4KHOA

Structure of the fact complex subunit spt16m
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
290
structure length
268
Chain Sequence
VVEQDKLIEIRRPAVLDNVYIRPALGKRVPGKVEIHQNGIRYQSPLSTTQRVDVLFSNIRHLFFQPCQNEMIVIIHLHLKDPILFGKKKTKDVQFYREAIDEFEAEQEERRRKAELDRLFKSFAEKIAEAGRNEGIEVDMPIRDLGFNGVPNRSNVVIYPTTECLIQITEPPFLVITLEDVEWAHLERVQFGLKNFDLVFVFKDFTRPVVHINTIPVESLEDVKEFLDSSDIPFSEGPLNLNWSVIMKTVTANPHQFFLDGGWGFLQN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Uncharacterized protein Spt16M
publication title Structural basis of histone H2A-H2B recognition by the essential chaperone FACT.
pubmed doi rcsb
source organism Chaetomium thermophilum var. thermophilum
molecule tags Transcription/replication
total genus 70
structure length 268
sequence length 290
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-04-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08512 Rtt106 Histone chaperone Rttp106-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 4khoA02
2.30.29.150 Mainly Beta Roll PH-domain like PH-domain like 4khoA01
3PZDA 1DDMA 2P0HA 4HHVA 3AU5A 4L6EA 1MAIA 3GYPA 1MIXA 2NZ8B 5DHFB 2LG1A 1LB1A 4DX90 3MDBC 2DX5A 2COCA 1EGXA 1MPHA 2Q13A 3HW2B 4YONA 1RJ2A 3DXDA 4ZRKA 3P7ZA 3DXEA 3TCAA 1V88A 1J19A 2MFQA 2DLWA 5FI0A 1ZM0A 1TJ6A 4GPTB 1MK9B 2YVCA 1WI1A 2W2WA 2W2XC 1OMWA 5C79A 2K2UA 2ELBA 2YRYA 1OY2A 2K00A 2YT1A 3MPXA 2EC1A 5J3QA 4A6FB 2X18A 1U5FA 4F7HA 2LOZA 1I2HA 1OQNA 2CY4A 3G9WA 1ISNA 1NU2A 2EJ8A 2YS1A 3BINA 2ADZA 2I1KA 1DDWA 2Y8GA 1UNRA 1UNQA 1X1FA 3PVWA 2COAA 1BAKA 2G35A 1XD4A 4PNKA 1PLSA 2W2XD 2DKQA 2HTHB 3SYXA 3HQCA 5GOWB 1NTYA 4WSFA 3PEGA 3SV1A 5KQ4A 3FEHA 1GC6A 2IFSA 1B55A 2VKIA 4WJ7A 2N23A 3A8PA 1U5EA 1Z87A 2M38A 1XKEA 1EF1A 2DA0A 4YL8A 3ODWA 1V5UA 4ZRJA 3TW1A 4NSWA 1W1DA 2K2JA 1GC7A 2RVBB 5J3TA 3ZDTA 3TO1A 1V89A 1K5DB 2GCJA 2DX1A 1X05A 2MKRA 2J59M 1DBHA 1M7EA 2D9WA 1QQGA 2RUKB 2KUPA 2AEHA 2IYBA 1FAOA 4ZRIA 1QC6A 5C5BB 2YS5A 2DYNA 2I5FA 1LW3A 3PVLA 4CHJA 3QIJA 1XCGA 1WJMA 5HE2A 2DYQA 4HAZB 2NMBA 1PFJA 4GMXB 1FHXA 4HDQA 5KQ1A 1SGHA 2YSZA 5KCVA 5EFXA 1XODA 3AJ4A 4WVFB 3P6AA 4HAWB 2DKPA 4A6HA 1FGYA 1TQZA 2D9XA 3FM8C 2OTXA 1UPQA 2CRFA 3KZ1A 2BCJA 1DDVA 1KZ7A 2GJYA 2V76A 3LJUX 1EAZA 4KAXB 3ODXA 4EJNA 2LYDA 4HATB 4BBKA 2AL6A 3ML4A 4HDOA 2R0DA 3BJIA 4A6FA 5JHHA 1ZC3B 1P5TA 3TFMA 1U2BA 5CLLB 1FHWA 1Y5OA 4CYEA 2YT0A 2L1CA 3ZVRA 2GS0A 4K81A 2JP2A 3OANA 5LOPB 5DHAB 1TXDA 4H8SA 1KI1B 2EMSA 4GN1A 2Z0OA 5JLJB 2YS3A 4A5KA 2D9VA 2Y8FA 1AWEA 1W1GA 3PP2A 1K5GB 4NY0A 2CAYA 3KSYA 5DI9B 3VOQA 3KY9A 2COFA 1U5DA 3A8QA 3F0WA 2LULA 3A98B 1WGUA 1V61A 4MT7A 1WGQA 3KRXA 4HAUB 1UPRA 5C5BA 2GCLA 1Q67A 4PQ0A 2DHJA 4TYZA 4Y94A 2D2QA 5HE0A 2DN6A 2D9YA 4KHAA 3PG7A 5L81A 1MIZB 5D3YA 3D8EA 2HE7A 3SNHA 3WA0A 2UZSA 2QKLA 1WVHA 1NTVA 4P7IA 2XQNM 1PMSA 3PSCA 4KHOA 2ELAA 1BTKA 1V5PA 1P3RA 5JHGA 5C16A 4DXAB 1I7AA 2DHKA 3PVUA 1NI2A 1E5WA 5DH9B 5JP4A 4K2OA 1X11A 2RGNB 4IOYX 3ULCA 1MK7B 5D3XA 1J0WA 5DIFB 3GYOA 2D11A 2L2IA 4HB0B 5D27A 3AU4A 3KRWA 2Y7BA 4HAXB 3SUZA 3DXCA 2D9ZA 4DBBA 4CHMA 3D8FA 5HE1A 1WJ1A 2H7DA 2DTCA 2J0MA 2E2XA 1M7RA 1V5MA 2RNRB 4IFSA 4TKNA 5FI1A 1EVHA 4EKUA 2CODA 3HK0A 3QWMA 3X23A 2Z0PA 3F5RA 3O96A 4GMVA 4GXBA 1DYNA 3VIAA 1XX0A 5J3YA 1H10A 2RLOA 3SO6A 2M14A 5LONB 4K17A 1ZC4B 1U29A 1Y19B 2H7EA 1FGZA 4HAVB 2ROVA 1MKEA 1FB8A 3WYFB 2P0FA 3N7CA 1GG3A 1DROA 1UNPA 4HB3B 2J0JA 1WG7A 1ZSQA 1BWNA 4Z2NA 2KGXB 2PZ1A 2D4QA 2D10A 4F7UP 2EMTA 3ULBA 2ZPYA 2UZRA 1U5GA 3CIKA 3CXBB 4IAPA 2I5CA 1W1HA 3RCPA 2J0KA 4A6KA 4KHBB 2KCJA 1U27A 1X1GA 1N3HA 4B6HA 4DX8A 4C0AA 1RRPB 3NSUA 4KVGB 1FHOA 5D3WA 3D8DA 1UEFA 4K2PA 3T06A 2YF0A 2N0YA 3ODOA 2OQBA 1P6SA 1AQCA 2DHIA 1ZVRA 5HE3A 2R09A 2RSGA 2CY5A 2VRWB 4MK0A 1X86A 2P8VA 2UVMA 4D0NB 2P0DA 1BTNA 5D3VA 2ROZB 1SHCA 2LOXA 4GZUA 5CLQB 2LKOA 4F7GA 2FJLA 4Z2MB 1FOEA 3FSSA 2Z0QA 2I1JA 4MY6A 3QBVB 5C6RA 3V5WA 4EMOA 3U7DA 2DFKA 2VSZA 3M1IB 4HAYB 3U8ZA 4HB4B 4HB2B 3IVFA 4XWXA 3UZTA 1KZGA 2MDXA 1IRSA 3TVVA 2QKMA 1H4RA 1XR0B 2MWNB
chains in the Genus database with same CATH superfamily
3PZDA 1DDMA 2P0HA 4HHVA 3AU5A 4L6EA 1MAIA 3GYPA 1MIXA 2NZ8B 5DHFB 2LG1A 1LB1A 4DX90 3MDBC 2DX5A 2COCA 1EGXA 1MPHA 2Q13A 3HW2B 3NWAA 1RJ2A 3DXDA 4YONA 4ZRKA 3P7ZA 3DXEA 3TCAA 1V88A 1J19A 2MFQA 2DLWA 5I2SA 5FI0A 1ZM0A 1TJ6A 4GPTB 1MK9B 2YVCA 2Z14A 1WI1A 2W2WA 2W2XC 2Z4DA 1OMWA 5C79A 2K2UA 4KHBA 2ELBA 3NWFA 1MI1A 2YRYA 1OY2A 2K00A 2YT1A 3MPXA 2EC1A 5J3QA 4A6FB 2X18A 1U5FA 4F7HA 2LOZA 1I2HA 1OQNA 2CY4A 3G9WA 1ISNA 1NU2A 2EJ8A 2YS1A 3BINA 4QJ4B 2ADZA 2I1KA 1DDWA 2Y8GA 1UNRA 1UNQA 1X1FA 3PVWA 2COAA 1BAKA 2G35A 1XD4A 4PNKA 1PLSA 2W2XD 2DKQA 2HTHB 5M4YB 3SYXA 3HQCA 5GOWB 1NTYA 4WSFA 3PEGA 3SV1A 5KQ4A 4QJ3B 3FEHA 1GC6A 2IFSA 2R2YA 1B55A 2VKIA 4WJ7A 2N23A 3A8PA 1U5EA 1Z87A 2M38A 1XKEA 1EF1A 4HSIA 2DA0A 2KIGA 5I2MA 4YL8A 3ODWA 3A58A 1V5UA 4ZRJA 3TW1A 4NSWA 1W1DA 2K2JA 1GC7A 2RVBB 5J3TA 3ZDTA 3TO1A 3U12A 4D6WA 1V89A 1K5DB 2GCJA 2DX1A 1X05A 2MKRA 2J59M 1DBHA 1M7EA 2D9WA 1QQGA 2RUKB 2KUPA 2AEHA 2IYBA 1FAOA 4ZRIA 1QC6A 3HSAA 5C5BB 2YS5A 2DYNA 2I5FA 1LW3A 3PVLA 4CHJA 3QIJA 1XCGA 1WJMA 5HE2A 2DYQA 4HAZB 2NMBA 1PFJA 4GMXB 1FHXA 4HDQA 5KQ1A 1SGHA 2YSZA 5KCVA 5EFXA 1XODA 3AJ4A 4WVFB 3P6AA 4HAWB 2DKPA 4A6HA 1FGYA 1TQZA 2D9XA 3FM8C 2OTXA 1UPQA 2CRFA 3KZ1A 2BCJA 1DDVA 1KZ7A 2GJYA 2V76A 4L1RA 3LJUX 1EAZA 4KAXB 3ODXA 1T77A 4EJNA 2LYDA 4HATB 4BBKA 2AL6A 3ML4A 4HDOA 2R0DA 3BJIA 4A6FA 5JHHA 1ZC3B 1P5TA 3TFMA 1U2BA 5CLLB 1FHWA 1Y5OA 4CYEA 3HIEA 2YT0A 2L1CA 3ZVRA 2GS0A 4GNKB 4K81A 2JP2A 3OANA 5LOPB 5DHAB 1TXDA 4H8SA 1KI1B 2EMSA 4GN1A 2Z0OA 5JLJB 2KIEA 2YS3A 4OT1A 4A5KA 2D9VA 2Y8FA 1AWEA 1W1GA 4GOUA 3PP2A 1K5GB 4NY0A 2CAYA 3KSYA 5DI9B 3VOQA 2Z13A 3KY9A 2COFA 1U5DA 3A8QA 3F0WA 3NWDA 2LULA 2ZKMX 2YT2A 3A98B 1WGUA 1V61A 4MT7A 1WGQA 3KRXA 4HAUB 2K8EA 1UPRA 5C5BA 2K49A 2GCLA 1Q67A 4PQ0A 2DHJA 4TYZA 4Y94A 2D2QA 5HE0A 2DN6A 2D9YA 4KHAA 3PG7A 5LG4B 5L81A 1MIZB 5D3YA 3D8EA 2HE7A 3SNHA 3WA0A 2UZSA 2QKLA 1WVHA 1NTVA 4P7IA 2XQNM 1PMSA 3PSCA 4KHOA 2ELAA 1BTKA 1V5PA 1P3RA 5JHGA 5C16A 4DXAB 1I7AA 2DHKA 3PVUA 1NI2A 1E5WA 5DH9B 5JP4A 4K2OA 1X11A 2RGNB 4IOYX 3ULCA 1MK7B 5D3XA 1J0WA 5DIFB 3GYOA 2D11A 2L2IA 4HB0B 5D27A 3AU4A 3KRWA 2Y7BA 4OSNA 4HAXB 3SUZA 3DXCA 2KR0A 2D9ZA 4DBBA 4CHMA 3D8FA 5HE1A 1WJ1A 2H7DA 2DTCA 2J0MA 4CSQA 3FVCA 2E2XA 2Z59A 1M7RA 1V5MA 2RNRB 5IRSA 4IFSA 4TKNA 5FI1A 1EVHA 4EKUA 2CODA 3HK0A 3QWMA 3X23A 2Z0PA 3F5RA 3O96A 3OHMB 4GMVA 4GXBA 1DYNA 3VIAA 1XX0A 5J3YA 1H10A 3NW8A 2RLOA 3SO6A 2M14A 5LONB 4K17A 4DIXA 1ZC4B 1U29A 1Y19B 2H7EA 4QXAB 1FGZA 4HAVB 2ROVA 1MKEA 1FB8A 3WYFB 2P0FA 3N7CA 1GG3A 2RRFA 1DROA 1UNPA 4HB3B 2J0JA 1WG7A 1ZSQA 1BWNA 1ZYIA 4Z2NA 2KGXB 2PZ1A 2D4QA 2D10A 2KUQA 4F7UP 2EMTA 3ULBA 2ZPYA 2GUMA 2UZRA 1U5GA 3CIKA 3CXBB 4IAPA 2I5CA 1W1HA 3DCXA 3RCPA 2J0KA 4A6KA 4KHBB 2KCJA 1U27A 1X1GA 1N3HA 4B6HA 4DX8A 4C0AA 1RRPB 2NBVA 3NSUA 4KVGB 3B77A 1FHOA 5D3WA 3D8DA 1UEFA 4K2PA 3T06A 2YF0A 2N0YA 3ODOA 4QJ5B 2OQBA 1P6SA 1AQCA 2DHIA 1ZVRA 5HE3A 2R09A 2RSGA 2CY5A 2VRWB 4MK0A 1X86A 2P8VA 2UVMA 4D0NB 2P0DA 1BTNA 5D3VA 2ROZB 1SHCA 2LOXA 4GZUA 5CLQB 2LKOA 4F7GA 2FJLA 4Z2MB 1FOEA 3FSSA 2Z0QA 2I1JA 2FJUB 3QBVB 4MY6A 3V5WA 5C6RA 4EMOA 3U7DA 2DFKA 2VSZA 3M1IB 4HAYB 3U8ZA 4HB4B 4HB2B 3IVFA 4XWXA 3UZTA 1KZGA 2MDXA 1IRSA 3TVVA 2QKMA 1H4RA 1XR0B 2MWNB
chains in the Genus database with same CATH topology
3PZDA 1DDMA 2P0HA 4HHVA 3AU5A 4L6EA 1MAIA 3GYPA 1MIXA 2NZ8B 5DHFB 2LG1A 1LB1A 4DX90 3MDBC 2DX5A 2COCA 1EGXA 1MPHA 2Q13A 3HW2B 4YONA 1RJ2A 3DXDA 3NWAA 4ZRKA 3P7ZA 3DXEA 3TCAA 1V88A 1J19A 2MFQA 2DLWA 5I2SA 5FI0A 1ZM0A 1TJ6A 4GPTB 1MK9B 2YVCA 2Z14A 1WI1A 2W2WA 2W2XC 2Z4DA 1OMWA 5C79A 2K2UA 4KHBA 2ELBA 3NWFA 2YRYA 1OY2A 2K00A 2YT1A 3MPXA 2EC1A 5J3QA 4A6FB 2X18A 1U5FA 4F7HA 2LOZA 1I2HA 1OQNA 2CY4A 3G9WA 1ISNA 1NU2A 2EJ8A 2YS1A 3BINA 4QJ4B 2ADZA 2I1KA 1DDWA 2Y8GA 1UNRA 1UNQA 1X1FA 3PVWA 2COAA 1BAKA 2G35A 1XD4A 4PNKA 1PLSA 2W2XD 2DKQA 2HTHB 5M4YB 3SYXA 3HQCA 5GOWB 1NTYA 4WSFA 3PEGA 3SV1A 5KQ4A 4QJ3B 3FEHA 1GC6A 2IFSA 2R2YA 1B55A 2VKIA 4WJ7A 2N23A 3A8PA 1U5EA 1Z87A 2M38A 1XKEA 1EF1A 4HSIA 2DA0A 2KIGA 5I2MA 4YL8A 3ODWA 3A58A 1V5UA 4ZRJA 3TW1A 4NSWA 1W1DA 2K2JA 1GC7A 2RVBB 5J3TA 3ZDTA 3TO1A 3U12A 4D6WA 1V89A 1K5DB 2GCJA 2DX1A 1X05A 2MKRA 2J59M 1DBHA 1M7EA 2D9WA 1QQGA 2RUKB 2KUPA 2AEHA 2IYBA 1FAOA 4ZRIA 1QC6A 5C5BB 2YS5A 2DYNA 2I5FA 1LW3A 3PVLA 4CHJA 3QIJA 1XCGA 1WJMA 5HE2A 2DYQA 4HAZB 2NMBA 1PFJA 4GMXB 1FHXA 4HDQA 5KQ1A 1SGHA 2YSZA 5KCVA 5EFXA 1XODA 3AJ4A 4WVFB 3P6AA 4HAWB 2DKPA 4A6HA 1FGYA 1TQZA 2D9XA 3FM8C 2OTXA 1UPQA 2CRFA 3KZ1A 2BCJA 1DDVA 1KZ7A 2GJYA 2V76A 4L1RA 3LJUX 1EAZA 4KAXB 3ODXA 4EJNA 2LYDA 4HATB 4BBKA 2AL6A 3ML4A 4HDOA 2R0DA 3BJIA 4A6FA 5JHHA 1ZC3B 1P5TA 3TFMA 1U2BA 5CLLB 1FHWA 1Y5OA 4CYEA 3HIEA 2YT0A 2L1CA 3ZVRA 2GS0A 4GNKB 4K81A 2JP2A 3OANA 5LOPB 5DHAB 1TXDA 4H8SA 1KI1B 2EMSA 4GN1A 2Z0OA 5JLJB 2KIEA 2YS3A 4A5KA 4OT1A 2D9VA 2Y8FA 1AWEA 1W1GA 4GOUA 3PP2A 1K5GB 4NY0A 2CAYA 3KSYA 5DI9B 3VOQA 2Z13A 3KY9A 2COFA 1U5DA 3A8QA 3F0WA 3NWDA 2LULA 2ZKMX 2YT2A 3A98B 1WGUA 1V61A 4MT7A 1WGQA 3KRXA 4HAUB 2K8EA 1UPRA 5C5BA 2K49A 2GCLA 1Q67A 4PQ0A 2DHJA 4TYZA 4Y94A 2D2QA 5HE0A 2DN6A 2D9YA 4KHAA 3PG7A 5LG4B 5L81A 1MIZB 5D3YA 3D8EA 2HE7A 3SNHA 3WA0A 2UZSA 2QKLA 1WVHA 1NTVA 4P7IA 2XQNM 1PMSA 3PSCA 4KHOA 2ELAA 1BTKA 1V5PA 1P3RA 5JHGA 5C16A 4DXAB 1I7AA 2DHKA 3PVUA 1NI2A 1E5WA 5DH9B 5JP4A 4K2OA 1X11A 2RGNB 4IOYX 3ULCA 1MK7B 5D3XA 1J0WA 5DIFB 3GYOA 2D11A 2L2IA 4HB0B 5D27A 3AU4A 3KRWA 2Y7BA 4OSNA 4HAXB 3SUZA 3DXCA 2KR0A 2D9ZA 4DBBA 4CHMA 3D8FA 5HE1A 1WJ1A 2H7DA 2DTCA 2J0MA 4CSQA 3FVCA 2E2XA 2Z59A 1M7RA 1V5MA 2RNRB 5IRSA 4IFSA 4TKNA 5FI1A 1EVHA 4EKUA 2CODA 3HK0A 3QWMA 3X23A 2Z0PA 3F5RA 3O96A 4GMVA 4GXBA 3OHMB 1DYNA 3VIAA 1XX0A 5J3YA 1H10A 3NW8A 2RLOA 3SO6A 2M14A 5LONB 4K17A 4DIXA 1ZC4B 1U29A 1Y19B 2H7EA 4QXAB 1FGZA 4HAVB 2ROVA 1MKEA 1FB8A 3WYFB 2P0FA 3N7CA 1GG3A 2RRFA 1DROA 1UNPA 4HB3B 2J0JA 1WG7A 1ZSQA 1BWNA 4Z2NA 1ZYIA 2KGXB 2PZ1A 2D4QA 2D10A 2KUQA 4F7UP 2EMTA 3ULBA 2ZPYA 2GUMA 2UZRA 1U5GA 3CIKA 3CXBB 4IAPA 2I5CA 1W1HA 3RCPA 2J0KA 4A6KA 4KHBB 2KCJA 1U27A 1X1GA 1N3HA 4B6HA 4DX8A 4C0AA 1RRPB 2NBVA 3NSUA 4KVGB 1FHOA 5D3WA 3D8DA 1UEFA 4K2PA 3T06A 2YF0A 2N0YA 3ODOA 4QJ5B 2OQBA 1P6SA 1AQCA 2DHIA 1ZVRA 5HE3A 2R09A 2RSGA 2CY5A 2VRWB 4MK0A 1X86A 2P8VA 2UVMA 4D0NB 2P0DA 1BTNA 5D3VA 2ROZB 1SHCA 2LOXA 4GZUA 5CLQB 2LKOA 4F7GA 2FJLA 4Z2MB 1FOEA 3FSSA 2Z0QA 2I1JA 4MY6A 3QBVB 5C6RA 3V5WA 2FJUB 4EMOA 3U7DA 2DFKA 2VSZA 3M1IB 4HAYB 3U8ZA 4HB4B 4HB2B 3IVFA 4XWXA 3UZTA 1KZGA 2MDXA 1IRSA 3TVVA 2QKMA 1H4RA 1XR0B 2MWNB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PZD A;  1DDM A;  2P0H A;  4HHV A;  3AU5 A;  4L6E A;  1MAI A;  3GYP A;  1MIX A;  2NZ8 B;  5DHF B;  2LG1 A;  1LB1 A;  4DX9 0;  3MDB C;  2DX5 A;  2COC A;  1EGX A;  1MPH A;  2Q13 A;  3HW2 B;  4YON A;  1RJ2 A;  3DXD A;  4ZRK A;  3P7Z A;  3DXE A;  3TCA A;  1V88 A;  1J19 A;  2MFQ A;  2DLW A;  5FI0 A;  1ZM0 A;  1TJ6 A;  4GPT B;  1MK9 B;  2YVC A;  1WI1 A;  2W2W A;  2W2X C;  1OMW A;  5C79 A;  2K2U A;  2ELB A;  2YRY A;  1OY2 A;  2K00 A;  2YT1 A;  3MPX A;  2EC1 A;  5J3Q A;  4A6F B;  2X18 A;  1U5F A;  4F7H A;  2LOZ A;  1I2H A;  1OQN A;  2CY4 A;  3G9W A;  1ISN A;  1NU2 A;  2EJ8 A;  2YS1 A;  3BIN A;  2ADZ A;  2I1K A;  1DDW A;  2Y8G A;  1UNR A;  1UNQ A;  1X1F A;  3PVW A;  2COA A;  1BAK A;  2G35 A;  1XD4 A;  4PNK A;  1PLS A;  2W2X D;  2DKQ A;  2HTH B;  3SYX A;  3HQC A;  5GOW B;  1NTY A;  4WSF A;  3PEG A;  3SV1 A;  5KQ4 A;  3FEH A;  1GC6 A;  2IFS A;  1B55 A;  2VKI A;  4WJ7 A;  2N23 A;  3A8P A;  1U5E A;  1Z87 A;  2M38 A;  1XKE A;  1EF1 A;  2DA0 A;  4YL8 A;  3ODW A;  1V5U A;  4ZRJ A;  3TW1 A;  4NSW A;  1W1D A;  2K2J A;  1GC7 A;  2RVB B;  5J3T A;  3ZDT A;  3TO1 A;  1V89 A;  1K5D B;  2GCJ A;  2DX1 A;  1X05 A;  2MKR A;  2J59 M;  1DBH A;  1M7E A;  2D9W A;  1QQG A;  2RUK B;  2KUP A;  2AEH A;  2IYB A;  1FAO A;  4ZRI A;  1QC6 A;  5C5B B;  2YS5 A;  2DYN A;  2I5F A;  1LW3 A;  3PVL A;  4CHJ A;  3QIJ A;  1XCG A;  1WJM A;  5HE2 A;  2DYQ A;  4HAZ B;  2NMB A;  1PFJ A;  4GMX B;  1FHX A;  4HDQ A;  5KQ1 A;  1SGH A;  2YSZ A;  5KCV A;  5EFX A;  1XOD A;  3AJ4 A;  4WVF B;  3P6A A;  4HAW B;  2DKP A;  4A6H A;  1FGY A;  1TQZ A;  2D9X A;  3FM8 C;  2OTX A;  1UPQ A;  2CRF A;  3KZ1 A;  2BCJ A;  1DDV A;  1KZ7 A;  2GJY A;  2V76 A;  3LJU X;  1EAZ A;  4KAX B;  3ODX A;  4EJN A;  2LYD A;  4HAT B;  4BBK A;  2AL6 A;  3ML4 A;  4HDO A;  2R0D A;  3BJI A;  4A6F A;  5JHH A;  1ZC3 B;  1P5T A;  3TFM A;  1U2B A;  5CLL B;  1FHW A;  1Y5O A;  4CYE A;  2YT0 A;  2L1C A;  3ZVR A;  2GS0 A;  4K81 A;  2JP2 A;  3OAN A;  5LOP B;  5DHA B;  1TXD A;  4H8S A;  1KI1 B;  2EMS A;  4GN1 A;  2Z0O A;  5JLJ B;  2YS3 A;  4A5K A;  2D9V A;  2Y8F A;  1AWE A;  1W1G A;  3PP2 A;  1K5G B;  4NY0 A;  2CAY A;  3KSY A;  5DI9 B;  3VOQ A;  3KY9 A;  2COF A;  1U5D A;  3A8Q A;  3F0W A;  2LUL A;  3A98 B;  1WGU A;  1V61 A;  4MT7 A;  1WGQ A;  3KRX A;  4HAU B;  1UPR A;  5C5B A;  2GCL A;  1Q67 A;  4PQ0 A;  2DHJ A;  4TYZ A;  4Y94 A;  2D2Q A;  5HE0 A;  2DN6 A;  2D9Y A;  4KHA A;  3PG7 A;  5L81 A;  1MIZ B;  5D3Y A;  3D8E A;  2HE7 A;  3SNH A;  3WA0 A;  2UZS A;  2QKL A;  1WVH A;  1NTV A;  4P7I A;  2XQN M;  1PMS A;  3PSC A;  4KHO A;  2ELA A;  1BTK A;  1V5P A;  1P3R A;  5JHG A;  5C16 A;  4DXA B;  1I7A A;  2DHK A;  3PVU A;  1NI2 A;  1E5W A;  5DH9 B;  5JP4 A;  4K2O A;  1X11 A;  2RGN B;  4IOY X;  3ULC A;  1MK7 B;  5D3X A;  1J0W A;  5DIF B;  3GYO A;  2D11 A;  2L2I A;  4HB0 B;  5D27 A;  3AU4 A;  3KRW A;  2Y7B A;  4HAX B;  3SUZ A;  3DXC A;  2D9Z A;  4DBB A;  4CHM A;  3D8F A;  5HE1 A;  1WJ1 A;  2H7D A;  2DTC A;  2J0M A;  2E2X A;  1M7R A;  1V5M A;  2RNR B;  4IFS A;  4TKN A;  5FI1 A;  1EVH A;  4EKU A;  2COD A;  3HK0 A;  3QWM A;  3X23 A;  2Z0P A;  3F5R A;  3O96 A;  4GMV A;  4GXB A;  1DYN A;  3VIA A;  1XX0 A;  5J3Y A;  1H10 A;  2RLO A;  3SO6 A;  2M14 A;  5LON B;  4K17 A;  1ZC4 B;  1U29 A;  1Y19 B;  2H7E A;  1FGZ A;  4HAV B;  2ROV A;  1MKE A;  1FB8 A;  3WYF B;  2P0F A;  3N7C A;  1GG3 A;  1DRO A;  1UNP A;  4HB3 B;  2J0J A;  1WG7 A;  1ZSQ A;  1BWN A;  4Z2N A;  2KGX B;  2PZ1 A;  2D4Q A;  2D10 A;  4F7U P;  2EMT A;  3ULB A;  2ZPY A;  2UZR A;  1U5G A;  3CIK A;  3CXB B;  4IAP A;  2I5C A;  1W1H A;  3RCP A;  2J0K A;  4A6K A;  4KHB B;  2KCJ A;  1U27 A;  1X1G A;  1N3H A;  4B6H A;  4DX8 A;  4C0A A;  1RRP B;  3NSU A;  4KVG B;  1FHO A;  5D3W A;  3D8D A;  1UEF A;  4K2P A;  3T06 A;  2YF0 A;  2N0Y A;  3ODO A;  2OQB A;  1P6S A;  1AQC A;  2DHI A;  1ZVR A;  5HE3 A;  2R09 A;  2RSG A;  2CY5 A;  2VRW B;  4MK0 A;  1X86 A;  2P8V A;  2UVM A;  4D0N B;  2P0D A;  1BTN A;  5D3V A;  2ROZ B;  1SHC A;  2LOX A;  4GZU A;  5CLQ B;  2LKO A;  4F7G A;  2FJL A;  4Z2M B;  1FOE A;  3FSS A;  2Z0Q A;  2I1J A;  4MY6 A;  3QBV B;  5C6R A;  3V5W A;  4EMO A;  3U7D A;  2DFK A;  2VSZ A;  3M1I B;  4HAY B;  3U8Z A;  4HB4 B;  4HB2 B;  3IVF A;  4XWX A;  3UZT A;  1KZG A;  2MDX A;  1IRS A;  3TVV A;  2QKM A;  1H4R A;  1XR0 B;  2MWN B; 
#chains in the Genus database with same CATH topology
 3PZD A;  1DDM A;  2P0H A;  4HHV A;  3AU5 A;  4L6E A;  1MAI A;  3GYP A;  1MIX A;  2NZ8 B;  5DHF B;  2LG1 A;  1LB1 A;  4DX9 0;  3MDB C;  2DX5 A;  2COC A;  1EGX A;  1MPH A;  2Q13 A;  3HW2 B;  3NWA A;  1RJ2 A;  3DXD A;  4YON A;  4ZRK A;  3P7Z A;  3DXE A;  3TCA A;  1V88 A;  1J19 A;  2MFQ A;  2DLW A;  5I2S A;  5FI0 A;  1ZM0 A;  1TJ6 A;  4GPT B;  1MK9 B;  2YVC A;  2Z14 A;  1WI1 A;  2W2W A;  2W2X C;  2Z4D A;  1OMW A;  5C79 A;  2K2U A;  4KHB A;  2ELB A;  3NWF A;  1MI1 A;  2YRY A;  1OY2 A;  2K00 A;  2YT1 A;  3MPX A;  2EC1 A;  5J3Q A;  4A6F B;  2X18 A;  1U5F A;  4F7H A;  2LOZ A;  1I2H A;  1OQN A;  2CY4 A;  3G9W A;  1ISN A;  1NU2 A;  2EJ8 A;  2YS1 A;  3BIN A;  4QJ4 B;  2ADZ A;  2I1K A;  1DDW A;  2Y8G A;  1UNR A;  1UNQ A;  1X1F A;  3PVW A;  2COA A;  1BAK A;  2G35 A;  1XD4 A;  4PNK A;  1PLS A;  2W2X D;  2DKQ A;  2HTH B;  5M4Y B;  3SYX A;  3HQC A;  5GOW B;  1NTY A;  4WSF A;  3PEG A;  3SV1 A;  5KQ4 A;  4QJ3 B;  3FEH A;  1GC6 A;  2IFS A;  2R2Y A;  1B55 A;  2VKI A;  4WJ7 A;  2N23 A;  3A8P A;  1U5E A;  1Z87 A;  2M38 A;  1XKE A;  1EF1 A;  4HSI A;  2DA0 A;  2KIG A;  5I2M A;  4YL8 A;  3ODW A;  3A58 A;  1V5U A;  4ZRJ A;  3TW1 A;  4NSW A;  1W1D A;  2K2J A;  1GC7 A;  2RVB B;  5J3T A;  3ZDT A;  3TO1 A;  3U12 A;  4D6W A;  1V89 A;  1K5D B;  2GCJ A;  2DX1 A;  1X05 A;  2MKR A;  2J59 M;  1DBH A;  1M7E A;  2D9W A;  1QQG A;  2RUK B;  2KUP A;  2AEH A;  2IYB A;  1FAO A;  4ZRI A;  1QC6 A;  3HSA A;  5C5B B;  2YS5 A;  2DYN A;  2I5F A;  1LW3 A;  3PVL A;  4CHJ A;  3QIJ A;  1XCG A;  1WJM A;  5HE2 A;  2DYQ A;  4HAZ B;  2NMB A;  1PFJ A;  4GMX B;  1FHX A;  4HDQ A;  5KQ1 A;  1SGH A;  2YSZ A;  5KCV A;  5EFX A;  1XOD A;  3AJ4 A;  4WVF B;  3P6A A;  4HAW B;  2DKP A;  4A6H A;  1FGY A;  1TQZ A;  2D9X A;  3FM8 C;  2OTX A;  1UPQ A;  2CRF A;  3KZ1 A;  2BCJ A;  1DDV A;  1KZ7 A;  2GJY A;  2V76 A;  4L1R A;  3LJU X;  1EAZ A;  4KAX B;  3ODX A;  1T77 A;  4EJN A;  2LYD A;  4HAT B;  4BBK A;  2AL6 A;  3ML4 A;  4HDO A;  2R0D A;  3BJI A;  4A6F A;  5JHH A;  1ZC3 B;  1P5T A;  3TFM A;  1U2B A;  5CLL B;  1FHW A;  1Y5O A;  4CYE A;  3HIE A;  2YT0 A;  2L1C A;  3ZVR A;  2GS0 A;  4GNK B;  4K81 A;  2JP2 A;  3OAN A;  5LOP B;  5DHA B;  1TXD A;  4H8S A;  1KI1 B;  2EMS A;  4GN1 A;  2Z0O A;  5JLJ B;  2KIE A;  2YS3 A;  4OT1 A;  4A5K A;  2D9V A;  2Y8F A;  1AWE A;  1W1G A;  4GOU A;  3PP2 A;  1K5G B;  4NY0 A;  2CAY A;  3KSY A;  5DI9 B;  3VOQ A;  2Z13 A;  3KY9 A;  2COF A;  1U5D A;  3A8Q A;  3F0W A;  3NWD A;  2LUL A;  2ZKM X;  2YT2 A;  3A98 B;  1WGU A;  1V61 A;  4MT7 A;  1WGQ A;  3KRX A;  4HAU B;  2K8E A;  1UPR A;  5C5B A;  2K49 A;  2GCL A;  1Q67 A;  4PQ0 A;  2DHJ A;  4TYZ A;  4Y94 A;  2D2Q A;  5HE0 A;  2DN6 A;  2D9Y A;  4KHA A;  3PG7 A;  5LG4 B;  5L81 A;  1MIZ B;  5D3Y A;  3D8E A;  2HE7 A;  3SNH A;  3WA0 A;  2UZS A;  2QKL A;  1WVH A;  1NTV A;  4P7I A;  2XQN M;  1PMS A;  3PSC A;  4KHO A;  2ELA A;  1BTK A;  1V5P A;  1P3R A;  5JHG A;  5C16 A;  4DXA B;  1I7A A;  2DHK A;  3PVU A;  1NI2 A;  1E5W A;  5DH9 B;  5JP4 A;  4K2O A;  1X11 A;  2RGN B;  4IOY X;  3ULC A;  1MK7 B;  5D3X A;  1J0W A;  5DIF B;  3GYO A;  2D11 A;  2L2I A;  4HB0 B;  5D27 A;  3AU4 A;  3KRW A;  2Y7B A;  4OSN A;  4HAX B;  3SUZ A;  3DXC A;  2KR0 A;  2D9Z A;  4DBB A;  4CHM A;  3D8F A;  5HE1 A;  1WJ1 A;  2H7D A;  2DTC A;  2J0M A;  4CSQ A;  3FVC A;  2E2X A;  2Z59 A;  1M7R A;  1V5M A;  2RNR B;  5IRS A;  4IFS A;  4TKN A;  5FI1 A;  1EVH A;  4EKU A;  2COD A;  3HK0 A;  3QWM A;  3X23 A;  2Z0P A;  3F5R A;  3O96 A;  3OHM B;  4GMV A;  4GXB A;  1DYN A;  3VIA A;  1XX0 A;  5J3Y A;  1H10 A;  3NW8 A;  2RLO A;  3SO6 A;  2M14 A;  5LON B;  4K17 A;  4DIX A;  1ZC4 B;  1U29 A;  1Y19 B;  2H7E A;  4QXA B;  1FGZ A;  4HAV B;  2ROV A;  1MKE A;  1FB8 A;  3WYF B;  2P0F A;  3N7C A;  1GG3 A;  2RRF A;  1DRO A;  1UNP A;  4HB3 B;  2J0J A;  1WG7 A;  1ZSQ A;  1BWN A;  1ZYI A;  4Z2N A;  2KGX B;  2PZ1 A;  2D4Q A;  2D10 A;  2KUQ A;  4F7U P;  2EMT A;  3ULB A;  2ZPY A;  2GUM A;  2UZR A;  1U5G A;  3CIK A;  3CXB B;  4IAP A;  2I5C A;  1W1H A;  3DCX A;  3RCP A;  2J0K A;  4A6K A;  4KHB B;  2KCJ A;  1U27 A;  1X1G A;  1N3H A;  4B6H A;  4DX8 A;  4C0A A;  1RRP B;  2NBV A;  3NSU A;  4KVG B;  3B77 A;  1FHO A;  5D3W A;  3D8D A;  1UEF A;  4K2P A;  3T06 A;  2YF0 A;  2N0Y A;  3ODO A;  4QJ5 B;  2OQB A;  1P6S A;  1AQC A;  2DHI A;  1ZVR A;  5HE3 A;  2R09 A;  2RSG A;  2CY5 A;  2VRW B;  4MK0 A;  1X86 A;  2P8V A;  2UVM A;  4D0N B;  2P0D A;  1BTN A;  5D3V A;  2ROZ B;  1SHC A;  2LOX A;  4GZU A;  5CLQ B;  2LKO A;  4F7G A;  2FJL A;  4Z2M B;  1FOE A;  3FSS A;  2Z0Q A;  2I1J A;  2FJU B;  3QBV B;  4MY6 A;  3V5W A;  5C6R A;  4EMO A;  3U7D A;  2DFK A;  2VSZ A;  3M1I B;  4HAY B;  3U8Z A;  4HB4 B;  4HB2 B;  3IVF A;  4XWX A;  3UZT A;  1KZG A;  2MDX A;  1IRS A;  3TVV A;  2QKM A;  1H4R A;  1XR0 B;  2MWN B; 
#chains in the Genus database with same CATH homology
 3PZD A;  1DDM A;  2P0H A;  4HHV A;  3AU5 A;  4L6E A;  1MAI A;  3GYP A;  1MIX A;  2NZ8 B;  5DHF B;  2LG1 A;  1LB1 A;  4DX9 0;  3MDB C;  2DX5 A;  2COC A;  1EGX A;  1MPH A;  2Q13 A;  3HW2 B;  4YON A;  1RJ2 A;  3DXD A;  3NWA A;  4ZRK A;  3P7Z A;  3DXE A;  3TCA A;  1V88 A;  1J19 A;  2MFQ A;  2DLW A;  5I2S A;  5FI0 A;  1ZM0 A;  1TJ6 A;  4GPT B;  1MK9 B;  2YVC A;  2Z14 A;  1WI1 A;  2W2W A;  2W2X C;  2Z4D A;  1OMW A;  5C79 A;  2K2U A;  4KHB A;  2ELB A;  3NWF A;  2YRY A;  1OY2 A;  2K00 A;  2YT1 A;  3MPX A;  2EC1 A;  5J3Q A;  4A6F B;  2X18 A;  1U5F A;  4F7H A;  2LOZ A;  1I2H A;  1OQN A;  2CY4 A;  3G9W A;  1ISN A;  1NU2 A;  2EJ8 A;  2YS1 A;  3BIN A;  4QJ4 B;  2ADZ A;  2I1K A;  1DDW A;  2Y8G A;  1UNR A;  1UNQ A;  1X1F A;  3PVW A;  2COA A;  1BAK A;  2G35 A;  1XD4 A;  4PNK A;  1PLS A;  2W2X D;  2DKQ A;  2HTH B;  5M4Y B;  3SYX A;  3HQC A;  5GOW B;  1NTY A;  4WSF A;  3PEG A;  3SV1 A;  5KQ4 A;  4QJ3 B;  3FEH A;  1GC6 A;  2IFS A;  2R2Y A;  1B55 A;  2VKI A;  4WJ7 A;  2N23 A;  3A8P A;  1U5E A;  1Z87 A;  2M38 A;  1XKE A;  1EF1 A;  4HSI A;  2DA0 A;  2KIG A;  5I2M A;  4YL8 A;  3ODW A;  3A58 A;  1V5U A;  4ZRJ A;  3TW1 A;  4NSW A;  1W1D A;  2K2J A;  1GC7 A;  2RVB B;  5J3T A;  3ZDT A;  3TO1 A;  3U12 A;  4D6W A;  1V89 A;  1K5D B;  2GCJ A;  2DX1 A;  1X05 A;  2MKR A;  2J59 M;  1DBH A;  1M7E A;  2D9W A;  1QQG A;  2RUK B;  2KUP A;  2AEH A;  2IYB A;  1FAO A;  4ZRI A;  1QC6 A;  5C5B B;  2YS5 A;  2DYN A;  2I5F A;  1LW3 A;  3PVL A;  4CHJ A;  3QIJ A;  1XCG A;  1WJM A;  5HE2 A;  2DYQ A;  4HAZ B;  2NMB A;  1PFJ A;  4GMX B;  1FHX A;  4HDQ A;  5KQ1 A;  1SGH A;  2YSZ A;  5KCV A;  5EFX A;  1XOD A;  3AJ4 A;  4WVF B;  3P6A A;  4HAW B;  2DKP A;  4A6H A;  1FGY A;  1TQZ A;  2D9X A;  3FM8 C;  2OTX A;  1UPQ A;  2CRF A;  3KZ1 A;  2BCJ A;  1DDV A;  1KZ7 A;  2GJY A;  2V76 A;  4L1R A;  3LJU X;  1EAZ A;  4KAX B;  3ODX A;  4EJN A;  2LYD A;  4HAT B;  4BBK A;  2AL6 A;  3ML4 A;  4HDO A;  2R0D A;  3BJI A;  4A6F A;  5JHH A;  1ZC3 B;  1P5T A;  3TFM A;  1U2B A;  5CLL B;  1FHW A;  1Y5O A;  4CYE A;  3HIE A;  2YT0 A;  2L1C A;  3ZVR A;  2GS0 A;  4GNK B;  4K81 A;  2JP2 A;  3OAN A;  5LOP B;  5DHA B;  1TXD A;  4H8S A;  1KI1 B;  2EMS A;  4GN1 A;  2Z0O A;  5JLJ B;  2KIE A;  2YS3 A;  4A5K A;  4OT1 A;  2D9V A;  2Y8F A;  1AWE A;  1W1G A;  4GOU A;  3PP2 A;  1K5G B;  4NY0 A;  2CAY A;  3KSY A;  5DI9 B;  3VOQ A;  2Z13 A;  3KY9 A;  2COF A;  1U5D A;  3A8Q A;  3F0W A;  3NWD A;  2LUL A;  2ZKM X;  2YT2 A;  3A98 B;  1WGU A;  1V61 A;  4MT7 A;  1WGQ A;  3KRX A;  4HAU B;  2K8E A;  1UPR A;  5C5B A;  2K49 A;  2GCL A;  1Q67 A;  4PQ0 A;  2DHJ A;  4TYZ A;  4Y94 A;  2D2Q A;  5HE0 A;  2DN6 A;  2D9Y A;  4KHA A;  3PG7 A;  5LG4 B;  5L81 A;  1MIZ B;  5D3Y A;  3D8E A;  2HE7 A;  3SNH A;  3WA0 A;  2UZS A;  2QKL A;  1WVH A;  1NTV A;  4P7I A;  2XQN M;  1PMS A;  3PSC A;  4KHO A;  2ELA A;  1BTK A;  1V5P A;  1P3R A;  5JHG A;  5C16 A;  4DXA B;  1I7A A;  2DHK A;  3PVU A;  1NI2 A;  1E5W A;  5DH9 B;  5JP4 A;  4K2O A;  1X11 A;  2RGN B;  4IOY X;  3ULC A;  1MK7 B;  5D3X A;  1J0W A;  5DIF B;  3GYO A;  2D11 A;  2L2I A;  4HB0 B;  5D27 A;  3AU4 A;  3KRW A;  2Y7B A;  4OSN A;  4HAX B;  3SUZ A;  3DXC A;  2KR0 A;  2D9Z A;  4DBB A;  4CHM A;  3D8F A;  5HE1 A;  1WJ1 A;  2H7D A;  2DTC A;  2J0M A;  4CSQ A;  3FVC A;  2E2X A;  2Z59 A;  1M7R A;  1V5M A;  2RNR B;  5IRS A;  4IFS A;  4TKN A;  5FI1 A;  1EVH A;  4EKU A;  2COD A;  3HK0 A;  3QWM A;  3X23 A;  2Z0P A;  3F5R A;  3O96 A;  4GMV A;  4GXB A;  3OHM B;  1DYN A;  3VIA A;  1XX0 A;  5J3Y A;  1H10 A;  3NW8 A;  2RLO A;  3SO6 A;  2M14 A;  5LON B;  4K17 A;  4DIX A;  1ZC4 B;  1U29 A;  1Y19 B;  2H7E A;  4QXA B;  1FGZ A;  4HAV B;  2ROV A;  1MKE A;  1FB8 A;  3WYF B;  2P0F A;  3N7C A;  1GG3 A;  2RRF A;  1DRO A;  1UNP A;  4HB3 B;  2J0J A;  1WG7 A;  1ZSQ A;  1BWN A;  4Z2N A;  1ZYI A;  2KGX B;  2PZ1 A;  2D4Q A;  2D10 A;  2KUQ A;  4F7U P;  2EMT A;  3ULB A;  2ZPY A;  2GUM A;  2UZR A;  1U5G A;  3CIK A;  3CXB B;  4IAP A;  2I5C A;  1W1H A;  3RCP A;  2J0K A;  4A6K A;  4KHB B;  2KCJ A;  1U27 A;  1X1G A;  1N3H A;  4B6H A;  4DX8 A;  4C0A A;  1RRP B;  2NBV A;  3NSU A;  4KVG B;  1FHO A;  5D3W A;  3D8D A;  1UEF A;  4K2P A;  3T06 A;  2YF0 A;  2N0Y A;  3ODO A;  4QJ5 B;  2OQB A;  1P6S A;  1AQC A;  2DHI A;  1ZVR A;  5HE3 A;  2R09 A;  2RSG A;  2CY5 A;  2VRW B;  4MK0 A;  1X86 A;  2P8V A;  2UVM A;  4D0N B;  2P0D A;  1BTN A;  5D3V A;  2ROZ B;  1SHC A;  2LOX A;  4GZU A;  5CLQ B;  2LKO A;  4F7G A;  2FJL A;  4Z2M B;  1FOE A;  3FSS A;  2Z0Q A;  2I1J A;  4MY6 A;  3QBV B;  5C6R A;  3V5W A;  2FJU B;  4EMO A;  3U7D A;  2DFK A;  2VSZ A;  3M1I B;  4HAY B;  3U8Z A;  4HB4 B;  4HB2 B;  3IVF A;  4XWX A;  3UZT A;  1KZG A;  2MDX A;  1IRS A;  3TVV A;  2QKM A;  1H4R A;  1XR0 B;  2MWN B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...