4KHOA

Structure of the fact complex subunit spt16m
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
290
structure length
268
Chain Sequence
VVEQDKLIEIRRPAVLDNVYIRPALGKRVPGKVEIHQNGIRYQSPLSTTQRVDVLFSNIRHLFFQPCQNEMIVIIHLHLKDPILFGKKKTKDVQFYREAIDEFEAEQEERRRKAELDRLFKSFAEKIAEAGRNEGIEVDMPIRDLGFNGVPNRSNVVIYPTTECLIQITEPPFLVITLEDVEWAHLERVQFGLKNFDLVFVFKDFTRPVVHINTIPVESLEDVKEFLDSSDIPFSEGPLNLNWSVIMKTVTANPHQFFLDGGWGFLQN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural basis of histone H2A-H2B recognition by the essential chaperone FACT.
pubmed doi rcsb
source organism Chaetomium thermophilum var. thermophilum
molecule tags Transcription/replication
molecule keywords Uncharacterized protein Spt16M
total genus 70
structure length 268
sequence length 290
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-04-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08512 Rtt106 Histone chaperone Rttp106-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 4khoA02
2.30.29.150 Mainly Beta Roll PH-domain like PH-domain like 4khoA01
2L1CA 5JHHA 3NSUA 4A6HA 1U5GA 1XX0A 1J0WA 1UPRA 2CAYA 2YS1A 2CY5A 3PZDA 1H4RA 1BTNA 1P3RA 1U5EA 3PVUA 2AL6A 5JHGA 1WI1A 2ROZB 2VKIA 1AWEA 1XR0B 4GMXB 2I5CA 3SUZA 4HB3B 3U8ZA 2UZRA 1KZ7A 1U29A 2RLOA 1RJ2A 4KHBB 4Z2NA 2G35A 2GCJA 3AU5A 3HW2B 3PG7A 1NI2A 3TVVA 2VSZA 4CHMA 5GOWB 2NZ8B 1BWNA 1U27A 4IFSA 1N3HA 3D8DA 4A6KA 3D8FA 3VIAA 2DX1A 2Z0PA 4KHOA 4K2OA 2Y8FA 2E2XA 3D8EA 4IOYX 2RUKB 2L2IA 4HAUB 4NSWA 3SNHA 1M7RA 2DN6A 2ADZA 4F7UP 1PFJA 2DHJA 2Z0OA 5D3YA 3SO6A 4MY6A 3DXEA 3CXBB 1U2BA 3WYFB 3MPXA 4P7IA 2LYDA 5DHFB 3F5RA 2P0FA 4GXBA 4D0NB 2K2UA 3PEGA 4WVFB 4GPTB 1WG7A 3SYXA 4MK0A 4B6HA 2BCJA 1DYNA 3A8PA 2DTCA 2KUPA 3QBVB 2D11A 4BBKA 2LOZA 1WGUA 2YSZA 1IRSA 4EKUA 3HQCA 3CIKA 1PMSA 4CYEA 1XD4A 5D3WA 2IFSA 2PZ1A 4YL8A 1GG3A 4MT7A 2NMBA 1EGXA 1KZGA 2LOXA 5D3XA 4HAWB 1FHWA 2D4QA 3P6AA 2H7EA 1QQGA 3AJ4A 2LG1A 2EJ8A 1I7AA 1DROA 2Y7BA 2DYNA 5DI9B 1V88A 3QWMA 1U5FA 2DFKA 4PQ0A 2X18A 3BINA 1V5PA 2D9ZA 2H7DA 4KHAA 4A5KA 2D9VA 2I1KA 1ZC3B 3KSYA 1KI1B 1TXDA 3FSSA 2K2JA 1GC6A 1ZVRA 4PNKA 5HE2A 4HAVB 2Z0QA 2D9WA 2D2QA 2ELBA 5FI1A 4K81A 3PSCA 1AQCA 3VOQA 1V89A 1MAIA 1MPHA 2J0JA 4WSFA 2HE7A 4K2PA 3N7CA 2MDXA 2DX5A 2UZSA 1MIZB 2KGXB 4EMOA 2YS3A 4F7GA 5D3VA 1H10A 4TKNA 5KQ1A 1P5TA 4GMVA 3KY9A 5DHAB 1Z87A 2D10A 2V76A 2DKPA 5D27A 4TYZA 3KZ1A 1XKEA 3X23A 4ZRIA 1WGQA 5HE0A 1UNRA 3ZDTA 2ELAA 4H8SA 1PLSA 4A6FB 2DLWA 1FAOA 4HDQA 2D9XA 2EMTA 1UNQA 3UZTA 2YT0A 3BJIA 1W1GA 1DBHA 1W1DA 2W2XD 3GYOA 5J3YA 2IYBA 4ZRJA 2ZPYA 2N0YA 4DX90 5CLLB 1MIXA 4DBBA 2UVMA 4HDOA 1FGZA 2R09A 4YONA 1Q67A 2Y8GA 3TFMA 3WA0A 1FB8A 5FI0A 5C6RA 4HATB 5L81A 1DDWA 2YRYA 1ZM0A 1GC7A 1B55A 4GN1A 1RRPB 5C5BA 2OTXA 3PP2A 5KCVA 2COAA 1MK7B 1Y19B 2M14A 5CLQB 4HAXB 4GZUA 3KRXA 5LOPB 1UPQA 2CRFA 3ODXA 2I1JA 5C79A 2ROVA 2K00A 3KRWA 3HK0A 1DDVA 2P0DA 2DYQA 3PVWA 4HAZB 3A8QA 3ZVRA 4EJNA 4KAXB 2CODA 1K5GB 3PVLA 1FOEA 3M1IB 1X1FA 2COCA 3TW1A 1UEFA 5EFXA 1V61A 4XWXA 5DIFB 2OQBA 1V5UA 2GS0A 5J3QA 3LJUX 4NY0A 1ISNA 1MKEA 2MKRA 3O96A 1WJ1A 2YF0A 3MDBC 3U7DA 2P0HA 1Y5OA 1V5MA 3FEHA 3SV1A 2W2XC 3T06A 3TO1A 5KQ4A 2AEHA 1X11A 2YS5A 2YVCA 5JLJB 3QIJA 3ULCA 1LB1A 3ODOA 3AU4A 2EC1A 1BTKA 2COFA 2EMSA 1SHCA 2P8VA 1TJ6A 2QKLA 3F0WA 1EF1A 1SGHA 2LULA 3FM8C 1UNPA 2YT1A 4ZRKA 4F7HA 1LW3A 2XQNM 3RCPA 3DXDA 1TQZA 3V5WA 3GYPA 2RSGA 1EAZA 4HB0B 2J0KA 1J19A 2D9YA 2RVBB 2VRWB 4DXAB 4HHVA 1ZC4B 2QKMA 2RNRB 1K5DB 4HB2B 2DHIA 5LONB 3G9WA 2LKOA 5JP4A 2HTHB 1NTVA 3OANA 4KVGB 2J59M 2GJYA 1W1HA 4K17A 2FJLA 1E5WA 2W2WA 4Z2MB 1DDMA 1X05A 4L6EA 3TCAA 2J0MA 5C16A 3P7ZA 4WJ7A 5C5BB 4CHJA 1MK9B 5HE1A 1FGYA 1X86A 1OQNA 2Q13A 2JP2A 4DX8A 5J3TA 4C0AA 5DH9B 1OY2A 1I2HA 2GCLA 1OMWA 4Y94A 2KCJA 1XODA 3A98B 3ODWA 2CY4A 5HE3A 1U5DA 2R0DA 1BAKA 1X1GA 1ZSQA 3ML4A 4A6FA 1QC6A 1NU2A 1M7EA 1P6SA 1FHOA 3ULBA 4HB4B 1WVHA 1XCGA 2DA0A 2DHKA 2MFQA 2RGNB 4HAYB 1EVHA 1FHXA 2N23A 2I5FA 2M38A 3DXCA 2MWNB 3IVFA 2DKQA 1NTYA 4IAPA 1WJMA
chains in the Genus database with same CATH superfamily
2L1CA 5JHHA 3NSUA 4A6HA 1U5GA 1XX0A 1J0WA 1UPRA 4GOUA 2CAYA 3NWFA 2YS1A 2CY5A 3PZDA 1H4RA 1BTNA 1P3RA 1U5EA 3PVUA 2AL6A 5JHGA 1WI1A 2ROZB 2VKIA 1AWEA 1XR0B 4GMXB 2I5CA 3SUZA 4HB3B 3U8ZA 2UZRA 1KZ7A 1U29A 2KUQA 4IAPA 2RLOA 1RJ2A 4KHBB 4Z2NA 2G35A 2GCJA 3AU5A 3OHMB 3HW2B 5I2MA 3PG7A 3A58A 3NW8A 1NI2A 3TVVA 2VSZA 4CHMA 5GOWB 2NZ8B 1BWNA 1U27A 4IFSA 1N3HA 3D8DA 3HIEA 4A6KA 3D8FA 3VIAA 2DX1A 2Z0PA 4KHOA 2Y8FA 2E2XA 4K2OA 3D8EA 4IOYX 2RUKB 2L2IA 4HAUB 4NSWA 3SNHA 1M7RA 2DN6A 2ADZA 4F7UP 1PFJA 2DHJA 2Z0OA 5D3YA 3SO6A 4MY6A 3DXEA 3CXBB 1U2BA 3WYFB 3MPXA 4P7IA 2LYDA 5DHFB 3F5RA 2P0FA 4GXBA 4D0NB 2R2YA 2Z14A 2K2UA 3PEGA 4WVFB 4GPTB 1WG7A 4HSIA 3SYXA 2Z59A 5I2SA 2RRFA 4MK0A 4B6HA 2BCJA 4OT1A 1DYNA 3A8PA 2DTCA 2KUPA 3QBVB 2D11A 4BBKA 2LOZA 1WGUA 2YSZA 1IRSA 4EKUA 3HQCA 3CIKA 1PMSA 4CYEA 1XD4A 5D3WA 2IFSA 2PZ1A 4L1RA 4YL8A 1GG3A 4MT7A 2NMBA 1EGXA 2LOXA 5D3XA 4HAWB 1FHWA 2D4QA 3P6AA 2H7EA 1QQGA 3AJ4A 4DIXA 2LG1A 2EJ8A 4GNKB 1I7AA 1DROA 2Y7BA 2NBVA 2DYNA 5DI9B 1V88A 3QWMA 2ZKMX 1U5FA 2DFKA 4PQ0A 2X18A 3BINA 1V5PA 2D9ZA 2H7DA 2Z13A 4KHAA 4A5KA 2D9VA 2I1KA 1ZC3B 3KSYA 1KI1B 1TXDA 3FSSA 4D6WA 2K2JA 1GC6A 1ZVRA 4PNKA 5HE2A 4HAVB 2Z0QA 2D9WA 2D2QA 2ELBA 5FI1A 4K81A 3PSCA 1AQCA 3VOQA 1V89A 1MAIA 1MPHA 2J0JA 4WSFA 2HE7A 4K2PA 3N7CA 2MDXA 2DX5A 2UZSA 1MIZB 2KGXB 4EMOA 2YS3A 3NWAA 4F7GA 5D3VA 1H10A 4TKNA 5KQ1A 1P5TA 4GMVA 3KY9A 5DHAB 1ZYIA 1Z87A 2D10A 2V76A 2DKPA 5D27A 2GUMA 4TYZA 3KZ1A 1XKEA 3X23A 4ZRIA 1WGQA 5HE0A 1UNRA 3ZDTA 2ELAA 4H8SA 1PLSA 4A6FB 2DLWA 1FAOA 4HDQA 2D9XA 2EMTA 1UNQA 3UZTA 3B77A 2YT0A 3BJIA 1W1GA 2K8EA 1DBHA 1W1DA 2W2XD 3GYOA 5J3YA 2KIGA 2IYBA 2YT2A 4ZRJA 2ZPYA 2N0YA 4DX90 5CLLB 1MIXA 4DBBA 2UVMA 4HDOA 1FGZA 2R09A 4YONA 1Q67A 2Y8GA 3FVCA 3TFMA 5LG4B 3WA0A 1FB8A 5FI0A 5C6RA 4HATB 5L81A 1DDWA 2YRYA 1ZM0A 1GC7A 1B55A 4GN1A 1RRPB 5C5BA 2OTXA 3PP2A 5KCVA 2COAA 1MK7B 1Y19B 2M14A 2KR0A 5CLQB 4HAXB 4GZUA 4QJ5B 3KRXA 5LOPB 1UPQA 2CRFA 3ODXA 2I1JA 4KHBA 5C79A 2ROVA 2K00A 3KRWA 3HK0A 1DDVA 2P0DA 2DYQA 3U12A 3PVWA 4HAZB 3A8QA 3ZVRA 4EJNA 4KAXB 2CODA 1K5GB 3PVLA 1FOEA 3M1IB 1X1FA 2COCA 3TW1A 1UEFA 5EFXA 1V61A 4XWXA 5DIFB 2OQBA 1V5UA 2GS0A 2KIEA 5J3QA 3LJUX 4NY0A 1ISNA 1MKEA 2MKRA 3O96A 1WJ1A 2YF0A 3MDBC 3U7DA 2P0HA 1Y5OA 1V5MA 3FEHA 3SV1A 2W2XC 3T06A 3TO1A 5KQ4A 2AEHA 1X11A 2YS5A 2YVCA 3DCXA 5JLJB 4OSNA 3QIJA 3ULCA 1LB1A 3ODOA 3AU4A 2EC1A 1BTKA 2COFA 2EMSA 1SHCA 2P8VA 1TJ6A 2QKLA 3F0WA 4QXAB 1EF1A 1SGHA 2LULA 3FM8C 1UNPA 2YT1A 4ZRKA 4F7HA 4QJ4B 1LW3A 2XQNM 3RCPA 3DXDA 1TQZA 3V5WA 3GYPA 2RSGA 1EAZA 4HB0B 2Z4DA 2J0KA 1J19A 2D9YA 2RVBB 2VRWB 4DXAB 4HHVA 1ZC4B 2QKMA 2RNRB 1K5DB 4HB2B 2DHIA 5LONB 3G9WA 2LKOA 4QJ3B 5JP4A 2HTHB 1NTVA 3OANA 4KVGB 2J59M 2GJYA 1W1HA 4K17A 2FJLA 1E5WA 2W2WA 4Z2MB 1DDMA 1X05A 3HSAA 4L6EA 3TCAA 2J0MA 5C16A 3P7ZA 4WJ7A 5C5BB 2FJUB 4CHJA 1MK9B 5HE1A 1FGYA 1MI1A 1X86A 1OQNA 2Q13A 2JP2A 4DX8A 5J3TA 4C0AA 5IRSA 5DH9B 1OY2A 1I2HA 2GCLA 5M4YB 1OMWA 4Y94A 2KCJA 1XODA 3A98B 3ODWA 2CY4A 5HE3A 1U5DA 2R0DA 1BAKA 2K49A 1X1GA 1ZSQA 3ML4A 4A6FA 1QC6A 1NU2A 1T77A 1M7EA 4CSQA 1P6SA 1FHOA 3NWDA 3ULBA 4HB4B 1WVHA 1XCGA 2DA0A 2DHKA 2MFQA 2RGNB 4HAYB 1EVHA 1FHXA 2N23A 2I5FA 2M38A 3DXCA 2MWNB 3IVFA 2DKQA 1NTYA 1KZGA 1WJMA
chains in the Genus database with same CATH topology
2L1CA 5JHHA 3NSUA 4A6HA 1U5GA 1XX0A 1J0WA 1UPRA 4GOUA 2CAYA 3NWFA 2YS1A 2CY5A 3PZDA 1H4RA 1BTNA 1P3RA 1U5EA 3PVUA 2AL6A 5JHGA 1WI1A 2ROZB 2VKIA 1AWEA 1XR0B 4GMXB 2I5CA 3SUZA 4HB3B 3U8ZA 2UZRA 1KZ7A 1U29A 2KUQA 2RLOA 1RJ2A 4KHBB 4Z2NA 2G35A 2GCJA 3AU5A 3OHMB 3HW2B 5I2MA 3PG7A 3A58A 3NW8A 1NI2A 3TVVA 2VSZA 4CHMA 5GOWB 2NZ8B 1BWNA 1U27A 4IFSA 1N3HA 3D8DA 3HIEA 4A6KA 3D8FA 3VIAA 2DX1A 2Z0PA 4KHOA 4K2OA 2Y8FA 2E2XA 3D8EA 4IOYX 2RUKB 2L2IA 4HAUB 4NSWA 3SNHA 1M7RA 2DN6A 2ADZA 4F7UP 1PFJA 2DHJA 2Z0OA 5D3YA 3SO6A 4MY6A 3DXEA 3CXBB 1U2BA 3WYFB 3MPXA 4P7IA 2LYDA 5DHFB 3F5RA 2P0FA 4GXBA 4D0NB 2R2YA 2Z14A 2K2UA 3PEGA 4WVFB 4GPTB 1WG7A 4HSIA 3SYXA 2Z59A 5I2SA 4MK0A 2RRFA 4B6HA 2BCJA 4OT1A 1DYNA 3A8PA 2DTCA 2KUPA 3QBVB 2D11A 4BBKA 2LOZA 1WGUA 2YSZA 1IRSA 4EKUA 3HQCA 3CIKA 1PMSA 4CYEA 1XD4A 5D3WA 2IFSA 2PZ1A 4YL8A 4L1RA 1GG3A 4MT7A 2NMBA 1EGXA 1KZGA 2LOXA 5D3XA 4HAWB 1FHWA 2D4QA 3P6AA 2H7EA 1QQGA 3AJ4A 4DIXA 2LG1A 2EJ8A 4GNKB 1I7AA 1DROA 2Y7BA 2NBVA 2DYNA 5DI9B 1V88A 3QWMA 2ZKMX 1U5FA 2DFKA 4PQ0A 2X18A 3BINA 1V5PA 2D9ZA 2H7DA 2Z13A 4KHAA 4A5KA 2D9VA 2I1KA 1ZC3B 3KSYA 1KI1B 1TXDA 3FSSA 4D6WA 2K2JA 1GC6A 1ZVRA 4PNKA 5HE2A 4HAVB 2Z0QA 2D9WA 2D2QA 2ELBA 5FI1A 4K81A 3PSCA 1AQCA 3VOQA 1V89A 1MAIA 1MPHA 2J0JA 4WSFA 2HE7A 4K2PA 3N7CA 2MDXA 2DX5A 2UZSA 1MIZB 2KGXB 4EMOA 2YS3A 3NWAA 4F7GA 5D3VA 1H10A 4TKNA 5KQ1A 1P5TA 4GMVA 3KY9A 5DHAB 1ZYIA 1Z87A 2D10A 2V76A 2DKPA 5D27A 4TYZA 2GUMA 3KZ1A 1XKEA 3X23A 4ZRIA 1WGQA 5HE0A 1UNRA 3ZDTA 2ELAA 4H8SA 1PLSA 4A6FB 2DLWA 1FAOA 4HDQA 2D9XA 2EMTA 1UNQA 3UZTA 2YT0A 3BJIA 1W1GA 2K8EA 1DBHA 1W1DA 2W2XD 3GYOA 5J3YA 2KIGA 2IYBA 2YT2A 4ZRJA 2ZPYA 2N0YA 4DX90 5CLLB 1MIXA 4DBBA 2UVMA 4HDOA 1FGZA 2R09A 4YONA 1Q67A 2Y8GA 3TFMA 3FVCA 5LG4B 3WA0A 1FB8A 5FI0A 5C6RA 4HATB 5L81A 1DDWA 2YRYA 1ZM0A 1GC7A 1B55A 4GN1A 1RRPB 5C5BA 2OTXA 3PP2A 5KCVA 2COAA 1MK7B 1Y19B 2M14A 2KR0A 5CLQB 4HAXB 4GZUA 4QJ5B 3KRXA 5LOPB 1UPQA 2CRFA 3ODXA 2I1JA 5C79A 4KHBA 2ROVA 2K00A 3KRWA 3HK0A 1DDVA 2P0DA 2DYQA 3U12A 3PVWA 4HAZB 3A8QA 3ZVRA 4EJNA 4KAXB 2CODA 1K5GB 3PVLA 1FOEA 3M1IB 1X1FA 2COCA 3TW1A 1UEFA 5EFXA 1V61A 4XWXA 5DIFB 2OQBA 1V5UA 2GS0A 2KIEA 5J3QA 3LJUX 4NY0A 1ISNA 1MKEA 2MKRA 3O96A 1WJ1A 2YF0A 3MDBC 3U7DA 2P0HA 1Y5OA 1V5MA 3FEHA 3SV1A 2W2XC 3T06A 3TO1A 5KQ4A 2AEHA 1X11A 2YS5A 2YVCA 5JLJB 4OSNA 3QIJA 3ULCA 1LB1A 3ODOA 3AU4A 2EC1A 1BTKA 2COFA 2EMSA 1SHCA 2P8VA 1TJ6A 2QKLA 3F0WA 4QXAB 1EF1A 1SGHA 2LULA 3FM8C 1UNPA 2YT1A 4ZRKA 4F7HA 4QJ4B 1LW3A 2XQNM 3RCPA 3DXDA 1TQZA 3V5WA 3GYPA 2RSGA 1EAZA 4HB0B 2Z4DA 2J0KA 1J19A 2D9YA 2RVBB 2VRWB 4DXAB 4HHVA 1ZC4B 2QKMA 2RNRB 1K5DB 4HB2B 2DHIA 5LONB 3G9WA 2LKOA 4QJ3B 5JP4A 2HTHB 1NTVA 3OANA 4KVGB 2J59M 2GJYA 1W1HA 4K17A 2FJLA 1E5WA 2W2WA 4Z2MB 1DDMA 1X05A 4L6EA 3TCAA 2J0MA 5C16A 3P7ZA 4WJ7A 5C5BB 2FJUB 4CHJA 1MK9B 5HE1A 1FGYA 1X86A 1OQNA 2Q13A 2JP2A 4DX8A 5J3TA 4C0AA 5IRSA 5DH9B 1OY2A 1I2HA 2GCLA 5M4YB 1OMWA 4Y94A 2KCJA 1XODA 3A98B 3ODWA 2CY4A 5HE3A 1U5DA 2R0DA 1BAKA 2K49A 1X1GA 1ZSQA 3ML4A 4A6FA 1QC6A 1NU2A 1M7EA 4CSQA 1P6SA 1FHOA 3NWDA 3ULBA 4HB4B 1WVHA 1XCGA 2DA0A 2DHKA 2MFQA 2RGNB 4HAYB 1EVHA 1FHXA 2N23A 2I5FA 2M38A 3DXCA 2MWNB 3IVFA 2DKQA 1NTYA 4IAPA 1WJMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2L1C A;  5JHH A;  3NSU A;  4A6H A;  1U5G A;  1XX0 A;  1J0W A;  1UPR A;  2CAY A;  2YS1 A;  2CY5 A;  3PZD A;  1H4R A;  1BTN A;  1P3R A;  1U5E A;  3PVU A;  2AL6 A;  5JHG A;  1WI1 A;  2ROZ B;  2VKI A;  1AWE A;  1XR0 B;  4GMX B;  2I5C A;  3SUZ A;  4HB3 B;  3U8Z A;  2UZR A;  1KZ7 A;  1U29 A;  2RLO A;  1RJ2 A;  4KHB B;  4Z2N A;  2G35 A;  2GCJ A;  3AU5 A;  3HW2 B;  3PG7 A;  1NI2 A;  3TVV A;  2VSZ A;  4CHM A;  5GOW B;  2NZ8 B;  1BWN A;  1U27 A;  4IFS A;  1N3H A;  3D8D A;  4A6K A;  3D8F A;  3VIA A;  2DX1 A;  2Z0P A;  4KHO A;  4K2O A;  2Y8F A;  2E2X A;  3D8E A;  4IOY X;  2RUK B;  2L2I A;  4HAU B;  4NSW A;  3SNH A;  1M7R A;  2DN6 A;  2ADZ A;  4F7U P;  1PFJ A;  2DHJ A;  2Z0O A;  5D3Y A;  3SO6 A;  4MY6 A;  3DXE A;  3CXB B;  1U2B A;  3WYF B;  3MPX A;  4P7I A;  2LYD A;  5DHF B;  3F5R A;  2P0F A;  4GXB A;  4D0N B;  2K2U A;  3PEG A;  4WVF B;  4GPT B;  1WG7 A;  3SYX A;  4MK0 A;  4B6H A;  2BCJ A;  1DYN A;  3A8P A;  2DTC A;  2KUP A;  3QBV B;  2D11 A;  4BBK A;  2LOZ A;  1WGU A;  2YSZ A;  1IRS A;  4EKU A;  3HQC A;  3CIK A;  1PMS A;  4CYE A;  1XD4 A;  5D3W A;  2IFS A;  2PZ1 A;  4YL8 A;  1GG3 A;  4MT7 A;  2NMB A;  1EGX A;  1KZG A;  2LOX A;  5D3X A;  4HAW B;  1FHW A;  2D4Q A;  3P6A A;  2H7E A;  1QQG A;  3AJ4 A;  2LG1 A;  2EJ8 A;  1I7A A;  1DRO A;  2Y7B A;  2DYN A;  5DI9 B;  1V88 A;  3QWM A;  1U5F A;  2DFK A;  4PQ0 A;  2X18 A;  3BIN A;  1V5P A;  2D9Z A;  2H7D A;  4KHA A;  4A5K A;  2D9V A;  2I1K A;  1ZC3 B;  3KSY A;  1KI1 B;  1TXD A;  3FSS A;  2K2J A;  1GC6 A;  1ZVR A;  4PNK A;  5HE2 A;  4HAV B;  2Z0Q A;  2D9W A;  2D2Q A;  2ELB A;  5FI1 A;  4K81 A;  3PSC A;  1AQC A;  3VOQ A;  1V89 A;  1MAI A;  1MPH A;  2J0J A;  4WSF A;  2HE7 A;  4K2P A;  3N7C A;  2MDX A;  2DX5 A;  2UZS A;  1MIZ B;  2KGX B;  4EMO A;  2YS3 A;  4F7G A;  5D3V A;  1H10 A;  4TKN A;  5KQ1 A;  1P5T A;  4GMV A;  3KY9 A;  5DHA B;  1Z87 A;  2D10 A;  2V76 A;  2DKP A;  5D27 A;  4TYZ A;  3KZ1 A;  1XKE A;  3X23 A;  4ZRI A;  1WGQ A;  5HE0 A;  1UNR A;  3ZDT A;  2ELA A;  4H8S A;  1PLS A;  4A6F B;  2DLW A;  1FAO A;  4HDQ A;  2D9X A;  2EMT A;  1UNQ A;  3UZT A;  2YT0 A;  3BJI A;  1W1G A;  1DBH A;  1W1D A;  2W2X D;  3GYO A;  5J3Y A;  2IYB A;  4ZRJ A;  2ZPY A;  2N0Y A;  4DX9 0;  5CLL B;  1MIX A;  4DBB A;  2UVM A;  4HDO A;  1FGZ A;  2R09 A;  4YON A;  1Q67 A;  2Y8G A;  3TFM A;  3WA0 A;  1FB8 A;  5FI0 A;  5C6R A;  4HAT B;  5L81 A;  1DDW A;  2YRY A;  1ZM0 A;  1GC7 A;  1B55 A;  4GN1 A;  1RRP B;  5C5B A;  2OTX A;  3PP2 A;  5KCV A;  2COA A;  1MK7 B;  1Y19 B;  2M14 A;  5CLQ B;  4HAX B;  4GZU A;  3KRX A;  5LOP B;  1UPQ A;  2CRF A;  3ODX A;  2I1J A;  5C79 A;  2ROV A;  2K00 A;  3KRW A;  3HK0 A;  1DDV A;  2P0D A;  2DYQ A;  3PVW A;  4HAZ B;  3A8Q A;  3ZVR A;  4EJN A;  4KAX B;  2COD A;  1K5G B;  3PVL A;  1FOE A;  3M1I B;  1X1F A;  2COC A;  3TW1 A;  1UEF A;  5EFX A;  1V61 A;  4XWX A;  5DIF B;  2OQB A;  1V5U A;  2GS0 A;  5J3Q A;  3LJU X;  4NY0 A;  1ISN A;  1MKE A;  2MKR A;  3O96 A;  1WJ1 A;  2YF0 A;  3MDB C;  3U7D A;  2P0H A;  1Y5O A;  1V5M A;  3FEH A;  3SV1 A;  2W2X C;  3T06 A;  3TO1 A;  5KQ4 A;  2AEH A;  1X11 A;  2YS5 A;  2YVC A;  5JLJ B;  3QIJ A;  3ULC A;  1LB1 A;  3ODO A;  3AU4 A;  2EC1 A;  1BTK A;  2COF A;  2EMS A;  1SHC A;  2P8V A;  1TJ6 A;  2QKL A;  3F0W A;  1EF1 A;  1SGH A;  2LUL A;  3FM8 C;  1UNP A;  2YT1 A;  4ZRK A;  4F7H A;  1LW3 A;  2XQN M;  3RCP A;  3DXD A;  1TQZ A;  3V5W A;  3GYP A;  2RSG A;  1EAZ A;  4HB0 B;  2J0K A;  1J19 A;  2D9Y A;  2RVB B;  2VRW B;  4DXA B;  4HHV A;  1ZC4 B;  2QKM A;  2RNR B;  1K5D B;  4HB2 B;  2DHI A;  5LON B;  3G9W A;  2LKO A;  5JP4 A;  2HTH B;  1NTV A;  3OAN A;  4KVG B;  2J59 M;  2GJY A;  1W1H A;  4K17 A;  2FJL A;  1E5W A;  2W2W A;  4Z2M B;  1DDM A;  1X05 A;  4L6E A;  3TCA A;  2J0M A;  5C16 A;  3P7Z A;  4WJ7 A;  5C5B B;  4CHJ A;  1MK9 B;  5HE1 A;  1FGY A;  1X86 A;  1OQN A;  2Q13 A;  2JP2 A;  4DX8 A;  5J3T A;  4C0A A;  5DH9 B;  1OY2 A;  1I2H A;  2GCL A;  1OMW A;  4Y94 A;  2KCJ A;  1XOD A;  3A98 B;  3ODW A;  2CY4 A;  5HE3 A;  1U5D A;  2R0D A;  1BAK A;  1X1G A;  1ZSQ A;  3ML4 A;  4A6F A;  1QC6 A;  1NU2 A;  1M7E A;  1P6S A;  1FHO A;  3ULB A;  4HB4 B;  1WVH A;  1XCG A;  2DA0 A;  2DHK A;  2MFQ A;  2RGN B;  4HAY B;  1EVH A;  1FHX A;  2N23 A;  2I5F A;  2M38 A;  3DXC A;  2MWN B;  3IVF A;  2DKQ A;  1NTY A;  4IAP A;  1WJM A; 
#chains in the Genus database with same CATH topology
 2L1C A;  5JHH A;  3NSU A;  4A6H A;  1U5G A;  1XX0 A;  1J0W A;  1UPR A;  4GOU A;  2CAY A;  3NWF A;  2YS1 A;  2CY5 A;  3PZD A;  1H4R A;  1BTN A;  1P3R A;  1U5E A;  3PVU A;  2AL6 A;  5JHG A;  1WI1 A;  2ROZ B;  2VKI A;  1AWE A;  1XR0 B;  4GMX B;  2I5C A;  3SUZ A;  4HB3 B;  3U8Z A;  2UZR A;  1KZ7 A;  1U29 A;  2KUQ A;  4IAP A;  2RLO A;  1RJ2 A;  4KHB B;  4Z2N A;  2G35 A;  2GCJ A;  3AU5 A;  3OHM B;  3HW2 B;  5I2M A;  3PG7 A;  3A58 A;  3NW8 A;  1NI2 A;  3TVV A;  2VSZ A;  4CHM A;  5GOW B;  2NZ8 B;  1BWN A;  1U27 A;  4IFS A;  1N3H A;  3D8D A;  3HIE A;  4A6K A;  3D8F A;  3VIA A;  2DX1 A;  2Z0P A;  4KHO A;  2Y8F A;  2E2X A;  4K2O A;  3D8E A;  4IOY X;  2RUK B;  2L2I A;  4HAU B;  4NSW A;  3SNH A;  1M7R A;  2DN6 A;  2ADZ A;  4F7U P;  1PFJ A;  2DHJ A;  2Z0O A;  5D3Y A;  3SO6 A;  4MY6 A;  3DXE A;  3CXB B;  1U2B A;  3WYF B;  3MPX A;  4P7I A;  2LYD A;  5DHF B;  3F5R A;  2P0F A;  4GXB A;  4D0N B;  2R2Y A;  2Z14 A;  2K2U A;  3PEG A;  4WVF B;  4GPT B;  1WG7 A;  4HSI A;  3SYX A;  2Z59 A;  5I2S A;  2RRF A;  4MK0 A;  4B6H A;  2BCJ A;  4OT1 A;  1DYN A;  3A8P A;  2DTC A;  2KUP A;  3QBV B;  2D11 A;  4BBK A;  2LOZ A;  1WGU A;  2YSZ A;  1IRS A;  4EKU A;  3HQC A;  3CIK A;  1PMS A;  4CYE A;  1XD4 A;  5D3W A;  2IFS A;  2PZ1 A;  4L1R A;  4YL8 A;  1GG3 A;  4MT7 A;  2NMB A;  1EGX A;  2LOX A;  5D3X A;  4HAW B;  1FHW A;  2D4Q A;  3P6A A;  2H7E A;  1QQG A;  3AJ4 A;  4DIX A;  2LG1 A;  2EJ8 A;  4GNK B;  1I7A A;  1DRO A;  2Y7B A;  2NBV A;  2DYN A;  5DI9 B;  1V88 A;  3QWM A;  2ZKM X;  1U5F A;  2DFK A;  4PQ0 A;  2X18 A;  3BIN A;  1V5P A;  2D9Z A;  2H7D A;  2Z13 A;  4KHA A;  4A5K A;  2D9V A;  2I1K A;  1ZC3 B;  3KSY A;  1KI1 B;  1TXD A;  3FSS A;  4D6W A;  2K2J A;  1GC6 A;  1ZVR A;  4PNK A;  5HE2 A;  4HAV B;  2Z0Q A;  2D9W A;  2D2Q A;  2ELB A;  5FI1 A;  4K81 A;  3PSC A;  1AQC A;  3VOQ A;  1V89 A;  1MAI A;  1MPH A;  2J0J A;  4WSF A;  2HE7 A;  4K2P A;  3N7C A;  2MDX A;  2DX5 A;  2UZS A;  1MIZ B;  2KGX B;  4EMO A;  2YS3 A;  3NWA A;  4F7G A;  5D3V A;  1H10 A;  4TKN A;  5KQ1 A;  1P5T A;  4GMV A;  3KY9 A;  5DHA B;  1ZYI A;  1Z87 A;  2D10 A;  2V76 A;  2DKP A;  5D27 A;  2GUM A;  4TYZ A;  3KZ1 A;  1XKE A;  3X23 A;  4ZRI A;  1WGQ A;  5HE0 A;  1UNR A;  3ZDT A;  2ELA A;  4H8S A;  1PLS A;  4A6F B;  2DLW A;  1FAO A;  4HDQ A;  2D9X A;  2EMT A;  1UNQ A;  3UZT A;  3B77 A;  2YT0 A;  3BJI A;  1W1G A;  2K8E A;  1DBH A;  1W1D A;  2W2X D;  3GYO A;  5J3Y A;  2KIG A;  2IYB A;  2YT2 A;  4ZRJ A;  2ZPY A;  2N0Y A;  4DX9 0;  5CLL B;  1MIX A;  4DBB A;  2UVM A;  4HDO A;  1FGZ A;  2R09 A;  4YON A;  1Q67 A;  2Y8G A;  3FVC A;  3TFM A;  5LG4 B;  3WA0 A;  1FB8 A;  5FI0 A;  5C6R A;  4HAT B;  5L81 A;  1DDW A;  2YRY A;  1ZM0 A;  1GC7 A;  1B55 A;  4GN1 A;  1RRP B;  5C5B A;  2OTX A;  3PP2 A;  5KCV A;  2COA A;  1MK7 B;  1Y19 B;  2M14 A;  2KR0 A;  5CLQ B;  4HAX B;  4GZU A;  4QJ5 B;  3KRX A;  5LOP B;  1UPQ A;  2CRF A;  3ODX A;  2I1J A;  4KHB A;  5C79 A;  2ROV A;  2K00 A;  3KRW A;  3HK0 A;  1DDV A;  2P0D A;  2DYQ A;  3U12 A;  3PVW A;  4HAZ B;  3A8Q A;  3ZVR A;  4EJN A;  4KAX B;  2COD A;  1K5G B;  3PVL A;  1FOE A;  3M1I B;  1X1F A;  2COC A;  3TW1 A;  1UEF A;  5EFX A;  1V61 A;  4XWX A;  5DIF B;  2OQB A;  1V5U A;  2GS0 A;  2KIE A;  5J3Q A;  3LJU X;  4NY0 A;  1ISN A;  1MKE A;  2MKR A;  3O96 A;  1WJ1 A;  2YF0 A;  3MDB C;  3U7D A;  2P0H A;  1Y5O A;  1V5M A;  3FEH A;  3SV1 A;  2W2X C;  3T06 A;  3TO1 A;  5KQ4 A;  2AEH A;  1X11 A;  2YS5 A;  2YVC A;  3DCX A;  5JLJ B;  4OSN A;  3QIJ A;  3ULC A;  1LB1 A;  3ODO A;  3AU4 A;  2EC1 A;  1BTK A;  2COF A;  2EMS A;  1SHC A;  2P8V A;  1TJ6 A;  2QKL A;  3F0W A;  4QXA B;  1EF1 A;  1SGH A;  2LUL A;  3FM8 C;  1UNP A;  2YT1 A;  4ZRK A;  4F7H A;  4QJ4 B;  1LW3 A;  2XQN M;  3RCP A;  3DXD A;  1TQZ A;  3V5W A;  3GYP A;  2RSG A;  1EAZ A;  4HB0 B;  2Z4D A;  2J0K A;  1J19 A;  2D9Y A;  2RVB B;  2VRW B;  4DXA B;  4HHV A;  1ZC4 B;  2QKM A;  2RNR B;  1K5D B;  4HB2 B;  2DHI A;  5LON B;  3G9W A;  2LKO A;  4QJ3 B;  5JP4 A;  2HTH B;  1NTV A;  3OAN A;  4KVG B;  2J59 M;  2GJY A;  1W1H A;  4K17 A;  2FJL A;  1E5W A;  2W2W A;  4Z2M B;  1DDM A;  1X05 A;  3HSA A;  4L6E A;  3TCA A;  2J0M A;  5C16 A;  3P7Z A;  4WJ7 A;  5C5B B;  2FJU B;  4CHJ A;  1MK9 B;  5HE1 A;  1FGY A;  1MI1 A;  1X86 A;  1OQN A;  2Q13 A;  2JP2 A;  4DX8 A;  5J3T A;  4C0A A;  5IRS A;  5DH9 B;  1OY2 A;  1I2H A;  2GCL A;  5M4Y B;  1OMW A;  4Y94 A;  2KCJ A;  1XOD A;  3A98 B;  3ODW A;  2CY4 A;  5HE3 A;  1U5D A;  2R0D A;  1BAK A;  2K49 A;  1X1G A;  1ZSQ A;  3ML4 A;  4A6F A;  1QC6 A;  1NU2 A;  1T77 A;  1M7E A;  4CSQ A;  1P6S A;  1FHO A;  3NWD A;  3ULB A;  4HB4 B;  1WVH A;  1XCG A;  2DA0 A;  2DHK A;  2MFQ A;  2RGN B;  4HAY B;  1EVH A;  1FHX A;  2N23 A;  2I5F A;  2M38 A;  3DXC A;  2MWN B;  3IVF A;  2DKQ A;  1NTY A;  1KZG A;  1WJM A; 
#chains in the Genus database with same CATH homology
 2L1C A;  5JHH A;  3NSU A;  4A6H A;  1U5G A;  1XX0 A;  1J0W A;  1UPR A;  4GOU A;  2CAY A;  3NWF A;  2YS1 A;  2CY5 A;  3PZD A;  1H4R A;  1BTN A;  1P3R A;  1U5E A;  3PVU A;  2AL6 A;  5JHG A;  1WI1 A;  2ROZ B;  2VKI A;  1AWE A;  1XR0 B;  4GMX B;  2I5C A;  3SUZ A;  4HB3 B;  3U8Z A;  2UZR A;  1KZ7 A;  1U29 A;  2KUQ A;  2RLO A;  1RJ2 A;  4KHB B;  4Z2N A;  2G35 A;  2GCJ A;  3AU5 A;  3OHM B;  3HW2 B;  5I2M A;  3PG7 A;  3A58 A;  3NW8 A;  1NI2 A;  3TVV A;  2VSZ A;  4CHM A;  5GOW B;  2NZ8 B;  1BWN A;  1U27 A;  4IFS A;  1N3H A;  3D8D A;  3HIE A;  4A6K A;  3D8F A;  3VIA A;  2DX1 A;  2Z0P A;  4KHO A;  4K2O A;  2Y8F A;  2E2X A;  3D8E A;  4IOY X;  2RUK B;  2L2I A;  4HAU B;  4NSW A;  3SNH A;  1M7R A;  2DN6 A;  2ADZ A;  4F7U P;  1PFJ A;  2DHJ A;  2Z0O A;  5D3Y A;  3SO6 A;  4MY6 A;  3DXE A;  3CXB B;  1U2B A;  3WYF B;  3MPX A;  4P7I A;  2LYD A;  5DHF B;  3F5R A;  2P0F A;  4GXB A;  4D0N B;  2R2Y A;  2Z14 A;  2K2U A;  3PEG A;  4WVF B;  4GPT B;  1WG7 A;  4HSI A;  3SYX A;  2Z59 A;  5I2S A;  4MK0 A;  2RRF A;  4B6H A;  2BCJ A;  4OT1 A;  1DYN A;  3A8P A;  2DTC A;  2KUP A;  3QBV B;  2D11 A;  4BBK A;  2LOZ A;  1WGU A;  2YSZ A;  1IRS A;  4EKU A;  3HQC A;  3CIK A;  1PMS A;  4CYE A;  1XD4 A;  5D3W A;  2IFS A;  2PZ1 A;  4YL8 A;  4L1R A;  1GG3 A;  4MT7 A;  2NMB A;  1EGX A;  1KZG A;  2LOX A;  5D3X A;  4HAW B;  1FHW A;  2D4Q A;  3P6A A;  2H7E A;  1QQG A;  3AJ4 A;  4DIX A;  2LG1 A;  2EJ8 A;  4GNK B;  1I7A A;  1DRO A;  2Y7B A;  2NBV A;  2DYN A;  5DI9 B;  1V88 A;  3QWM A;  2ZKM X;  1U5F A;  2DFK A;  4PQ0 A;  2X18 A;  3BIN A;  1V5P A;  2D9Z A;  2H7D A;  2Z13 A;  4KHA A;  4A5K A;  2D9V A;  2I1K A;  1ZC3 B;  3KSY A;  1KI1 B;  1TXD A;  3FSS A;  4D6W A;  2K2J A;  1GC6 A;  1ZVR A;  4PNK A;  5HE2 A;  4HAV B;  2Z0Q A;  2D9W A;  2D2Q A;  2ELB A;  5FI1 A;  4K81 A;  3PSC A;  1AQC A;  3VOQ A;  1V89 A;  1MAI A;  1MPH A;  2J0J A;  4WSF A;  2HE7 A;  4K2P A;  3N7C A;  2MDX A;  2DX5 A;  2UZS A;  1MIZ B;  2KGX B;  4EMO A;  2YS3 A;  3NWA A;  4F7G A;  5D3V A;  1H10 A;  4TKN A;  5KQ1 A;  1P5T A;  4GMV A;  3KY9 A;  5DHA B;  1ZYI A;  1Z87 A;  2D10 A;  2V76 A;  2DKP A;  5D27 A;  4TYZ A;  2GUM A;  3KZ1 A;  1XKE A;  3X23 A;  4ZRI A;  1WGQ A;  5HE0 A;  1UNR A;  3ZDT A;  2ELA A;  4H8S A;  1PLS A;  4A6F B;  2DLW A;  1FAO A;  4HDQ A;  2D9X A;  2EMT A;  1UNQ A;  3UZT A;  2YT0 A;  3BJI A;  1W1G A;  2K8E A;  1DBH A;  1W1D A;  2W2X D;  3GYO A;  5J3Y A;  2KIG A;  2IYB A;  2YT2 A;  4ZRJ A;  2ZPY A;  2N0Y A;  4DX9 0;  5CLL B;  1MIX A;  4DBB A;  2UVM A;  4HDO A;  1FGZ A;  2R09 A;  4YON A;  1Q67 A;  2Y8G A;  3TFM A;  3FVC A;  5LG4 B;  3WA0 A;  1FB8 A;  5FI0 A;  5C6R A;  4HAT B;  5L81 A;  1DDW A;  2YRY A;  1ZM0 A;  1GC7 A;  1B55 A;  4GN1 A;  1RRP B;  5C5B A;  2OTX A;  3PP2 A;  5KCV A;  2COA A;  1MK7 B;  1Y19 B;  2M14 A;  2KR0 A;  5CLQ B;  4HAX B;  4GZU A;  4QJ5 B;  3KRX A;  5LOP B;  1UPQ A;  2CRF A;  3ODX A;  2I1J A;  5C79 A;  4KHB A;  2ROV A;  2K00 A;  3KRW A;  3HK0 A;  1DDV A;  2P0D A;  2DYQ A;  3U12 A;  3PVW A;  4HAZ B;  3A8Q A;  3ZVR A;  4EJN A;  4KAX B;  2COD A;  1K5G B;  3PVL A;  1FOE A;  3M1I B;  1X1F A;  2COC A;  3TW1 A;  1UEF A;  5EFX A;  1V61 A;  4XWX A;  5DIF B;  2OQB A;  1V5U A;  2GS0 A;  2KIE A;  5J3Q A;  3LJU X;  4NY0 A;  1ISN A;  1MKE A;  2MKR A;  3O96 A;  1WJ1 A;  2YF0 A;  3MDB C;  3U7D A;  2P0H A;  1Y5O A;  1V5M A;  3FEH A;  3SV1 A;  2W2X C;  3T06 A;  3TO1 A;  5KQ4 A;  2AEH A;  1X11 A;  2YS5 A;  2YVC A;  5JLJ B;  4OSN A;  3QIJ A;  3ULC A;  1LB1 A;  3ODO A;  3AU4 A;  2EC1 A;  1BTK A;  2COF A;  2EMS A;  1SHC A;  2P8V A;  1TJ6 A;  2QKL A;  3F0W A;  4QXA B;  1EF1 A;  1SGH A;  2LUL A;  3FM8 C;  1UNP A;  2YT1 A;  4ZRK A;  4F7H A;  4QJ4 B;  1LW3 A;  2XQN M;  3RCP A;  3DXD A;  1TQZ A;  3V5W A;  3GYP A;  2RSG A;  1EAZ A;  4HB0 B;  2Z4D A;  2J0K A;  1J19 A;  2D9Y A;  2RVB B;  2VRW B;  4DXA B;  4HHV A;  1ZC4 B;  2QKM A;  2RNR B;  1K5D B;  4HB2 B;  2DHI A;  5LON B;  3G9W A;  2LKO A;  4QJ3 B;  5JP4 A;  2HTH B;  1NTV A;  3OAN A;  4KVG B;  2J59 M;  2GJY A;  1W1H A;  4K17 A;  2FJL A;  1E5W A;  2W2W A;  4Z2M B;  1DDM A;  1X05 A;  4L6E A;  3TCA A;  2J0M A;  5C16 A;  3P7Z A;  4WJ7 A;  5C5B B;  2FJU B;  4CHJ A;  1MK9 B;  5HE1 A;  1FGY A;  1X86 A;  1OQN A;  2Q13 A;  2JP2 A;  4DX8 A;  5J3T A;  4C0A A;  5IRS A;  5DH9 B;  1OY2 A;  1I2H A;  2GCL A;  5M4Y B;  1OMW A;  4Y94 A;  2KCJ A;  1XOD A;  3A98 B;  3ODW A;  2CY4 A;  5HE3 A;  1U5D A;  2R0D A;  1BAK A;  2K49 A;  1X1G A;  1ZSQ A;  3ML4 A;  4A6F A;  1QC6 A;  1NU2 A;  1M7E A;  4CSQ A;  1P6S A;  1FHO A;  3NWD A;  3ULB A;  4HB4 B;  1WVH A;  1XCG A;  2DA0 A;  2DHK A;  2MFQ A;  2RGN B;  4HAY B;  1EVH A;  1FHX A;  2N23 A;  2I5F A;  2M38 A;  3DXC A;  2MWN B;  3IVF A;  2DKQ A;  1NTY A;  4IAP A;  1WJM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...