MDBC 1DROA 1X86A 2D9VA 1ZSQA 2HE7A 4IFSA 1DBHA 2UZRA 2W2WA 4K2PA 1XKEA 2ADZA 3O96A 3PG7A 5D27A 2EMSA 2J0KA 3SO6A 2OQBA 4WJ7A 3U7DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HAX B;  5HE1 A;  1XOD A;  4IAP A;  2YS3 A;  4HDQ A;  2COC A;  5C5B B;  1WG7 A;  2W2X C;  2D9Z A;  4HB2 B;  3GYP A;  1OMW A;  3N7C A;  1K5G B;  5J3Y A;  1FGZ A;  1UNR A;  4WSF A;  1UPR A;  4KHA A;  4HAW B;  3SV1 A;  1H10 A;  2D10 A;  2EJ8 A;  4NSW A;  2I5C A;  1QC6 A;  1X1G A;  2UVM A;  3ULB A;  3SYX A;  3CXB B;  4D0N B;  3DXC A;  3HK0 A;  1I2H A;  4EJN A;  3TCA A;  5JHH A;  1EF1 A;  5D3X A;  3GYO A;  1MKE A;  5EFX A;  4F7H A;  5C16 A;  1OQN A;  3WYF B;  2J0M A;  3TFM A;  2KUP A;  1FOE A;  5D3Y A;  2AL6 A;  2LOX A;  2FJL A;  2COA A;  2GS0 A;  2YT1 A;  3F0W A;  2M38 A;  4GZU A;  5KQ4 A;  1U2B A;  3PZD A;  3PEG A;  5C6R A;  2DLW A;  3KRX A;  1J19 A;  1LB1 A;  3PP2 A;  3ZDT A;  4L6E A;  1X05 A;  3QBV B;  1TQZ A;  1KZ7 A;  3V5W A;  3UZT A;  3F5R A;  3QWM A;  3ODW A;  4MK0 A;  4DX8 A;  3A98 B;  2LG1 A;  4KVG B;  5C5B A;  1V5M A;  2DHK A;  3P7Z A;  2DFK A;  4ZRI A;  1OY2 A;  1WVH A;  2I1J A;  5CLQ B;  5LOP B;  2G35 A;  1XCG A;  2MDX A;  2CY4 A;  2RLO A;  2IYB A;  3M1I B;  3BJI A;  1FGY A;  5HE3 A;  2XQN M;  2DHJ A;  2CRF A;  4ZRK A;  1W1H A;  2ROV A;  2P0D A;  4HAV B;  1BAK A;  1MK9 B;  1NTV A;  5J3Q A;  3WA0 A;  2DYN A;  2N0Y A;  1DDM A;  1DDV A;  2COD A;  4DBB A;  1J0W A;  1LW3 A;  2YS1 A;  2D4Q A;  1GC7 A;  4YL8 A;  1U5E A;  1DDW A;  2KCJ A;  5DHA B;  1MAI A;  1MIZ B;  1X1F A;  4GMV A;  2GJY A;  4DX9 0;  1EGX A;  5JHG A;  4KHB B;  3ML4 A;  1IRS A;  4Y94 A;  3PVL A;  2E2X A;  2D2Q A;  2LYD A;  2Z0P A;  4Z2M B;  2GCL A;  2K2J A;  2YS5 A;  2LUL A;  1MIX A;  2YSZ A;  1MK7 B;  3U8Z A;  2H7E A;  3NSU A;  4Z2N A;  1U27 A;  2VRW B;  3KRW A;  4CHJ A;  4ZRJ A;  1U5D A;  5HE0 A;  2DA0 A;  1EAZ A;  2RSG A;  3DXE A;  4TKN A;  2CAY A;  2J59 M;  1WI1 A;  4A6F B;  1GG3 A;  4IOY X;  2IFS A;  1AWE A;  2YF0 A;  1V61 A;  5KQ1 A;  3SNH A;  1WJ1 A;  5JLJ B;  1RRP B;  4KHO A;  1ISN A;  3BIN A;  2N23 A;  5L81 A;  2COF A;  2L2I A;  1FHW A;  3FEH A;  3VIA A;  3TO1 A;  2I5F A;  5D3V A;  5FI1 A;  1U5G A;  5DI9 B;  3RCP A;  1PMS A;  2P0F A;  5DIF B;  1W1D A;  2YVC A;  3KZ1 A;  2EMT A;  4HAU B;  2K2U A;  5DH9 B;  1KZG A;  2LKO A;  5HE2 A;  4K17 A;  1Q67 A;  4KAX B;  4P7I A;  1Y5O A;  4TYZ A;  2CY5 A;  1DYN A;  1NI2 A;  4HHV A;  1MPH A;  2LOZ A;  1ZM0 A;  3QIJ A;  1X11 A;  2MFQ A;  2J0J A;  4A6K A;  4EMO A;  1SHC A;  2Z0Q A;  1M7E A;  1I7A A;  5J3T A;  1GC6 A;  2R0D A;  3P6A A;  4F7G A;  2QKM A;  3D8F A;  3FSS A;  2RNR B;  1BWN A;  1WGU A;  2D9Y A;  2D9W A;  1AQC A;  4HAT B;  2KGX B;  4GMX B;  3TVV A;  2PZ1 A;  2H7D A;  2ZPY A;  2RVB B;  3AU4 A;  2GCJ A;  2YT0 A;  4MT7 A;  2NZ8 B;  1UEF A;  5DHF B;  2NMB A;  4YON A;  4DXA B;  4A6F A;  4CHM A;  5KCV A;  2P8V A;  2DHI A;  4HB3 B;  2ROZ B;  4B6H A;  2DTC A;  1FHX A;  1XX0 A;  3MPX A;  3PSC A;  2W2X D;  4HAY B;  4PQ0 A;  1BTN A;  2DX1 A;  1WGQ A;  1V89 A;  5GOW B;  1FB8 A;  2Y8F A;  2AEH A;  1ZC3 B;  1ZVR A;  4EKU A;  2YRY A;  2X18 A;  2DX5 A;  3FM8 C;  4XWX A;  3CIK A;  3PVW A;  2RUK B;  4A5K A;  2Y7B A;  4A6H A;  2R09 A;  3T06 A;  3IVF A;  3X23 A;  1WJM A;  4WVF B;  1U5F A;  4GPT B;  3TW1 A;  4HDO A;  1FHO A;  2M14 A;  4CYE A;  2UZS A;  2D9X A;  4MY6 A;  4GXB A;  2JP2 A;  2DN6 A;  4HB4 B;  1K5D B;  3ODX A;  1V5U A;  1Y19 B;  1KI1 B;  2V76 A;  1P5T A;  1ZC4 B;  2DYQ A;  2DKP A;  2P0H A;  1PLS A;  1W1G A;  2Y8G A;  1NU2 A;  1XD4 A;  4HB0 B;  3PVU A;  2Q13 A;  2L1C A;  1P3R A;  3AU5 A;  3KSY A;  4K81 A;  2HTH B;  1QQG A;  5FI0 A;  1FAO A;  3ZVR A;  4PNK A;  3ODO A;  3ULC A;  2MWN B;  2ELA A;  1TJ6 A;  1H4R A;  2DKQ A;  3D8D A;  3D8E A;  5CLL B;  5C79 A;  1SGH A;  1UNP A;  3OAN A;  3G9W A;  4GN1 A;  3VOQ A;  4H8S A;  5D3W A;  2Z0O A;  2I1K A;  4BBK A;  3A8P A;  3LJU X;  4HAZ B;  1XR0 B;  3HQC A;  1EVH A;  1P6S A;  1V88 A;  2BCJ A;  4K2O A;  1E5W A;  3A8Q A;  2EC1 A;  3KY9 A;  2RGN B;  1PFJ A;  1UNQ A;  2QKL A;  1Z87 A;  5LON B;  3AJ4 A;  3DXD A;  3SUZ A;  2VSZ A;  4NY0 A;  1BTK A;  2MKR A;  1B55 A;  4C0A A;  1RJ2 A;  4F7U P;  1NTY A;  1TXD A;  1M7R A;  1V5P A;  2K00 A;  2D11 A;  1U29 A;  3HW2 B;  1N3H A;  2VKI A;  1UPQ A;  5JP4 A;  2ELB A;  2OTX A;  3MDB C;  1DRO A;  1X86 A;  2D9V A;  1ZSQ A;  2HE7 A;  4IFS A;  1DBH A;  2UZR A;  2W2W A;  4K2P A;  1XKE A;  2ADZ A;  3O96 A;  3PG7 A;  5D27 A;  2EMS A;  2J0K A;  3SO6 A;  2OQB A;  4WJ7 A;  3U7D A; 
#chains in the Genus database with same CATH topology
 4HAX B;  5HE1 A;  1XOD A;  4IAP A;  2YS3 A;  4HDQ A;  2COC A;  3NWA A;  5C5B B;  1WG7 A;  2W2X C;  2D9Z A;  4HB2 B;  3GYP A;  1OMW A;  3N7C A;  3U12 A;  1K5G B;  1ZYI A;  5J3Y A;  1FGZ A;  1MI1 A;  1UNR A;  4WSF A;  3HIE A;  1UPR A;  4KHA A;  4HAW B;  3SV1 A;  4DIX A;  1H10 A;  2D10 A;  2EJ8 A;  4NSW A;  2I5C A;  1QC6 A;  1X1G A;  2UVM A;  3ULB A;  3SYX A;  3CXB B;  2KIE A;  4D0N B;  3DXC A;  3HK0 A;  1I2H A;  4EJN A;  3TCA A;  5JHH A;  1EF1 A;  5D3X A;  3GYO A;  1MKE A;  5EFX A;  4F7H A;  5C16 A;  1OQN A;  3WYF B;  2J0M A;  3TFM A;  2KUP A;  1FOE A;  5D3Y A;  5M4Y B;  2AL6 A;  2LOX A;  2FJL A;  2COA A;  2GS0 A;  2Z4D A;  2YT1 A;  3F0W A;  2M38 A;  4GZU A;  5KQ4 A;  1U2B A;  3PZD A;  3PEG A;  5C6R A;  2R2Y A;  2DLW A;  3KRX A;  1J19 A;  1LB1 A;  3PP2 A;  3ZDT A;  4L6E A;  1X05 A;  3QBV B;  1TQZ A;  1KZ7 A;  3V5W A;  3UZT A;  3F5R A;  3QWM A;  3ODW A;  4MK0 A;  4DX8 A;  3A98 B;  2LG1 A;  4KVG B;  5C5B A;  1V5M A;  2DHK A;  3P7Z A;  2DFK A;  4ZRI A;  1OY2 A;  1WVH A;  2I1J A;  5CLQ B;  5LOP B;  2G35 A;  1XCG A;  2MDX A;  3NWF A;  2CY4 A;  2RLO A;  2IYB A;  3M1I B;  3BJI A;  1FGY A;  5HE3 A;  2XQN M;  2DHJ A;  2CRF A;  3OHM B;  2Z13 A;  4ZRK A;  1W1H A;  2ROV A;  2P0D A;  4HAV B;  1BAK A;  1MK9 B;  1NTV A;  5J3Q A;  2NBV A;  3WA0 A;  2DYN A;  2N0Y A;  1DDM A;  1DDV A;  2COD A;  4DBB A;  1J0W A;  1LW3 A;  2YS1 A;  2D4Q A;  1GC7 A;  4YL8 A;  1U5E A;  2KUQ A;  1DDW A;  2KCJ A;  5DHA B;  1MAI A;  1MIZ B;  1X1F A;  4GOU A;  4GMV A;  2GJY A;  4DX9 0;  1EGX A;  2RRF A;  5JHG A;  4KHB B;  2KIG A;  3ML4 A;  1IRS A;  4Y94 A;  3PVL A;  2E2X A;  2D2Q A;  2LYD A;  2Z0P A;  4Z2M B;  2GCL A;  2K2J A;  2YS5 A;  2LUL A;  1MIX A;  2YSZ A;  1MK7 B;  3FVC A;  4OT1 A;  3U8Z A;  2H7E A;  3NSU A;  4Z2N A;  1U27 A;  2VRW B;  3KRW A;  4CHJ A;  4ZRJ A;  2ZKM X;  1U5D A;  5HE0 A;  2DA0 A;  1EAZ A;  2RSG A;  3DXE A;  4TKN A;  2CAY A;  5I2S A;  2J59 M;  1WI1 A;  4A6F B;  1GG3 A;  4IOY X;  4QJ5 B;  2IFS A;  1AWE A;  2YF0 A;  2GUM A;  1V61 A;  5KQ1 A;  3SNH A;  1WJ1 A;  5JLJ B;  1RRP B;  4KHO A;  1ISN A;  3BIN A;  2N23 A;  5L81 A;  3B77 A;  2COF A;  2L2I A;  1FHW A;  3FEH A;  3VIA A;  3TO1 A;  2I5F A;  5D3V A;  5FI1 A;  3NWD A;  1U5G A;  5DI9 B;  3RCP A;  1PMS A;  2P0F A;  5DIF B;  1W1D A;  2YVC A;  3KZ1 A;  2EMT A;  4HAU B;  2K2U A;  5DH9 B;  1KZG A;  1T77 A;  2LKO A;  5HE2 A;  4K17 A;  1Q67 A;  4KAX B;  4P7I A;  2Z59 A;  1Y5O A;  4TYZ A;  2CY5 A;  1DYN A;  1NI2 A;  4HHV A;  1MPH A;  2LOZ A;  1ZM0 A;  3QIJ A;  1X11 A;  2MFQ A;  2J0J A;  4A6K A;  4EMO A;  4KHB A;  1SHC A;  2Z0Q A;  1M7E A;  1I7A A;  5I2M A;  5J3T A;  1GC6 A;  2R0D A;  3P6A A;  4F7G A;  2QKM A;  3D8F A;  3FSS A;  2RNR B;  1BWN A;  1WGU A;  3DCX A;  2D9Y A;  2D9W A;  2K8E A;  1AQC A;  4HAT B;  2KGX B;  4GMX B;  3TVV A;  2PZ1 A;  2H7D A;  2ZPY A;  2RVB B;  3AU4 A;  2GCJ A;  5IRS A;  2YT0 A;  4MT7 A;  2NZ8 B;  1UEF A;  5DHF B;  2NMB A;  4YON A;  4DXA B;  4A6F A;  4CHM A;  5KCV A;  2P8V A;  2DHI A;  4HB3 B;  2ROZ B;  4B6H A;  2DTC A;  1FHX A;  1XX0 A;  3MPX A;  3PSC A;  2W2X D;  4HAY B;  4PQ0 A;  1BTN A;  2DX1 A;  1WGQ A;  3HSA A;  1V89 A;  5GOW B;  4CSQ A;  1FB8 A;  2Y8F A;  2AEH A;  1ZC3 B;  1ZVR A;  4EKU A;  2YRY A;  2X18 A;  2DX5 A;  3FM8 C;  4XWX A;  3A58 A;  3CIK A;  3NW8 A;  3PVW A;  2FJU B;  2RUK B;  4A5K A;  2Y7B A;  4A6H A;  2R09 A;  3T06 A;  3IVF A;  3X23 A;  1WJM A;  4GNK B;  4WVF B;  1U5F A;  4GPT B;  3TW1 A;  4HDO A;  1FHO A;  2M14 A;  4CYE A;  2UZS A;  2D9X A;  4MY6 A;  4GXB A;  2JP2 A;  2DN6 A;  4HB4 B;  1K5D B;  3ODX A;  1V5U A;  1Y19 B;  1KI1 B;  2V76 A;  1P5T A;  1ZC4 B;  2DYQ A;  2DKP A;  2P0H A;  1PLS A;  1W1G A;  2Z14 A;  2Y8G A;  1NU2 A;  2K49 A;  1XD4 A;  4HB0 B;  3PVU A;  2Q13 A;  2L1C A;  1P3R A;  3AU5 A;  3KSY A;  4K81 A;  2HTH B;  1QQG A;  5FI0 A;  1FAO A;  4QJ3 B;  3ZVR A;  4PNK A;  3ODO A;  3ULC A;  2MWN B;  2ELA A;  1TJ6 A;  4QXA B;  1H4R A;  2DKQ A;  3D8D A;  3D8E A;  4HSI A;  4QJ4 B;  5CLL B;  5C79 A;  1SGH A;  1UNP A;  3OAN A;  3G9W A;  4GN1 A;  3VOQ A;  4H8S A;  5D3W A;  2Z0O A;  2I1K A;  4BBK A;  3A8P A;  3LJU X;  4HAZ B;  1XR0 B;  3HQC A;  1EVH A;  1P6S A;  2KR0 A;  1V88 A;  2BCJ A;  4K2O A;  1E5W A;  3A8Q A;  2EC1 A;  3KY9 A;  2RGN B;  1PFJ A;  1UNQ A;  2QKL A;  1Z87 A;  5LON B;  3AJ4 A;  3DXD A;  3SUZ A;  2VSZ A;  4NY0 A;  1BTK A;  2MKR A;  1B55 A;  2YT2 A;  4C0A A;  1RJ2 A;  4F7U P;  1NTY A;  1TXD A;  1M7R A;  1V5P A;  2K00 A;  2D11 A;  1U29 A;  3HW2 B;  1N3H A;  2VKI A;  1UPQ A;  5JP4 A;  2ELB A;  2OTX A;  3MDB C;  4L1R A;  1DRO A;  1X86 A;  4D6W A;  2D9V A;  1ZSQ A;  2HE7 A;  4OSN A;  4IFS A;  5LG4 B;  1DBH A;  2UZR A;  2W2W A;  4K2P A;  1XKE A;  2ADZ A;  3O96 A;  3PG7 A;  5D27 A;  2EMS A;  2J0K A;  3SO6 A;  2OQB A;  4WJ7 A;  3U7D A; 
#chains in the Genus database with same CATH homology
 4HAX B;  5HE1 A;  1XOD A;  4IAP A;  2YS3 A;  4HDQ A;  2COC A;  5C5B B;  1WG7 A;  2W2X C;  2D9Z A;  4HB2 B;  3GYP A;  1OMW A;  3N7C A;  1K5G B;  5J3Y A;  1FGZ A;  1UNR A;  4WSF A;  1UPR A;  4KHA A;  4HAW B;  3SV1 A;  1H10 A;  2D10 A;  2EJ8 A;  4NSW A;  2I5C A;  1QC6 A;  1X1G A;  2UVM A;  3ULB A;  3SYX A;  3CXB B;  4D0N B;  3DXC A;  3HK0 A;  1I2H A;  4EJN A;  3TCA A;  5JHH A;  1EF1 A;  5D3X A;  3GYO A;  1MKE A;  5EFX A;  4F7H A;  5C16 A;  1OQN A;  3WYF B;  2J0M A;  3TFM A;  2KUP A;  1FOE A;  5D3Y A;  2AL6 A;  2LOX A;  2FJL A;  2COA A;  2GS0 A;  2YT1 A;  3F0W A;  2M38 A;  4GZU A;  5KQ4 A;  1U2B A;  3PZD A;  3PEG A;  5C6R A;  2DLW A;  3KRX A;  1J19 A;  1LB1 A;  3PP2 A;  3ZDT A;  4L6E A;  1X05 A;  3QBV B;  1TQZ A;  1KZ7 A;  3V5W A;  3UZT A;  3F5R A;  3QWM A;  3ODW A;  4MK0 A;  4DX8 A;  3A98 B;  2LG1 A;  4KVG B;  5C5B A;  1V5M A;  2DHK A;  3P7Z A;  2DFK A;  4ZRI A;  1OY2 A;  1WVH A;  2I1J A;  5CLQ B;  5LOP B;  2G35 A;  1XCG A;  2MDX A;  2CY4 A;  2RLO A;  2IYB A;  3M1I B;  3BJI A;  1FGY A;  5HE3 A;  2XQN M;  2DHJ A;  2CRF A;  4ZRK A;  1W1H A;  2ROV A;  2P0D A;  4HAV B;  1BAK A;  1MK9 B;  1NTV A;  5J3Q A;  3WA0 A;  2DYN A;  2N0Y A;  1DDM A;  1DDV A;  2COD A;  4DBB A;  1J0W A;  1LW3 A;  2YS1 A;  2D4Q A;  1GC7 A;  4YL8 A;  1U5E A;  1DDW A;  2KCJ A;  5DHA B;  1MAI A;  1MIZ B;  1X1F A;  4GMV A;  2GJY A;  4DX9 0;  1EGX A;  5JHG A;  4KHB B;  3ML4 A;  1IRS A;  4Y94 A;  3PVL A;  2E2X A;  2D2Q A;  2LYD A;  2Z0P A;  4Z2M B;  2GCL A;  2K2J A;  2YS5 A;  2LUL A;  1MIX A;  2YSZ A;  1MK7 B;  3U8Z A;  2H7E A;  3NSU A;  4Z2N A;  1U27 A;  2VRW B;  3KRW A;  4CHJ A;  4ZRJ A;  1U5D A;  5HE0 A;  2DA0 A;  1EAZ A;  2RSG A;  3DXE A;  4TKN A;  2CAY A;  2J59 M;  1WI1 A;  4A6F B;  1GG3 A;  4IOY X;  2IFS A;  1AWE A;  2YF0 A;  1V61 A;  5KQ1 A;  3SNH A;  1WJ1 A;  5JLJ B;  1RRP B;  4KHO A;  1ISN A;  3BIN A;  2N23 A;  5L81 A;  2COF A;  2L2I A;  1FHW A;  3FEH A;  3VIA A;  3TO1 A;  2I5F A;  5D3V A;  5FI1 A;  1U5G A;  5DI9 B;  3RCP A;  1PMS A;  2P0F A;  5DIF B;  1W1D A;  2YVC A;  3KZ1 A;  2EMT A;  4HAU B;  2K2U A;  5DH9 B;  1KZG A;  2LKO A;  5HE2 A;  4K17 A;  1Q67 A;  4KAX B;  4P7I A;  1Y5O A;  4TYZ A;  2CY5 A;  1DYN A;  1NI2 A;  4HHV A;  1MPH A;  2LOZ A;  1ZM0 A;  3QIJ A;  1X11 A;  2MFQ A;  2J0J A;  4A6K A;  4EMO A;  1SHC A;  2Z0Q A;  1M7E A;  1I7A A;  5J3T A;  1GC6 A;  2R0D A;  3P6A A;  4F7G A;  2QKM A;  3D8F A;  3FSS A;  2RNR B;  1BWN A;  1WGU A;  2D9Y A;  2D9W A;  1AQC A;  4HAT B;  2KGX B;  4GMX B;  3TVV A;  2PZ1 A;  2H7D A;  2ZPY A;  2RVB B;  3AU4 A;  2GCJ A;  2YT0 A;  4MT7 A;  2NZ8 B;  1UEF A;  5DHF B;  2NMB A;  4YON A;  4DXA B;  4A6F A;  4CHM A;  5KCV A;  2P8V A;  2DHI A;  4HB3 B;  2ROZ B;  4B6H A;  2DTC A;  1FHX A;  1XX0 A;  3MPX A;  3PSC A;  2W2X D;  4HAY B;  4PQ0 A;  1BTN A;  2DX1 A;  1WGQ A;  1V89 A;  5GOW B;  1FB8 A;  2Y8F A;  2AEH A;  1ZC3 B;  1ZVR A;  4EKU A;  2YRY A;  2X18 A;  2DX5 A;  3FM8 C;  4XWX A;  3CIK A;  3PVW A;  2RUK B;  4A5K A;  2Y7B A;  4A6H A;  2R09 A;  3T06 A;  3IVF A;  3X23 A;  1WJM A;  4WVF B;  1U5F A;  4GPT B;  3TW1 A;  4HDO A;  1FHO A;  2M14 A;  4CYE A;  2UZS A;  2D9X A;  4MY6 A;  4GXB A;  2JP2 A;  2DN6 A;  4HB4 B;  1K5D B;  3ODX A;  1V5U A;  1Y19 B;  1KI1 B;  2V76 A;  1P5T A;  1ZC4 B;  2DYQ A;  2DKP A;  2P0H A;  1PLS A;  1W1G A;  2Y8G A;  1NU2 A;  1XD4 A;  4HB0 B;  3PVU A;  2Q13 A;  2L1C A;  1P3R A;  3AU5 A;  3KSY A;  4K81 A;  2HTH B;  1QQG A;  5FI0 A;  1FAO A;  3ZVR A;  4PNK A;  3ODO A;  3ULC A;  2MWN B;  2ELA A;  1TJ6 A;  1H4R A;  2DKQ A;  3D8D A;  3D8E A;  5CLL B;  5C79 A;  1SGH A;  1UNP A;  3OAN A;  3G9W A;  4GN1 A;  3VOQ A;  4H8S A;  5D3W A;  2Z0O A;  2I1K A;  4BBK A;  3A8P A;  3LJU X;  4HAZ B;  1XR0 B;  3HQC A;  1EVH A;  1P6S A;  1V88 A;  2BCJ A;  4K2O A;  1E5W A;  3A8Q A;  2EC1 A;  3KY9 A;  2RGN B;  1PFJ A;  1UNQ A;  2QKL A;  1Z87 A;  5LON B;  3AJ4 A;  3DXD A;  3SUZ A;  2VSZ A;  4NY0 A;  1BTK A;  2MKR A;  1B55 A;  4C0A A;  1RJ2 A;  4F7U P;  1NTY A;  1TXD A;  1M7R A;  1V5P A;  2K00 A;  2D11 A;  1U29 A;  3HW2 B;  1N3H A;  2VKI A;  1UPQ A;  5JP4 A;  2ELB A;  2OTX A;  3MDB C;  1DRO A;  1X86 A;  2D9V A;  1ZSQ A;  2HE7 A;  4IFS A;  1DBH A;  2UZR A;  2W2W A;  4K2P A;  1XKE A;  2ADZ A;  3O96 A;  3PG7 A;  5D27 A;  2EMS A;  2J0K A;  3SO6 A;  2OQB A;  4WJ7 A;  3U7D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...