4KHOA

Structure of the fact complex subunit spt16m
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
290
structure length
268
Chain Sequence
VVEQDKLIEIRRPAVLDNVYIRPALGKRVPGKVEIHQNGIRYQSPLSTTQRVDVLFSNIRHLFFQPCQNEMIVIIHLHLKDPILFGKKKTKDVQFYREAIDEFEAEQEERRRKAELDRLFKSFAEKIAEAGRNEGIEVDMPIRDLGFNGVPNRSNVVIYPTTECLIQITEPPFLVITLEDVEWAHLERVQFGLKNFDLVFVFKDFTRPVVHINTIPVESLEDVKEFLDSSDIPFSEGPLNLNWSVIMKTVTANPHQFFLDGGWGFLQN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transcription/replication
molecule keywords Uncharacterized protein Spt16M
publication title Structural basis of histone H2A-H2B recognition by the essential chaperone FACT.
pubmed doi rcsb
source organism Chaetomium thermophilum var. thermophilum
total genus 70
structure length 268
sequence length 290
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-04-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08512 Rtt106 Histone chaperone Rttp106-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 4khoA02
2.30.29.150 Mainly Beta Roll PH-domain like PH-domain like 4khoA01
2CY4A 1GC6A 3TO1A 2MKRA 5C5BB 1RRPB 3V5WA 4ZRKA 3PP2A 1WGUA 4H8SA 4KHOA 2ELBA 3VIAA 2QKLA 1BAKA 2JP2A 1FGZA 3GYOA 5LONB 3M1IB 2D9YA 3AJ4A 1QQGA 3SYXA 3F0WA 3P7ZA 1MK7B 2CAYA 1OQNA 1AWEA 2DN6A 2IYBA 4HATB 4K2PA 3U8ZA 4XWXA 4EKUA 3PVLA 1EVHA 4PQ0A 2AEHA 4EMOA 1U5FA 5HE0A 2MWNB 1TQZA 2Y8GA 5C79A 2LYDA 5C6RA 1B55A 2BCJA 2NZ8B 1K5DB 4TYZA 1X1FA 1OMWA 3DXCA 1TXDA 1FGYA 1ZC3B 2KCJA 4F7HA 5J3TA 2RVBB 3AU4A 2D4QA 2K00A 2LOXA 5C5BA 1PFJA 4GXBA 1DDVA 4P7IA 1I7AA 4KAXB 2RSGA 2IFSA 1V5MA 1U5DA 2VSZA 2YF0A 5J3YA 3O96A 2YS1A 1ZVRA 1N3HA 1WVHA 2RLOA 2DHIA 2Z0OA 5CLQB 2UVMA 1Q67A 1WJ1A 2H7DA 4A6FA 3T06A 1ZC4B 1MPHA 2XQNM 4HDOA 2YT1A 3MDBC 1PLSA 3KZ1A 1UNQA 5DHFB 1WJMA 2ADZA 4HAVB 1LW3A 2EC1A 2YS3A 3ML4A 4GMVA 2ZPYA 3IVFA 2P0FA 1MKEA 4DX90 4CYEA 1V61A 2W2XD 4B6HA 1W1HA 2VRWB 2I5FA 1U27A 1XCGA 2P0HA 4YL8A 2DYNA 4CHJA 5KCVA 3ZDTA 5C16A 2DHKA 4WSFA 4HDQA 1ZM0A 3KY9A 4Z2NA 2MDXA 5EFXA 2QKMA 2Z0PA 2EMTA 5D27A 2RUKB 2EJ8A 1P6SA 5D3YA 1ISNA 2J0MA 2EMSA 2D9VA 2D2QA 5LOPB 1P3RA 3SV1A 4IAPA 1DDMA 3DXEA 1Z87A 4EJNA 4HHVA 1UNRA 2P0DA 1UEFA 2L2IA 3D8DA 3TVVA 1K5GB 3HK0A 5GOWB 4A6FB 1W1GA 3A8QA 4MY6A 2N0YA 4L6EA 1DYNA 3QIJA 1KZGA 5FI1A 1WI1A 1GC7A 2FJLA 1XR0B 4MK0A 2LOZA 1EGXA 1UPRA 3U7DA 5HE3A 4HAZB 2X18A 2DTCA 1EF1A 2D11A 1FHXA 4DX8A 3G9WA 1X86A 4BBKA 3D8FA 2D10A 4IOYX 2D9XA 3LJUX 3SNHA 2CRFA 3X23A 1Y19B 1MAIA 1BWNA 1MIZB 2H7EA 2YRYA 3HQCA 2ELAA 3QWMA 2KGXB 1AQCA 4GZUA 3SO6A 1U2BA 1U5GA 1U29A 1DDWA 1KI1B 4WVFB 2ROZB 2YVCA 3QBVB 5JP4A 1V88A 1I2HA 2D9WA 2VKIA 2RGNB 1UNPA 4HB3B 3ZVRA 3DXDA 5JHGA 2J59M 4K2OA 2DLWA 4HB4B 2I1KA 1NTYA 2ROVA 5DHAB 1RJ2A 2LKOA 2LG1A 3OANA 3WYFB 1NU2A 1ZSQA 2LULA 3A98B 1XX0A 1EAZA 2R0DA 4DXAB 3PVWA 4Z2MB 2COAA 4K81A 5JHHA 5KQ1A 3KSYA 1WG7A 3FM8C 4HAWB 3PZDA 5J3QA 2DX5A 2N23A 4KHBB 2K2UA 2RNRB 2D9ZA 1BTNA 4YONA 2R09A 2OTXA 4CHMA 1TJ6A 3KRWA 1PMSA 5D3VA 5D3WA 2GCLA 2M14A 3AU5A 3BJIA 2V76A 3VOQA 2DA0A 1V89A 3GYPA 3ODWA 1J0WA 4MT7A 4GMXB 2K2JA 2W2WA 1H4RA 4HAYB 3SUZA 3P6AA 2DX1A 5DH9B 5KQ4A 2J0JA 3F5RA 3PSCA 3ULBA 3TFMA 2GS0A 1U5EA 1Y5OA 3KRXA 2GJYA 4NY0A 2HTHB 1FHOA 1M7EA 2YT0A 3A8PA 4HAXB 1FAOA 1W1DA 5FI0A 2J0KA 2MFQA 2AL6A 2HE7A 1OY2A 1SGHA 2L1CA 2UZRA 4ZRJA 1XD4A 2NMBA 2DYQA 1MIXA 2KUPA 1NI2A 4GN1A 2OQBA 1X11A 4KVGB 2PZ1A 1SHCA 3ULCA 2COCA 1DROA 2YS5A 4Y94A 1UPQA 5D3XA 4HAUB 3N7CA 4F7UP 3HW2B 4IFSA 3UZTA 3PVUA 2I1JA 2Y7BA 2DHJA 1WGQA 3MPXA 2Z0QA 2M38A 1E5WA 3TCAA 4HB2B 3PEGA 5L81A 4A6KA 1X1GA 4A6HA 4K17A 1M7RA 1IRSA 1DBHA 1V5UA 4A5KA 1MK9B 2DKQA 1NTVA 1BTKA 1QC6A 5JLJB 1V5PA 1LB1A 1X05A 2Y8FA 2COFA 4D0NB 4KHAA 1XKEA 2DFKA 2P8VA 1H10A 4WJ7A 5DI9B 3TW1A 3FEHA 3FSSA 2YSZA 1KZ7A 5CLLB 1FOEA 2GCJA 3ODOA 1P5TA 5HE2A 2CODA 2E2XA 4HB0B 2DKPA 5DIFB 4DBBA 4TKNA 3ODXA 4NSWA 2UZSA 1J19A 2I5CA 4C0AA 3NSUA 4ZRIA 3CXBB 4GPTB 1GG3A 3WA0A 2W2XC 3PG7A 4PNKA 2CY5A 1XODA 2Q13A 2G35A 1FHWA 3D8EA 5HE1A 3RCPA 3BINA 4F7GA 1FB8A 3CIKA
chains in the Genus database with same CATH superfamily
2CY4A 1GC6A 4QXAB 3TO1A 5I2SA 2MKRA 5C5BB 1RRPB 3V5WA 4ZRKA 2Z14A 3PP2A 1WGUA 4H8SA 4KHOA 2ELBA 3VIAA 2QKLA 3NWDA 3U12A 1BAKA 2JP2A 1FGZA 2Z4DA 3GYOA 5LONB 3M1IB 2D9YA 3AJ4A 1QQGA 4QJ4B 3SYXA 3F0WA 3P7ZA 1MK7B 2CAYA 1OQNA 4QJ3B 1AWEA 2DN6A 2IYBA 4HATB 4K2PA 3U8ZA 4XWXA 4EKUA 3PVLA 1EVHA 4PQ0A 2ZKMX 2AEHA 4EMOA 1U5FA 5HE0A 2MWNB 1TQZA 2Y8GA 5C79A 2LYDA 5C6RA 1B55A 2BCJA 2NZ8B 1K5DB 4TYZA 1X1FA 1OMWA 2Z13A 3DXCA 1TXDA 1FGYA 1ZC3B 2KCJA 4F7HA 5J3TA 2RVBB 3AU4A 2D4QA 2K49A 2K00A 2LOXA 5C5BA 2RRFA 1PFJA 4GXBA 1DDVA 4P7IA 1I7AA 4KAXB 2RSGA 2IFSA 1V5MA 1U5DA 2VSZA 4HSIA 2YF0A 5J3YA 2YS1A 1ZVRA 3O96A 1N3HA 1WVHA 2RLOA 2DHIA 1T77A 2Z0OA 5CLQB 2UVMA 1Q67A 1WJ1A 2H7DA 2YT2A 4A6FA 3T06A 1ZC4B 1MPHA 2XQNM 4HDOA 2YT1A 3MDBC 2GUMA 1PLSA 3KZ1A 1UNQA 5DHFB 1WJMA 2ADZA 4HAVB 1LW3A 2EC1A 2YS3A 3ML4A 4GMVA 2Z59A 2ZPYA 3IVFA 2P0FA 1MKEA 3B77A 4DX90 4CYEA 1V61A 2W2XD 4B6HA 1W1HA 2VRWB 2I5FA 1U27A 1XCGA 2P0HA 4YL8A 4QJ5B 4GNKB 2DYNA 4CHJA 5KCVA 4GOUA 3ZDTA 5C16A 2DHKA 4WSFA 4HDQA 1ZM0A 3KY9A 4Z2NA 2MDXA 5EFXA 2QKMA 2Z0PA 2EMTA 5D27A 2RUKB 2EJ8A 1P6SA 5D3YA 1ISNA 2J0MA 2EMSA 2D9VA 2D2QA 5LOPB 1P3RA 3SV1A 4IAPA 1DDMA 3DXEA 1Z87A 4EJNA 4HHVA 1UNRA 2P0DA 1UEFA 2L2IA 3NWFA 3D8DA 3TVVA 1K5GB 3HK0A 5GOWB 4A6FB 1W1GA 3A8QA 4MY6A 2N0YA 4L6EA 1DYNA 3QIJA 1KZGA 5FI1A 1WI1A 1GC7A 2K8EA 2FJLA 3HIEA 1XR0B 4MK0A 2LOZA 5IRSA 1EGXA 1UPRA 3U7DA 5HE3A 4HAZB 2X18A 2DTCA 1EF1A 2D11A 4KHBA 1FHXA 3HSAA 4DX8A 3G9WA 1X86A 3A58A 4BBKA 3D8FA 2D10A 4IOYX 2D9XA 3LJUX 3SNHA 2CRFA 3X23A 1Y19B 1MAIA 1BWNA 1MIZB 2H7EA 4DIXA 4OSNA 2YRYA 3HQCA 2ELAA 3QWMA 2KGXB 1AQCA 4GZUA 3SO6A 1U2BA 3FVCA 1U5GA 1U29A 1DDWA 1KI1B 4WVFB 2ROZB 2YVCA 3QBVB 5JP4A 1V88A 1I2HA 2D9WA 2VKIA 2RGNB 1UNPA 4HB3B 3ZVRA 3DXDA 5JHGA 2J59M 4K2OA 2DLWA 4HB4B 2I1KA 1NTYA 2ROVA 5DHAB 1RJ2A 2LKOA 2LG1A 3OANA 3WYFB 1NU2A 1ZSQA 2LULA 3A98B 1XX0A 1EAZA 2R0DA 4DXAB 3PVWA 4Z2MB 2COAA 4K81A 5JHHA 5KQ1A 3KSYA 1WG7A 3FM8C 4HAWB 3PZDA 5J3QA 2DX5A 2N23A 4KHBB 2K2UA 2RNRB 2D9ZA 1BTNA 1MI1A 3OHMB 4YONA 2R09A 4D6WA 2OTXA 4CHMA 1TJ6A 3KRWA 1PMSA 5D3VA 5D3WA 2GCLA 2M14A 3AU5A 3BJIA 2V76A 3VOQA 2DA0A 1V89A 3NWAA 3GYPA 2R2YA 3ODWA 1J0WA 4MT7A 4GMXB 2K2JA 2W2WA 1H4RA 4HAYB 3SUZA 3P6AA 2DX1A 5DH9B 5KQ4A 2J0JA 3F5RA 3PSCA 3ULBA 3TFMA 2GS0A 1U5EA 5I2MA 5LG4B 1Y5OA 3KRXA 2GJYA 4NY0A 2HTHB 1FHOA 1M7EA 2YT0A 3A8PA 2NBVA 4HAXB 1FAOA 1W1DA 5FI0A 2J0KA 2MFQA 2AL6A 2HE7A 1OY2A 1SGHA 2L1CA 2UZRA 4ZRJA 1XD4A 2NMBA 2DYQA 1MIXA 2KUPA 1NI2A 4GN1A 2OQBA 1X11A 4KVGB 2PZ1A 1SHCA 3ULCA 2COCA 4CSQA 2YS5A 1DROA 4Y94A 1UPQA 2KUQA 5D3XA 4HAUB 3N7CA 4F7UP 3NW8A 3HW2B 2FJUB 4IFSA 3UZTA 3PVUA 2I1JA 2Y7BA 2DHJA 1WGQA 2KIGA 3MPXA 2Z0QA 2M38A 1E5WA 3TCAA 4HB2B 3PEGA 5L81A 4A6KA 4OT1A 1X1GA 4A6HA 4K17A 1M7RA 1IRSA 1DBHA 1V5UA 4A5KA 1MK9B 4L1RA 2DKQA 1NTVA 1BTKA 1QC6A 5JLJB 1V5PA 1LB1A 1X05A 2Y8FA 2COFA 4D0NB 4KHAA 1XKEA 2DFKA 2P8VA 1H10A 4WJ7A 5DI9B 3TW1A 3FEHA 3FSSA 2YSZA 5M4YB 1KZ7A 2KR0A 5CLLB 1FOEA 2GCJA 3ODOA 1P5TA 5HE2A 2CODA 2E2XA 4HB0B 2DKPA 5DIFB 4DBBA 4TKNA 3ODXA 4NSWA 2UZSA 1J19A 2I5CA 4C0AA 3NSUA 4ZRIA 3CXBB 4GPTB 1GG3A 3WA0A 2W2XC 3PG7A 4PNKA 2KIEA 2CY5A 1XODA 1ZYIA 2Q13A 2G35A 3DCXA 1FHWA 3D8EA 5HE1A 3RCPA 3BINA 4F7GA 1FB8A 3CIKA
chains in the Genus database with same CATH topology
2CY4A 1GC6A 4QXAB 3TO1A 5I2SA 2MKRA 5C5BB 1RRPB 3V5WA 4ZRKA 2Z14A 3PP2A 1WGUA 4H8SA 4KHOA 2ELBA 3VIAA 2QKLA 3NWDA 1BAKA 3U12A 2JP2A 1FGZA 2Z4DA 3GYOA 5LONB 3M1IB 2D9YA 3AJ4A 1QQGA 4QJ4B 3SYXA 3F0WA 3P7ZA 1MK7B 2CAYA 1OQNA 4QJ3B 1AWEA 2DN6A 2IYBA 4HATB 4K2PA 3U8ZA 4XWXA 4EKUA 3PVLA 1EVHA 4PQ0A 2ZKMX 2AEHA 4EMOA 1U5FA 5HE0A 2MWNB 1TQZA 2Y8GA 5C79A 2LYDA 5C6RA 1B55A 2BCJA 2NZ8B 1K5DB 4TYZA 1X1FA 1OMWA 2Z13A 3DXCA 1TXDA 1FGYA 1ZC3B 2KCJA 4F7HA 5J3TA 2RVBB 3AU4A 2D4QA 2K49A 2K00A 2LOXA 5C5BA 2RRFA 1PFJA 4GXBA 1DDVA 4P7IA 1I7AA 4KAXB 2RSGA 2IFSA 1V5MA 1U5DA 2VSZA 4HSIA 2YF0A 5J3YA 3O96A 2YS1A 1ZVRA 1N3HA 1WVHA 2RLOA 2DHIA 2Z0OA 5CLQB 2UVMA 1Q67A 1WJ1A 2H7DA 2YT2A 4A6FA 3T06A 1ZC4B 1MPHA 2XQNM 4HDOA 2YT1A 3MDBC 2GUMA 1PLSA 3KZ1A 1UNQA 5DHFB 1WJMA 2ADZA 4HAVB 1LW3A 2EC1A 2YS3A 3ML4A 4GMVA 2Z59A 2ZPYA 3IVFA 2P0FA 1MKEA 4DX90 4CYEA 1V61A 2W2XD 4B6HA 1W1HA 2VRWB 2I5FA 1U27A 1XCGA 2P0HA 4YL8A 4QJ5B 4GNKB 2DYNA 4CHJA 5KCVA 4GOUA 3ZDTA 5C16A 2DHKA 4WSFA 4HDQA 1ZM0A 3KY9A 4Z2NA 2MDXA 5EFXA 2QKMA 2Z0PA 2EMTA 5D27A 2RUKB 2EJ8A 1P6SA 5D3YA 1ISNA 2J0MA 2EMSA 2D9VA 2D2QA 5LOPB 1P3RA 3SV1A 4IAPA 1DDMA 3DXEA 1Z87A 4EJNA 4HHVA 1UNRA 2P0DA 1UEFA 2L2IA 3NWFA 3D8DA 3TVVA 1K5GB 3HK0A 5GOWB 4A6FB 1W1GA 3A8QA 4MY6A 2N0YA 4L6EA 1DYNA 3QIJA 1KZGA 5FI1A 1WI1A 1GC7A 2K8EA 2FJLA 3HIEA 1XR0B 4MK0A 2LOZA 5IRSA 1EGXA 1UPRA 3U7DA 5HE3A 4HAZB 2X18A 2DTCA 1EF1A 2D11A 4KHBA 1FHXA 4DX8A 3G9WA 1X86A 3A58A 4BBKA 3D8FA 2D10A 4IOYX 2D9XA 3LJUX 3SNHA 2CRFA 3X23A 1Y19B 1MAIA 1BWNA 1MIZB 2H7EA 4DIXA 4OSNA 2YRYA 3HQCA 2ELAA 3QWMA 2KGXB 1AQCA 4GZUA 3SO6A 1U2BA 3FVCA 1U5GA 1U29A 1DDWA 1KI1B 4WVFB 2ROZB 2YVCA 3QBVB 5JP4A 1V88A 1I2HA 2D9WA 2VKIA 2RGNB 1UNPA 4HB3B 3ZVRA 3DXDA 5JHGA 2J59M 4K2OA 2DLWA 4HB4B 2I1KA 1NTYA 2ROVA 5DHAB 1RJ2A 2LKOA 2LG1A 3OANA 3WYFB 1NU2A 1ZSQA 2LULA 3A98B 1XX0A 1EAZA 2R0DA 4DXAB 3PVWA 4Z2MB 2COAA 4K81A 5JHHA 5KQ1A 3KSYA 1WG7A 3FM8C 4HAWB 3PZDA 5J3QA 2DX5A 2N23A 4KHBB 2K2UA 2RNRB 2D9ZA 1BTNA 3OHMB 4YONA 2R09A 4D6WA 2OTXA 4CHMA 1TJ6A 3KRWA 1PMSA 5D3VA 5D3WA 2GCLA 2M14A 3AU5A 3BJIA 2V76A 3VOQA 2DA0A 1V89A 3NWAA 3GYPA 2R2YA 3ODWA 1J0WA 4MT7A 4GMXB 2K2JA 2W2WA 1H4RA 4HAYB 3SUZA 3P6AA 2DX1A 5DH9B 5KQ4A 2J0JA 3F5RA 3PSCA 3ULBA 3TFMA 2GS0A 1U5EA 5I2MA 5LG4B 1Y5OA 3KRXA 2GJYA 4NY0A 2HTHB 1FHOA 1M7EA 2YT0A 3A8PA 4HAXB 2NBVA 1FAOA 1W1DA 5FI0A 2J0KA 2MFQA 2AL6A 2HE7A 1OY2A 1SGHA 2L1CA 2UZRA 4ZRJA 1XD4A 2NMBA 2DYQA 1MIXA 2KUPA 1NI2A 4GN1A 2OQBA 1X11A 4KVGB 2PZ1A 1SHCA 3ULCA 2COCA 1DROA 2YS5A 4CSQA 4Y94A 1UPQA 2KUQA 5D3XA 4HAUB 3N7CA 4F7UP 3NW8A 3HW2B 2FJUB 4IFSA 3UZTA 3PVUA 2I1JA 2Y7BA 2DHJA 1WGQA 2KIGA 3MPXA 2Z0QA 2M38A 1E5WA 3TCAA 4HB2B 3PEGA 5L81A 4A6KA 4OT1A 1X1GA 4A6HA 4K17A 1M7RA 1IRSA 1DBHA 1V5UA 4A5KA 1MK9B 4L1RA 2DKQA 1NTVA 1BTKA 1QC6A 5JLJB 1V5PA 1LB1A 1X05A 2Y8FA 2COFA 4D0NB 4KHAA 1XKEA 2DFKA 2P8VA 1H10A 4WJ7A 5DI9B 3TW1A 3FEHA 3FSSA 2YSZA 5M4YB 1KZ7A 2KR0A 5CLLB 1FOEA 2GCJA 3ODOA 1P5TA 5HE2A 2CODA 2E2XA 4HB0B 2DKPA 5DIFB 4DBBA 4TKNA 3ODXA 4NSWA 2UZSA 1J19A 2I5CA 4C0AA 3NSUA 4ZRIA 3CXBB 4GPTB 1GG3A 3WA0A 2W2XC 3PG7A 4PNKA 2KIEA 2CY5A 1XODA 1ZYIA 2Q13A 2G35A 1FHWA 3D8EA 5HE1A 3RCPA 3BINA 4F7GA 1FB8A 3CIKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CY4 A;  1GC6 A;  3TO1 A;  2MKR A;  5C5B B;  1RRP B;  3V5W A;  4ZRK A;  3PP2 A;  1WGU A;  4H8S A;  4KHO A;  2ELB A;  3VIA A;  2QKL A;  1BAK A;  2JP2 A;  1FGZ A;  3GYO A;  5LON B;  3M1I B;  2D9Y A;  3AJ4 A;  1QQG A;  3SYX A;  3F0W A;  3P7Z A;  1MK7 B;  2CAY A;  1OQN A;  1AWE A;  2DN6 A;  2IYB A;  4HAT B;  4K2P A;  3U8Z A;  4XWX A;  4EKU A;  3PVL A;  1EVH A;  4PQ0 A;  2AEH A;  4EMO A;  1U5F A;  5HE0 A;  2MWN B;  1TQZ A;  2Y8G A;  5C79 A;  2LYD A;  5C6R A;  1B55 A;  2BCJ A;  2NZ8 B;  1K5D B;  4TYZ A;  1X1F A;  1OMW A;  3DXC A;  1TXD A;  1FGY A;  1ZC3 B;  2KCJ A;  4F7H A;  5J3T A;  2RVB B;  3AU4 A;  2D4Q A;  2K00 A;  2LOX A;  5C5B A;  1PFJ A;  4GXB A;  1DDV A;  4P7I A;  1I7A A;  4KAX B;  2RSG A;  2IFS A;  1V5M A;  1U5D A;  2VSZ A;  2YF0 A;  5J3Y A;  3O96 A;  2YS1 A;  1ZVR A;  1N3H A;  1WVH A;  2RLO A;  2DHI A;  2Z0O A;  5CLQ B;  2UVM A;  1Q67 A;  1WJ1 A;  2H7D A;  4A6F A;  3T06 A;  1ZC4 B;  1MPH A;  2XQN M;  4HDO A;  2YT1 A;  3MDB C;  1PLS A;  3KZ1 A;  1UNQ A;  5DHF B;  1WJM A;  2ADZ A;  4HAV B;  1LW3 A;  2EC1 A;  2YS3 A;  3ML4 A;  4GMV A;  2ZPY A;  3IVF A;  2P0F A;  1MKE A;  4DX9 0;  4CYE A;  1V61 A;  2W2X D;  4B6H A;  1W1H A;  2VRW B;  2I5F A;  1U27 A;  1XCG A;  2P0H A;  4YL8 A;  2DYN A;  4CHJ A;  5KCV A;  3ZDT A;  5C16 A;  2DHK A;  4WSF A;  4HDQ A;  1ZM0 A;  3KY9 A;  4Z2N A;  2MDX A;  5EFX A;  2QKM A;  2Z0P A;  2EMT A;  5D27 A;  2RUK B;  2EJ8 A;  1P6S A;  5D3Y A;  1ISN A;  2J0M A;  2EMS A;  2D9V A;  2D2Q A;  5LOP B;  1P3R A;  3SV1 A;  4IAP A;  1DDM A;  3DXE A;  1Z87 A;  4EJN A;  4HHV A;  1UNR A;  2P0D A;  1UEF A;  2L2I A;  3D8D A;  3TVV A;  1K5G B;  3HK0 A;  5GOW B;  4A6F B;  1W1G A;  3A8Q A;  4MY6 A;  2N0Y A;  4L6E A;  1DYN A;  3QIJ A;  1KZG A;  5FI1 A;  1WI1 A;  1GC7 A;  2FJL A;  1XR0 B;  4MK0 A;  2LOZ A;  1EGX A;  1UPR A;  3U7D A;  5HE3 A;  4HAZ B;  2X18 A;  2DTC A;  1EF1 A;  2D11 A;  1FHX A;  4DX8 A;  3G9W A;  1X86 A;  4BBK A;  3D8F A;  2D10 A;  4IOY X;  2D9X A;  3LJU X;  3SNH A;  2CRF A;  3X23 A;  1Y19 B;  1MAI A;  1BWN A;  1MIZ B;  2H7E A;  2YRY A;  3HQC A;  2ELA A;  3QWM A;  2KGX B;  1AQC A;  4GZU A;  3SO6 A;  1U2B A;  1U5G A;  1U29 A;  1DDW A;  1KI1 B;  4WVF B;  2ROZ B;  2YVC A;  3QBV B;  5JP4 A;  1V88 A;  1I2H A;  2D9W A;  2VKI A;  2RGN B;  1UNP A;  4HB3 B;  3ZVR A;  3DXD A;  5JHG A;  2J59 M;  4K2O A;  2DLW A;  4HB4 B;  2I1K A;  1NTY A;  2ROV A;  5DHA B;  1RJ2 A;  2LKO A;  2LG1 A;  3OAN A;  3WYF B;  1NU2 A;  1ZSQ A;  2LUL A;  3A98 B;  1XX0 A;  1EAZ A;  2R0D A;  4DXA B;  3PVW A;  4Z2M B;  2COA A;  4K81 A;  5JHH A;  5KQ1 A;  3KSY A;  1WG7 A;  3FM8 C;  4HAW B;  3PZD A;  5J3Q A;  2DX5 A;  2N23 A;  4KHB B;  2K2U A;  2RNR B;  2D9Z A;  1BTN A;  4YON A;  2R09 A;  2OTX A;  4CHM A;  1TJ6 A;  3KRW A;  1PMS A;  5D3V A;  5D3W A;  2GCL A;  2M14 A;  3AU5 A;  3BJI A;  2V76 A;  3VOQ A;  2DA0 A;  1V89 A;  3GYP A;  3ODW A;  1J0W A;  4MT7 A;  4GMX B;  2K2J A;  2W2W A;  1H4R A;  4HAY B;  3SUZ A;  3P6A A;  2DX1 A;  5DH9 B;  5KQ4 A;  2J0J A;  3F5R A;  3PSC A;  3ULB A;  3TFM A;  2GS0 A;  1U5E A;  1Y5O A;  3KRX A;  2GJY A;  4NY0 A;  2HTH B;  1FHO A;  1M7E A;  2YT0 A;  3A8P A;  4HAX B;  1FAO A;  1W1D A;  5FI0 A;  2J0K A;  2MFQ A;  2AL6 A;  2HE7 A;  1OY2 A;  1SGH A;  2L1C A;  2UZR A;  4ZRJ A;  1XD4 A;  2NMB A;  2DYQ A;  1MIX A;  2KUP A;  1NI2 A;  4GN1 A;  2OQB A;  1X11 A;  4KVG B;  2PZ1 A;  1SHC A;  3ULC A;  2COC A;  1DRO A;  2YS5 A;  4Y94 A;  1UPQ A;  5D3X A;  4HAU B;  3N7C A;  4F7U P;  3HW2 B;  4IFS A;  3UZT A;  3PVU A;  2I1J A;  2Y7B A;  2DHJ A;  1WGQ A;  3MPX A;  2Z0Q A;  2M38 A;  1E5W A;  3TCA A;  4HB2 B;  3PEG A;  5L81 A;  4A6K A;  1X1G A;  4A6H A;  4K17 A;  1M7R A;  1IRS A;  1DBH A;  1V5U A;  4A5K A;  1MK9 B;  2DKQ A;  1NTV A;  1BTK A;  1QC6 A;  5JLJ B;  1V5P A;  1LB1 A;  1X05 A;  2Y8F A;  2COF A;  4D0N B;  4KHA A;  1XKE A;  2DFK A;  2P8V A;  1H10 A;  4WJ7 A;  5DI9 B;  3TW1 A;  3FEH A;  3FSS A;  2YSZ A;  1KZ7 A;  5CLL B;  1FOE A;  2GCJ A;  3ODO A;  1P5T A;  5HE2 A;  2COD A;  2E2X A;  4HB0 B;  2DKP A;  5DIF B;  4DBB A;  4TKN A;  3ODX A;  4NSW A;  2UZS A;  1J19 A;  2I5C A;  4C0A A;  3NSU A;  4ZRI A;  3CXB B;  4GPT B;  1GG3 A;  3WA0 A;  2W2X C;  3PG7 A;  4PNK A;  2CY5 A;  1XOD A;  2Q13 A;  2G35 A;  1FHW A;  3D8E A;  5HE1 A;  3RCP A;  3BIN A;  4F7G A;  1FB8 A;  3CIK A; 
#chains in the Genus database with same CATH topology
 2CY4 A;  1GC6 A;  4QXA B;  3TO1 A;  5I2S A;  2MKR A;  5C5B B;  1RRP B;  3V5W A;  4ZRK A;  2Z14 A;  3PP2 A;  1WGU A;  4H8S A;  4KHO A;  2ELB A;  3VIA A;  2QKL A;  3NWD A;  3U12 A;  1BAK A;  2JP2 A;  1FGZ A;  2Z4D A;  3GYO A;  5LON B;  3M1I B;  2D9Y A;  3AJ4 A;  1QQG A;  4QJ4 B;  3SYX A;  3F0W A;  3P7Z A;  1MK7 B;  2CAY A;  1OQN A;  4QJ3 B;  1AWE A;  2DN6 A;  2IYB A;  4HAT B;  4K2P A;  3U8Z A;  4XWX A;  4EKU A;  3PVL A;  1EVH A;  4PQ0 A;  2ZKM X;  2AEH A;  4EMO A;  1U5F A;  5HE0 A;  2MWN B;  1TQZ A;  2Y8G A;  5C79 A;  2LYD A;  5C6R A;  1B55 A;  2BCJ A;  2NZ8 B;  1K5D B;  4TYZ A;  1X1F A;  1OMW A;  2Z13 A;  3DXC A;  1TXD A;  1FGY A;  1ZC3 B;  2KCJ A;  4F7H A;  5J3T A;  2RVB B;  3AU4 A;  2D4Q A;  2K49 A;  2K00 A;  2LOX A;  5C5B A;  2RRF A;  1PFJ A;  4GXB A;  1DDV A;  4P7I A;  1I7A A;  4KAX B;  2RSG A;  2IFS A;  1V5M A;  1U5D A;  2VSZ A;  4HSI A;  2YF0 A;  5J3Y A;  2YS1 A;  1ZVR A;  3O96 A;  1N3H A;  1WVH A;  2RLO A;  2DHI A;  1T77 A;  2Z0O A;  5CLQ B;  2UVM A;  1Q67 A;  1WJ1 A;  2H7D A;  2YT2 A;  4A6F A;  3T06 A;  1ZC4 B;  1MPH A;  2XQN M;  4HDO A;  2YT1 A;  3MDB C;  2GUM A;  1PLS A;  3KZ1 A;  1UNQ A;  5DHF B;  1WJM A;  2ADZ A;  4HAV B;  1LW3 A;  2EC1 A;  2YS3 A;  3ML4 A;  4GMV A;  2Z59 A;  2ZPY A;  3IVF A;  2P0F A;  1MKE A;  3B77 A;  4DX9 0;  4CYE A;  1V61 A;  2W2X D;  4B6H A;  1W1H A;  2VRW B;  2I5F A;  1U27 A;  1XCG A;  2P0H A;  4YL8 A;  4QJ5 B;  4GNK B;  2DYN A;  4CHJ A;  5KCV A;  4GOU A;  3ZDT A;  5C16 A;  2DHK A;  4WSF A;  4HDQ A;  1ZM0 A;  3KY9 A;  4Z2N A;  2MDX A;  5EFX A;  2QKM A;  2Z0P A;  2EMT A;  5D27 A;  2RUK B;  2EJ8 A;  1P6S A;  5D3Y A;  1ISN A;  2J0M A;  2EMS A;  2D9V A;  2D2Q A;  5LOP B;  1P3R A;  3SV1 A;  4IAP A;  1DDM A;  3DXE A;  1Z87 A;  4EJN A;  4HHV A;  1UNR A;  2P0D A;  1UEF A;  2L2I A;  3NWF A;  3D8D A;  3TVV A;  1K5G B;  3HK0 A;  5GOW B;  4A6F B;  1W1G A;  3A8Q A;  4MY6 A;  2N0Y A;  4L6E A;  1DYN A;  3QIJ A;  1KZG A;  5FI1 A;  1WI1 A;  1GC7 A;  2K8E A;  2FJL A;  3HIE A;  1XR0 B;  4MK0 A;  2LOZ A;  5IRS A;  1EGX A;  1UPR A;  3U7D A;  5HE3 A;  4HAZ B;  2X18 A;  2DTC A;  1EF1 A;  2D11 A;  4KHB A;  1FHX A;  3HSA A;  4DX8 A;  3G9W A;  1X86 A;  3A58 A;  4BBK A;  3D8F A;  2D10 A;  4IOY X;  2D9X A;  3LJU X;  3SNH A;  2CRF A;  3X23 A;  1Y19 B;  1MAI A;  1BWN A;  1MIZ B;  2H7E A;  4DIX A;  4OSN A;  2YRY A;  3HQC A;  2ELA A;  3QWM A;  2KGX B;  1AQC A;  4GZU A;  3SO6 A;  1U2B A;  3FVC A;  1U5G A;  1U29 A;  1DDW A;  1KI1 B;  4WVF B;  2ROZ B;  2YVC A;  3QBV B;  5JP4 A;  1V88 A;  1I2H A;  2D9W A;  2VKI A;  2RGN B;  1UNP A;  4HB3 B;  3ZVR A;  3DXD A;  5JHG A;  2J59 M;  4K2O A;  2DLW A;  4HB4 B;  2I1K A;  1NTY A;  2ROV A;  5DHA B;  1RJ2 A;  2LKO A;  2LG1 A;  3OAN A;  3WYF B;  1NU2 A;  1ZSQ A;  2LUL A;  3A98 B;  1XX0 A;  1EAZ A;  2R0D A;  4DXA B;  3PVW A;  4Z2M B;  2COA A;  4K81 A;  5JHH A;  5KQ1 A;  3KSY A;  1WG7 A;  3FM8 C;  4HAW B;  3PZD A;  5J3Q A;  2DX5 A;  2N23 A;  4KHB B;  2K2U A;  2RNR B;  2D9Z A;  1BTN A;  1MI1 A;  3OHM B;  4YON A;  2R09 A;  4D6W A;  2OTX A;  4CHM A;  1TJ6 A;  3KRW A;  1PMS A;  5D3V A;  5D3W A;  2GCL A;  2M14 A;  3AU5 A;  3BJI A;  2V76 A;  3VOQ A;  2DA0 A;  1V89 A;  3NWA A;  3GYP A;  2R2Y A;  3ODW A;  1J0W A;  4MT7 A;  4GMX B;  2K2J A;  2W2W A;  1H4R A;  4HAY B;  3SUZ A;  3P6A A;  2DX1 A;  5DH9 B;  5KQ4 A;  2J0J A;  3F5R A;  3PSC A;  3ULB A;  3TFM A;  2GS0 A;  1U5E A;  5I2M A;  5LG4 B;  1Y5O A;  3KRX A;  2GJY A;  4NY0 A;  2HTH B;  1FHO A;  1M7E A;  2YT0 A;  3A8P A;  2NBV A;  4HAX B;  1FAO A;  1W1D A;  5FI0 A;  2J0K A;  2MFQ A;  2AL6 A;  2HE7 A;  1OY2 A;  1SGH A;  2L1C A;  2UZR A;  4ZRJ A;  1XD4 A;  2NMB A;  2DYQ A;  1MIX A;  2KUP A;  1NI2 A;  4GN1 A;  2OQB A;  1X11 A;  4KVG B;  2PZ1 A;  1SHC A;  3ULC A;  2COC A;  4CSQ A;  2YS5 A;  1DRO A;  4Y94 A;  1UPQ A;  2KUQ A;  5D3X A;  4HAU B;  3N7C A;  4F7U P;  3NW8 A;  3HW2 B;  2FJU B;  4IFS A;  3UZT A;  3PVU A;  2I1J A;  2Y7B A;  2DHJ A;  1WGQ A;  2KIG A;  3MPX A;  2Z0Q A;  2M38 A;  1E5W A;  3TCA A;  4HB2 B;  3PEG A;  5L81 A;  4A6K A;  4OT1 A;  1X1G A;  4A6H A;  4K17 A;  1M7R A;  1IRS A;  1DBH A;  1V5U A;  4A5K A;  1MK9 B;  4L1R A;  2DKQ A;  1NTV A;  1BTK A;  1QC6 A;  5JLJ B;  1V5P A;  1LB1 A;  1X05 A;  2Y8F A;  2COF A;  4D0N B;  4KHA A;  1XKE A;  2DFK A;  2P8V A;  1H10 A;  4WJ7 A;  5DI9 B;  3TW1 A;  3FEH A;  3FSS A;  2YSZ A;  5M4Y B;  1KZ7 A;  2KR0 A;  5CLL B;  1FOE A;  2GCJ A;  3ODO A;  1P5T A;  5HE2 A;  2COD A;  2E2X A;  4HB0 B;  2DKP A;  5DIF B;  4DBB A;  4TKN A;  3ODX A;  4NSW A;  2UZS A;  1J19 A;  2I5C A;  4C0A A;  3NSU A;  4ZRI A;  3CXB B;  4GPT B;  1GG3 A;  3WA0 A;  2W2X C;  3PG7 A;  4PNK A;  2KIE A;  2CY5 A;  1XOD A;  1ZYI A;  2Q13 A;  2G35 A;  3DCX A;  1FHW A;  3D8E A;  5HE1 A;  3RCP A;  3BIN A;  4F7G A;  1FB8 A;  3CIK A; 
#chains in the Genus database with same CATH homology
 2CY4 A;  1GC6 A;  4QXA B;  3TO1 A;  5I2S A;  2MKR A;  5C5B B;  1RRP B;  3V5W A;  4ZRK A;  2Z14 A;  3PP2 A;  1WGU A;  4H8S A;  4KHO A;  2ELB A;  3VIA A;  2QKL A;  3NWD A;  1BAK A;  3U12 A;  2JP2 A;  1FGZ A;  2Z4D A;  3GYO A;  5LON B;  3M1I B;  2D9Y A;  3AJ4 A;  1QQG A;  4QJ4 B;  3SYX A;  3F0W A;  3P7Z A;  1MK7 B;  2CAY A;  1OQN A;  4QJ3 B;  1AWE A;  2DN6 A;  2IYB A;  4HAT B;  4K2P A;  3U8Z A;  4XWX A;  4EKU A;  3PVL A;  1EVH A;  4PQ0 A;  2ZKM X;  2AEH A;  4EMO A;  1U5F A;  5HE0 A;  2MWN B;  1TQZ A;  2Y8G A;  5C79 A;  2LYD A;  5C6R A;  1B55 A;  2BCJ A;  2NZ8 B;  1K5D B;  4TYZ A;  1X1F A;  1OMW A;  2Z13 A;  3DXC A;  1TXD A;  1FGY A;  1ZC3 B;  2KCJ A;  4F7H A;  5J3T A;  2RVB B;  3AU4 A;  2D4Q A;  2K49 A;  2K00 A;  2LOX A;  5C5B A;  2RRF A;  1PFJ A;  4GXB A;  1DDV A;  4P7I A;  1I7A A;  4KAX B;  2RSG A;  2IFS A;  1V5M A;  1U5D A;  2VSZ A;  4HSI A;  2YF0 A;  5J3Y A;  3O96 A;  2YS1 A;  1ZVR A;  1N3H A;  1WVH A;  2RLO A;  2DHI A;  2Z0O A;  5CLQ B;  2UVM A;  1Q67 A;  1WJ1 A;  2H7D A;  2YT2 A;  4A6F A;  3T06 A;  1ZC4 B;  1MPH A;  2XQN M;  4HDO A;  2YT1 A;  3MDB C;  2GUM A;  1PLS A;  3KZ1 A;  1UNQ A;  5DHF B;  1WJM A;  2ADZ A;  4HAV B;  1LW3 A;  2EC1 A;  2YS3 A;  3ML4 A;  4GMV A;  2Z59 A;  2ZPY A;  3IVF A;  2P0F A;  1MKE A;  4DX9 0;  4CYE A;  1V61 A;  2W2X D;  4B6H A;  1W1H A;  2VRW B;  2I5F A;  1U27 A;  1XCG A;  2P0H A;  4YL8 A;  4QJ5 B;  4GNK B;  2DYN A;  4CHJ A;  5KCV A;  4GOU A;  3ZDT A;  5C16 A;  2DHK A;  4WSF A;  4HDQ A;  1ZM0 A;  3KY9 A;  4Z2N A;  2MDX A;  5EFX A;  2QKM A;  2Z0P A;  2EMT A;  5D27 A;  2RUK B;  2EJ8 A;  1P6S A;  5D3Y A;  1ISN A;  2J0M A;  2EMS A;  2D9V A;  2D2Q A;  5LOP B;  1P3R A;  3SV1 A;  4IAP A;  1DDM A;  3DXE A;  1Z87 A;  4EJN A;  4HHV A;  1UNR A;  2P0D A;  1UEF A;  2L2I A;  3NWF A;  3D8D A;  3TVV A;  1K5G B;  3HK0 A;  5GOW B;  4A6F B;  1W1G A;  3A8Q A;  4MY6 A;  2N0Y A;  4L6E A;  1DYN A;  3QIJ A;  1KZG A;  5FI1 A;  1WI1 A;  1GC7 A;  2K8E A;  2FJL A;  3HIE A;  1XR0 B;  4MK0 A;  2LOZ A;  5IRS A;  1EGX A;  1UPR A;  3U7D A;  5HE3 A;  4HAZ B;  2X18 A;  2DTC A;  1EF1 A;  2D11 A;  4KHB A;  1FHX A;  4DX8 A;  3G9W A;  1X86 A;  3A58 A;  4BBK A;  3D8F A;  2D10 A;  4IOY X;  2D9X A;  3LJU X;  3SNH A;  2CRF A;  3X23 A;  1Y19 B;  1MAI A;  1BWN A;  1MIZ B;  2H7E A;  4DIX A;  4OSN A;  2YRY A;  3HQC A;  2ELA A;  3QWM A;  2KGX B;  1AQC A;  4GZU A;  3SO6 A;  1U2B A;  3FVC A;  1U5G A;  1U29 A;  1DDW A;  1KI1 B;  4WVF B;  2ROZ B;  2YVC A;  3QBV B;  5JP4 A;  1V88 A;  1I2H A;  2D9W A;  2VKI A;  2RGN B;  1UNP A;  4HB3 B;  3ZVR A;  3DXD A;  5JHG A;  2J59 M;  4K2O A;  2DLW A;  4HB4 B;  2I1K A;  1NTY A;  2ROV A;  5DHA B;  1RJ2 A;  2LKO A;  2LG1 A;  3OAN A;  3WYF B;  1NU2 A;  1ZSQ A;  2LUL A;  3A98 B;  1XX0 A;  1EAZ A;  2R0D A;  4DXA B;  3PVW A;  4Z2M B;  2COA A;  4K81 A;  5JHH A;  5KQ1 A;  3KSY A;  1WG7 A;  3FM8 C;  4HAW B;  3PZD A;  5J3Q A;  2DX5 A;  2N23 A;  4KHB B;  2K2U A;  2RNR B;  2D9Z A;  1BTN A;  3OHM B;  4YON A;  2R09 A;  4D6W A;  2OTX A;  4CHM A;  1TJ6 A;  3KRW A;  1PMS A;  5D3V A;  5D3W A;  2GCL A;  2M14 A;  3AU5 A;  3BJI A;  2V76 A;  3VOQ A;  2DA0 A;  1V89 A;  3NWA A;  3GYP A;  2R2Y A;  3ODW A;  1J0W A;  4MT7 A;  4GMX B;  2K2J A;  2W2W A;  1H4R A;  4HAY B;  3SUZ A;  3P6A A;  2DX1 A;  5DH9 B;  5KQ4 A;  2J0J A;  3F5R A;  3PSC A;  3ULB A;  3TFM A;  2GS0 A;  1U5E A;  5I2M A;  5LG4 B;  1Y5O A;  3KRX A;  2GJY A;  4NY0 A;  2HTH B;  1FHO A;  1M7E A;  2YT0 A;  3A8P A;  4HAX B;  2NBV A;  1FAO A;  1W1D A;  5FI0 A;  2J0K A;  2MFQ A;  2AL6 A;  2HE7 A;  1OY2 A;  1SGH A;  2L1C A;  2UZR A;  4ZRJ A;  1XD4 A;  2NMB A;  2DYQ A;  1MIX A;  2KUP A;  1NI2 A;  4GN1 A;  2OQB A;  1X11 A;  4KVG B;  2PZ1 A;  1SHC A;  3ULC A;  2COC A;  1DRO A;  2YS5 A;  4CSQ A;  4Y94 A;  1UPQ A;  2KUQ A;  5D3X A;  4HAU B;  3N7C A;  4F7U P;  3NW8 A;  3HW2 B;  2FJU B;  4IFS A;  3UZT A;  3PVU A;  2I1J A;  2Y7B A;  2DHJ A;  1WGQ A;  2KIG A;  3MPX A;  2Z0Q A;  2M38 A;  1E5W A;  3TCA A;  4HB2 B;  3PEG A;  5L81 A;  4A6K A;  4OT1 A;  1X1G A;  4A6H A;  4K17 A;  1M7R A;  1IRS A;  1DBH A;  1V5U A;  4A5K A;  1MK9 B;  4L1R A;  2DKQ A;  1NTV A;  1BTK A;  1QC6 A;  5JLJ B;  1V5P A;  1LB1 A;  1X05 A;  2Y8F A;  2COF A;  4D0N B;  4KHA A;  1XKE A;  2DFK A;  2P8V A;  1H10 A;  4WJ7 A;  5DI9 B;  3TW1 A;  3FEH A;  3FSS A;  2YSZ A;  5M4Y B;  1KZ7 A;  2KR0 A;  5CLL B;  1FOE A;  2GCJ A;  3ODO A;  1P5T A;  5HE2 A;  2COD A;  2E2X A;  4HB0 B;  2DKP A;  5DIF B;  4DBB A;  4TKN A;  3ODX A;  4NSW A;  2UZS A;  1J19 A;  2I5C A;  4C0A A;  3NSU A;  4ZRI A;  3CXB B;  4GPT B;  1GG3 A;  3WA0 A;  2W2X C;  3PG7 A;  4PNK A;  2KIE A;  2CY5 A;  1XOD A;  1ZYI A;  2Q13 A;  2G35 A;  1FHW A;  3D8E A;  5HE1 A;  3RCP A;  3BIN A;  4F7G A;  1FB8 A;  3CIK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...