4KHOA

Structure of the fact complex subunit spt16m
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
290
structure length
268
Chain Sequence
VVEQDKLIEIRRPAVLDNVYIRPALGKRVPGKVEIHQNGIRYQSPLSTTQRVDVLFSNIRHLFFQPCQNEMIVIIHLHLKDPILFGKKKTKDVQFYREAIDEFEAEQEERRRKAELDRLFKSFAEKIAEAGRNEGIEVDMPIRDLGFNGVPNRSNVVIYPTTECLIQITEPPFLVITLEDVEWAHLERVQFGLKNFDLVFVFKDFTRPVVHINTIPVESLEDVKEFLDSSDIPFSEGPLNLNWSVIMKTVTANPHQFFLDGGWGFLQN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural basis of histone H2A-H2B recognition by the essential chaperone FACT.
pubmed doi rcsb
source organism Chaetomium thermophilum var. thermophilum
molecule tags Transcription/replication
molecule keywords Uncharacterized protein Spt16M
total genus 70
structure length 268
sequence length 290
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-04-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08512 Rtt106 Histone chaperone Rttp106-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 4khoA02
2.30.29.150 Mainly Beta Roll PH-domain like PH-domain like 4khoA01
2DFKA 5JHHA 3SUZA 3KRXA 2DA0A 5EFXA 3M1IB 4DX8A 4EMOA 2D4QA 1RRPB 1U5GA 4NSWA 1ZVRA 1BTNA 2CRFA 2YT1A 2EC1A 1XKEA 1Y19B 1UPQA 2UZSA 1NTVA 2NMBA 1U5DA 1EVHA 4H8SA 2H7DA 4EJNA 2AL6A 3UZTA 3D8EA 3V5WA 1OY2A 1WGQA 5HE3A 2VRWB 5D27A 2LG1A 3PG7A 2D2QA 4EKUA 1WJMA 1M7EA 4HAVB 2K2UA 3X23A 1MAIA 2CODA 4GPTB 1B55A 2GCLA 1AWEA 4BBKA 1ZM0A 1GC6A 1V89A 3PEGA 4HAZB 5KQ4A 4GZUA 3VIAA 1FGZA 4MK0A 1XODA 2DLWA 2VSZA 3PP2A 4HB3B 2Z0PA 4A6HA 2I1JA 1W1GA 1WGUA 4HDQA 4ZRIA 2Q13A 1H4RA 1FHWA 4K81A 4GMXB 4HB0B 2RSGA 1U29A 2LKOA 1OQNA 3IVFA 4IOYX 2JP2A 2K2JA 4B6HA 1V5MA 3BINA 3KZ1A 4A6FB 5J3YA 2OTXA 2E2XA 3MDBC 2ADZA 2DYQA 2D9YA 3KY9A 4HATB 2EMSA 1WG7A 2DYNA 1M7RA 1KI1B 4PNKA 1TQZA 3O96A 3PVWA 2ELAA 2P0FA 3T06A 2BCJA 1TJ6A 5FI1A 1ZC4B 3HQCA 5D3XA 3FEHA 3N7CA 2GS0A 3CXBB 1MPHA 2LYDA 2UVMA 4IAPA 3DXEA 1U27A 3DXDA 3SNHA 1NTYA 5FI0A 1OMWA 2D9XA 2RLOA 3HW2B 3CIKA 5KCVA 1DDMA 4A6KA 1MK7B 1J0WA 2ROZB 1V5UA 1DDVA 1BAKA 2DN6A 1ZC3B 1KZGA 2I5FA 1W1DA 2K00A 2HTHB 2P0DA 5HE1A 1QC6A 5DI9B 2AEHA 1NU2A 4YONA 5L81A 3ZVRA 5C16A 2PZ1A 1PFJA 2MWNB 5D3VA 2DHJA 2H7EA 4L6EA 4Z2MB 4GXBA 2D11A 2M14A 3KRWA 1X05A 3TVVA 2Y8FA 3TO1A 4HAXB 1TXDA 2YF0A 3MPXA 1V5PA 1Z87A 3PZDA 2NZ8B 3SYXA 2MKRA 1FGYA 1WVHA 4IFSA 1UEFA 2J0MA 2Y7BA 1EGXA 3A8PA 2Z0QA 4TYZA 2MDXA 4HHVA 4WJ7A 5DIFB 2LOZA 4CYEA 1DYNA 1PLSA 2COCA 1SGHA 1EF1A 2RVBB 1GG3A 2W2XD 1X11A 3DXCA 1BTKA 2COAA 2YT0A 2W2XC 1MIXA 4KHAA 1XR0B 4YL8A 3LJUX 3TFMA 2YS5A 1FB8A 2GJYA 2N23A 1K5DB 2L2IA 3ULCA 2M38A 4K2OA 1FHOA 4MY6A 1SHCA 1MK9B 2DKPA 4K17A 1KZ7A 4D0NB 1I7AA 1WJ1A 2J0KA 2GCJA 5D3YA 2D10A 4ZRJA 3D8DA 2QKLA 1XCGA 3RCPA 1U5FA 3AU5A 4K2PA 5J3TA 3AJ4A 2UZRA 4ZRKA 3P6AA 2FJLA 2KGXB 3D8FA 3HK0A 2J0JA 3ML4A 2EMTA 2P0HA 3KSYA 2OQBA 5D3WA 2X18A 4WVFB 4PQ0A 1ZSQA 1N3HA 3F5RA 2N0YA 3A8QA 4KHOA 1RJ2A 5J3QA 2RGNB 2DX1A 4DXAB 4C0AA 4KVGB 4CHJA 1P5TA 1Q67A 4DX90 1GC7A 4XWXA 2D9WA 2L1CA 1PMSA 1FOEA 1X1FA 3OANA 2G35A 2COFA 3QIJA 3U8ZA 4TKNA 2P8VA 3SV1A 1I2HA 2HE7A 2Y8GA 3BJIA 2CY5A 4WSFA 2D9ZA 4GN1A 5HE0A 3WYFB 3TCAA 1U5EA 2DHKA 5CLQB 2RNRB 1ISNA 3GYPA 2IYBA 2CY4A 3VOQA 1LW3A 1X86A 1EAZA 1DROA 5DHFB 1MKEA 5LONB 1NI2A 1BWNA 3ULBA 1LB1A 2R09A 4GMVA 2MFQA 4HAWB 3PSCA 3P7ZA 2D9VA 5C5BA 1MIZB 2Z0OA 4CHMA 1QQGA 2XQNM 1P6SA 2I5CA 4Y94A 5C5BB 1UNRA 5JHGA 5GOWB 2KCJA 1XD4A 1AQCA 5LOPB 2R0DA 2V76A 5DHAB 3QWMA 1XX0A 4HDOA 2CAYA 5KQ1A 3F0WA 4DBBA 3NSUA 3ZDTA 3GYOA 2YRYA 3TW1A 1V88A 2QKMA 1E5WA 3PVLA 1DBHA 1FAOA 3ODWA 3PVUA 4F7GA 4A5KA 4NY0A 4MT7A 2LULA 1UPRA 5JP4A 2VKIA 1DDWA 2LOXA 4KHBB 4HB2B 4HAUB 4HAYB 2ROVA 1J19A 2DTCA 2EJ8A 3ODOA 3U7DA 2YVCA 3SO6A 2W2WA 4P7IA 2KUPA 2DKQA 2YS1A 2RUKB 2I1KA 1UNPA 2ZPYA 2YS3A 4A6FA 3G9WA 2IFSA 1Y5OA 1H10A 4F7HA 3AU4A 1X1GA 3FM8C 1U2BA 3ODXA 5C79A 3FSSA 5HE2A 1FHXA 2ELBA 5JLJB 1W1HA 2YSZA 3A98B 4HB4B 1K5GB 2DHIA 3QBVB 2DX5A 1V61A 5DH9B 3WA0A 5CLLB 4F7UP 4KAXB 5C6RA 2J59M 1IRSA 4Z2NA 1UNQA 1P3RA 1WI1A
chains in the Genus database with same CATH superfamily
2DFKA 5JHHA 3SUZA 4GNKB 4L1RA 3KRXA 4QXAB 2DA0A 5EFXA 3M1IB 4DX8A 4EMOA 2D4QA 1RRPB 1U5GA 4NSWA 1ZVRA 1BTNA 2CRFA 2YT1A 2EC1A 1XKEA 1Y19B 3NWDA 1UPQA 2UZSA 1NTVA 2NMBA 1U5DA 1EVHA 4H8SA 4GOUA 2H7DA 4EJNA 2AL6A 3UZTA 3D8EA 3NWAA 3V5WA 1OY2A 1WGQA 5HE3A 2VRWB 5D27A 2LG1A 3PG7A 3U12A 2D2QA 4EKUA 1WJMA 1M7EA 4HAVB 2K2UA 3X23A 1MAIA 2CODA 4GPTB 1B55A 2GCLA 1AWEA 4BBKA 1ZM0A 1GC6A 1V89A 3PEGA 4HAZB 5KQ4A 4GZUA 3VIAA 1FGZA 4MK0A 2Z14A 1XODA 2DLWA 2VSZA 3PP2A 4HB3B 2Z0PA 4A6HA 2I1JA 1W1GA 1WGUA 4HDQA 4ZRIA 2Q13A 1H4RA 2RRFA 1FHWA 4K81A 4GMXB 4HB0B 2RSGA 1U29A 2LKOA 1OQNA 3IVFA 4QJ4B 4IOYX 2JP2A 2K2JA 4B6HA 5M4YB 1V5MA 3BINA 3KZ1A 4A6FB 5J3YA 2OTXA 2E2XA 3MDBC 2ADZA 2DYQA 2D9YA 3KY9A 4HATB 2EMSA 1WG7A 2ZKMX 2DYNA 2K49A 1M7RA 1KI1B 3A58A 4PNKA 1TQZA 3B77A 3O96A 3PVWA 2ELAA 2P0FA 3T06A 2BCJA 1TJ6A 5FI1A 1ZC4B 3HQCA 5D3XA 3FEHA 3N7CA 2GS0A 3CXBB 1MPHA 2LYDA 2UVMA 4IAPA 3DXEA 1U27A 3DXDA 3SNHA 1NTYA 5FI0A 1OMWA 2D9XA 2RLOA 3HW2B 3CIKA 5KCVA 1DDMA 4A6KA 1MK7B 1J0WA 2ROZB 1V5UA 1DDVA 1BAKA 2DN6A 1ZC3B 1KZGA 2I5FA 1W1DA 2K00A 2HTHB 2P0DA 5HE1A 1QC6A 5DI9B 2AEHA 1NU2A 4YONA 5I2MA 5L81A 3ZVRA 5C16A 2PZ1A 1PFJA 2MWNB 5D3VA 2DHJA 2H7EA 3FVCA 4L6EA 4QJ5B 4Z2MB 4GXBA 2D11A 2M14A 3KRWA 1X05A 3TVVA 2Y8FA 3TO1A 4HAXB 1TXDA 2YF0A 3MPXA 1V5PA 1Z87A 3PZDA 2NZ8B 3SYXA 2MKRA 1FGYA 1WVHA 4IFSA 1UEFA 2J0MA 2Z4DA 3OHMB 2Z59A 2Y7BA 2R2YA 1EGXA 3A8PA 2Z0QA 4TYZA 2MDXA 4HHVA 4WJ7A 2KUQA 2LOZA 5DIFB 4CYEA 1DYNA 1PLSA 2COCA 1SGHA 1EF1A 2RVBB 1GG3A 2W2XD 1X11A 3DXCA 5LG4B 1BTKA 2COAA 2YT0A 2W2XC 3NW8A 1MIXA 4KHAA 1XR0B 4YL8A 3LJUX 3TFMA 3NWFA 2YS5A 1FB8A 2GJYA 2N23A 3HSAA 1K5DB 2L2IA 3ULCA 2M38A 4K2OA 1FHOA 4MY6A 1SHCA 1MK9B 2DKPA 3DCXA 4K17A 1KZ7A 4D0NB 1I7AA 1WJ1A 2J0KA 2GCJA 5D3YA 2D10A 4ZRJA 3D8DA 2QKLA 2KIEA 2Z13A 1XCGA 3RCPA 1U5FA 3AU5A 4K2PA 5J3TA 3AJ4A 2UZRA 4ZRKA 3P6AA 2FJLA 2KGXB 3D8FA 3HK0A 2J0JA 3ML4A 2EMTA 2P0HA 3KSYA 2OQBA 5D3WA 2X18A 4WVFB 4PQ0A 1ZSQA 2KIGA 4CSQA 1N3HA 1T77A 3F5RA 2N0YA 3A8QA 4KHOA 1RJ2A 5J3QA 2RGNB 2DX1A 4OT1A 4DXAB 4C0AA 4KVGB 4CHJA 1P5TA 1Q67A 4DIXA 4DX90 1GC7A 4XWXA 2D9WA 2L1CA 1PMSA 1FOEA 1X1FA 3OANA 2G35A 2COFA 3QIJA 4QJ3B 3U8ZA 4TKNA 2P8VA 3SV1A 1I2HA 2HE7A 2Y8GA 3BJIA 2CY5A 4WSFA 2D9ZA 4GN1A 5HE0A 3WYFB 3TCAA 1U5EA 2DHKA 5CLQB 2RNRB 1ISNA 2GUMA 5IRSA 3GYPA 2IYBA 2CY4A 3VOQA 1LW3A 1X86A 1EAZA 1DROA 5DHFB 1MKEA 5LONB 1NI2A 1BWNA 3ULBA 1LB1A 2R09A 4GMVA 2MFQA 4HAWB 3PSCA 3P7ZA 2D9VA 4OSNA 5C5BA 1MIZB 2Z0OA 4CHMA 1QQGA 2XQNM 1P6SA 2I5CA 4Y94A 5C5BB 1UNRA 5JHGA 5GOWB 2KCJA 1XD4A 1AQCA 5LOPB 2R0DA 2V76A 5DHAB 3QWMA 1XX0A 4HDOA 2CAYA 4HSIA 5KQ1A 3F0WA 4DBBA 3NSUA 3ZDTA 3GYOA 2YRYA 3TW1A 1V88A 2QKMA 1E5WA 3PVLA 1DBHA 1FAOA 3ODWA 3PVUA 1ZYIA 4KHBA 4F7GA 4A5KA 4NY0A 4MT7A 2LULA 1UPRA 5JP4A 2VKIA 1DDWA 2LOXA 4KHBB 4HB2B 4HAUB 4HAYB 2ROVA 1J19A 2KR0A 2DTCA 2EJ8A 2YT2A 3ODOA 3U7DA 2YVCA 3SO6A 2W2WA 4P7IA 2KUPA 2DKQA 2YS1A 2RUKB 2I1KA 1UNPA 2NBVA 2ZPYA 1MI1A 2YS3A 4A6FA 3G9WA 2IFSA 1Y5OA 1H10A 4F7HA 2FJUB 2K8EA 5I2SA 3AU4A 1X1GA 3FM8C 3HIEA 1U2BA 3ODXA 5C79A 3FSSA 5HE2A 1FHXA 2ELBA 5JLJB 1W1HA 2YSZA 3A98B 4HB4B 1K5GB 2DHIA 3QBVB 2DX5A 1V61A 5DH9B 4D6WA 3WA0A 5CLLB 4F7UP 4KAXB 5C6RA 2J59M 1IRSA 4Z2NA 1UNQA 1P3RA 1WI1A
chains in the Genus database with same CATH topology
2DFKA 5JHHA 3SUZA 4GNKB 4L1RA 3KRXA 4QXAB 2DA0A 5EFXA 3M1IB 4DX8A 4EMOA 2D4QA 1RRPB 1U5GA 4NSWA 1ZVRA 1BTNA 2CRFA 2YT1A 2EC1A 1XKEA 1Y19B 3NWDA 1UPQA 2UZSA 1NTVA 2NMBA 1U5DA 1EVHA 4H8SA 4GOUA 2H7DA 4EJNA 2AL6A 3UZTA 3D8EA 3NWAA 3V5WA 1OY2A 1WGQA 5HE3A 2VRWB 5D27A 2LG1A 3PG7A 3U12A 2D2QA 4EKUA 1WJMA 1M7EA 4HAVB 2K2UA 3X23A 1MAIA 2CODA 4GPTB 1B55A 2GCLA 1AWEA 4BBKA 1ZM0A 1GC6A 1V89A 3PEGA 4HAZB 5KQ4A 4GZUA 3VIAA 1FGZA 4MK0A 2Z14A 1XODA 2DLWA 2VSZA 3PP2A 4HB3B 2Z0PA 4A6HA 2I1JA 1W1GA 1WGUA 4HDQA 4ZRIA 2Q13A 1H4RA 2RRFA 1FHWA 4K81A 4GMXB 4HB0B 2RSGA 1U29A 2LKOA 1OQNA 3IVFA 4QJ4B 4IOYX 2JP2A 2K2JA 4B6HA 5M4YB 1V5MA 3BINA 3KZ1A 4A6FB 5J3YA 2OTXA 2E2XA 3MDBC 2ADZA 2DYQA 2D9YA 3KY9A 4HATB 2EMSA 1WG7A 2ZKMX 2DYNA 2K49A 1M7RA 1KI1B 3A58A 4PNKA 1TQZA 3O96A 3PVWA 2ELAA 2P0FA 3T06A 2BCJA 1TJ6A 5FI1A 1ZC4B 3HQCA 5D3XA 3FEHA 3N7CA 2GS0A 3CXBB 1MPHA 2LYDA 2UVMA 4IAPA 3DXEA 1U27A 3DXDA 3SNHA 1NTYA 5FI0A 1OMWA 2D9XA 2RLOA 3HW2B 3CIKA 5KCVA 1DDMA 4A6KA 1MK7B 1J0WA 2ROZB 1V5UA 1DDVA 1BAKA 2DN6A 1ZC3B 1KZGA 2I5FA 1W1DA 2K00A 2HTHB 2P0DA 5HE1A 1QC6A 5DI9B 2AEHA 1NU2A 4YONA 5I2MA 5L81A 3ZVRA 5C16A 2PZ1A 1PFJA 2MWNB 5D3VA 2DHJA 2H7EA 4L6EA 3FVCA 4QJ5B 4Z2MB 4GXBA 2D11A 2M14A 3KRWA 1X05A 3TVVA 2Y8FA 3TO1A 4HAXB 1TXDA 2YF0A 3MPXA 1V5PA 1Z87A 3PZDA 2NZ8B 3SYXA 2MKRA 1FGYA 1WVHA 4IFSA 1UEFA 2J0MA 2Z4DA 3OHMB 2Z59A 2Y7BA 2R2YA 1EGXA 3A8PA 2Z0QA 4TYZA 2MDXA 4HHVA 4WJ7A 5DIFB 2LOZA 4CYEA 2KUQA 1DYNA 1PLSA 2COCA 1SGHA 1EF1A 2RVBB 1GG3A 2W2XD 1X11A 3DXCA 5LG4B 1BTKA 2COAA 2YT0A 2W2XC 3NW8A 1MIXA 4KHAA 1XR0B 4YL8A 3LJUX 3TFMA 3NWFA 2YS5A 1FB8A 2GJYA 2N23A 1K5DB 2L2IA 3ULCA 2M38A 4K2OA 1FHOA 4MY6A 1SHCA 1MK9B 2DKPA 4K17A 1KZ7A 4D0NB 1I7AA 1WJ1A 2J0KA 2GCJA 5D3YA 2D10A 4ZRJA 3D8DA 2QKLA 2KIEA 2Z13A 1XCGA 3RCPA 1U5FA 3AU5A 4K2PA 5J3TA 3AJ4A 2UZRA 4ZRKA 3P6AA 2FJLA 2KGXB 3D8FA 3HK0A 2J0JA 3ML4A 2EMTA 2P0HA 3KSYA 2OQBA 5D3WA 2X18A 4WVFB 4PQ0A 1ZSQA 2KIGA 4CSQA 1N3HA 3F5RA 2N0YA 3A8QA 4KHOA 1RJ2A 5J3QA 2RGNB 2DX1A 4OT1A 4DXAB 4C0AA 4KVGB 4CHJA 1P5TA 1Q67A 4DIXA 4DX90 1GC7A 4XWXA 2D9WA 2L1CA 1PMSA 1FOEA 1X1FA 3OANA 2G35A 2COFA 3QIJA 4QJ3B 3U8ZA 4TKNA 2P8VA 3SV1A 1I2HA 2HE7A 2Y8GA 3BJIA 2CY5A 4WSFA 2D9ZA 4GN1A 5HE0A 3WYFB 3TCAA 1U5EA 2DHKA 5CLQB 2RNRB 1ISNA 2GUMA 5IRSA 3GYPA 2IYBA 2CY4A 3VOQA 1LW3A 1X86A 1EAZA 1DROA 5DHFB 1MKEA 5LONB 1NI2A 1BWNA 3ULBA 1LB1A 2R09A 4GMVA 2MFQA 4HAWB 3PSCA 3P7ZA 2D9VA 4OSNA 5C5BA 1MIZB 2Z0OA 4CHMA 1QQGA 2XQNM 1P6SA 2I5CA 4Y94A 5C5BB 1UNRA 5JHGA 5GOWB 2KCJA 1XD4A 1AQCA 5LOPB 2R0DA 2V76A 5DHAB 3QWMA 1XX0A 4HDOA 2CAYA 5KQ1A 4HSIA 3F0WA 4DBBA 3NSUA 3ZDTA 3GYOA 2YRYA 3TW1A 1V88A 2QKMA 1E5WA 3PVLA 1DBHA 1FAOA 3ODWA 3PVUA 1ZYIA 4KHBA 4F7GA 4A5KA 4NY0A 4MT7A 2LULA 1UPRA 5JP4A 2VKIA 1DDWA 2LOXA 4KHBB 4HB2B 4HAUB 4HAYB 2ROVA 1J19A 2KR0A 2DTCA 2EJ8A 2YT2A 3ODOA 3U7DA 2YVCA 3SO6A 2W2WA 4P7IA 2KUPA 2DKQA 2YS1A 2RUKB 2I1KA 1UNPA 2ZPYA 2NBVA 2YS3A 4A6FA 3G9WA 2IFSA 1Y5OA 1H10A 4F7HA 2FJUB 2K8EA 5I2SA 3AU4A 1X1GA 3FM8C 3HIEA 1U2BA 3ODXA 5C79A 3FSSA 5HE2A 1FHXA 2ELBA 5JLJB 1W1HA 2YSZA 3A98B 4HB4B 1K5GB 2DHIA 3QBVB 2DX5A 1V61A 5DH9B 4D6WA 3WA0A 5CLLB 4F7UP 4KAXB 5C6RA 2J59M 1IRSA 4Z2NA 1UNQA 1P3RA 1WI1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DFK A;  5JHH A;  3SUZ A;  3KRX A;  2DA0 A;  5EFX A;  3M1I B;  4DX8 A;  4EMO A;  2D4Q A;  1RRP B;  1U5G A;  4NSW A;  1ZVR A;  1BTN A;  2CRF A;  2YT1 A;  2EC1 A;  1XKE A;  1Y19 B;  1UPQ A;  2UZS A;  1NTV A;  2NMB A;  1U5D A;  1EVH A;  4H8S A;  2H7D A;  4EJN A;  2AL6 A;  3UZT A;  3D8E A;  3V5W A;  1OY2 A;  1WGQ A;  5HE3 A;  2VRW B;  5D27 A;  2LG1 A;  3PG7 A;  2D2Q A;  4EKU A;  1WJM A;  1M7E A;  4HAV B;  2K2U A;  3X23 A;  1MAI A;  2COD A;  4GPT B;  1B55 A;  2GCL A;  1AWE A;  4BBK A;  1ZM0 A;  1GC6 A;  1V89 A;  3PEG A;  4HAZ B;  5KQ4 A;  4GZU A;  3VIA A;  1FGZ A;  4MK0 A;  1XOD A;  2DLW A;  2VSZ A;  3PP2 A;  4HB3 B;  2Z0P A;  4A6H A;  2I1J A;  1W1G A;  1WGU A;  4HDQ A;  4ZRI A;  2Q13 A;  1H4R A;  1FHW A;  4K81 A;  4GMX B;  4HB0 B;  2RSG A;  1U29 A;  2LKO A;  1OQN A;  3IVF A;  4IOY X;  2JP2 A;  2K2J A;  4B6H A;  1V5M A;  3BIN A;  3KZ1 A;  4A6F B;  5J3Y A;  2OTX A;  2E2X A;  3MDB C;  2ADZ A;  2DYQ A;  2D9Y A;  3KY9 A;  4HAT B;  2EMS A;  1WG7 A;  2DYN A;  1M7R A;  1KI1 B;  4PNK A;  1TQZ A;  3O96 A;  3PVW A;  2ELA A;  2P0F A;  3T06 A;  2BCJ A;  1TJ6 A;  5FI1 A;  1ZC4 B;  3HQC A;  5D3X A;  3FEH A;  3N7C A;  2GS0 A;  3CXB B;  1MPH A;  2LYD A;  2UVM A;  4IAP A;  3DXE A;  1U27 A;  3DXD A;  3SNH A;  1NTY A;  5FI0 A;  1OMW A;  2D9X A;  2RLO A;  3HW2 B;  3CIK A;  5KCV A;  1DDM A;  4A6K A;  1MK7 B;  1J0W A;  2ROZ B;  1V5U A;  1DDV A;  1BAK A;  2DN6 A;  1ZC3 B;  1KZG A;  2I5F A;  1W1D A;  2K00 A;  2HTH B;  2P0D A;  5HE1 A;  1QC6 A;  5DI9 B;  2AEH A;  1NU2 A;  4YON A;  5L81 A;  3ZVR A;  5C16 A;  2PZ1 A;  1PFJ A;  2MWN B;  5D3V A;  2DHJ A;  2H7E A;  4L6E A;  4Z2M B;  4GXB A;  2D11 A;  2M14 A;  3KRW A;  1X05 A;  3TVV A;  2Y8F A;  3TO1 A;  4HAX B;  1TXD A;  2YF0 A;  3MPX A;  1V5P A;  1Z87 A;  3PZD A;  2NZ8 B;  3SYX A;  2MKR A;  1FGY A;  1WVH A;  4IFS A;  1UEF A;  2J0M A;  2Y7B A;  1EGX A;  3A8P A;  2Z0Q A;  4TYZ A;  2MDX A;  4HHV A;  4WJ7 A;  5DIF B;  2LOZ A;  4CYE A;  1DYN A;  1PLS A;  2COC A;  1SGH A;  1EF1 A;  2RVB B;  1GG3 A;  2W2X D;  1X11 A;  3DXC A;  1BTK A;  2COA A;  2YT0 A;  2W2X C;  1MIX A;  4KHA A;  1XR0 B;  4YL8 A;  3LJU X;  3TFM A;  2YS5 A;  1FB8 A;  2GJY A;  2N23 A;  1K5D B;  2L2I A;  3ULC A;  2M38 A;  4K2O A;  1FHO A;  4MY6 A;  1SHC A;  1MK9 B;  2DKP A;  4K17 A;  1KZ7 A;  4D0N B;  1I7A A;  1WJ1 A;  2J0K A;  2GCJ A;  5D3Y A;  2D10 A;  4ZRJ A;  3D8D A;  2QKL A;  1XCG A;  3RCP A;  1U5F A;  3AU5 A;  4K2P A;  5J3T A;  3AJ4 A;  2UZR A;  4ZRK A;  3P6A A;  2FJL A;  2KGX B;  3D8F A;  3HK0 A;  2J0J A;  3ML4 A;  2EMT A;  2P0H A;  3KSY A;  2OQB A;  5D3W A;  2X18 A;  4WVF B;  4PQ0 A;  1ZSQ A;  1N3H A;  3F5R A;  2N0Y A;  3A8Q A;  4KHO A;  1RJ2 A;  5J3Q A;  2RGN B;  2DX1 A;  4DXA B;  4C0A A;  4KVG B;  4CHJ A;  1P5T A;  1Q67 A;  4DX9 0;  1GC7 A;  4XWX A;  2D9W A;  2L1C A;  1PMS A;  1FOE A;  1X1F A;  3OAN A;  2G35 A;  2COF A;  3QIJ A;  3U8Z A;  4TKN A;  2P8V A;  3SV1 A;  1I2H A;  2HE7 A;  2Y8G A;  3BJI A;  2CY5 A;  4WSF A;  2D9Z A;  4GN1 A;  5HE0 A;  3WYF B;  3TCA A;  1U5E A;  2DHK A;  5CLQ B;  2RNR B;  1ISN A;  3GYP A;  2IYB A;  2CY4 A;  3VOQ A;  1LW3 A;  1X86 A;  1EAZ A;  1DRO A;  5DHF B;  1MKE A;  5LON B;  1NI2 A;  1BWN A;  3ULB A;  1LB1 A;  2R09 A;  4GMV A;  2MFQ A;  4HAW B;  3PSC A;  3P7Z A;  2D9V A;  5C5B A;  1MIZ B;  2Z0O A;  4CHM A;  1QQG A;  2XQN M;  1P6S A;  2I5C A;  4Y94 A;  5C5B B;  1UNR A;  5JHG A;  5GOW B;  2KCJ A;  1XD4 A;  1AQC A;  5LOP B;  2R0D A;  2V76 A;  5DHA B;  3QWM A;  1XX0 A;  4HDO A;  2CAY A;  5KQ1 A;  3F0W A;  4DBB A;  3NSU A;  3ZDT A;  3GYO A;  2YRY A;  3TW1 A;  1V88 A;  2QKM A;  1E5W A;  3PVL A;  1DBH A;  1FAO A;  3ODW A;  3PVU A;  4F7G A;  4A5K A;  4NY0 A;  4MT7 A;  2LUL A;  1UPR A;  5JP4 A;  2VKI A;  1DDW A;  2LOX A;  4KHB B;  4HB2 B;  4HAU B;  4HAY B;  2ROV A;  1J19 A;  2DTC A;  2EJ8 A;  3ODO A;  3U7D A;  2YVC A;  3SO6 A;  2W2W A;  4P7I A;  2KUP A;  2DKQ A;  2YS1 A;  2RUK B;  2I1K A;  1UNP A;  2ZPY A;  2YS3 A;  4A6F A;  3G9W A;  2IFS A;  1Y5O A;  1H10 A;  4F7H A;  3AU4 A;  1X1G A;  3FM8 C;  1U2B A;  3ODX A;  5C79 A;  3FSS A;  5HE2 A;  1FHX A;  2ELB A;  5JLJ B;  1W1H A;  2YSZ A;  3A98 B;  4HB4 B;  1K5G B;  2DHI A;  3QBV B;  2DX5 A;  1V61 A;  5DH9 B;  3WA0 A;  5CLL B;  4F7U P;  4KAX B;  5C6R A;  2J59 M;  1IRS A;  4Z2N A;  1UNQ A;  1P3R A;  1WI1 A; 
#chains in the Genus database with same CATH topology
 2DFK A;  5JHH A;  3SUZ A;  4GNK B;  4L1R A;  3KRX A;  4QXA B;  2DA0 A;  5EFX A;  3M1I B;  4DX8 A;  4EMO A;  2D4Q A;  1RRP B;  1U5G A;  4NSW A;  1ZVR A;  1BTN A;  2CRF A;  2YT1 A;  2EC1 A;  1XKE A;  1Y19 B;  3NWD A;  1UPQ A;  2UZS A;  1NTV A;  2NMB A;  1U5D A;  1EVH A;  4H8S A;  4GOU A;  2H7D A;  4EJN A;  2AL6 A;  3UZT A;  3D8E A;  3NWA A;  3V5W A;  1OY2 A;  1WGQ A;  5HE3 A;  2VRW B;  5D27 A;  2LG1 A;  3PG7 A;  3U12 A;  2D2Q A;  4EKU A;  1WJM A;  1M7E A;  4HAV B;  2K2U A;  3X23 A;  1MAI A;  2COD A;  4GPT B;  1B55 A;  2GCL A;  1AWE A;  4BBK A;  1ZM0 A;  1GC6 A;  1V89 A;  3PEG A;  4HAZ B;  5KQ4 A;  4GZU A;  3VIA A;  1FGZ A;  4MK0 A;  2Z14 A;  1XOD A;  2DLW A;  2VSZ A;  3PP2 A;  4HB3 B;  2Z0P A;  4A6H A;  2I1J A;  1W1G A;  1WGU A;  4HDQ A;  4ZRI A;  2Q13 A;  1H4R A;  2RRF A;  1FHW A;  4K81 A;  4GMX B;  4HB0 B;  2RSG A;  1U29 A;  2LKO A;  1OQN A;  3IVF A;  4QJ4 B;  4IOY X;  2JP2 A;  2K2J A;  4B6H A;  5M4Y B;  1V5M A;  3BIN A;  3KZ1 A;  4A6F B;  5J3Y A;  2OTX A;  2E2X A;  3MDB C;  2ADZ A;  2DYQ A;  2D9Y A;  3KY9 A;  4HAT B;  2EMS A;  1WG7 A;  2ZKM X;  2DYN A;  2K49 A;  1M7R A;  1KI1 B;  3A58 A;  4PNK A;  1TQZ A;  3B77 A;  3O96 A;  3PVW A;  2ELA A;  2P0F A;  3T06 A;  2BCJ A;  1TJ6 A;  5FI1 A;  1ZC4 B;  3HQC A;  5D3X A;  3FEH A;  3N7C A;  2GS0 A;  3CXB B;  1MPH A;  2LYD A;  2UVM A;  4IAP A;  3DXE A;  1U27 A;  3DXD A;  3SNH A;  1NTY A;  5FI0 A;  1OMW A;  2D9X A;  2RLO A;  3HW2 B;  3CIK A;  5KCV A;  1DDM A;  4A6K A;  1MK7 B;  1J0W A;  2ROZ B;  1V5U A;  1DDV A;  1BAK A;  2DN6 A;  1ZC3 B;  1KZG A;  2I5F A;  1W1D A;  2K00 A;  2HTH B;  2P0D A;  5HE1 A;  1QC6 A;  5DI9 B;  2AEH A;  1NU2 A;  4YON A;  5I2M A;  5L81 A;  3ZVR A;  5C16 A;  2PZ1 A;  1PFJ A;  2MWN B;  5D3V A;  2DHJ A;  2H7E A;  3FVC A;  4L6E A;  4QJ5 B;  4Z2M B;  4GXB A;  2D11 A;  2M14 A;  3KRW A;  1X05 A;  3TVV A;  2Y8F A;  3TO1 A;  4HAX B;  1TXD A;  2YF0 A;  3MPX A;  1V5P A;  1Z87 A;  3PZD A;  2NZ8 B;  3SYX A;  2MKR A;  1FGY A;  1WVH A;  4IFS A;  1UEF A;  2J0M A;  2Z4D A;  3OHM B;  2Z59 A;  2Y7B A;  2R2Y A;  1EGX A;  3A8P A;  2Z0Q A;  4TYZ A;  2MDX A;  4HHV A;  4WJ7 A;  2KUQ A;  2LOZ A;  5DIF B;  4CYE A;  1DYN A;  1PLS A;  2COC A;  1SGH A;  1EF1 A;  2RVB B;  1GG3 A;  2W2X D;  1X11 A;  3DXC A;  5LG4 B;  1BTK A;  2COA A;  2YT0 A;  2W2X C;  3NW8 A;  1MIX A;  4KHA A;  1XR0 B;  4YL8 A;  3LJU X;  3TFM A;  3NWF A;  2YS5 A;  1FB8 A;  2GJY A;  2N23 A;  3HSA A;  1K5D B;  2L2I A;  3ULC A;  2M38 A;  4K2O A;  1FHO A;  4MY6 A;  1SHC A;  1MK9 B;  2DKP A;  3DCX A;  4K17 A;  1KZ7 A;  4D0N B;  1I7A A;  1WJ1 A;  2J0K A;  2GCJ A;  5D3Y A;  2D10 A;  4ZRJ A;  3D8D A;  2QKL A;  2KIE A;  2Z13 A;  1XCG A;  3RCP A;  1U5F A;  3AU5 A;  4K2P A;  5J3T A;  3AJ4 A;  2UZR A;  4ZRK A;  3P6A A;  2FJL A;  2KGX B;  3D8F A;  3HK0 A;  2J0J A;  3ML4 A;  2EMT A;  2P0H A;  3KSY A;  2OQB A;  5D3W A;  2X18 A;  4WVF B;  4PQ0 A;  1ZSQ A;  2KIG A;  4CSQ A;  1N3H A;  1T77 A;  3F5R A;  2N0Y A;  3A8Q A;  4KHO A;  1RJ2 A;  5J3Q A;  2RGN B;  2DX1 A;  4OT1 A;  4DXA B;  4C0A A;  4KVG B;  4CHJ A;  1P5T A;  1Q67 A;  4DIX A;  4DX9 0;  1GC7 A;  4XWX A;  2D9W A;  2L1C A;  1PMS A;  1FOE A;  1X1F A;  3OAN A;  2G35 A;  2COF A;  3QIJ A;  4QJ3 B;  3U8Z A;  4TKN A;  2P8V A;  3SV1 A;  1I2H A;  2HE7 A;  2Y8G A;  3BJI A;  2CY5 A;  4WSF A;  2D9Z A;  4GN1 A;  5HE0 A;  3WYF B;  3TCA A;  1U5E A;  2DHK A;  5CLQ B;  2RNR B;  1ISN A;  2GUM A;  5IRS A;  3GYP A;  2IYB A;  2CY4 A;  3VOQ A;  1LW3 A;  1X86 A;  1EAZ A;  1DRO A;  5DHF B;  1MKE A;  5LON B;  1NI2 A;  1BWN A;  3ULB A;  1LB1 A;  2R09 A;  4GMV A;  2MFQ A;  4HAW B;  3PSC A;  3P7Z A;  2D9V A;  4OSN A;  5C5B A;  1MIZ B;  2Z0O A;  4CHM A;  1QQG A;  2XQN M;  1P6S A;  2I5C A;  4Y94 A;  5C5B B;  1UNR A;  5JHG A;  5GOW B;  2KCJ A;  1XD4 A;  1AQC A;  5LOP B;  2R0D A;  2V76 A;  5DHA B;  3QWM A;  1XX0 A;  4HDO A;  2CAY A;  4HSI A;  5KQ1 A;  3F0W A;  4DBB A;  3NSU A;  3ZDT A;  3GYO A;  2YRY A;  3TW1 A;  1V88 A;  2QKM A;  1E5W A;  3PVL A;  1DBH A;  1FAO A;  3ODW A;  3PVU A;  1ZYI A;  4KHB A;  4F7G A;  4A5K A;  4NY0 A;  4MT7 A;  2LUL A;  1UPR A;  5JP4 A;  2VKI A;  1DDW A;  2LOX A;  4KHB B;  4HB2 B;  4HAU B;  4HAY B;  2ROV A;  1J19 A;  2KR0 A;  2DTC A;  2EJ8 A;  2YT2 A;  3ODO A;  3U7D A;  2YVC A;  3SO6 A;  2W2W A;  4P7I A;  2KUP A;  2DKQ A;  2YS1 A;  2RUK B;  2I1K A;  1UNP A;  2NBV A;  2ZPY A;  1MI1 A;  2YS3 A;  4A6F A;  3G9W A;  2IFS A;  1Y5O A;  1H10 A;  4F7H A;  2FJU B;  2K8E A;  5I2S A;  3AU4 A;  1X1G A;  3FM8 C;  3HIE A;  1U2B A;  3ODX A;  5C79 A;  3FSS A;  5HE2 A;  1FHX A;  2ELB A;  5JLJ B;  1W1H A;  2YSZ A;  3A98 B;  4HB4 B;  1K5G B;  2DHI A;  3QBV B;  2DX5 A;  1V61 A;  5DH9 B;  4D6W A;  3WA0 A;  5CLL B;  4F7U P;  4KAX B;  5C6R A;  2J59 M;  1IRS A;  4Z2N A;  1UNQ A;  1P3R A;  1WI1 A; 
#chains in the Genus database with same CATH homology
 2DFK A;  5JHH A;  3SUZ A;  4GNK B;  4L1R A;  3KRX A;  4QXA B;  2DA0 A;  5EFX A;  3M1I B;  4DX8 A;  4EMO A;  2D4Q A;  1RRP B;  1U5G A;  4NSW A;  1ZVR A;  1BTN A;  2CRF A;  2YT1 A;  2EC1 A;  1XKE A;  1Y19 B;  3NWD A;  1UPQ A;  2UZS A;  1NTV A;  2NMB A;  1U5D A;  1EVH A;  4H8S A;  4GOU A;  2H7D A;  4EJN A;  2AL6 A;  3UZT A;  3D8E A;  3NWA A;  3V5W A;  1OY2 A;  1WGQ A;  5HE3 A;  2VRW B;  5D27 A;  2LG1 A;  3PG7 A;  3U12 A;  2D2Q A;  4EKU A;  1WJM A;  1M7E A;  4HAV B;  2K2U A;  3X23 A;  1MAI A;  2COD A;  4GPT B;  1B55 A;  2GCL A;  1AWE A;  4BBK A;  1ZM0 A;  1GC6 A;  1V89 A;  3PEG A;  4HAZ B;  5KQ4 A;  4GZU A;  3VIA A;  1FGZ A;  4MK0 A;  2Z14 A;  1XOD A;  2DLW A;  2VSZ A;  3PP2 A;  4HB3 B;  2Z0P A;  4A6H A;  2I1J A;  1W1G A;  1WGU A;  4HDQ A;  4ZRI A;  2Q13 A;  1H4R A;  2RRF A;  1FHW A;  4K81 A;  4GMX B;  4HB0 B;  2RSG A;  1U29 A;  2LKO A;  1OQN A;  3IVF A;  4QJ4 B;  4IOY X;  2JP2 A;  2K2J A;  4B6H A;  5M4Y B;  1V5M A;  3BIN A;  3KZ1 A;  4A6F B;  5J3Y A;  2OTX A;  2E2X A;  3MDB C;  2ADZ A;  2DYQ A;  2D9Y A;  3KY9 A;  4HAT B;  2EMS A;  1WG7 A;  2ZKM X;  2DYN A;  2K49 A;  1M7R A;  1KI1 B;  3A58 A;  4PNK A;  1TQZ A;  3O96 A;  3PVW A;  2ELA A;  2P0F A;  3T06 A;  2BCJ A;  1TJ6 A;  5FI1 A;  1ZC4 B;  3HQC A;  5D3X A;  3FEH A;  3N7C A;  2GS0 A;  3CXB B;  1MPH A;  2LYD A;  2UVM A;  4IAP A;  3DXE A;  1U27 A;  3DXD A;  3SNH A;  1NTY A;  5FI0 A;  1OMW A;  2D9X A;  2RLO A;  3HW2 B;  3CIK A;  5KCV A;  1DDM A;  4A6K A;  1MK7 B;  1J0W A;  2ROZ B;  1V5U A;  1DDV A;  1BAK A;  2DN6 A;  1ZC3 B;  1KZG A;  2I5F A;  1W1D A;  2K00 A;  2HTH B;  2P0D A;  5HE1 A;  1QC6 A;  5DI9 B;  2AEH A;  1NU2 A;  4YON A;  5I2M A;  5L81 A;  3ZVR A;  5C16 A;  2PZ1 A;  1PFJ A;  2MWN B;  5D3V A;  2DHJ A;  2H7E A;  4L6E A;  3FVC A;  4QJ5 B;  4Z2M B;  4GXB A;  2D11 A;  2M14 A;  3KRW A;  1X05 A;  3TVV A;  2Y8F A;  3TO1 A;  4HAX B;  1TXD A;  2YF0 A;  3MPX A;  1V5P A;  1Z87 A;  3PZD A;  2NZ8 B;  3SYX A;  2MKR A;  1FGY A;  1WVH A;  4IFS A;  1UEF A;  2J0M A;  2Z4D A;  3OHM B;  2Z59 A;  2Y7B A;  2R2Y A;  1EGX A;  3A8P A;  2Z0Q A;  4TYZ A;  2MDX A;  4HHV A;  4WJ7 A;  5DIF B;  2LOZ A;  4CYE A;  2KUQ A;  1DYN A;  1PLS A;  2COC A;  1SGH A;  1EF1 A;  2RVB B;  1GG3 A;  2W2X D;  1X11 A;  3DXC A;  5LG4 B;  1BTK A;  2COA A;  2YT0 A;  2W2X C;  3NW8 A;  1MIX A;  4KHA A;  1XR0 B;  4YL8 A;  3LJU X;  3TFM A;  3NWF A;  2YS5 A;  1FB8 A;  2GJY A;  2N23 A;  1K5D B;  2L2I A;  3ULC A;  2M38 A;  4K2O A;  1FHO A;  4MY6 A;  1SHC A;  1MK9 B;  2DKP A;  4K17 A;  1KZ7 A;  4D0N B;  1I7A A;  1WJ1 A;  2J0K A;  2GCJ A;  5D3Y A;  2D10 A;  4ZRJ A;  3D8D A;  2QKL A;  2KIE A;  2Z13 A;  1XCG A;  3RCP A;  1U5F A;  3AU5 A;  4K2P A;  5J3T A;  3AJ4 A;  2UZR A;  4ZRK A;  3P6A A;  2FJL A;  2KGX B;  3D8F A;  3HK0 A;  2J0J A;  3ML4 A;  2EMT A;  2P0H A;  3KSY A;  2OQB A;  5D3W A;  2X18 A;  4WVF B;  4PQ0 A;  1ZSQ A;  2KIG A;  4CSQ A;  1N3H A;  3F5R A;  2N0Y A;  3A8Q A;  4KHO A;  1RJ2 A;  5J3Q A;  2RGN B;  2DX1 A;  4OT1 A;  4DXA B;  4C0A A;  4KVG B;  4CHJ A;  1P5T A;  1Q67 A;  4DIX A;  4DX9 0;  1GC7 A;  4XWX A;  2D9W A;  2L1C A;  1PMS A;  1FOE A;  1X1F A;  3OAN A;  2G35 A;  2COF A;  3QIJ A;  4QJ3 B;  3U8Z A;  4TKN A;  2P8V A;  3SV1 A;  1I2H A;  2HE7 A;  2Y8G A;  3BJI A;  2CY5 A;  4WSF A;  2D9Z A;  4GN1 A;  5HE0 A;  3WYF B;  3TCA A;  1U5E A;  2DHK A;  5CLQ B;  2RNR B;  1ISN A;  2GUM A;  5IRS A;  3GYP A;  2IYB A;  2CY4 A;  3VOQ A;  1LW3 A;  1X86 A;  1EAZ A;  1DRO A;  5DHF B;  1MKE A;  5LON B;  1NI2 A;  1BWN A;  3ULB A;  1LB1 A;  2R09 A;  4GMV A;  2MFQ A;  4HAW B;  3PSC A;  3P7Z A;  2D9V A;  4OSN A;  5C5B A;  1MIZ B;  2Z0O A;  4CHM A;  1QQG A;  2XQN M;  1P6S A;  2I5C A;  4Y94 A;  5C5B B;  1UNR A;  5JHG A;  5GOW B;  2KCJ A;  1XD4 A;  1AQC A;  5LOP B;  2R0D A;  2V76 A;  5DHA B;  3QWM A;  1XX0 A;  4HDO A;  2CAY A;  5KQ1 A;  4HSI A;  3F0W A;  4DBB A;  3NSU A;  3ZDT A;  3GYO A;  2YRY A;  3TW1 A;  1V88 A;  2QKM A;  1E5W A;  3PVL A;  1DBH A;  1FAO A;  3ODW A;  3PVU A;  1ZYI A;  4KHB A;  4F7G A;  4A5K A;  4NY0 A;  4MT7 A;  2LUL A;  1UPR A;  5JP4 A;  2VKI A;  1DDW A;  2LOX A;  4KHB B;  4HB2 B;  4HAU B;  4HAY B;  2ROV A;  1J19 A;  2KR0 A;  2DTC A;  2EJ8 A;  2YT2 A;  3ODO A;  3U7D A;  2YVC A;  3SO6 A;  2W2W A;  4P7I A;  2KUP A;  2DKQ A;  2YS1 A;  2RUK B;  2I1K A;  1UNP A;  2ZPY A;  2NBV A;  2YS3 A;  4A6F A;  3G9W A;  2IFS A;  1Y5O A;  1H10 A;  4F7H A;  2FJU B;  2K8E A;  5I2S A;  3AU4 A;  1X1G A;  3FM8 C;  3HIE A;  1U2B A;  3ODX A;  5C79 A;  3FSS A;  5HE2 A;  1FHX A;  2ELB A;  5JLJ B;  1W1H A;  2YSZ A;  3A98 B;  4HB4 B;  1K5G B;  2DHI A;  3QBV B;  2DX5 A;  1V61 A;  5DH9 B;  4D6W A;  3WA0 A;  5CLL B;  4F7U P;  4KAX B;  5C6R A;  2J59 M;  1IRS A;  4Z2N A;  1UNQ A;  1P3R A;  1WI1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...