2ROZB

Structure of the c-terminal pid domain of fe65l1 complexed with the cytoplasmic tail of app reveals a novel peptide binding mode
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
136
structure length
136
Chain Sequence
GSSGSSGPTPKTELVQKFRVQYLGMLPVDRPVGMDTLNSAIENLMTSSSKEDWPSVNMNVADATVTVISEKNEEEVLVECRVRFLSFMGVGKDVHTFAFIMDTGNQRFECHVFWCEPNAANVSEAVQAACSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Peptide binding protein
molecule keywords peptide from Amyloid beta A4 protein
publication title Structure of the C-terminal phosphotyrosine interaction domain of Fe65L1 complexed with the cytoplasmic tail of amyloid precursor protein reveals a novel peptide binding mode
pubmed doi rcsb
source organism Mus musculus
total genus 18
structure length 136
sequence length 136
ec nomenclature
pdb deposition date 2008-04-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2rozB00
2Y8GA 1LB1A 4HB3B 2N0YA 2H7EA 2YS1A 2I1KA 1I2HA 4GZUA 2RGNB 5CLLB 2R09A 4DXAB 1WVHA 2DX1A 1RRPB 1SHCA 1DDVA 2V76A 1U29A 2Z0OA 1SGHA 4KHAA 3MPXA 1U5FA 2P0HA 3N7CA 1PMSA 2HTHB 4HB0B 2LOXA 2UZSA 3KRWA 4Z2MB 2LKOA 4K2OA 2LULA 1OY2A 1V5UA 2ELBA 5JP4A 5J3TA 3CXBB 1X86A 1H4RA 3TW1A 2COAA 2DYQA 4F7GA 2LOZA 4NSWA 1GG3A 1BTNA 5JHHA 5HE3A 1NTYA 1MIXA 1W1HA 5C5BA 2RLOA 2D11A 3ML4A 5DH9B 2Y7BA 4MY6A 1WI1A 5D3YA 3SV1A 4YL8A 1Y5OA 3TCAA 3D8EA 1TJ6A 4HAWB 4WJ7A 1FGYA 2X18A 3NSUA 4HAZB 2GCLA 2CY5A 4DX90 2FJLA 4TKNA 2DTCA 1MPHA 5DHAB 1IRSA 1DDMA 1V61A 3A8PA 1U5EA 4KAXB 2EC1A 5DIFB 1KZ7A 2YS5A 1QC6A 2DN6A 4K17A 2ROZB 4KHOA 1WJMA 2ELAA 2KGXB 4KHBB 1GC6A 3HK0A 3OANA 3QWMA 3RCPA 2LYDA 1UNPA 1KI1B 3DXDA 4MK0A 4GN1A 4HATB 1U2BA 3QBVB 1U5GA 4HDQA 2UZRA 1K5DB 1I7AA 1EVHA 3AU4A 3KRXA 4HAYB 5C79A 2MKRA 1ZSQA 5HE1A 1OMWA 3ZDTA 1UNRA 2PZ1A 1V89A 2N23A 4K2PA 2DHIA 2K2UA 5D27A 2DFKA 4TYZA 1U27A 1AQCA 5LOPB 4DX8A 4GPTB 4IAPA 5FI1A 4B6HA 1UNQA 3HW2B 1X11A 1ZVRA 3T06A 1MKEA 3CIKA 1LW3A 2K2JA 3TO1A 3X23A 1FB8A 1P5TA 4HHVA 3PP2A 1K5GB 4GMXB 3BJIA 3PVWA 3G9WA 3TVVA 1NI2A 2W2XC 4F7UP 3VIAA 5GOWB 3AJ4A 4WSFA 1FHXA 3P6AA 2DYNA 2QKMA 2RVBB 4XWXA 2DKQA 1MIZB 3WYFB 4HAUB 2DKPA 5CLQB 3SNHA 1ZC3B 2OTXA 2AL6A 3M1IB 5DHFB 4Z2NA 4HB4B 1AWEA 1X05A 3SO6A 2IYBA 4ZRKA 1DYNA 1XCGA 1M7RA 2ZPYA 2CY4A 3MDBC 3DXEA 3VOQA 1XD4A 2D9VA 1UEFA 2GCJA 3U8ZA 5J3YA 4NY0A 2MDXA 2YT1A 3V5WA 1UPRA 4EJNA 1DDWA 1MK7B 4A6KA 3ODWA 1J0WA 2DHKA 1X1FA 3F0WA 2D9ZA 3PSCA 5HE2A 2EJ8A 1TQZA 1M7EA 2P0DA 2D10A 4EKUA 1XKEA 2P8VA 2OQBA 3LJUX 2Z0PA 1ZC4B 3AU5A 3BINA 2MFQA 3PZDA 2L1CA 5JHGA 3DXCA 2KUPA 1EF1A 2CRFA 3A8QA 4A6HA 3PG7A 1Q67A 2DA0A 2L2IA 4HAXB 1W1GA 1XX0A 1XODA 3U7DA 4IFSA 2I5CA 3P7ZA 4H8SA 3FM8C 1TXDA 2J59M 4MT7A 3PEGA 3F5RA 4PNKA 5JLJB 1XR0B 5EFXA 1BTKA 2GS0A 2ADZA 1H10A 4HDOA 5KCVA 1Z87A 2M38A 2D4QA 3FEHA 3KSYA 3ULCA 4CHMA 1UPQA 2H7DA 4D0NB 5LONB 5C6RA 1WJ1A 1ZM0A 2W2WA 4ZRIA 1OQNA 2RSGA 4A6FB 5KQ1A 1WGUA 2CAYA 2D9YA 2UVMA 4GXBA 5DI9B 2J0KA 4PQ0A 4A5KA 3PVUA 5D3WA 3O96A 3FSSA 5FI0A 4HAVB 3WA0A 2D9XA 5L81A 1PLSA 3PVLA 5D3VA 3D8FA 1P6SA 2COCA 3GYPA 1DROA 2KCJA 1U5DA 2ROVA 4ZRJA 5HE0A 1NTVA 1BWNA 2Y8FA 2R0DA 3KY9A 3ZVRA 1X1GA 2YVCA 4BBKA 3KZ1A 2CODA 2QKLA 2YT0A 3SUZA 4L6EA 4F7HA 4HB2B 2G35A 2K00A 2DLWA 2DX5A 1FOEA 1B55A 3UZTA 4WVFB 1QQGA 2LG1A 4DBBA 4GMVA 2E2XA 4YONA 3GYOA 2VKIA 5KQ4A 1FAOA 2M14A 4CYEA 1WGQA 3ODOA 2JP2A 1V5PA 2BCJA 4P7IA 2J0MA 1GC7A 2Z0QA 1FGZA 1EGXA 4A6FA 2EMSA 1E5WA 2W2XD 4C0AA 1FHOA 1W1DA 2J0JA 1KZGA 1EAZA 4CHJA 1RJ2A 2D9WA 1MK9B 4Y94A 2RNRB 2GJYA 1NU2A 1DBHA 2MWNB 2Q13A 1P3RA 3ULBA 3ODXA 2NMBA 2YRYA 2COFA 1ISNA 5C16A 5J3QA 2VSZA 1Y19B 1N3HA 4K81A 2YF0A 5C5BB 2D2QA 2I5FA 1PFJA 3IVFA 1FHWA 3QIJA 1MAIA 2RUKB 2XQNM 2YSZA 2VRWB 4EMOA 3HQCA 2EMTA 3TFMA 2YS3A 3A98B 1BAKA 2HE7A 4IOYX 2P0FA 1WG7A 2IFSA 2AEHA 5D3XA 4KVGB 2I1JA 1V5MA 2DHJA 3D8DA 3SYXA 1J19A 2NZ8B 1V88A
chains in the Genus database with same CATH superfamily
2Y8GA 1LB1A 1T77A 4HB3B 2N0YA 2H7EA 2YS1A 2I1KA 1I2HA 4GZUA 2RGNB 5CLLB 2R09A 4DXAB 2R2YA 2K49A 1WVHA 2DX1A 1RRPB 1SHCA 1DDVA 2V76A 1U29A 2Z0OA 1SGHA 4KHAA 2Z4DA 3MPXA 1U5FA 2P0HA 3N7CA 2RRFA 1PMSA 3FVCA 2HTHB 4HB0B 2LOXA 2UZSA 3KRWA 4Z2MB 4QJ4B 2LKOA 4K2OA 2LULA 1OY2A 1V5UA 2ELBA 5JP4A 5J3TA 3CXBB 1X86A 1H4RA 3TW1A 2COAA 2DYQA 4F7GA 5M4YB 2LOZA 4NSWA 1GG3A 1BTNA 5JHHA 5HE3A 1NTYA 1MIXA 1W1HA 5C5BA 2RLOA 2D11A 3ML4A 5DH9B 2Y7BA 4MY6A 1WI1A 5D3YA 3SV1A 4YL8A 1Y5OA 3TCAA 3D8EA 1TJ6A 4HAWB 4WJ7A 1FGYA 2X18A 3NSUA 4HAZB 2GCLA 1MI1A 2CY5A 4DX90 2FJLA 4TKNA 2DTCA 1MPHA 5DHAB 1IRSA 1DDMA 1V61A 3A8PA 1U5EA 4KAXB 2EC1A 5DIFB 1KZ7A 2YS5A 1QC6A 2DN6A 4K17A 2ROZB 4KHOA 1WJMA 2ELAA 2KGXB 4KHBB 1GC6A 3HK0A 3OANA 3QWMA 3RCPA 2LYDA 1UNPA 1KI1B 3DXDA 4MK0A 4GN1A 4HATB 1U2BA 3QBVB 1U5GA 5LG4B 3B77A 4HDQA 2UZRA 1K5DB 1I7AA 1EVHA 3AU4A 3KRXA 4HAYB 5C79A 2MKRA 1ZSQA 5HE1A 1OMWA 3ZDTA 1UNRA 2PZ1A 1V89A 2N23A 4K2PA 2DHIA 2K2UA 5D27A 2DFKA 4TYZA 1U27A 2Z13A 1AQCA 5LOPB 4DX8A 4GPTB 4IAPA 5FI1A 4B6HA 1UNQA 3HW2B 4DIXA 1X11A 1ZVRA 3T06A 1MKEA 4GNKB 3CIKA 1LW3A 2K2JA 3TO1A 3X23A 1FB8A 1P5TA 4HHVA 3PP2A 3NWAA 1K5GB 4GMXB 3BJIA 3PVWA 3G9WA 3TVVA 1NI2A 2W2XC 4F7UP 3VIAA 5GOWB 3AJ4A 2GUMA 4WSFA 1FHXA 3HSAA 3P6AA 2DYNA 2QKMA 2RVBB 4XWXA 2DKQA 1MIZB 2KIEA 2KR0A 3WYFB 4HAUB 2DKPA 5CLQB 3SNHA 1ZC3B 2OTXA 2AL6A 3M1IB 5DHFB 4Z2NA 4HB4B 1AWEA 4QJ3B 2Z59A 1X05A 4KHBA 3SO6A 2IYBA 4ZRKA 1DYNA 1XCGA 1M7RA 2ZPYA 2CY4A 3MDBC 3DXEA 3VOQA 1XD4A 2D9VA 1UEFA 2GCJA 3U8ZA 5J3YA 4NY0A 2MDXA 2YT1A 3NWDA 3V5WA 1UPRA 4EJNA 1DDWA 1MK7B 5I2MA 4A6KA 3ODWA 1J0WA 2DHKA 1X1FA 3F0WA 2D9ZA 3NWFA 3PSCA 5HE2A 2EJ8A 1TQZA 1M7EA 2P0DA 4GOUA 2D10A 4EKUA 1XKEA 2P8VA 2OQBA 2Z0PA 3AU5A 1ZC4B 3BINA 3LJUX 2MFQA 3PZDA 4OT1A 2L1CA 2YT2A 5JHGA 3DXCA 2KUPA 1EF1A 2CRFA 3A8QA 4A6HA 3PG7A 1Q67A 2DA0A 2L2IA 4HAXB 1W1GA 1XX0A 1XODA 3U7DA 2KIGA 4IFSA 2I5CA 3P7ZA 4H8SA 3FM8C 1TXDA 3U12A 2J59M 4L1RA 4MT7A 3PEGA 3F5RA 4PNKA 5JLJB 1XR0B 5EFXA 1BTKA 2GS0A 2ADZA 1H10A 5I2SA 4HDOA 5KCVA 3OHMB 1Z87A 2M38A 1ZYIA 2D4QA 3FEHA 4OSNA 3KSYA 3ULCA 4CHMA 4QJ5B 1UPQA 2H7DA 4D0NB 5LONB 5C6RA 1WJ1A 1ZM0A 2W2WA 4ZRIA 1OQNA 2RSGA 4A6FB 5KQ1A 1WGUA 2CAYA 2D9YA 2UVMA 4GXBA 5DI9B 2J0KA 2Z14A 4PQ0A 4A5KA 3PVUA 5D3WA 3O96A 3FSSA 5FI0A 3DCXA 3HIEA 4HAVB 5IRSA 3WA0A 2D9XA 5L81A 1PLSA 3PVLA 5D3VA 3D8FA 1P6SA 2COCA 3GYPA 1DROA 3NW8A 2KCJA 1U5DA 2ROVA 4ZRJA 4QXAB 5HE0A 1NTVA 1BWNA 2Y8FA 2R0DA 3KY9A 3ZVRA 1X1GA 2YVCA 4BBKA 3KZ1A 2CODA 2QKLA 2YT0A 3SUZA 4L6EA 4F7HA 4HB2B 2G35A 2K00A 4CSQA 2DLWA 2DX5A 1FOEA 1B55A 3UZTA 4WVFB 1QQGA 2LG1A 4DBBA 4GMVA 2E2XA 4YONA 3GYOA 2VKIA 5KQ4A 1FAOA 2M14A 4CYEA 1WGQA 3ODOA 2JP2A 1V5PA 2BCJA 4P7IA 2J0MA 1GC7A 2Z0QA 1FGZA 2KUQA 1EGXA 4A6FA 2EMSA 1E5WA 2W2XD 3A58A 4C0AA 1FHOA 1W1DA 2J0JA 1KZGA 1EAZA 4D6WA 4CHJA 1RJ2A 2D9WA 1MK9B 4Y94A 2RNRB 2NBVA 2GJYA 1NU2A 1DBHA 2MWNB 2Q13A 1P3RA 3ULBA 3ODXA 2NMBA 2YRYA 2COFA 1ISNA 5C16A 5J3QA 2VSZA 1Y19B 1N3HA 4HSIA 4K81A 2YF0A 5C5BB 2D2QA 2I5FA 1PFJA 2K8EA 1FHWA 3IVFA 3QIJA 1MAIA 2RUKB 2XQNM 2FJUB 2YSZA 2VRWB 4EMOA 3HQCA 2EMTA 3TFMA 2YS3A 3A98B 2ZKMX 1BAKA 2HE7A 4IOYX 2P0FA 1WG7A 2IFSA 2AEHA 5D3XA 4KVGB 2I1JA 1V5MA 2DHJA 3D8DA 3SYXA 1J19A 2NZ8B 1V88A
chains in the Genus database with same CATH topology
2Y8GA 1LB1A 4HB3B 2N0YA 2H7EA 2YS1A 2I1KA 1I2HA 4GZUA 2RGNB 5CLLB 2R09A 4DXAB 1WVHA 2DX1A 1RRPB 1SHCA 1DDVA 2V76A 1U29A 2Z0OA 1SGHA 4KHAA 3MPXA 1U5FA 2P0HA 3N7CA 1PMSA 2HTHB 4HB0B 2LOXA 2UZSA 3KRWA 4Z2MB 2LKOA 4K2OA 2LULA 1OY2A 1V5UA 2ELBA 5JP4A 5J3TA 3CXBB 1X86A 1H4RA 3TW1A 2COAA 2DYQA 4F7GA 2LOZA 4NSWA 1GG3A 1BTNA 5JHHA 5HE3A 1NTYA 1MIXA 1W1HA 5C5BA 2RLOA 2D11A 3ML4A 5DH9B 2Y7BA 4MY6A 1WI1A 5D3YA 3SV1A 4YL8A 1Y5OA 3TCAA 3D8EA 1TJ6A 4HAWB 4WJ7A 1FGYA 2X18A 3NSUA 4HAZB 2GCLA 2CY5A 4DX90 2FJLA 4TKNA 2DTCA 1MPHA 5DHAB 1IRSA 1DDMA 1V61A 3A8PA 1U5EA 4KAXB 2EC1A 5DIFB 1KZ7A 2YS5A 1QC6A 2DN6A 4K17A 2ROZB 4KHOA 1WJMA 2ELAA 2KGXB 4KHBB 1GC6A 3HK0A 3OANA 3QWMA 3RCPA 2LYDA 1UNPA 1KI1B 3DXDA 4MK0A 4GN1A 4HATB 1U2BA 3QBVB 1U5GA 4HDQA 2UZRA 1K5DB 1I7AA 1EVHA 3AU4A 3KRXA 4HAYB 5C79A 2MKRA 1ZSQA 5HE1A 1OMWA 3ZDTA 1UNRA 2PZ1A 1V89A 2N23A 4K2PA 2DHIA 2K2UA 5D27A 2DFKA 4TYZA 1U27A 1AQCA 5LOPB 4DX8A 4GPTB 4IAPA 5FI1A 4B6HA 1UNQA 3HW2B 1X11A 1ZVRA 3T06A 1MKEA 3CIKA 1LW3A 2K2JA 3TO1A 3X23A 1FB8A 1P5TA 4HHVA 3PP2A 1K5GB 4GMXB 3BJIA 3PVWA 3G9WA 3TVVA 1NI2A 2W2XC 4F7UP 3VIAA 5GOWB 3AJ4A 4WSFA 1FHXA 3P6AA 2DYNA 2QKMA 2RVBB 4XWXA 2DKQA 1MIZB 3WYFB 4HAUB 2DKPA 5CLQB 3SNHA 1ZC3B 2OTXA 2AL6A 3M1IB 5DHFB 4Z2NA 4HB4B 1AWEA 1X05A 3SO6A 2IYBA 4ZRKA 1DYNA 1XCGA 1M7RA 2ZPYA 2CY4A 3MDBC 3DXEA 3VOQA 1XD4A 2D9VA 1UEFA 2GCJA 3U8ZA 5J3YA 4NY0A 2MDXA 2YT1A 3V5WA 1UPRA 4EJNA 1DDWA 1MK7B 4A6KA 3ODWA 1J0WA 2DHKA 1X1FA 3F0WA 2D9ZA 3PSCA 5HE2A 2EJ8A 1TQZA 1M7EA 2P0DA 2D10A 4EKUA 1XKEA 2P8VA 2OQBA 3LJUX 2Z0PA 1ZC4B 3AU5A 3BINA 2MFQA 3PZDA 2L1CA 5JHGA 3DXCA 2KUPA 1EF1A 2CRFA 3A8QA 4A6HA 3PG7A 1Q67A 2DA0A 2L2IA 4HAXB 1W1GA 1XX0A 1XODA 3U7DA 4IFSA 2I5CA 3P7ZA 4H8SA 3FM8C 1TXDA 2J59M 4MT7A 3PEGA 3F5RA 4PNKA 5JLJB 1XR0B 5EFXA 1BTKA 2GS0A 2ADZA 1H10A 4HDOA 5KCVA 1Z87A 2M38A 2D4QA 3FEHA 3KSYA 3ULCA 4CHMA 1UPQA 2H7DA 4D0NB 5LONB 5C6RA 1WJ1A 1ZM0A 2W2WA 4ZRIA 1OQNA 2RSGA 4A6FB 5KQ1A 1WGUA 2CAYA 2D9YA 2UVMA 4GXBA 5DI9B 2J0KA 4PQ0A 4A5KA 3PVUA 5D3WA 3O96A 3FSSA 5FI0A 4HAVB 3WA0A 2D9XA 5L81A 1PLSA 3PVLA 5D3VA 3D8FA 1P6SA 2COCA 3GYPA 1DROA 2KCJA 1U5DA 2ROVA 4ZRJA 5HE0A 1NTVA 1BWNA 2Y8FA 2R0DA 3KY9A 3ZVRA 1X1GA 2YVCA 4BBKA 3KZ1A 2CODA 2QKLA 2YT0A 3SUZA 4L6EA 4F7HA 4HB2B 2G35A 2K00A 2DLWA 2DX5A 1FOEA 1B55A 3UZTA 4WVFB 1QQGA 2LG1A 4DBBA 4GMVA 2E2XA 4YONA 3GYOA 2VKIA 5KQ4A 1FAOA 2M14A 4CYEA 1WGQA 3ODOA 2JP2A 1V5PA 2BCJA 4P7IA 2J0MA 1GC7A 2Z0QA 1FGZA 1EGXA 4A6FA 2EMSA 1E5WA 2W2XD 4C0AA 1FHOA 1W1DA 2J0JA 1KZGA 1EAZA 4CHJA 1RJ2A 2D9WA 1MK9B 4Y94A 2RNRB 2GJYA 1NU2A 1DBHA 2MWNB 2Q13A 1P3RA 3ULBA 3ODXA 2NMBA 2YRYA 2COFA 1ISNA 5C16A 5J3QA 2VSZA 1Y19B 1N3HA 4K81A 2YF0A 5C5BB 2D2QA 2I5FA 1PFJA 3IVFA 1FHWA 3QIJA 1MAIA 2RUKB 2XQNM 2YSZA 2VRWB 4EMOA 3HQCA 2EMTA 3TFMA 2YS3A 3A98B 1BAKA 2HE7A 4IOYX 2P0FA 1WG7A 2IFSA 2AEHA 5D3XA 4KVGB 2I1JA 1V5MA 2DHJA 3D8DA 3SYXA 1J19A 2NZ8B 1V88A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Y8G A;  1LB1 A;  4HB3 B;  2N0Y A;  2H7E A;  2YS1 A;  2I1K A;  1I2H A;  4GZU A;  2RGN B;  5CLL B;  2R09 A;  4DXA B;  1WVH A;  2DX1 A;  1RRP B;  1SHC A;  1DDV A;  2V76 A;  1U29 A;  2Z0O A;  1SGH A;  4KHA A;  3MPX A;  1U5F A;  2P0H A;  3N7C A;  1PMS A;  2HTH B;  4HB0 B;  2LOX A;  2UZS A;  3KRW A;  4Z2M B;  2LKO A;  4K2O A;  2LUL A;  1OY2 A;  1V5U A;  2ELB A;  5JP4 A;  5J3T A;  3CXB B;  1X86 A;  1H4R A;  3TW1 A;  2COA A;  2DYQ A;  4F7G A;  2LOZ A;  4NSW A;  1GG3 A;  1BTN A;  5JHH A;  5HE3 A;  1NTY A;  1MIX A;  1W1H A;  5C5B A;  2RLO A;  2D11 A;  3ML4 A;  5DH9 B;  2Y7B A;  4MY6 A;  1WI1 A;  5D3Y A;  3SV1 A;  4YL8 A;  1Y5O A;  3TCA A;  3D8E A;  1TJ6 A;  4HAW B;  4WJ7 A;  1FGY A;  2X18 A;  3NSU A;  4HAZ B;  2GCL A;  2CY5 A;  4DX9 0;  2FJL A;  4TKN A;  2DTC A;  1MPH A;  5DHA B;  1IRS A;  1DDM A;  1V61 A;  3A8P A;  1U5E A;  4KAX B;  2EC1 A;  5DIF B;  1KZ7 A;  2YS5 A;  1QC6 A;  2DN6 A;  4K17 A;  2ROZ B;  4KHO A;  1WJM A;  2ELA A;  2KGX B;  4KHB B;  1GC6 A;  3HK0 A;  3OAN A;  3QWM A;  3RCP A;  2LYD A;  1UNP A;  1KI1 B;  3DXD A;  4MK0 A;  4GN1 A;  4HAT B;  1U2B A;  3QBV B;  1U5G A;  4HDQ A;  2UZR A;  1K5D B;  1I7A A;  1EVH A;  3AU4 A;  3KRX A;  4HAY B;  5C79 A;  2MKR A;  1ZSQ A;  5HE1 A;  1OMW A;  3ZDT A;  1UNR A;  2PZ1 A;  1V89 A;  2N23 A;  4K2P A;  2DHI A;  2K2U A;  5D27 A;  2DFK A;  4TYZ A;  1U27 A;  1AQC A;  5LOP B;  4DX8 A;  4GPT B;  4IAP A;  5FI1 A;  4B6H A;  1UNQ A;  3HW2 B;  1X11 A;  1ZVR A;  3T06 A;  1MKE A;  3CIK A;  1LW3 A;  2K2J A;  3TO1 A;  3X23 A;  1FB8 A;  1P5T A;  4HHV A;  3PP2 A;  1K5G B;  4GMX B;  3BJI A;  3PVW A;  3G9W A;  3TVV A;  1NI2 A;  2W2X C;  4F7U P;  3VIA A;  5GOW B;  3AJ4 A;  4WSF A;  1FHX A;  3P6A A;  2DYN A;  2QKM A;  2RVB B;  4XWX A;  2DKQ A;  1MIZ B;  3WYF B;  4HAU B;  2DKP A;  5CLQ B;  3SNH A;  1ZC3 B;  2OTX A;  2AL6 A;  3M1I B;  5DHF B;  4Z2N A;  4HB4 B;  1AWE A;  1X05 A;  3SO6 A;  2IYB A;  4ZRK A;  1DYN A;  1XCG A;  1M7R A;  2ZPY A;  2CY4 A;  3MDB C;  3DXE A;  3VOQ A;  1XD4 A;  2D9V A;  1UEF A;  2GCJ A;  3U8Z A;  5J3Y A;  4NY0 A;  2MDX A;  2YT1 A;  3V5W A;  1UPR A;  4EJN A;  1DDW A;  1MK7 B;  4A6K A;  3ODW A;  1J0W A;  2DHK A;  1X1F A;  3F0W A;  2D9Z A;  3PSC A;  5HE2 A;  2EJ8 A;  1TQZ A;  1M7E A;  2P0D A;  2D10 A;  4EKU A;  1XKE A;  2P8V A;  2OQB A;  3LJU X;  2Z0P A;  1ZC4 B;  3AU5 A;  3BIN A;  2MFQ A;  3PZD A;  2L1C A;  5JHG A;  3DXC A;  2KUP A;  1EF1 A;  2CRF A;  3A8Q A;  4A6H A;  3PG7 A;  1Q67 A;  2DA0 A;  2L2I A;  4HAX B;  1W1G A;  1XX0 A;  1XOD A;  3U7D A;  4IFS A;  2I5C A;  3P7Z A;  4H8S A;  3FM8 C;  1TXD A;  2J59 M;  4MT7 A;  3PEG A;  3F5R A;  4PNK A;  5JLJ B;  1XR0 B;  5EFX A;  1BTK A;  2GS0 A;  2ADZ A;  1H10 A;  4HDO A;  5KCV A;  1Z87 A;  2M38 A;  2D4Q A;  3FEH A;  3KSY A;  3ULC A;  4CHM A;  1UPQ A;  2H7D A;  4D0N B;  5LON B;  5C6R A;  1WJ1 A;  1ZM0 A;  2W2W A;  4ZRI A;  1OQN A;  2RSG A;  4A6F B;  5KQ1 A;  1WGU A;  2CAY A;  2D9Y A;  2UVM A;  4GXB A;  5DI9 B;  2J0K A;  4PQ0 A;  4A5K A;  3PVU A;  5D3W A;  3O96 A;  3FSS A;  5FI0 A;  4HAV B;  3WA0 A;  2D9X A;  5L81 A;  1PLS A;  3PVL A;  5D3V A;  3D8F A;  1P6S A;  2COC A;  3GYP A;  1DRO A;  2KCJ A;  1U5D A;  2ROV A;  4ZRJ A;  5HE0 A;  1NTV A;  1BWN A;  2Y8F A;  2R0D A;  3KY9 A;  3ZVR A;  1X1G A;  2YVC A;  4BBK A;  3KZ1 A;  2COD A;  2QKL A;  2YT0 A;  3SUZ A;  4L6E A;  4F7H A;  4HB2 B;  2G35 A;  2K00 A;  2DLW A;  2DX5 A;  1FOE A;  1B55 A;  3UZT A;  4WVF B;  1QQG A;  2LG1 A;  4DBB A;  4GMV A;  2E2X A;  4YON A;  3GYO A;  2VKI A;  5KQ4 A;  1FAO A;  2M14 A;  4CYE A;  1WGQ A;  3ODO A;  2JP2 A;  1V5P A;  2BCJ A;  4P7I A;  2J0M A;  1GC7 A;  2Z0Q A;  1FGZ A;  1EGX A;  4A6F A;  2EMS A;  1E5W A;  2W2X D;  4C0A A;  1FHO A;  1W1D A;  2J0J A;  1KZG A;  1EAZ A;  4CHJ A;  1RJ2 A;  2D9W A;  1MK9 B;  4Y94 A;  2RNR B;  2GJY A;  1NU2 A;  1DBH A;  2MWN B;  2Q13 A;  1P3R A;  3ULB A;  3ODX A;  2NMB A;  2YRY A;  2COF A;  1ISN A;  5C16 A;  5J3Q A;  2VSZ A;  1Y19 B;  1N3H A;  4K81 A;  2YF0 A;  5C5B B;  2D2Q A;  2I5F A;  1PFJ A;  3IVF A;  1FHW A;  3QIJ A;  1MAI A;  2RUK B;  2XQN M;  2YSZ A;  2VRW B;  4EMO A;  3HQC A;  2EMT A;  3TFM A;  2YS3 A;  3A98 B;  1BAK A;  2HE7 A;  4IOY X;  2P0F A;  1WG7 A;  2IFS A;  2AEH A;  5D3X A;  4KVG B;  2I1J A;  1V5M A;  2DHJ A;  3D8D A;  3SYX A;  1J19 A;  2NZ8 B;  1V88 A; 
#chains in the Genus database with same CATH topology
 2Y8G A;  1LB1 A;  1T77 A;  4HB3 B;  2N0Y A;  2H7E A;  2YS1 A;  2I1K A;  1I2H A;  4GZU A;  2RGN B;  5CLL B;  2R09 A;  4DXA B;  2R2Y A;  2K49 A;  1WVH A;  2DX1 A;  1RRP B;  1SHC A;  1DDV A;  2V76 A;  1U29 A;  2Z0O A;  1SGH A;  4KHA A;  2Z4D A;  3MPX A;  1U5F A;  2P0H A;  3N7C A;  2RRF A;  1PMS A;  3FVC A;  2HTH B;  4HB0 B;  2LOX A;  2UZS A;  3KRW A;  4Z2M B;  4QJ4 B;  2LKO A;  4K2O A;  2LUL A;  1OY2 A;  1V5U A;  2ELB A;  5JP4 A;  5J3T A;  3CXB B;  1X86 A;  1H4R A;  3TW1 A;  2COA A;  2DYQ A;  4F7G A;  5M4Y B;  2LOZ A;  4NSW A;  1GG3 A;  1BTN A;  5JHH A;  5HE3 A;  1NTY A;  1MIX A;  1W1H A;  5C5B A;  2RLO A;  2D11 A;  3ML4 A;  5DH9 B;  2Y7B A;  4MY6 A;  1WI1 A;  5D3Y A;  3SV1 A;  4YL8 A;  1Y5O A;  3TCA A;  3D8E A;  1TJ6 A;  4HAW B;  4WJ7 A;  1FGY A;  2X18 A;  3NSU A;  4HAZ B;  2GCL A;  1MI1 A;  2CY5 A;  4DX9 0;  2FJL A;  4TKN A;  2DTC A;  1MPH A;  5DHA B;  1IRS A;  1DDM A;  1V61 A;  3A8P A;  1U5E A;  4KAX B;  2EC1 A;  5DIF B;  1KZ7 A;  2YS5 A;  1QC6 A;  2DN6 A;  4K17 A;  2ROZ B;  4KHO A;  1WJM A;  2ELA A;  2KGX B;  4KHB B;  1GC6 A;  3HK0 A;  3OAN A;  3QWM A;  3RCP A;  2LYD A;  1UNP A;  1KI1 B;  3DXD A;  4MK0 A;  4GN1 A;  4HAT B;  1U2B A;  3QBV B;  1U5G A;  5LG4 B;  3B77 A;  4HDQ A;  2UZR A;  1K5D B;  1I7A A;  1EVH A;  3AU4 A;  3KRX A;  4HAY B;  5C79 A;  2MKR A;  1ZSQ A;  5HE1 A;  1OMW A;  3ZDT A;  1UNR A;  2PZ1 A;  1V89 A;  2N23 A;  4K2P A;  2DHI A;  2K2U A;  5D27 A;  2DFK A;  4TYZ A;  1U27 A;  2Z13 A;  1AQC A;  5LOP B;  4DX8 A;  4GPT B;  4IAP A;  5FI1 A;  4B6H A;  1UNQ A;  3HW2 B;  4DIX A;  1X11 A;  1ZVR A;  3T06 A;  1MKE A;  4GNK B;  3CIK A;  1LW3 A;  2K2J A;  3TO1 A;  3X23 A;  1FB8 A;  1P5T A;  4HHV A;  3PP2 A;  3NWA A;  1K5G B;  4GMX B;  3BJI A;  3PVW A;  3G9W A;  3TVV A;  1NI2 A;  2W2X C;  4F7U P;  3VIA A;  5GOW B;  3AJ4 A;  2GUM A;  4WSF A;  1FHX A;  3HSA A;  3P6A A;  2DYN A;  2QKM A;  2RVB B;  4XWX A;  2DKQ A;  1MIZ B;  2KIE A;  2KR0 A;  3WYF B;  4HAU B;  2DKP A;  5CLQ B;  3SNH A;  1ZC3 B;  2OTX A;  2AL6 A;  3M1I B;  5DHF B;  4Z2N A;  4HB4 B;  1AWE A;  4QJ3 B;  2Z59 A;  1X05 A;  4KHB A;  3SO6 A;  2IYB A;  4ZRK A;  1DYN A;  1XCG A;  1M7R A;  2ZPY A;  2CY4 A;  3MDB C;  3DXE A;  3VOQ A;  1XD4 A;  2D9V A;  1UEF A;  2GCJ A;  3U8Z A;  5J3Y A;  4NY0 A;  2MDX A;  2YT1 A;  3NWD A;  3V5W A;  1UPR A;  4EJN A;  1DDW A;  1MK7 B;  5I2M A;  4A6K A;  3ODW A;  1J0W A;  2DHK A;  1X1F A;  3F0W A;  2D9Z A;  3NWF A;  3PSC A;  5HE2 A;  2EJ8 A;  1TQZ A;  1M7E A;  2P0D A;  4GOU A;  2D10 A;  4EKU A;  1XKE A;  2P8V A;  2OQB A;  2Z0P A;  3AU5 A;  1ZC4 B;  3BIN A;  3LJU X;  2MFQ A;  3PZD A;  4OT1 A;  2L1C A;  2YT2 A;  5JHG A;  3DXC A;  2KUP A;  1EF1 A;  2CRF A;  3A8Q A;  4A6H A;  3PG7 A;  1Q67 A;  2DA0 A;  2L2I A;  4HAX B;  1W1G A;  1XX0 A;  1XOD A;  3U7D A;  2KIG A;  4IFS A;  2I5C A;  3P7Z A;  4H8S A;  3FM8 C;  1TXD A;  3U12 A;  2J59 M;  4L1R A;  4MT7 A;  3PEG A;  3F5R A;  4PNK A;  5JLJ B;  1XR0 B;  5EFX A;  1BTK A;  2GS0 A;  2ADZ A;  1H10 A;  5I2S A;  4HDO A;  5KCV A;  3OHM B;  1Z87 A;  2M38 A;  1ZYI A;  2D4Q A;  3FEH A;  4OSN A;  3KSY A;  3ULC A;  4CHM A;  4QJ5 B;  1UPQ A;  2H7D A;  4D0N B;  5LON B;  5C6R A;  1WJ1 A;  1ZM0 A;  2W2W A;  4ZRI A;  1OQN A;  2RSG A;  4A6F B;  5KQ1 A;  1WGU A;  2CAY A;  2D9Y A;  2UVM A;  4GXB A;  5DI9 B;  2J0K A;  2Z14 A;  4PQ0 A;  4A5K A;  3PVU A;  5D3W A;  3O96 A;  3FSS A;  5FI0 A;  3DCX A;  3HIE A;  4HAV B;  5IRS A;  3WA0 A;  2D9X A;  5L81 A;  1PLS A;  3PVL A;  5D3V A;  3D8F A;  1P6S A;  2COC A;  3GYP A;  1DRO A;  3NW8 A;  2KCJ A;  1U5D A;  2ROV A;  4ZRJ A;  4QXA B;  5HE0 A;  1NTV A;  1BWN A;  2Y8F A;  2R0D A;  3KY9 A;  3ZVR A;  1X1G A;  2YVC A;  4BBK A;  3KZ1 A;  2COD A;  2QKL A;  2YT0 A;  3SUZ A;  4L6E A;  4F7H A;  4HB2 B;  2G35 A;  2K00 A;  4CSQ A;  2DLW A;  2DX5 A;  1FOE A;  1B55 A;  3UZT A;  4WVF B;  1QQG A;  2LG1 A;  4DBB A;  4GMV A;  2E2X A;  4YON A;  3GYO A;  2VKI A;  5KQ4 A;  1FAO A;  2M14 A;  4CYE A;  1WGQ A;  3ODO A;  2JP2 A;  1V5P A;  2BCJ A;  4P7I A;  2J0M A;  1GC7 A;  2Z0Q A;  1FGZ A;  2KUQ A;  1EGX A;  4A6F A;  2EMS A;  1E5W A;  2W2X D;  3A58 A;  4C0A A;  1FHO A;  1W1D A;  2J0J A;  1KZG A;  1EAZ A;  4D6W A;  4CHJ A;  1RJ2 A;  2D9W A;  1MK9 B;  4Y94 A;  2RNR B;  2NBV A;  2GJY A;  1NU2 A;  1DBH A;  2MWN B;  2Q13 A;  1P3R A;  3ULB A;  3ODX A;  2NMB A;  2YRY A;  2COF A;  1ISN A;  5C16 A;  5J3Q A;  2VSZ A;  1Y19 B;  1N3H A;  4HSI A;  4K81 A;  2YF0 A;  5C5B B;  2D2Q A;  2I5F A;  1PFJ A;  2K8E A;  1FHW A;  3IVF A;  3QIJ A;  1MAI A;  2RUK B;  2XQN M;  2FJU B;  2YSZ A;  2VRW B;  4EMO A;  3HQC A;  2EMT A;  3TFM A;  2YS3 A;  3A98 B;  2ZKM X;  1BAK A;  2HE7 A;  4IOY X;  2P0F A;  1WG7 A;  2IFS A;  2AEH A;  5D3X A;  4KVG B;  2I1J A;  1V5M A;  2DHJ A;  3D8D A;  3SYX A;  1J19 A;  2NZ8 B;  1V88 A; 
#chains in the Genus database with same CATH homology
 2Y8G A;  1LB1 A;  4HB3 B;  2N0Y A;  2H7E A;  2YS1 A;  2I1K A;  1I2H A;  4GZU A;  2RGN B;  5CLL B;  2R09 A;  4DXA B;  1WVH A;  2DX1 A;  1RRP B;  1SHC A;  1DDV A;  2V76 A;  1U29 A;  2Z0O A;  1SGH A;  4KHA A;  3MPX A;  1U5F A;  2P0H A;  3N7C A;  1PMS A;  2HTH B;  4HB0 B;  2LOX A;  2UZS A;  3KRW A;  4Z2M B;  2LKO A;  4K2O A;  2LUL A;  1OY2 A;  1V5U A;  2ELB A;  5JP4 A;  5J3T A;  3CXB B;  1X86 A;  1H4R A;  3TW1 A;  2COA A;  2DYQ A;  4F7G A;  2LOZ A;  4NSW A;  1GG3 A;  1BTN A;  5JHH A;  5HE3 A;  1NTY A;  1MIX A;  1W1H A;  5C5B A;  2RLO A;  2D11 A;  3ML4 A;  5DH9 B;  2Y7B A;  4MY6 A;  1WI1 A;  5D3Y A;  3SV1 A;  4YL8 A;  1Y5O A;  3TCA A;  3D8E A;  1TJ6 A;  4HAW B;  4WJ7 A;  1FGY A;  2X18 A;  3NSU A;  4HAZ B;  2GCL A;  2CY5 A;  4DX9 0;  2FJL A;  4TKN A;  2DTC A;  1MPH A;  5DHA B;  1IRS A;  1DDM A;  1V61 A;  3A8P A;  1U5E A;  4KAX B;  2EC1 A;  5DIF B;  1KZ7 A;  2YS5 A;  1QC6 A;  2DN6 A;  4K17 A;  2ROZ B;  4KHO A;  1WJM A;  2ELA A;  2KGX B;  4KHB B;  1GC6 A;  3HK0 A;  3OAN A;  3QWM A;  3RCP A;  2LYD A;  1UNP A;  1KI1 B;  3DXD A;  4MK0 A;  4GN1 A;  4HAT B;  1U2B A;  3QBV B;  1U5G A;  4HDQ A;  2UZR A;  1K5D B;  1I7A A;  1EVH A;  3AU4 A;  3KRX A;  4HAY B;  5C79 A;  2MKR A;  1ZSQ A;  5HE1 A;  1OMW A;  3ZDT A;  1UNR A;  2PZ1 A;  1V89 A;  2N23 A;  4K2P A;  2DHI A;  2K2U A;  5D27 A;  2DFK A;  4TYZ A;  1U27 A;  1AQC A;  5LOP B;  4DX8 A;  4GPT B;  4IAP A;  5FI1 A;  4B6H A;  1UNQ A;  3HW2 B;  1X11 A;  1ZVR A;  3T06 A;  1MKE A;  3CIK A;  1LW3 A;  2K2J A;  3TO1 A;  3X23 A;  1FB8 A;  1P5T A;  4HHV A;  3PP2 A;  1K5G B;  4GMX B;  3BJI A;  3PVW A;  3G9W A;  3TVV A;  1NI2 A;  2W2X C;  4F7U P;  3VIA A;  5GOW B;  3AJ4 A;  4WSF A;  1FHX A;  3P6A A;  2DYN A;  2QKM A;  2RVB B;  4XWX A;  2DKQ A;  1MIZ B;  3WYF B;  4HAU B;  2DKP A;  5CLQ B;  3SNH A;  1ZC3 B;  2OTX A;  2AL6 A;  3M1I B;  5DHF B;  4Z2N A;  4HB4 B;  1AWE A;  1X05 A;  3SO6 A;  2IYB A;  4ZRK A;  1DYN A;  1XCG A;  1M7R A;  2ZPY A;  2CY4 A;  3MDB C;  3DXE A;  3VOQ A;  1XD4 A;  2D9V A;  1UEF A;  2GCJ A;  3U8Z A;  5J3Y A;  4NY0 A;  2MDX A;  2YT1 A;  3V5W A;  1UPR A;  4EJN A;  1DDW A;  1MK7 B;  4A6K A;  3ODW A;  1J0W A;  2DHK A;  1X1F A;  3F0W A;  2D9Z A;  3PSC A;  5HE2 A;  2EJ8 A;  1TQZ A;  1M7E A;  2P0D A;  2D10 A;  4EKU A;  1XKE A;  2P8V A;  2OQB A;  3LJU X;  2Z0P A;  1ZC4 B;  3AU5 A;  3BIN A;  2MFQ A;  3PZD A;  2L1C A;  5JHG A;  3DXC A;  2KUP A;  1EF1 A;  2CRF A;  3A8Q A;  4A6H A;  3PG7 A;  1Q67 A;  2DA0 A;  2L2I A;  4HAX B;  1W1G A;  1XX0 A;  1XOD A;  3U7D A;  4IFS A;  2I5C A;  3P7Z A;  4H8S A;  3FM8 C;  1TXD A;  2J59 M;  4MT7 A;  3PEG A;  3F5R A;  4PNK A;  5JLJ B;  1XR0 B;  5EFX A;  1BTK A;  2GS0 A;  2ADZ A;  1H10 A;  4HDO A;  5KCV A;  1Z87 A;  2M38 A;  2D4Q A;  3FEH A;  3KSY A;  3ULC A;  4CHM A;  1UPQ A;  2H7D A;  4D0N B;  5LON B;  5C6R A;  1WJ1 A;  1ZM0 A;  2W2W A;  4ZRI A;  1OQN A;  2RSG A;  4A6F B;  5KQ1 A;  1WGU A;  2CAY A;  2D9Y A;  2UVM A;  4GXB A;  5DI9 B;  2J0K A;  4PQ0 A;  4A5K A;  3PVU A;  5D3W A;  3O96 A;  3FSS A;  5FI0 A;  4HAV B;  3WA0 A;  2D9X A;  5L81 A;  1PLS A;  3PVL A;  5D3V A;  3D8F A;  1P6S A;  2COC A;  3GYP A;  1DRO A;  2KCJ A;  1U5D A;  2ROV A;  4ZRJ A;  5HE0 A;  1NTV A;  1BWN A;  2Y8F A;  2R0D A;  3KY9 A;  3ZVR A;  1X1G A;  2YVC A;  4BBK A;  3KZ1 A;  2COD A;  2QKL A;  2YT0 A;  3SUZ A;  4L6E A;  4F7H A;  4HB2 B;  2G35 A;  2K00 A;  2DLW A;  2DX5 A;  1FOE A;  1B55 A;  3UZT A;  4WVF B;  1QQG A;  2LG1 A;  4DBB A;  4GMV A;  2E2X A;  4YON A;  3GYO A;  2VKI A;  5KQ4 A;  1FAO A;  2M14 A;  4CYE A;  1WGQ A;  3ODO A;  2JP2 A;  1V5P A;  2BCJ A;  4P7I A;  2J0M A;  1GC7 A;  2Z0Q A;  1FGZ A;  1EGX A;  4A6F A;  2EMS A;  1E5W A;  2W2X D;  4C0A A;  1FHO A;  1W1D A;  2J0J A;  1KZG A;  1EAZ A;  4CHJ A;  1RJ2 A;  2D9W A;  1MK9 B;  4Y94 A;  2RNR B;  2GJY A;  1NU2 A;  1DBH A;  2MWN B;  2Q13 A;  1P3R A;  3ULB A;  3ODX A;  2NMB A;  2YRY A;  2COF A;  1ISN A;  5C16 A;  5J3Q A;  2VSZ A;  1Y19 B;  1N3H A;  4K81 A;  2YF0 A;  5C5B B;  2D2Q A;  2I5F A;  1PFJ A;  3IVF A;  1FHW A;  3QIJ A;  1MAI A;  2RUK B;  2XQN M;  2YSZ A;  2VRW B;  4EMO A;  3HQC A;  2EMT A;  3TFM A;  2YS3 A;  3A98 B;  1BAK A;  2HE7 A;  4IOY X;  2P0F A;  1WG7 A;  2IFS A;  2AEH A;  5D3X A;  4KVG B;  2I1J A;  1V5M A;  2DHJ A;  3D8D A;  3SYX A;  1J19 A;  2NZ8 B;  1V88 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...