1P3RA

Crystal structure of the phosphotyrosin binding domain(ptb) of mouse disabled 1(dab1)
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
148
structure length
148
Chain Sequence
MEKTDEYLLARFKGDGVKYKAKLIGIDDVPDARGDKMSQDSMMKLKGMAAAGRSQGQHKQRIWVNISLSGIKIIDEKTGVIEHEHPVNKISFIARDVTDNRAFGYVCGGEGQHQFFAIKTGQQAEPLVVDLKDLFQVIYNVKKKEEDK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords Disabled homolog 2
publication title Crystal structures of the Dab homology domains of mouse disabled 1 and 2.
pubmed doi rcsb
source organism Mus musculus
total genus 47
structure length 148
sequence length 148
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2003-04-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00640 PID Phosphotyrosine interaction domain (PTB/PID)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 1p3rA00
1NI2A 1LB1A 2N23A 4XWXA 4A6FA 3PEGA 5D3VA 2DKPA 2DX5A 4GXBA 4H8SA 2R0DA 3CIKA 5J3YA 2LOXA 2Z0PA 4IFSA 2CY4A 1EVHA 4DX8A 2LYDA 4EMOA 3LJUX 1DDWA 1EGXA 3GYPA 5D3XA 1V5UA 1V88A 1WJ1A 2EJ8A 1XR0B 2GCLA 2D11A 3M1IB 1Y5OA 2UVMA 2Z0QA 1WG7A 1WGQA 4A6HA 1UNPA 3TW1A 3U7DA 2DHKA 4A5KA 1GC7A 1UEFA 2Y8GA 2LKOA 2Q13A 2YT1A 2ROVA 4NSWA 4HHVA 5D3YA 3MDBC 2UZRA 1IRSA 2GS0A 2ZPYA 2YS5A 2RVBB 4NY0A 2H7EA 4ZRJA 2RSGA 5KQ4A 3P7ZA 4D0NB 3RCPA 4K2OA 2P0HA 2D9YA 1DDVA 4B6HA 1P6SA 1P5TA 1U5DA 3ML4A 3X23A 3OANA 2RNRB 1UPRA 4Y94A 5HE3A 5D3WA 4HB0B 2AL6A 4YL8A 1ZVRA 4HAXB 5JLJB 2P0FA 1AWEA 4F7GA 2COCA 1NTVA 5HE0A 2MWNB 1PMSA 2I5FA 3ODOA 1DYNA 4DX90 1XKEA 1ZSQA 4BBKA 3QIJA 4IAPA 1X86A 3CXBB 5DHFB 2DA0A 3TFMA 1DROA 5C16A 2J0MA 2H7DA 2NMBA 3DXDA 3FSSA 1V5PA 1UNRA 2GJYA 4MK0A 2EMSA 3GYOA 2YSZA 4HAUB 4YONA 4HATB 3AU4A 2D9VA 4IOYX 2Y8FA 1XODA 2XQNM 4HAYB 1FHOA 1Y19B 3TVVA 1J19A 1FGZA 1BTKA 3VIAA 2LG1A 2E2XA 1M7RA 4GMVA 1XD4A 1U27A 2D10A 1V5MA 3ODXA 1DBHA 1E5WA 2VRWB 2W2XC 1FHXA 1EF1A 1J0WA 2COAA 3PVLA 2D9ZA 2DLWA 1BTNA 1RJ2A 3KY9A 3A98B 5HE2A 2YS1A 2L2IA 2VSZA 3QWMA 1WVHA 1X1GA 2LOZA 4F7HA 4CHMA 4KHOA 1ZM0A 4WSFA 5EFXA 5DIFB 1KZ7A 4HDOA 2OQBA 3KSYA 5C5BA 1LW3A 3PVUA 3AU5A 2NZ8B 1PLSA 4MY6A 1MK7B 1DDMA 1RRPB 2N0YA 5DHAB 5KCVA 1X11A 1I7AA 2KCJA 2DKQA 5J3TA 2M14A 3G9WA 2I5CA 3BJIA 2L1CA 3FM8C 2I1KA 1TJ6A 4ZRKA 1Q67A 1N3HA 2X18A 3ZDTA 3TCAA 1NU2A 5GOWB 1OQNA 1SHCA 4TYZA 2G35A 2MDXA 2P8VA 1BAKA 2D9WA 1W1GA 5JHGA 1EAZA 5JHHA 1MKEA 3UZTA 4F7UP 4HAVB 2COFA 2M38A 3D8FA 1KI1B 1Z87A 2DYNA 3FEHA 4K81A 1KZGA 1P3RA 3D8DA 4Z2NA 2IYBA 1K5DB 3WA0A 1QQGA 1FAOA 3HK0A 2QKMA 5CLLB 3ULBA 1K5GB 2CAYA 1B55A 3PSCA 4A6FB 2IFSA 3PVWA 5JP4A 4C0AA 2HTHB 4EKUA 3DXCA 1UPQA 2R09A 2DFKA 2DHIA 2MKRA 3A8PA 1WI1A 2YVCA 4HB2B 1V61A 1ISNA 3SO6A 3IVFA 2EC1A 5FI0A 3KRWA 5D27A 2D9XA 2J0KA 4GZUA 2Y7BA 1WJMA 3A8QA 1FHWA 2K00A 3DXEA 2D2QA 1U2BA 4GPTB 1TXDA 2RLOA 2MFQA 2DX1A 4GN1A 4GMXB 2D4QA 2ADZA 4K17A 3ZVRA 1I2HA 2HE7A 5DI9B 1WGUA 2K2UA 4HB4B 3HQCA 1MAIA 4DBBA 4WVFB 2J59M 4TKNA 1W1DA 1V89A 3T06A 3SUZA 3KZ1A 3U8ZA 2CRFA 3SNHA 1ZC3B 5FI1A 2ROZB 2RGNB 4HAZB 4WJ7A 4DXAB 4KAXB 2GCJA 4ZRIA 2I1JA 3ULCA 1XX0A 4KHBB 1M7EA 2DYQA 2JP2A 2UZSA 4Z2MB 2PZ1A 2V76A 1GG3A 3F5RA 1NTYA 1U5GA 3TO1A 3VOQA 2VKIA 3HW2B 5C6RA 5LOPB 4L6EA 1BWNA 2KGXB 4HDQA 2OTXA 3P6AA 1U29A 2J0JA 4HAWB 1U5EA 1QC6A 5C79A 4KVGB 4P7IA 1FB8A 5KQ1A 1UNQA 1X1FA 4EJNA 2W2XD 2YT0A 4CHJA 2BCJA 2FJLA 3V5WA 1W1HA 1ZC4B 1U5FA 2QKLA 2CY5A 3F0WA 5HE1A 1AQCA 1PFJA 2W2WA 1MPHA 2CODA 3SYXA 2RUKB 3WYFB 3PZDA 3QBVB 4CYEA 3O96A 4KHAA 4MT7A 5CLQB 1OMWA 1MIZB 3AJ4A 3MPXA 1MIXA 2DHJA 1MK9B 1FGYA 5LONB 2DTCA 5DH9B 5J3QA 4PQ0A 2K2JA 2ELAA 2Z0OA 3ODWA 3SV1A 1GC6A 2KUPA 2YS3A 2EMTA 2YF0A 3PG7A 2P0DA 1FOEA 3NSUA 3N7CA 3PP2A 3BINA 4PNKA 1XCGA 1TQZA 2LULA 3KRXA 5C5BB 1OY2A 2DN6A 3D8EA 5L81A 1H10A 1SGHA 4HB3B 2YRYA 1X05A 1H4RA 4K2PA 4A6KA 2ELBA 2AEHA
chains in the Genus database with same CATH superfamily
1NI2A 1LB1A 2N23A 4XWXA 4A6FA 3PEGA 5D3VA 2DKPA 2DX5A 4GXBA 2FJUB 4H8SA 2R0DA 3CIKA 5J3YA 2LOXA 2Z0PA 4IFSA 2CY4A 1EVHA 4DX8A 2LYDA 4EMOA 3LJUX 1DDWA 1EGXA 3GYPA 5D3XA 1V5UA 1V88A 1WJ1A 2EJ8A 1XR0B 2GCLA 2D11A 3M1IB 1Y5OA 2UVMA 2Z0QA 1WG7A 1WGQA 4A6HA 2KR0A 2KIEA 1UNPA 1MI1A 3TW1A 3U7DA 2DHKA 4DIXA 4A5KA 1GC7A 1UEFA 2Y8GA 2LKOA 2Q13A 2YT1A 2ROVA 4NSWA 4HHVA 5D3YA 3MDBC 2UZRA 1IRSA 3HIEA 2GS0A 2ZPYA 2YS5A 4QJ4B 2RVBB 4NY0A 4QXAB 2H7EA 4ZRJA 2RSGA 5KQ4A 3P7ZA 4D0NB 3RCPA 4K2OA 2P0HA 2D9YA 1DDVA 4B6HA 1P6SA 1P5TA 1U5DA 3ML4A 3X23A 3OANA 2RNRB 1UPRA 4Y94A 5HE3A 2GUMA 4GNKB 5D3WA 4HB0B 2AL6A 4YL8A 1ZVRA 4HAXB 5JLJB 2P0FA 1AWEA 4F7GA 2COCA 2Z59A 1NTVA 5HE0A 2MWNB 1PMSA 2I5FA 3ODOA 1DYNA 4DX90 1XKEA 1ZSQA 4BBKA 3QIJA 4IAPA 1X86A 3CXBB 2R2YA 4L1RA 5DHFB 2DA0A 3TFMA 1DROA 3NWFA 5C16A 2J0MA 2H7DA 2K49A 2NMBA 3DXDA 3FSSA 1V5PA 1UNRA 2Z4DA 2GJYA 4MK0A 2EMSA 5M4YB 3GYOA 2YSZA 4HAUB 3B77A 4YONA 4HATB 3AU4A 2D9VA 4IOYX 2ZKMX 2Y8FA 1XODA 2XQNM 4HAYB 1FHOA 1Y19B 3TVVA 1J19A 2KUQA 1FGZA 1BTKA 3VIAA 2LG1A 2E2XA 1M7RA 4GMVA 1XD4A 1U27A 2D10A 1V5MA 3ODXA 1DBHA 1E5WA 2VRWB 2W2XC 1FHXA 1EF1A 1J0WA 2COAA 3PVLA 2D9ZA 2DLWA 1BTNA 1RJ2A 3KY9A 3A98B 5HE2A 2YS1A 2L2IA 2VSZA 3QWMA 1WVHA 1X1GA 2LOZA 4F7HA 4OT1A 4CHMA 4KHOA 1ZM0A 4WSFA 5EFXA 5DIFB 1KZ7A 4HDOA 2Z13A 2OQBA 3KSYA 5C5BA 5LG4B 1LW3A 3PVUA 3AU5A 2NZ8B 1PLSA 4MY6A 1MK7B 1DDMA 1RRPB 2N0YA 5DHAB 5KCVA 1X11A 1I7AA 2KCJA 2DKQA 5J3TA 2M14A 3G9WA 2I5CA 3BJIA 2L1CA 3FM8C 2I1KA 1TJ6A 4ZRKA 1Q67A 5I2MA 1N3HA 3OHMB 2X18A 3ZDTA 3TCAA 1NU2A 5GOWB 1OQNA 1SHCA 4TYZA 2G35A 2MDXA 2P8VA 1BAKA 2D9WA 1W1GA 5JHGA 2NBVA 1EAZA 5JHHA 1MKEA 3UZTA 4F7UP 4HAVB 2COFA 2M38A 3D8FA 1KI1B 1Z87A 2DYNA 3FEHA 4K81A 1KZGA 1P3RA 3D8DA 4Z2NA 2IYBA 1K5DB 4KHBA 3WA0A 1QQGA 1FAOA 3HK0A 2Z14A 2QKMA 5CLLB 3ULBA 1K5GB 2CAYA 1B55A 3PSCA 4A6FB 2IFSA 3PVWA 5JP4A 4C0AA 2HTHB 4EKUA 3DXCA 1UPQA 2R09A 2DFKA 2DHIA 2MKRA 3A8PA 1WI1A 4D6WA 2YVCA 4HB2B 1V61A 1ISNA 3SO6A 3IVFA 2EC1A 5FI0A 3KRWA 3U12A 5D27A 2D9XA 5IRSA 2J0KA 4GZUA 2Y7BA 1WJMA 4GOUA 3A8QA 1FHWA 4HSIA 2K00A 3NW8A 1T77A 3NWDA 3DXEA 2D2QA 1U2BA 4GPTB 1TXDA 4OSNA 2RLOA 2MFQA 2DX1A 4GN1A 4GMXB 2D4QA 2ADZA 4K17A 3ZVRA 1I2HA 2HE7A 5DI9B 1WGUA 2K2UA 4HB4B 4QJ5B 3NWAA 3HQCA 1MAIA 4DBBA 4WVFB 3A58A 2J59M 4TKNA 1W1DA 1V89A 3T06A 3SUZA 3KZ1A 3U8ZA 2CRFA 3SNHA 3DCXA 1ZC3B 5FI1A 2K8EA 2ROZB 2RGNB 4HAZB 4WJ7A 4DXAB 4KAXB 2GCJA 4ZRIA 2I1JA 1ZYIA 3ULCA 1XX0A 4KHBB 1M7EA 2DYQA 2JP2A 2UZSA 4Z2MB 2PZ1A 2V76A 1GG3A 3F5RA 1NTYA 1U5GA 3TO1A 2YT2A 3VOQA 2VKIA 3HW2B 5C6RA 5LOPB 4L6EA 1BWNA 2KGXB 4HDQA 2OTXA 3P6AA 2KIGA 5I2SA 1U29A 2J0JA 4HAWB 1U5EA 1QC6A 5C79A 4KVGB 4QJ3B 4P7IA 1FB8A 5KQ1A 3FVCA 1UNQA 1X1FA 4EJNA 2W2XD 2YT0A 4CHJA 2BCJA 2FJLA 3V5WA 1W1HA 1ZC4B 1U5FA 2QKLA 2CY5A 3F0WA 5HE1A 1AQCA 1PFJA 2W2WA 1MPHA 2CODA 3SYXA 2RUKB 3WYFB 3PZDA 4CSQA 3QBVB 4CYEA 3O96A 2RRFA 4KHAA 4MT7A 5CLQB 1OMWA 1MIZB 3AJ4A 3MPXA 1MIXA 2DHJA 1MK9B 1FGYA 5LONB 2DTCA 5DH9B 5J3QA 4PQ0A 2K2JA 2ELAA 2Z0OA 3ODWA 3SV1A 1GC6A 2KUPA 2YS3A 2EMTA 2YF0A 3PG7A 2P0DA 1FOEA 3NSUA 3N7CA 3HSAA 3PP2A 3BINA 4PNKA 1XCGA 1TQZA 2LULA 3KRXA 5C5BB 1OY2A 2DN6A 3D8EA 5L81A 1H10A 1SGHA 4HB3B 2YRYA 1X05A 1H4RA 4K2PA 4A6KA 2ELBA 2AEHA
chains in the Genus database with same CATH topology
1NI2A 1LB1A 2N23A 4XWXA 4A6FA 3PEGA 5D3VA 2DKPA 2DX5A 4GXBA 4H8SA 2R0DA 3CIKA 5J3YA 2LOXA 2Z0PA 4IFSA 2CY4A 1EVHA 4DX8A 2LYDA 4EMOA 3LJUX 1DDWA 1EGXA 3GYPA 5D3XA 1V5UA 1V88A 1WJ1A 2EJ8A 1XR0B 2GCLA 2D11A 3M1IB 1Y5OA 2UVMA 2Z0QA 1WG7A 1WGQA 4A6HA 1UNPA 3TW1A 3U7DA 2DHKA 4A5KA 1GC7A 1UEFA 2Y8GA 2LKOA 2Q13A 2YT1A 2ROVA 4NSWA 4HHVA 5D3YA 3MDBC 2UZRA 1IRSA 2GS0A 2ZPYA 2YS5A 2RVBB 4NY0A 2H7EA 4ZRJA 2RSGA 5KQ4A 3P7ZA 4D0NB 3RCPA 4K2OA 2P0HA 2D9YA 1DDVA 4B6HA 1P6SA 1P5TA 1U5DA 3ML4A 3X23A 3OANA 2RNRB 1UPRA 4Y94A 5HE3A 5D3WA 4HB0B 2AL6A 4YL8A 1ZVRA 4HAXB 5JLJB 2P0FA 1AWEA 4F7GA 2COCA 1NTVA 5HE0A 2MWNB 1PMSA 2I5FA 3ODOA 1DYNA 4DX90 1XKEA 1ZSQA 4BBKA 3QIJA 4IAPA 1X86A 3CXBB 5DHFB 2DA0A 3TFMA 1DROA 5C16A 2J0MA 2H7DA 2NMBA 3DXDA 3FSSA 1V5PA 1UNRA 2GJYA 4MK0A 2EMSA 3GYOA 2YSZA 4HAUB 4YONA 4HATB 3AU4A 2D9VA 4IOYX 2Y8FA 1XODA 2XQNM 4HAYB 1FHOA 1Y19B 3TVVA 1J19A 1FGZA 1BTKA 3VIAA 2LG1A 2E2XA 1M7RA 4GMVA 1XD4A 1U27A 2D10A 1V5MA 3ODXA 1DBHA 1E5WA 2VRWB 2W2XC 1FHXA 1EF1A 1J0WA 2COAA 3PVLA 2D9ZA 2DLWA 1BTNA 1RJ2A 3KY9A 3A98B 5HE2A 2YS1A 2L2IA 2VSZA 3QWMA 1WVHA 1X1GA 2LOZA 4F7HA 4CHMA 4KHOA 1ZM0A 4WSFA 5EFXA 5DIFB 1KZ7A 4HDOA 2OQBA 3KSYA 5C5BA 1LW3A 3PVUA 3AU5A 2NZ8B 1PLSA 4MY6A 1MK7B 1DDMA 1RRPB 2N0YA 5DHAB 5KCVA 1X11A 1I7AA 2KCJA 2DKQA 5J3TA 2M14A 3G9WA 2I5CA 3BJIA 2L1CA 3FM8C 2I1KA 1TJ6A 4ZRKA 1Q67A 1N3HA 2X18A 3ZDTA 3TCAA 1NU2A 5GOWB 1OQNA 1SHCA 4TYZA 2G35A 2MDXA 2P8VA 1BAKA 2D9WA 1W1GA 5JHGA 1EAZA 5JHHA 1MKEA 3UZTA 4F7UP 4HAVB 2COFA 2M38A 3D8FA 1KI1B 1Z87A 2DYNA 3FEHA 4K81A 1KZGA 1P3RA 3D8DA 4Z2NA 2IYBA 1K5DB 3WA0A 1QQGA 1FAOA 3HK0A 2QKMA 5CLLB 3ULBA 1K5GB 2CAYA 1B55A 3PSCA 4A6FB 2IFSA 3PVWA 5JP4A 4C0AA 2HTHB 4EKUA 3DXCA 1UPQA 2R09A 2DFKA 2DHIA 2MKRA 3A8PA 1WI1A 2YVCA 4HB2B 1V61A 1ISNA 3SO6A 3IVFA 2EC1A 5FI0A 3KRWA 5D27A 2D9XA 2J0KA 4GZUA 2Y7BA 1WJMA 3A8QA 1FHWA 2K00A 3DXEA 2D2QA 1U2BA 4GPTB 1TXDA 2RLOA 2MFQA 2DX1A 4GN1A 4GMXB 2D4QA 2ADZA 4K17A 3ZVRA 1I2HA 2HE7A 5DI9B 1WGUA 2K2UA 4HB4B 3HQCA 1MAIA 4DBBA 4WVFB 2J59M 4TKNA 1W1DA 1V89A 3T06A 3SUZA 3KZ1A 3U8ZA 2CRFA 3SNHA 1ZC3B 5FI1A 2ROZB 2RGNB 4HAZB 4WJ7A 4DXAB 4KAXB 2GCJA 4ZRIA 2I1JA 3ULCA 1XX0A 4KHBB 1M7EA 2DYQA 2JP2A 2UZSA 4Z2MB 2PZ1A 2V76A 1GG3A 3F5RA 1NTYA 1U5GA 3TO1A 3VOQA 2VKIA 3HW2B 5C6RA 5LOPB 4L6EA 1BWNA 2KGXB 4HDQA 2OTXA 3P6AA 1U29A 2J0JA 4HAWB 1U5EA 1QC6A 5C79A 4KVGB 4P7IA 1FB8A 5KQ1A 1UNQA 1X1FA 4EJNA 2W2XD 2YT0A 4CHJA 2BCJA 2FJLA 3V5WA 1W1HA 1ZC4B 1U5FA 2QKLA 2CY5A 3F0WA 5HE1A 1AQCA 1PFJA 2W2WA 1MPHA 2CODA 3SYXA 2RUKB 3WYFB 3PZDA 3QBVB 4CYEA 3O96A 4KHAA 4MT7A 5CLQB 1OMWA 1MIZB 3AJ4A 3MPXA 1MIXA 2DHJA 1MK9B 1FGYA 5LONB 2DTCA 5DH9B 5J3QA 4PQ0A 2K2JA 2ELAA 2Z0OA 3ODWA 3SV1A 1GC6A 2KUPA 2YS3A 2EMTA 2YF0A 3PG7A 2P0DA 1FOEA 3NSUA 3N7CA 3PP2A 3BINA 4PNKA 1XCGA 1TQZA 2LULA 3KRXA 5C5BB 1OY2A 2DN6A 3D8EA 5L81A 1H10A 1SGHA 4HB3B 2YRYA 1X05A 1H4RA 4K2PA 4A6KA 2ELBA 2AEHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NI2 A;  1LB1 A;  2N23 A;  4XWX A;  4A6F A;  3PEG A;  5D3V A;  2DKP A;  2DX5 A;  4GXB A;  4H8S A;  2R0D A;  3CIK A;  5J3Y A;  2LOX A;  2Z0P A;  4IFS A;  2CY4 A;  1EVH A;  4DX8 A;  2LYD A;  4EMO A;  3LJU X;  1DDW A;  1EGX A;  3GYP A;  5D3X A;  1V5U A;  1V88 A;  1WJ1 A;  2EJ8 A;  1XR0 B;  2GCL A;  2D11 A;  3M1I B;  1Y5O A;  2UVM A;  2Z0Q A;  1WG7 A;  1WGQ A;  4A6H A;  1UNP A;  3TW1 A;  3U7D A;  2DHK A;  4A5K A;  1GC7 A;  1UEF A;  2Y8G A;  2LKO A;  2Q13 A;  2YT1 A;  2ROV A;  4NSW A;  4HHV A;  5D3Y A;  3MDB C;  2UZR A;  1IRS A;  2GS0 A;  2ZPY A;  2YS5 A;  2RVB B;  4NY0 A;  2H7E A;  4ZRJ A;  2RSG A;  5KQ4 A;  3P7Z A;  4D0N B;  3RCP A;  4K2O A;  2P0H A;  2D9Y A;  1DDV A;  4B6H A;  1P6S A;  1P5T A;  1U5D A;  3ML4 A;  3X23 A;  3OAN A;  2RNR B;  1UPR A;  4Y94 A;  5HE3 A;  5D3W A;  4HB0 B;  2AL6 A;  4YL8 A;  1ZVR A;  4HAX B;  5JLJ B;  2P0F A;  1AWE A;  4F7G A;  2COC A;  1NTV A;  5HE0 A;  2MWN B;  1PMS A;  2I5F A;  3ODO A;  1DYN A;  4DX9 0;  1XKE A;  1ZSQ A;  4BBK A;  3QIJ A;  4IAP A;  1X86 A;  3CXB B;  5DHF B;  2DA0 A;  3TFM A;  1DRO A;  5C16 A;  2J0M A;  2H7D A;  2NMB A;  3DXD A;  3FSS A;  1V5P A;  1UNR A;  2GJY A;  4MK0 A;  2EMS A;  3GYO A;  2YSZ A;  4HAU B;  4YON A;  4HAT B;  3AU4 A;  2D9V A;  4IOY X;  2Y8F A;  1XOD A;  2XQN M;  4HAY B;  1FHO A;  1Y19 B;  3TVV A;  1J19 A;  1FGZ A;  1BTK A;  3VIA A;  2LG1 A;  2E2X A;  1M7R A;  4GMV A;  1XD4 A;  1U27 A;  2D10 A;  1V5M A;  3ODX A;  1DBH A;  1E5W A;  2VRW B;  2W2X C;  1FHX A;  1EF1 A;  1J0W A;  2COA A;  3PVL A;  2D9Z A;  2DLW A;  1BTN A;  1RJ2 A;  3KY9 A;  3A98 B;  5HE2 A;  2YS1 A;  2L2I A;  2VSZ A;  3QWM A;  1WVH A;  1X1G A;  2LOZ A;  4F7H A;  4CHM A;  4KHO A;  1ZM0 A;  4WSF A;  5EFX A;  5DIF B;  1KZ7 A;  4HDO A;  2OQB A;  3KSY A;  5C5B A;  1LW3 A;  3PVU A;  3AU5 A;  2NZ8 B;  1PLS A;  4MY6 A;  1MK7 B;  1DDM A;  1RRP B;  2N0Y A;  5DHA B;  5KCV A;  1X11 A;  1I7A A;  2KCJ A;  2DKQ A;  5J3T A;  2M14 A;  3G9W A;  2I5C A;  3BJI A;  2L1C A;  3FM8 C;  2I1K A;  1TJ6 A;  4ZRK A;  1Q67 A;  1N3H A;  2X18 A;  3ZDT A;  3TCA A;  1NU2 A;  5GOW B;  1OQN A;  1SHC A;  4TYZ A;  2G35 A;  2MDX A;  2P8V A;  1BAK A;  2D9W A;  1W1G A;  5JHG A;  1EAZ A;  5JHH A;  1MKE A;  3UZT A;  4F7U P;  4HAV B;  2COF A;  2M38 A;  3D8F A;  1KI1 B;  1Z87 A;  2DYN A;  3FEH A;  4K81 A;  1KZG A;  1P3R A;  3D8D A;  4Z2N A;  2IYB A;  1K5D B;  3WA0 A;  1QQG A;  1FAO A;  3HK0 A;  2QKM A;  5CLL B;  3ULB A;  1K5G B;  2CAY A;  1B55 A;  3PSC A;  4A6F B;  2IFS A;  3PVW A;  5JP4 A;  4C0A A;  2HTH B;  4EKU A;  3DXC A;  1UPQ A;  2R09 A;  2DFK A;  2DHI A;  2MKR A;  3A8P A;  1WI1 A;  2YVC A;  4HB2 B;  1V61 A;  1ISN A;  3SO6 A;  3IVF A;  2EC1 A;  5FI0 A;  3KRW A;  5D27 A;  2D9X A;  2J0K A;  4GZU A;  2Y7B A;  1WJM A;  3A8Q A;  1FHW A;  2K00 A;  3DXE A;  2D2Q A;  1U2B A;  4GPT B;  1TXD A;  2RLO A;  2MFQ A;  2DX1 A;  4GN1 A;  4GMX B;  2D4Q A;  2ADZ A;  4K17 A;  3ZVR A;  1I2H A;  2HE7 A;  5DI9 B;  1WGU A;  2K2U A;  4HB4 B;  3HQC A;  1MAI A;  4DBB A;  4WVF B;  2J59 M;  4TKN A;  1W1D A;  1V89 A;  3T06 A;  3SUZ A;  3KZ1 A;  3U8Z A;  2CRF A;  3SNH A;  1ZC3 B;  5FI1 A;  2ROZ B;  2RGN B;  4HAZ B;  4WJ7 A;  4DXA B;  4KAX B;  2GCJ A;  4ZRI A;  2I1J A;  3ULC A;  1XX0 A;  4KHB B;  1M7E A;  2DYQ A;  2JP2 A;  2UZS A;  4Z2M B;  2PZ1 A;  2V76 A;  1GG3 A;  3F5R A;  1NTY A;  1U5G A;  3TO1 A;  3VOQ A;  2VKI A;  3HW2 B;  5C6R A;  5LOP B;  4L6E A;  1BWN A;  2KGX B;  4HDQ A;  2OTX A;  3P6A A;  1U29 A;  2J0J A;  4HAW B;  1U5E A;  1QC6 A;  5C79 A;  4KVG B;  4P7I A;  1FB8 A;  5KQ1 A;  1UNQ A;  1X1F A;  4EJN A;  2W2X D;  2YT0 A;  4CHJ A;  2BCJ A;  2FJL A;  3V5W A;  1W1H A;  1ZC4 B;  1U5F A;  2QKL A;  2CY5 A;  3F0W A;  5HE1 A;  1AQC A;  1PFJ A;  2W2W A;  1MPH A;  2COD A;  3SYX A;  2RUK B;  3WYF B;  3PZD A;  3QBV B;  4CYE A;  3O96 A;  4KHA A;  4MT7 A;  5CLQ B;  1OMW A;  1MIZ B;  3AJ4 A;  3MPX A;  1MIX A;  2DHJ A;  1MK9 B;  1FGY A;  5LON B;  2DTC A;  5DH9 B;  5J3Q A;  4PQ0 A;  2K2J A;  2ELA A;  2Z0O A;  3ODW A;  3SV1 A;  1GC6 A;  2KUP A;  2YS3 A;  2EMT A;  2YF0 A;  3PG7 A;  2P0D A;  1FOE A;  3NSU A;  3N7C A;  3PP2 A;  3BIN A;  4PNK A;  1XCG A;  1TQZ A;  2LUL A;  3KRX A;  5C5B B;  1OY2 A;  2DN6 A;  3D8E A;  5L81 A;  1H10 A;  1SGH A;  4HB3 B;  2YRY A;  1X05 A;  1H4R A;  4K2P A;  4A6K A;  2ELB A;  2AEH A; 
#chains in the Genus database with same CATH topology
 1NI2 A;  1LB1 A;  2N23 A;  4XWX A;  4A6F A;  3PEG A;  5D3V A;  2DKP A;  2DX5 A;  4GXB A;  2FJU B;  4H8S A;  2R0D A;  3CIK A;  5J3Y A;  2LOX A;  2Z0P A;  4IFS A;  2CY4 A;  1EVH A;  4DX8 A;  2LYD A;  4EMO A;  3LJU X;  1DDW A;  1EGX A;  3GYP A;  5D3X A;  1V5U A;  1V88 A;  1WJ1 A;  2EJ8 A;  1XR0 B;  2GCL A;  2D11 A;  3M1I B;  1Y5O A;  2UVM A;  2Z0Q A;  1WG7 A;  1WGQ A;  4A6H A;  2KR0 A;  2KIE A;  1UNP A;  1MI1 A;  3TW1 A;  3U7D A;  2DHK A;  4DIX A;  4A5K A;  1GC7 A;  1UEF A;  2Y8G A;  2LKO A;  2Q13 A;  2YT1 A;  2ROV A;  4NSW A;  4HHV A;  5D3Y A;  3MDB C;  2UZR A;  1IRS A;  3HIE A;  2GS0 A;  2ZPY A;  2YS5 A;  4QJ4 B;  2RVB B;  4NY0 A;  4QXA B;  2H7E A;  4ZRJ A;  2RSG A;  5KQ4 A;  3P7Z A;  4D0N B;  3RCP A;  4K2O A;  2P0H A;  2D9Y A;  1DDV A;  4B6H A;  1P6S A;  1P5T A;  1U5D A;  3ML4 A;  3X23 A;  3OAN A;  2RNR B;  1UPR A;  4Y94 A;  5HE3 A;  2GUM A;  4GNK B;  5D3W A;  4HB0 B;  2AL6 A;  4YL8 A;  1ZVR A;  4HAX B;  5JLJ B;  2P0F A;  1AWE A;  4F7G A;  2COC A;  2Z59 A;  1NTV A;  5HE0 A;  2MWN B;  1PMS A;  2I5F A;  3ODO A;  1DYN A;  4DX9 0;  1XKE A;  1ZSQ A;  4BBK A;  3QIJ A;  4IAP A;  1X86 A;  3CXB B;  2R2Y A;  4L1R A;  5DHF B;  2DA0 A;  3TFM A;  1DRO A;  3NWF A;  5C16 A;  2J0M A;  2H7D A;  2K49 A;  2NMB A;  3DXD A;  3FSS A;  1V5P A;  1UNR A;  2Z4D A;  2GJY A;  4MK0 A;  2EMS A;  5M4Y B;  3GYO A;  2YSZ A;  4HAU B;  3B77 A;  4YON A;  4HAT B;  3AU4 A;  2D9V A;  4IOY X;  2ZKM X;  2Y8F A;  1XOD A;  2XQN M;  4HAY B;  1FHO A;  1Y19 B;  3TVV A;  1J19 A;  2KUQ A;  1FGZ A;  1BTK A;  3VIA A;  2LG1 A;  2E2X A;  1M7R A;  4GMV A;  1XD4 A;  1U27 A;  2D10 A;  1V5M A;  3ODX A;  1DBH A;  1E5W A;  2VRW B;  2W2X C;  1FHX A;  1EF1 A;  1J0W A;  2COA A;  3PVL A;  2D9Z A;  2DLW A;  1BTN A;  1RJ2 A;  3KY9 A;  3A98 B;  5HE2 A;  2YS1 A;  2L2I A;  2VSZ A;  3QWM A;  1WVH A;  1X1G A;  2LOZ A;  4F7H A;  4OT1 A;  4CHM A;  4KHO A;  1ZM0 A;  4WSF A;  5EFX A;  5DIF B;  1KZ7 A;  4HDO A;  2Z13 A;  2OQB A;  3KSY A;  5C5B A;  5LG4 B;  1LW3 A;  3PVU A;  3AU5 A;  2NZ8 B;  1PLS A;  4MY6 A;  1MK7 B;  1DDM A;  1RRP B;  2N0Y A;  5DHA B;  5KCV A;  1X11 A;  1I7A A;  2KCJ A;  2DKQ A;  5J3T A;  2M14 A;  3G9W A;  2I5C A;  3BJI A;  2L1C A;  3FM8 C;  2I1K A;  1TJ6 A;  4ZRK A;  1Q67 A;  5I2M A;  1N3H A;  3OHM B;  2X18 A;  3ZDT A;  3TCA A;  1NU2 A;  5GOW B;  1OQN A;  1SHC A;  4TYZ A;  2G35 A;  2MDX A;  2P8V A;  1BAK A;  2D9W A;  1W1G A;  5JHG A;  2NBV A;  1EAZ A;  5JHH A;  1MKE A;  3UZT A;  4F7U P;  4HAV B;  2COF A;  2M38 A;  3D8F A;  1KI1 B;  1Z87 A;  2DYN A;  3FEH A;  4K81 A;  1KZG A;  1P3R A;  3D8D A;  4Z2N A;  2IYB A;  1K5D B;  4KHB A;  3WA0 A;  1QQG A;  1FAO A;  3HK0 A;  2Z14 A;  2QKM A;  5CLL B;  3ULB A;  1K5G B;  2CAY A;  1B55 A;  3PSC A;  4A6F B;  2IFS A;  3PVW A;  5JP4 A;  4C0A A;  2HTH B;  4EKU A;  3DXC A;  1UPQ A;  2R09 A;  2DFK A;  2DHI A;  2MKR A;  3A8P A;  1WI1 A;  4D6W A;  2YVC A;  4HB2 B;  1V61 A;  1ISN A;  3SO6 A;  3IVF A;  2EC1 A;  5FI0 A;  3KRW A;  3U12 A;  5D27 A;  2D9X A;  5IRS A;  2J0K A;  4GZU A;  2Y7B A;  1WJM A;  4GOU A;  3A8Q A;  1FHW A;  4HSI A;  2K00 A;  3NW8 A;  1T77 A;  3NWD A;  3DXE A;  2D2Q A;  1U2B A;  4GPT B;  1TXD A;  4OSN A;  2RLO A;  2MFQ A;  2DX1 A;  4GN1 A;  4GMX B;  2D4Q A;  2ADZ A;  4K17 A;  3ZVR A;  1I2H A;  2HE7 A;  5DI9 B;  1WGU A;  2K2U A;  4HB4 B;  4QJ5 B;  3NWA A;  3HQC A;  1MAI A;  4DBB A;  4WVF B;  3A58 A;  2J59 M;  4TKN A;  1W1D A;  1V89 A;  3T06 A;  3SUZ A;  3KZ1 A;  3U8Z A;  2CRF A;  3SNH A;  3DCX A;  1ZC3 B;  5FI1 A;  2K8E A;  2ROZ B;  2RGN B;  4HAZ B;  4WJ7 A;  4DXA B;  4KAX B;  2GCJ A;  4ZRI A;  2I1J A;  1ZYI A;  3ULC A;  1XX0 A;  4KHB B;  1M7E A;  2DYQ A;  2JP2 A;  2UZS A;  4Z2M B;  2PZ1 A;  2V76 A;  1GG3 A;  3F5R A;  1NTY A;  1U5G A;  3TO1 A;  2YT2 A;  3VOQ A;  2VKI A;  3HW2 B;  5C6R A;  5LOP B;  4L6E A;  1BWN A;  2KGX B;  4HDQ A;  2OTX A;  3P6A A;  2KIG A;  5I2S A;  1U29 A;  2J0J A;  4HAW B;  1U5E A;  1QC6 A;  5C79 A;  4KVG B;  4QJ3 B;  4P7I A;  1FB8 A;  5KQ1 A;  3FVC A;  1UNQ A;  1X1F A;  4EJN A;  2W2X D;  2YT0 A;  4CHJ A;  2BCJ A;  2FJL A;  3V5W A;  1W1H A;  1ZC4 B;  1U5F A;  2QKL A;  2CY5 A;  3F0W A;  5HE1 A;  1AQC A;  1PFJ A;  2W2W A;  1MPH A;  2COD A;  3SYX A;  2RUK B;  3WYF B;  3PZD A;  4CSQ A;  3QBV B;  4CYE A;  3O96 A;  2RRF A;  4KHA A;  4MT7 A;  5CLQ B;  1OMW A;  1MIZ B;  3AJ4 A;  3MPX A;  1MIX A;  2DHJ A;  1MK9 B;  1FGY A;  5LON B;  2DTC A;  5DH9 B;  5J3Q A;  4PQ0 A;  2K2J A;  2ELA A;  2Z0O A;  3ODW A;  3SV1 A;  1GC6 A;  2KUP A;  2YS3 A;  2EMT A;  2YF0 A;  3PG7 A;  2P0D A;  1FOE A;  3NSU A;  3N7C A;  3HSA A;  3PP2 A;  3BIN A;  4PNK A;  1XCG A;  1TQZ A;  2LUL A;  3KRX A;  5C5B B;  1OY2 A;  2DN6 A;  3D8E A;  5L81 A;  1H10 A;  1SGH A;  4HB3 B;  2YRY A;  1X05 A;  1H4R A;  4K2P A;  4A6K A;  2ELB A;  2AEH A; 
#chains in the Genus database with same CATH homology
 1NI2 A;  1LB1 A;  2N23 A;  4XWX A;  4A6F A;  3PEG A;  5D3V A;  2DKP A;  2DX5 A;  4GXB A;  4H8S A;  2R0D A;  3CIK A;  5J3Y A;  2LOX A;  2Z0P A;  4IFS A;  2CY4 A;  1EVH A;  4DX8 A;  2LYD A;  4EMO A;  3LJU X;  1DDW A;  1EGX A;  3GYP A;  5D3X A;  1V5U A;  1V88 A;  1WJ1 A;  2EJ8 A;  1XR0 B;  2GCL A;  2D11 A;  3M1I B;  1Y5O A;  2UVM A;  2Z0Q A;  1WG7 A;  1WGQ A;  4A6H A;  1UNP A;  3TW1 A;  3U7D A;  2DHK A;  4A5K A;  1GC7 A;  1UEF A;  2Y8G A;  2LKO A;  2Q13 A;  2YT1 A;  2ROV A;  4NSW A;  4HHV A;  5D3Y A;  3MDB C;  2UZR A;  1IRS A;  2GS0 A;  2ZPY A;  2YS5 A;  2RVB B;  4NY0 A;  2H7E A;  4ZRJ A;  2RSG A;  5KQ4 A;  3P7Z A;  4D0N B;  3RCP A;  4K2O A;  2P0H A;  2D9Y A;  1DDV A;  4B6H A;  1P6S A;  1P5T A;  1U5D A;  3ML4 A;  3X23 A;  3OAN A;  2RNR B;  1UPR A;  4Y94 A;  5HE3 A;  5D3W A;  4HB0 B;  2AL6 A;  4YL8 A;  1ZVR A;  4HAX B;  5JLJ B;  2P0F A;  1AWE A;  4F7G A;  2COC A;  1NTV A;  5HE0 A;  2MWN B;  1PMS A;  2I5F A;  3ODO A;  1DYN A;  4DX9 0;  1XKE A;  1ZSQ A;  4BBK A;  3QIJ A;  4IAP A;  1X86 A;  3CXB B;  5DHF B;  2DA0 A;  3TFM A;  1DRO A;  5C16 A;  2J0M A;  2H7D A;  2NMB A;  3DXD A;  3FSS A;  1V5P A;  1UNR A;  2GJY A;  4MK0 A;  2EMS A;  3GYO A;  2YSZ A;  4HAU B;  4YON A;  4HAT B;  3AU4 A;  2D9V A;  4IOY X;  2Y8F A;  1XOD A;  2XQN M;  4HAY B;  1FHO A;  1Y19 B;  3TVV A;  1J19 A;  1FGZ A;  1BTK A;  3VIA A;  2LG1 A;  2E2X A;  1M7R A;  4GMV A;  1XD4 A;  1U27 A;  2D10 A;  1V5M A;  3ODX A;  1DBH A;  1E5W A;  2VRW B;  2W2X C;  1FHX A;  1EF1 A;  1J0W A;  2COA A;  3PVL A;  2D9Z A;  2DLW A;  1BTN A;  1RJ2 A;  3KY9 A;  3A98 B;  5HE2 A;  2YS1 A;  2L2I A;  2VSZ A;  3QWM A;  1WVH A;  1X1G A;  2LOZ A;  4F7H A;  4CHM A;  4KHO A;  1ZM0 A;  4WSF A;  5EFX A;  5DIF B;  1KZ7 A;  4HDO A;  2OQB A;  3KSY A;  5C5B A;  1LW3 A;  3PVU A;  3AU5 A;  2NZ8 B;  1PLS A;  4MY6 A;  1MK7 B;  1DDM A;  1RRP B;  2N0Y A;  5DHA B;  5KCV A;  1X11 A;  1I7A A;  2KCJ A;  2DKQ A;  5J3T A;  2M14 A;  3G9W A;  2I5C A;  3BJI A;  2L1C A;  3FM8 C;  2I1K A;  1TJ6 A;  4ZRK A;  1Q67 A;  1N3H A;  2X18 A;  3ZDT A;  3TCA A;  1NU2 A;  5GOW B;  1OQN A;  1SHC A;  4TYZ A;  2G35 A;  2MDX A;  2P8V A;  1BAK A;  2D9W A;  1W1G A;  5JHG A;  1EAZ A;  5JHH A;  1MKE A;  3UZT A;  4F7U P;  4HAV B;  2COF A;  2M38 A;  3D8F A;  1KI1 B;  1Z87 A;  2DYN A;  3FEH A;  4K81 A;  1KZG A;  1P3R A;  3D8D A;  4Z2N A;  2IYB A;  1K5D B;  3WA0 A;  1QQG A;  1FAO A;  3HK0 A;  2QKM A;  5CLL B;  3ULB A;  1K5G B;  2CAY A;  1B55 A;  3PSC A;  4A6F B;  2IFS A;  3PVW A;  5JP4 A;  4C0A A;  2HTH B;  4EKU A;  3DXC A;  1UPQ A;  2R09 A;  2DFK A;  2DHI A;  2MKR A;  3A8P A;  1WI1 A;  2YVC A;  4HB2 B;  1V61 A;  1ISN A;  3SO6 A;  3IVF A;  2EC1 A;  5FI0 A;  3KRW A;  5D27 A;  2D9X A;  2J0K A;  4GZU A;  2Y7B A;  1WJM A;  3A8Q A;  1FHW A;  2K00 A;  3DXE A;  2D2Q A;  1U2B A;  4GPT B;  1TXD A;  2RLO A;  2MFQ A;  2DX1 A;  4GN1 A;  4GMX B;  2D4Q A;  2ADZ A;  4K17 A;  3ZVR A;  1I2H A;  2HE7 A;  5DI9 B;  1WGU A;  2K2U A;  4HB4 B;  3HQC A;  1MAI A;  4DBB A;  4WVF B;  2J59 M;  4TKN A;  1W1D A;  1V89 A;  3T06 A;  3SUZ A;  3KZ1 A;  3U8Z A;  2CRF A;  3SNH A;  1ZC3 B;  5FI1 A;  2ROZ B;  2RGN B;  4HAZ B;  4WJ7 A;  4DXA B;  4KAX B;  2GCJ A;  4ZRI A;  2I1J A;  3ULC A;  1XX0 A;  4KHB B;  1M7E A;  2DYQ A;  2JP2 A;  2UZS A;  4Z2M B;  2PZ1 A;  2V76 A;  1GG3 A;  3F5R A;  1NTY A;  1U5G A;  3TO1 A;  3VOQ A;  2VKI A;  3HW2 B;  5C6R A;  5LOP B;  4L6E A;  1BWN A;  2KGX B;  4HDQ A;  2OTX A;  3P6A A;  1U29 A;  2J0J A;  4HAW B;  1U5E A;  1QC6 A;  5C79 A;  4KVG B;  4P7I A;  1FB8 A;  5KQ1 A;  1UNQ A;  1X1F A;  4EJN A;  2W2X D;  2YT0 A;  4CHJ A;  2BCJ A;  2FJL A;  3V5W A;  1W1H A;  1ZC4 B;  1U5F A;  2QKL A;  2CY5 A;  3F0W A;  5HE1 A;  1AQC A;  1PFJ A;  2W2W A;  1MPH A;  2COD A;  3SYX A;  2RUK B;  3WYF B;  3PZD A;  3QBV B;  4CYE A;  3O96 A;  4KHA A;  4MT7 A;  5CLQ B;  1OMW A;  1MIZ B;  3AJ4 A;  3MPX A;  1MIX A;  2DHJ A;  1MK9 B;  1FGY A;  5LON B;  2DTC A;  5DH9 B;  5J3Q A;  4PQ0 A;  2K2J A;  2ELA A;  2Z0O A;  3ODW A;  3SV1 A;  1GC6 A;  2KUP A;  2YS3 A;  2EMT A;  2YF0 A;  3PG7 A;  2P0D A;  1FOE A;  3NSU A;  3N7C A;  3PP2 A;  3BIN A;  4PNK A;  1XCG A;  1TQZ A;  2LUL A;  3KRX A;  5C5B B;  1OY2 A;  2DN6 A;  3D8E A;  5L81 A;  1H10 A;  1SGH A;  4HB3 B;  2YRY A;  1X05 A;  1H4R A;  4K2P A;  4A6K A;  2ELB A;  2AEH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...