1P3RA

Crystal structure of the phosphotyrosin binding domain(ptb) of mouse disabled 1(dab1)
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
148
structure length
148
Chain Sequence
MEKTDEYLLARFKGDGVKYKAKLIGIDDVPDARGDKMSQDSMMKLKGMAAAGRSQGQHKQRIWVNISLSGIKIIDEKTGVIEHEHPVNKISFIARDVTDNRAFGYVCGGEGQHQFFAIKTGQQAEPLVVDLKDLFQVIYNVKKKEEDK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Disabled homolog 2
publication title Crystal structures of the Dab homology domains of mouse disabled 1 and 2.
pubmed doi rcsb
source organism Mus musculus
molecule tags Signaling protein
total genus 47
structure length 148
sequence length 148
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2003-04-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00640 PID Phosphotyrosine interaction domain (PTB/PID)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 1p3rA00
5DHFB 1OQNA 5HE1A 1TQZA 4B6HA 5J3TA 2M14A 1GC6A 1XCGA 2ELAA 3V5WA 2RNRB 2Y8GA 2P0DA 1NTYA 2I1JA 2LG1A 3AU4A 3BINA 3TFMA 4MT7A 1KZGA 3KZ1A 2DKQA 2CY5A 2KUPA 1V5PA 3ODOA 2P8VA 2I5FA 5HE2A 4IAPA 2Z0OA 1EVHA 3VOQA 2J0JA 2G35A 2I1KA 4GXBA 1WGQA 4GN1A 1QC6A 2VRWB 4HAVB 2H7DA 2I5CA 2Z0QA 3QBVB 1UEFA 4F7GA 1WJ1A 4K2PA 1AWEA 2Q13A 4BBKA 2DYQA 5KQ1A 1U5DA 1NU2A 5D3WA 2FJLA 3RCPA 3GYPA 4K2OA 2W2XD 1J19A 3TVVA 3KRXA 3U8ZA 1V88A 4HATB 2DLWA 5C5BB 4A6FA 4EJNA 3PSCA 1B55A 3D8EA 1LB1A 2Z0PA 1MIZB 1AQCA 3F5RA 2QKLA 3ML4A 3LJUX 3M1IB 2KGXB 4Y94A 5HE0A 5D27A 3WA0A 5L81A 3PVWA 1FGZA 1M7RA 2XQNM 3GYOA 5JHHA 4GMVA 3KRWA 2MDXA 3SV1A 2JP2A 2DKPA 3F0WA 3MPXA 1FOEA 2DN6A 2R0DA 2ROVA 2LULA 4NY0A 1QQGA 1ZSQA 2DHJA 1PFJA 3SNHA 2VKIA 3AU5A 2D11A 3FM8C 3VIAA 4IOYX 2NMBA 2RSGA 4D0NB 2DX5A 2N23A 1SHCA 5C5BA 1X1FA 2GCJA 1UPRA 5JP4A 1UNQA 2E2XA 4TYZA 4EKUA 1FAOA 5KCVA 2R09A 4EMOA 1J0WA 2BCJA 2LYDA 2YRYA 4ZRKA 1DDWA 4HAYB 1FHWA 1EAZA 2LOXA 2UZRA 2DX1A 2EMTA 2EMSA 4PNKA 3CIKA 2HE7A 2COAA 2D9WA 2OQBA 3PVLA 3P6AA 2EJ8A 1X1GA 4K81A 2COCA 2W2XC 5DHAB 1XODA 1MK7B 2D4QA 4KVGB 2Y8FA 1EGXA 5LONB 1K5DB 1P6SA 1H4RA 1W1GA 2RGNB 2MFQA 1WGUA 1OY2A 2LOZA 3CXBB 1MK9B 2GCLA 3MDBC 2DTCA 1ISNA 3TW1A 1NTVA 1ZVRA 1UNRA 4KHOA 4HDQA 3DXCA 1WJMA 3A98B 1W1HA 4H8SA 3HQCA 1WG7A 3D8DA 4HDOA 1KZ7A 1XX0A 3DXEA 1P3RA 2DYNA 5D3VA 5J3QA 4WVFB 3SO6A 2ROZB 3DXDA 2P0FA 5J3YA 5D3YA 1FB8A 3PVUA 2J0MA 4ZRJA 1Y19B 3D8FA 1PMSA 2LKOA 1W1DA 4HHVA 2YT0A 3PEGA 1DYNA 1I2HA 3A8PA 1U5FA 2CRFA 2D9ZA 3BJIA 1BTNA 2D2QA 4CYEA 3SUZA 2J0KA 1E5WA 2OTXA 5HE3A 2AL6A 4CHMA 3SYXA 2H7EA 5C79A 3U7DA 1GG3A 1M7EA 1V89A 4Z2MB 3KY9A 4A6KA 1WI1A 2J59M 1MIXA 1UPQA 5C6RA 2MWNB 2CY4A 4K17A 4GPTB 2PZ1A 1ZC4B 3AJ4A 1Y5OA 1MPHA 2K2JA 1TJ6A 3PP2A 3TO1A 4MY6A 4DBBA 2MKRA 1XD4A 1DBHA 4KHBB 1XR0B 5C16A 3FSSA 2YS5A 4HAWB 1IRSA 4F7HA 3X23A 2YSZA 2L1CA 2UVMA 4PQ0A 3UZTA 2ADZA 3WYFB 1P5TA 5JHGA 4YL8A 5FI0A 3N7CA 4Z2NA 4WJ7A 2L2IA 1ZM0A 4NSWA 1BTKA 2IFSA 4DX90 2YT1A 2ELBA 1ZC3B 1X11A 1FGYA 4GZUA 1V61A 2RLOA 5DIFB 2GJYA 1UNPA 3TCAA 3P7ZA 1KI1B 4HAUB 2GS0A 2D9XA 5EFXA 4KAXB 2RVBB 3QIJA 1LW3A 2COFA 3T06A 2VSZA 1U2BA 5DI9B 5CLLB 1TXDA 1NI2A 1BAKA 1K5GB 2N0YA 3A8QA 5FI1A 2K00A 4A6FB 2KCJA 4A6HA 5JLJB 5LOPB 4WSFA 3OANA 1Z87A 5DH9B 2P0HA 1MAIA 1U27A 4HB4B 2M38A 1RRPB 3HW2B 2DA0A 1RJ2A 2D10A 5D3XA 1DDVA 2D9VA 4XWXA 3O96A 1WVHA 4HB3B 4CHJA 2ZPYA 2RUKB 3ZVRA 2YVCA 4IFSA 2DFKA 4HB2B 1U5GA 4DX8A 1GC7A 2HTHB 3IVFA 1X05A 1BWNA 3ULCA 3NSUA 2QKMA 2X18A 4P7IA 1PLSA 4DXAB 1Q67A 1FHOA 1XKEA 4C0AA 3ODXA 1DROA 2D9YA 4F7UP 1N3HA 2CODA 1V5UA 4MK0A 4HAXB 2IYBA 1FHXA 1EF1A 2K2UA 4HAZB 1MKEA 1OMWA 2YS1A 4ZRIA 1SGHA 3ULBA 3ZDTA 3PG7A 3KSYA 2AEHA 5KQ4A 1U29A 2DHKA 4KHAA 2YF0A 2DHIA 2YS3A 2UZSA 4GMXB 2Y7BA 3QWMA 2CAYA 1U5EA 1X86A 2NZ8B 2W2WA 5CLQB 1DDMA 3ODWA 3HK0A 5GOWB 2V76A 4A5KA 4L6EA 4YONA 1H10A 3G9WA 4HB0B 1I7AA 3FEHA 1V5MA 3PZDA 4TKNA 2EC1A
chains in the Genus database with same CATH superfamily
5DHFB 1OQNA 5HE1A 1TQZA 4B6HA 4QJ5B 5J3TA 2M14A 1GC6A 1XCGA 2ELAA 4CSQA 1ZYIA 3V5WA 2RNRB 2Y8GA 2P0DA 1NTYA 2I1JA 2LG1A 3AU4A 3BINA 3TFMA 4MT7A 1KZGA 3KZ1A 2DKQA 2CY5A 2KUPA 3NWAA 4OT1A 1V5PA 3ODOA 2P8VA 2I5FA 5HE2A 4IAPA 2Z0OA 1EVHA 3VOQA 2J0JA 2G35A 2I1KA 4GXBA 1WGQA 4GN1A 1QC6A 2VRWB 4HAVB 2H7DA 2I5CA 2Z0QA 3QBVB 2KR0A 1UEFA 4QXAB 4F7GA 2FJUB 1WJ1A 4K2PA 1AWEA 2Q13A 4BBKA 2DYQA 5KQ1A 1U5DA 1NU2A 5D3WA 2FJLA 3RCPA 3GYPA 2R2YA 4K2OA 2W2XD 2RRFA 1J19A 3TVVA 3KRXA 2YT2A 3U8ZA 1V88A 4HATB 2DLWA 5C5BB 4A6FA 4EJNA 3PSCA 1B55A 3D8EA 1LB1A 2Z0PA 1MIZB 1AQCA 5IRSA 3F5RA 3FVCA 4D6WA 2QKLA 3ML4A 3LJUX 2NBVA 3M1IB 2KGXB 4Y94A 5HE0A 5D27A 3WA0A 5L81A 3PVWA 1FGZA 1M7RA 2XQNM 3GYOA 5JHHA 4GMVA 3KRWA 2MDXA 4OSNA 2JP2A 3SV1A 2DKPA 3F0WA 3MPXA 1FOEA 2DN6A 2R0DA 2ROVA 1MI1A 2LULA 4NY0A 1QQGA 1ZSQA 2DHJA 1PFJA 3B77A 2VKIA 3SNHA 3AU5A 2D11A 4QJ3B 3FM8C 3VIAA 4IOYX 2NMBA 2RSGA 4D0NB 2DX5A 2N23A 1SHCA 5C5BA 1X1FA 2GCJA 1UPRA 5JP4A 1UNQA 2E2XA 4TYZA 4EKUA 5I2SA 1FAOA 5KCVA 2R09A 4EMOA 1J0WA 2BCJA 2LYDA 2YRYA 4ZRKA 1DDWA 4HAYB 3HIEA 1FHWA 1EAZA 2LOXA 2UZRA 2DX1A 2EMTA 2EMSA 4PNKA 3CIKA 2HE7A 2COAA 2D9WA 2OQBA 3PVLA 3P6AA 2EJ8A 1X1GA 4K81A 2COCA 2W2XC 3NW8A 5DHAB 1XODA 1MK7B 2D4QA 4KVGB 2Y8FA 1EGXA 3DCXA 5LONB 1K5DB 1P6SA 1H4RA 1W1GA 2RGNB 5M4YB 2MFQA 1WGUA 1OY2A 2LOZA 3CXBB 1MK9B 2Z4DA 2GCLA 3MDBC 2DTCA 1ISNA 3TW1A 1NTVA 1ZVRA 1UNRA 4KHOA 4HDQA 3DXCA 1WJMA 3A98B 1W1HA 4H8SA 3HQCA 1WG7A 3D8DA 4HDOA 1KZ7A 1XX0A 3DXEA 1P3RA 2DYNA 5D3VA 5J3QA 4WVFB 3SO6A 2ROZB 3DXDA 2P0FA 5J3YA 5D3YA 1FB8A 3PVUA 2J0MA 4ZRJA 1Y19B 3D8FA 1PMSA 2LKOA 2K8EA 1W1DA 4HHVA 2YT0A 3PEGA 2K49A 1DYNA 1I2HA 3A8PA 1U5FA 2CRFA 2D9ZA 2KIGA 3BJIA 1BTNA 2D2QA 4CYEA 3SUZA 2J0KA 1E5WA 2OTXA 5HE3A 2AL6A 4CHMA 3SYXA 2H7EA 5C79A 3U7DA 1GG3A 1M7EA 1V89A 4Z2MB 3KY9A 4A6KA 1WI1A 2J59M 1MIXA 1UPQA 5C6RA 2MWNB 2CY4A 4K17A 4GPTB 2PZ1A 1ZC4B 3AJ4A 2KUQA 1Y5OA 1MPHA 2K2JA 1TJ6A 3PP2A 3TO1A 4MY6A 4DBBA 3NWDA 2MKRA 1XD4A 1DBHA 4KHBB 1XR0B 5C16A 4L1RA 3FSSA 2YS5A 4HAWB 4QJ4B 1IRSA 4F7HA 2Z59A 3X23A 2YSZA 2L1CA 2UVMA 2Z14A 4PQ0A 3UZTA 2ADZA 3WYFB 1P5TA 5JHGA 4YL8A 5FI0A 4GNKB 3N7CA 4Z2NA 4WJ7A 2L2IA 1ZM0A 4NSWA 1BTKA 2IFSA 4DX90 2YT1A 2ELBA 1ZC3B 1X11A 1FGYA 4GZUA 1V61A 2RLOA 5DIFB 2GJYA 1UNPA 3TCAA 3P7ZA 1KI1B 4HAUB 2GS0A 2D9XA 5EFXA 4KAXB 2RVBB 3QIJA 1LW3A 2COFA 3T06A 2VSZA 1U2BA 5DI9B 5CLLB 1TXDA 1NI2A 1BAKA 1K5GB 2N0YA 1T77A 4KHBA 3A8QA 5FI1A 2K00A 4A6FB 2KCJA 4A6HA 5JLJB 5LOPB 4WSFA 2ZKMX 3OANA 1Z87A 5DH9B 2P0HA 1MAIA 1U27A 5LG4B 4HB4B 2M38A 1RRPB 3HW2B 2DA0A 1RJ2A 2D10A 2GUMA 5D3XA 1DDVA 2D9VA 4XWXA 3U12A 3O96A 1WVHA 4HB3B 4CHJA 2ZPYA 2RUKB 3ZVRA 2YVCA 3NWFA 4IFSA 2DFKA 4HB2B 1U5GA 4DX8A 1GC7A 3HSAA 2HTHB 3IVFA 1X05A 1BWNA 3ULCA 3NSUA 2QKMA 2X18A 4P7IA 1PLSA 2KIEA 4DXAB 1Q67A 1FHOA 1XKEA 4C0AA 3ODXA 1DROA 2D9YA 4F7UP 1N3HA 2CODA 1V5UA 4MK0A 5I2MA 4HAXB 2IYBA 1FHXA 1EF1A 2K2UA 4HAZB 1MKEA 1OMWA 2YS1A 4ZRIA 1SGHA 4DIXA 3ULBA 3ZDTA 3PG7A 3KSYA 3A58A 2AEHA 5KQ4A 1U29A 2DHKA 4KHAA 2YF0A 2DHIA 2YS3A 2UZSA 4GMXB 2Y7BA 3QWMA 2CAYA 1U5EA 1X86A 2NZ8B 2W2WA 5CLQB 1DDMA 3ODWA 3HK0A 5GOWB 2V76A 4A5KA 3OHMB 4L6EA 4YONA 1H10A 3G9WA 4HB0B 1I7AA 4HSIA 3FEHA 1V5MA 2Z13A 3PZDA 4TKNA 4GOUA 2EC1A
chains in the Genus database with same CATH topology
5DHFB 1OQNA 5HE1A 1TQZA 4B6HA 5J3TA 2M14A 1GC6A 1XCGA 2ELAA 3V5WA 2RNRB 2Y8GA 2P0DA 1NTYA 2I1JA 2LG1A 3AU4A 3BINA 3TFMA 4MT7A 1KZGA 3KZ1A 2DKQA 2CY5A 2KUPA 1V5PA 3ODOA 2P8VA 2I5FA 5HE2A 4IAPA 2Z0OA 1EVHA 3VOQA 2J0JA 2G35A 2I1KA 4GXBA 1WGQA 4GN1A 1QC6A 2VRWB 4HAVB 2H7DA 2I5CA 2Z0QA 3QBVB 1UEFA 4F7GA 1WJ1A 4K2PA 1AWEA 2Q13A 4BBKA 2DYQA 5KQ1A 1U5DA 1NU2A 5D3WA 2FJLA 3RCPA 3GYPA 4K2OA 2W2XD 1J19A 3TVVA 3KRXA 3U8ZA 1V88A 4HATB 2DLWA 5C5BB 4A6FA 4EJNA 3PSCA 1B55A 3D8EA 1LB1A 2Z0PA 1MIZB 1AQCA 3F5RA 2QKLA 3ML4A 3LJUX 3M1IB 2KGXB 4Y94A 5HE0A 5D27A 3WA0A 5L81A 3PVWA 1FGZA 1M7RA 2XQNM 3GYOA 5JHHA 4GMVA 3KRWA 2MDXA 3SV1A 2JP2A 2DKPA 3F0WA 3MPXA 1FOEA 2DN6A 2R0DA 2ROVA 2LULA 4NY0A 1QQGA 1ZSQA 2DHJA 1PFJA 3SNHA 2VKIA 3AU5A 2D11A 3FM8C 3VIAA 4IOYX 2NMBA 2RSGA 4D0NB 2DX5A 2N23A 1SHCA 5C5BA 1X1FA 2GCJA 1UPRA 5JP4A 1UNQA 2E2XA 4TYZA 4EKUA 1FAOA 5KCVA 2R09A 4EMOA 1J0WA 2BCJA 2LYDA 2YRYA 4ZRKA 1DDWA 4HAYB 1FHWA 1EAZA 2LOXA 2UZRA 2DX1A 2EMTA 2EMSA 4PNKA 3CIKA 2HE7A 2COAA 2D9WA 2OQBA 3PVLA 3P6AA 2EJ8A 1X1GA 4K81A 2COCA 2W2XC 5DHAB 1XODA 1MK7B 2D4QA 4KVGB 2Y8FA 1EGXA 5LONB 1K5DB 1P6SA 1H4RA 1W1GA 2RGNB 2MFQA 1WGUA 1OY2A 2LOZA 3CXBB 1MK9B 2GCLA 3MDBC 2DTCA 1ISNA 3TW1A 1NTVA 1ZVRA 1UNRA 4KHOA 4HDQA 3DXCA 1WJMA 3A98B 1W1HA 4H8SA 3HQCA 1WG7A 3D8DA 4HDOA 1KZ7A 1XX0A 3DXEA 1P3RA 2DYNA 5D3VA 5J3QA 4WVFB 3SO6A 2ROZB 3DXDA 2P0FA 5J3YA 5D3YA 1FB8A 3PVUA 2J0MA 4ZRJA 1Y19B 3D8FA 1PMSA 2LKOA 1W1DA 4HHVA 2YT0A 3PEGA 1DYNA 1I2HA 3A8PA 1U5FA 2CRFA 2D9ZA 3BJIA 1BTNA 2D2QA 4CYEA 3SUZA 2J0KA 1E5WA 2OTXA 5HE3A 2AL6A 4CHMA 3SYXA 2H7EA 5C79A 3U7DA 1GG3A 1M7EA 1V89A 4Z2MB 3KY9A 4A6KA 1WI1A 2J59M 1MIXA 1UPQA 5C6RA 2MWNB 2CY4A 4K17A 4GPTB 2PZ1A 1ZC4B 3AJ4A 1Y5OA 1MPHA 2K2JA 1TJ6A 3PP2A 3TO1A 4MY6A 4DBBA 2MKRA 1XD4A 1DBHA 4KHBB 1XR0B 5C16A 3FSSA 2YS5A 4HAWB 1IRSA 4F7HA 3X23A 2YSZA 2L1CA 2UVMA 4PQ0A 3UZTA 2ADZA 3WYFB 1P5TA 5JHGA 4YL8A 5FI0A 3N7CA 4Z2NA 4WJ7A 2L2IA 1ZM0A 4NSWA 1BTKA 2IFSA 4DX90 2YT1A 2ELBA 1ZC3B 1X11A 1FGYA 4GZUA 1V61A 2RLOA 5DIFB 2GJYA 1UNPA 3TCAA 3P7ZA 1KI1B 4HAUB 2GS0A 2D9XA 5EFXA 4KAXB 2RVBB 3QIJA 1LW3A 2COFA 3T06A 2VSZA 1U2BA 5DI9B 5CLLB 1TXDA 1NI2A 1BAKA 1K5GB 2N0YA 3A8QA 5FI1A 2K00A 4A6FB 2KCJA 4A6HA 5JLJB 5LOPB 4WSFA 3OANA 1Z87A 5DH9B 2P0HA 1MAIA 1U27A 4HB4B 2M38A 1RRPB 3HW2B 2DA0A 1RJ2A 2D10A 5D3XA 1DDVA 2D9VA 4XWXA 3O96A 1WVHA 4HB3B 4CHJA 2ZPYA 2RUKB 3ZVRA 2YVCA 4IFSA 2DFKA 4HB2B 1U5GA 4DX8A 1GC7A 2HTHB 3IVFA 1X05A 1BWNA 3ULCA 3NSUA 2QKMA 2X18A 4P7IA 1PLSA 4DXAB 1Q67A 1FHOA 1XKEA 4C0AA 3ODXA 1DROA 2D9YA 4F7UP 1N3HA 2CODA 1V5UA 4MK0A 4HAXB 2IYBA 1FHXA 1EF1A 2K2UA 4HAZB 1MKEA 1OMWA 2YS1A 4ZRIA 1SGHA 3ULBA 3ZDTA 3PG7A 3KSYA 2AEHA 5KQ4A 1U29A 2DHKA 4KHAA 2YF0A 2DHIA 2YS3A 2UZSA 4GMXB 2Y7BA 3QWMA 2CAYA 1U5EA 1X86A 2NZ8B 2W2WA 5CLQB 1DDMA 3ODWA 3HK0A 5GOWB 2V76A 4A5KA 4L6EA 4YONA 1H10A 3G9WA 4HB0B 1I7AA 3FEHA 1V5MA 3PZDA 4TKNA 2EC1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5DHF B;  1OQN A;  5HE1 A;  1TQZ A;  4B6H A;  5J3T A;  2M14 A;  1GC6 A;  1XCG A;  2ELA A;  3V5W A;  2RNR B;  2Y8G A;  2P0D A;  1NTY A;  2I1J A;  2LG1 A;  3AU4 A;  3BIN A;  3TFM A;  4MT7 A;  1KZG A;  3KZ1 A;  2DKQ A;  2CY5 A;  2KUP A;  1V5P A;  3ODO A;  2P8V A;  2I5F A;  5HE2 A;  4IAP A;  2Z0O A;  1EVH A;  3VOQ A;  2J0J A;  2G35 A;  2I1K A;  4GXB A;  1WGQ A;  4GN1 A;  1QC6 A;  2VRW B;  4HAV B;  2H7D A;  2I5C A;  2Z0Q A;  3QBV B;  1UEF A;  4F7G A;  1WJ1 A;  4K2P A;  1AWE A;  2Q13 A;  4BBK A;  2DYQ A;  5KQ1 A;  1U5D A;  1NU2 A;  5D3W A;  2FJL A;  3RCP A;  3GYP A;  4K2O A;  2W2X D;  1J19 A;  3TVV A;  3KRX A;  3U8Z A;  1V88 A;  4HAT B;  2DLW A;  5C5B B;  4A6F A;  4EJN A;  3PSC A;  1B55 A;  3D8E A;  1LB1 A;  2Z0P A;  1MIZ B;  1AQC A;  3F5R A;  2QKL A;  3ML4 A;  3LJU X;  3M1I B;  2KGX B;  4Y94 A;  5HE0 A;  5D27 A;  3WA0 A;  5L81 A;  3PVW A;  1FGZ A;  1M7R A;  2XQN M;  3GYO A;  5JHH A;  4GMV A;  3KRW A;  2MDX A;  3SV1 A;  2JP2 A;  2DKP A;  3F0W A;  3MPX A;  1FOE A;  2DN6 A;  2R0D A;  2ROV A;  2LUL A;  4NY0 A;  1QQG A;  1ZSQ A;  2DHJ A;  1PFJ A;  3SNH A;  2VKI A;  3AU5 A;  2D11 A;  3FM8 C;  3VIA A;  4IOY X;  2NMB A;  2RSG A;  4D0N B;  2DX5 A;  2N23 A;  1SHC A;  5C5B A;  1X1F A;  2GCJ A;  1UPR A;  5JP4 A;  1UNQ A;  2E2X A;  4TYZ A;  4EKU A;  1FAO A;  5KCV A;  2R09 A;  4EMO A;  1J0W A;  2BCJ A;  2LYD A;  2YRY A;  4ZRK A;  1DDW A;  4HAY B;  1FHW A;  1EAZ A;  2LOX A;  2UZR A;  2DX1 A;  2EMT A;  2EMS A;  4PNK A;  3CIK A;  2HE7 A;  2COA A;  2D9W A;  2OQB A;  3PVL A;  3P6A A;  2EJ8 A;  1X1G A;  4K81 A;  2COC A;  2W2X C;  5DHA B;  1XOD A;  1MK7 B;  2D4Q A;  4KVG B;  2Y8F A;  1EGX A;  5LON B;  1K5D B;  1P6S A;  1H4R A;  1W1G A;  2RGN B;  2MFQ A;  1WGU A;  1OY2 A;  2LOZ A;  3CXB B;  1MK9 B;  2GCL A;  3MDB C;  2DTC A;  1ISN A;  3TW1 A;  1NTV A;  1ZVR A;  1UNR A;  4KHO A;  4HDQ A;  3DXC A;  1WJM A;  3A98 B;  1W1H A;  4H8S A;  3HQC A;  1WG7 A;  3D8D A;  4HDO A;  1KZ7 A;  1XX0 A;  3DXE A;  1P3R A;  2DYN A;  5D3V A;  5J3Q A;  4WVF B;  3SO6 A;  2ROZ B;  3DXD A;  2P0F A;  5J3Y A;  5D3Y A;  1FB8 A;  3PVU A;  2J0M A;  4ZRJ A;  1Y19 B;  3D8F A;  1PMS A;  2LKO A;  1W1D A;  4HHV A;  2YT0 A;  3PEG A;  1DYN A;  1I2H A;  3A8P A;  1U5F A;  2CRF A;  2D9Z A;  3BJI A;  1BTN A;  2D2Q A;  4CYE A;  3SUZ A;  2J0K A;  1E5W A;  2OTX A;  5HE3 A;  2AL6 A;  4CHM A;  3SYX A;  2H7E A;  5C79 A;  3U7D A;  1GG3 A;  1M7E A;  1V89 A;  4Z2M B;  3KY9 A;  4A6K A;  1WI1 A;  2J59 M;  1MIX A;  1UPQ A;  5C6R A;  2MWN B;  2CY4 A;  4K17 A;  4GPT B;  2PZ1 A;  1ZC4 B;  3AJ4 A;  1Y5O A;  1MPH A;  2K2J A;  1TJ6 A;  3PP2 A;  3TO1 A;  4MY6 A;  4DBB A;  2MKR A;  1XD4 A;  1DBH A;  4KHB B;  1XR0 B;  5C16 A;  3FSS A;  2YS5 A;  4HAW B;  1IRS A;  4F7H A;  3X23 A;  2YSZ A;  2L1C A;  2UVM A;  4PQ0 A;  3UZT A;  2ADZ A;  3WYF B;  1P5T A;  5JHG A;  4YL8 A;  5FI0 A;  3N7C A;  4Z2N A;  4WJ7 A;  2L2I A;  1ZM0 A;  4NSW A;  1BTK A;  2IFS A;  4DX9 0;  2YT1 A;  2ELB A;  1ZC3 B;  1X11 A;  1FGY A;  4GZU A;  1V61 A;  2RLO A;  5DIF B;  2GJY A;  1UNP A;  3TCA A;  3P7Z A;  1KI1 B;  4HAU B;  2GS0 A;  2D9X A;  5EFX A;  4KAX B;  2RVB B;  3QIJ A;  1LW3 A;  2COF A;  3T06 A;  2VSZ A;  1U2B A;  5DI9 B;  5CLL B;  1TXD A;  1NI2 A;  1BAK A;  1K5G B;  2N0Y A;  3A8Q A;  5FI1 A;  2K00 A;  4A6F B;  2KCJ A;  4A6H A;  5JLJ B;  5LOP B;  4WSF A;  3OAN A;  1Z87 A;  5DH9 B;  2P0H A;  1MAI A;  1U27 A;  4HB4 B;  2M38 A;  1RRP B;  3HW2 B;  2DA0 A;  1RJ2 A;  2D10 A;  5D3X A;  1DDV A;  2D9V A;  4XWX A;  3O96 A;  1WVH A;  4HB3 B;  4CHJ A;  2ZPY A;  2RUK B;  3ZVR A;  2YVC A;  4IFS A;  2DFK A;  4HB2 B;  1U5G A;  4DX8 A;  1GC7 A;  2HTH B;  3IVF A;  1X05 A;  1BWN A;  3ULC A;  3NSU A;  2QKM A;  2X18 A;  4P7I A;  1PLS A;  4DXA B;  1Q67 A;  1FHO A;  1XKE A;  4C0A A;  3ODX A;  1DRO A;  2D9Y A;  4F7U P;  1N3H A;  2COD A;  1V5U A;  4MK0 A;  4HAX B;  2IYB A;  1FHX A;  1EF1 A;  2K2U A;  4HAZ B;  1MKE A;  1OMW A;  2YS1 A;  4ZRI A;  1SGH A;  3ULB A;  3ZDT A;  3PG7 A;  3KSY A;  2AEH A;  5KQ4 A;  1U29 A;  2DHK A;  4KHA A;  2YF0 A;  2DHI A;  2YS3 A;  2UZS A;  4GMX B;  2Y7B A;  3QWM A;  2CAY A;  1U5E A;  1X86 A;  2NZ8 B;  2W2W A;  5CLQ B;  1DDM A;  3ODW A;  3HK0 A;  5GOW B;  2V76 A;  4A5K A;  4L6E A;  4YON A;  1H10 A;  3G9W A;  4HB0 B;  1I7A A;  3FEH A;  1V5M A;  3PZD A;  4TKN A;  2EC1 A; 
#chains in the Genus database with same CATH topology
 5DHF B;  1OQN A;  5HE1 A;  1TQZ A;  4B6H A;  4QJ5 B;  5J3T A;  2M14 A;  1GC6 A;  1XCG A;  2ELA A;  4CSQ A;  1ZYI A;  3V5W A;  2RNR B;  2Y8G A;  2P0D A;  1NTY A;  2I1J A;  2LG1 A;  3AU4 A;  3BIN A;  3TFM A;  4MT7 A;  1KZG A;  3KZ1 A;  2DKQ A;  2CY5 A;  2KUP A;  3NWA A;  4OT1 A;  1V5P A;  3ODO A;  2P8V A;  2I5F A;  5HE2 A;  4IAP A;  2Z0O A;  1EVH A;  3VOQ A;  2J0J A;  2G35 A;  2I1K A;  4GXB A;  1WGQ A;  4GN1 A;  1QC6 A;  2VRW B;  4HAV B;  2H7D A;  2I5C A;  2Z0Q A;  3QBV B;  2KR0 A;  1UEF A;  4QXA B;  4F7G A;  2FJU B;  1WJ1 A;  4K2P A;  1AWE A;  2Q13 A;  4BBK A;  2DYQ A;  5KQ1 A;  1U5D A;  1NU2 A;  5D3W A;  2FJL A;  3RCP A;  3GYP A;  2R2Y A;  4K2O A;  2W2X D;  2RRF A;  1J19 A;  3TVV A;  3KRX A;  2YT2 A;  3U8Z A;  1V88 A;  4HAT B;  2DLW A;  5C5B B;  4A6F A;  4EJN A;  3PSC A;  1B55 A;  3D8E A;  1LB1 A;  2Z0P A;  1MIZ B;  1AQC A;  5IRS A;  3F5R A;  3FVC A;  4D6W A;  2QKL A;  3ML4 A;  3LJU X;  2NBV A;  3M1I B;  2KGX B;  4Y94 A;  5HE0 A;  5D27 A;  3WA0 A;  5L81 A;  3PVW A;  1FGZ A;  1M7R A;  2XQN M;  3GYO A;  5JHH A;  4GMV A;  3KRW A;  2MDX A;  4OSN A;  2JP2 A;  3SV1 A;  2DKP A;  3F0W A;  3MPX A;  1FOE A;  2DN6 A;  2R0D A;  2ROV A;  1MI1 A;  2LUL A;  4NY0 A;  1QQG A;  1ZSQ A;  2DHJ A;  1PFJ A;  3B77 A;  2VKI A;  3SNH A;  3AU5 A;  2D11 A;  4QJ3 B;  3FM8 C;  3VIA A;  4IOY X;  2NMB A;  2RSG A;  4D0N B;  2DX5 A;  2N23 A;  1SHC A;  5C5B A;  1X1F A;  2GCJ A;  1UPR A;  5JP4 A;  1UNQ A;  2E2X A;  4TYZ A;  4EKU A;  5I2S A;  1FAO A;  5KCV A;  2R09 A;  4EMO A;  1J0W A;  2BCJ A;  2LYD A;  2YRY A;  4ZRK A;  1DDW A;  4HAY B;  3HIE A;  1FHW A;  1EAZ A;  2LOX A;  2UZR A;  2DX1 A;  2EMT A;  2EMS A;  4PNK A;  3CIK A;  2HE7 A;  2COA A;  2D9W A;  2OQB A;  3PVL A;  3P6A A;  2EJ8 A;  1X1G A;  4K81 A;  2COC A;  2W2X C;  3NW8 A;  5DHA B;  1XOD A;  1MK7 B;  2D4Q A;  4KVG B;  2Y8F A;  1EGX A;  3DCX A;  5LON B;  1K5D B;  1P6S A;  1H4R A;  1W1G A;  2RGN B;  5M4Y B;  2MFQ A;  1WGU A;  1OY2 A;  2LOZ A;  3CXB B;  1MK9 B;  2Z4D A;  2GCL A;  3MDB C;  2DTC A;  1ISN A;  3TW1 A;  1NTV A;  1ZVR A;  1UNR A;  4KHO A;  4HDQ A;  3DXC A;  1WJM A;  3A98 B;  1W1H A;  4H8S A;  3HQC A;  1WG7 A;  3D8D A;  4HDO A;  1KZ7 A;  1XX0 A;  3DXE A;  1P3R A;  2DYN A;  5D3V A;  5J3Q A;  4WVF B;  3SO6 A;  2ROZ B;  3DXD A;  2P0F A;  5J3Y A;  5D3Y A;  1FB8 A;  3PVU A;  2J0M A;  4ZRJ A;  1Y19 B;  3D8F A;  1PMS A;  2LKO A;  2K8E A;  1W1D A;  4HHV A;  2YT0 A;  3PEG A;  2K49 A;  1DYN A;  1I2H A;  3A8P A;  1U5F A;  2CRF A;  2D9Z A;  2KIG A;  3BJI A;  1BTN A;  2D2Q A;  4CYE A;  3SUZ A;  2J0K A;  1E5W A;  2OTX A;  5HE3 A;  2AL6 A;  4CHM A;  3SYX A;  2H7E A;  5C79 A;  3U7D A;  1GG3 A;  1M7E A;  1V89 A;  4Z2M B;  3KY9 A;  4A6K A;  1WI1 A;  2J59 M;  1MIX A;  1UPQ A;  5C6R A;  2MWN B;  2CY4 A;  4K17 A;  4GPT B;  2PZ1 A;  1ZC4 B;  3AJ4 A;  2KUQ A;  1Y5O A;  1MPH A;  2K2J A;  1TJ6 A;  3PP2 A;  3TO1 A;  4MY6 A;  4DBB A;  3NWD A;  2MKR A;  1XD4 A;  1DBH A;  4KHB B;  1XR0 B;  5C16 A;  4L1R A;  3FSS A;  2YS5 A;  4HAW B;  4QJ4 B;  1IRS A;  4F7H A;  2Z59 A;  3X23 A;  2YSZ A;  2L1C A;  2UVM A;  2Z14 A;  4PQ0 A;  3UZT A;  2ADZ A;  3WYF B;  1P5T A;  5JHG A;  4YL8 A;  5FI0 A;  4GNK B;  3N7C A;  4Z2N A;  4WJ7 A;  2L2I A;  1ZM0 A;  4NSW A;  1BTK A;  2IFS A;  4DX9 0;  2YT1 A;  2ELB A;  1ZC3 B;  1X11 A;  1FGY A;  4GZU A;  1V61 A;  2RLO A;  5DIF B;  2GJY A;  1UNP A;  3TCA A;  3P7Z A;  1KI1 B;  4HAU B;  2GS0 A;  2D9X A;  5EFX A;  4KAX B;  2RVB B;  3QIJ A;  1LW3 A;  2COF A;  3T06 A;  2VSZ A;  1U2B A;  5DI9 B;  5CLL B;  1TXD A;  1NI2 A;  1BAK A;  1K5G B;  2N0Y A;  1T77 A;  4KHB A;  3A8Q A;  5FI1 A;  2K00 A;  4A6F B;  2KCJ A;  4A6H A;  5JLJ B;  5LOP B;  4WSF A;  2ZKM X;  3OAN A;  1Z87 A;  5DH9 B;  2P0H A;  1MAI A;  1U27 A;  5LG4 B;  4HB4 B;  2M38 A;  1RRP B;  3HW2 B;  2DA0 A;  1RJ2 A;  2D10 A;  2GUM A;  5D3X A;  1DDV A;  2D9V A;  4XWX A;  3U12 A;  3O96 A;  1WVH A;  4HB3 B;  4CHJ A;  2ZPY A;  2RUK B;  3ZVR A;  2YVC A;  3NWF A;  4IFS A;  2DFK A;  4HB2 B;  1U5G A;  4DX8 A;  1GC7 A;  3HSA A;  2HTH B;  3IVF A;  1X05 A;  1BWN A;  3ULC A;  3NSU A;  2QKM A;  2X18 A;  4P7I A;  1PLS A;  2KIE A;  4DXA B;  1Q67 A;  1FHO A;  1XKE A;  4C0A A;  3ODX A;  1DRO A;  2D9Y A;  4F7U P;  1N3H A;  2COD A;  1V5U A;  4MK0 A;  5I2M A;  4HAX B;  2IYB A;  1FHX A;  1EF1 A;  2K2U A;  4HAZ B;  1MKE A;  1OMW A;  2YS1 A;  4ZRI A;  1SGH A;  4DIX A;  3ULB A;  3ZDT A;  3PG7 A;  3KSY A;  3A58 A;  2AEH A;  5KQ4 A;  1U29 A;  2DHK A;  4KHA A;  2YF0 A;  2DHI A;  2YS3 A;  2UZS A;  4GMX B;  2Y7B A;  3QWM A;  2CAY A;  1U5E A;  1X86 A;  2NZ8 B;  2W2W A;  5CLQ B;  1DDM A;  3ODW A;  3HK0 A;  5GOW B;  2V76 A;  4A5K A;  3OHM B;  4L6E A;  4YON A;  1H10 A;  3G9W A;  4HB0 B;  1I7A A;  4HSI A;  3FEH A;  1V5M A;  2Z13 A;  3PZD A;  4TKN A;  4GOU A;  2EC1 A; 
#chains in the Genus database with same CATH homology
 5DHF B;  1OQN A;  5HE1 A;  1TQZ A;  4B6H A;  5J3T A;  2M14 A;  1GC6 A;  1XCG A;  2ELA A;  3V5W A;  2RNR B;  2Y8G A;  2P0D A;  1NTY A;  2I1J A;  2LG1 A;  3AU4 A;  3BIN A;  3TFM A;  4MT7 A;  1KZG A;  3KZ1 A;  2DKQ A;  2CY5 A;  2KUP A;  1V5P A;  3ODO A;  2P8V A;  2I5F A;  5HE2 A;  4IAP A;  2Z0O A;  1EVH A;  3VOQ A;  2J0J A;  2G35 A;  2I1K A;  4GXB A;  1WGQ A;  4GN1 A;  1QC6 A;  2VRW B;  4HAV B;  2H7D A;  2I5C A;  2Z0Q A;  3QBV B;  1UEF A;  4F7G A;  1WJ1 A;  4K2P A;  1AWE A;  2Q13 A;  4BBK A;  2DYQ A;  5KQ1 A;  1U5D A;  1NU2 A;  5D3W A;  2FJL A;  3RCP A;  3GYP A;  4K2O A;  2W2X D;  1J19 A;  3TVV A;  3KRX A;  3U8Z A;  1V88 A;  4HAT B;  2DLW A;  5C5B B;  4A6F A;  4EJN A;  3PSC A;  1B55 A;  3D8E A;  1LB1 A;  2Z0P A;  1MIZ B;  1AQC A;  3F5R A;  2QKL A;  3ML4 A;  3LJU X;  3M1I B;  2KGX B;  4Y94 A;  5HE0 A;  5D27 A;  3WA0 A;  5L81 A;  3PVW A;  1FGZ A;  1M7R A;  2XQN M;  3GYO A;  5JHH A;  4GMV A;  3KRW A;  2MDX A;  3SV1 A;  2JP2 A;  2DKP A;  3F0W A;  3MPX A;  1FOE A;  2DN6 A;  2R0D A;  2ROV A;  2LUL A;  4NY0 A;  1QQG A;  1ZSQ A;  2DHJ A;  1PFJ A;  3SNH A;  2VKI A;  3AU5 A;  2D11 A;  3FM8 C;  3VIA A;  4IOY X;  2NMB A;  2RSG A;  4D0N B;  2DX5 A;  2N23 A;  1SHC A;  5C5B A;  1X1F A;  2GCJ A;  1UPR A;  5JP4 A;  1UNQ A;  2E2X A;  4TYZ A;  4EKU A;  1FAO A;  5KCV A;  2R09 A;  4EMO A;  1J0W A;  2BCJ A;  2LYD A;  2YRY A;  4ZRK A;  1DDW A;  4HAY B;  1FHW A;  1EAZ A;  2LOX A;  2UZR A;  2DX1 A;  2EMT A;  2EMS A;  4PNK A;  3CIK A;  2HE7 A;  2COA A;  2D9W A;  2OQB A;  3PVL A;  3P6A A;  2EJ8 A;  1X1G A;  4K81 A;  2COC A;  2W2X C;  5DHA B;  1XOD A;  1MK7 B;  2D4Q A;  4KVG B;  2Y8F A;  1EGX A;  5LON B;  1K5D B;  1P6S A;  1H4R A;  1W1G A;  2RGN B;  2MFQ A;  1WGU A;  1OY2 A;  2LOZ A;  3CXB B;  1MK9 B;  2GCL A;  3MDB C;  2DTC A;  1ISN A;  3TW1 A;  1NTV A;  1ZVR A;  1UNR A;  4KHO A;  4HDQ A;  3DXC A;  1WJM A;  3A98 B;  1W1H A;  4H8S A;  3HQC A;  1WG7 A;  3D8D A;  4HDO A;  1KZ7 A;  1XX0 A;  3DXE A;  1P3R A;  2DYN A;  5D3V A;  5J3Q A;  4WVF B;  3SO6 A;  2ROZ B;  3DXD A;  2P0F A;  5J3Y A;  5D3Y A;  1FB8 A;  3PVU A;  2J0M A;  4ZRJ A;  1Y19 B;  3D8F A;  1PMS A;  2LKO A;  1W1D A;  4HHV A;  2YT0 A;  3PEG A;  1DYN A;  1I2H A;  3A8P A;  1U5F A;  2CRF A;  2D9Z A;  3BJI A;  1BTN A;  2D2Q A;  4CYE A;  3SUZ A;  2J0K A;  1E5W A;  2OTX A;  5HE3 A;  2AL6 A;  4CHM A;  3SYX A;  2H7E A;  5C79 A;  3U7D A;  1GG3 A;  1M7E A;  1V89 A;  4Z2M B;  3KY9 A;  4A6K A;  1WI1 A;  2J59 M;  1MIX A;  1UPQ A;  5C6R A;  2MWN B;  2CY4 A;  4K17 A;  4GPT B;  2PZ1 A;  1ZC4 B;  3AJ4 A;  1Y5O A;  1MPH A;  2K2J A;  1TJ6 A;  3PP2 A;  3TO1 A;  4MY6 A;  4DBB A;  2MKR A;  1XD4 A;  1DBH A;  4KHB B;  1XR0 B;  5C16 A;  3FSS A;  2YS5 A;  4HAW B;  1IRS A;  4F7H A;  3X23 A;  2YSZ A;  2L1C A;  2UVM A;  4PQ0 A;  3UZT A;  2ADZ A;  3WYF B;  1P5T A;  5JHG A;  4YL8 A;  5FI0 A;  3N7C A;  4Z2N A;  4WJ7 A;  2L2I A;  1ZM0 A;  4NSW A;  1BTK A;  2IFS A;  4DX9 0;  2YT1 A;  2ELB A;  1ZC3 B;  1X11 A;  1FGY A;  4GZU A;  1V61 A;  2RLO A;  5DIF B;  2GJY A;  1UNP A;  3TCA A;  3P7Z A;  1KI1 B;  4HAU B;  2GS0 A;  2D9X A;  5EFX A;  4KAX B;  2RVB B;  3QIJ A;  1LW3 A;  2COF A;  3T06 A;  2VSZ A;  1U2B A;  5DI9 B;  5CLL B;  1TXD A;  1NI2 A;  1BAK A;  1K5G B;  2N0Y A;  3A8Q A;  5FI1 A;  2K00 A;  4A6F B;  2KCJ A;  4A6H A;  5JLJ B;  5LOP B;  4WSF A;  3OAN A;  1Z87 A;  5DH9 B;  2P0H A;  1MAI A;  1U27 A;  4HB4 B;  2M38 A;  1RRP B;  3HW2 B;  2DA0 A;  1RJ2 A;  2D10 A;  5D3X A;  1DDV A;  2D9V A;  4XWX A;  3O96 A;  1WVH A;  4HB3 B;  4CHJ A;  2ZPY A;  2RUK B;  3ZVR A;  2YVC A;  4IFS A;  2DFK A;  4HB2 B;  1U5G A;  4DX8 A;  1GC7 A;  2HTH B;  3IVF A;  1X05 A;  1BWN A;  3ULC A;  3NSU A;  2QKM A;  2X18 A;  4P7I A;  1PLS A;  4DXA B;  1Q67 A;  1FHO A;  1XKE A;  4C0A A;  3ODX A;  1DRO A;  2D9Y A;  4F7U P;  1N3H A;  2COD A;  1V5U A;  4MK0 A;  4HAX B;  2IYB A;  1FHX A;  1EF1 A;  2K2U A;  4HAZ B;  1MKE A;  1OMW A;  2YS1 A;  4ZRI A;  1SGH A;  3ULB A;  3ZDT A;  3PG7 A;  3KSY A;  2AEH A;  5KQ4 A;  1U29 A;  2DHK A;  4KHA A;  2YF0 A;  2DHI A;  2YS3 A;  2UZS A;  4GMX B;  2Y7B A;  3QWM A;  2CAY A;  1U5E A;  1X86 A;  2NZ8 B;  2W2W A;  5CLQ B;  1DDM A;  3ODW A;  3HK0 A;  5GOW B;  2V76 A;  4A5K A;  4L6E A;  4YON A;  1H10 A;  3G9W A;  4HB0 B;  1I7A A;  3FEH A;  1V5M A;  3PZD A;  4TKN A;  2EC1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...