2YRYA

Solution structure of the ph domain of pleckstrin homology domain-containing family a member 6 from human
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
122
structure length
122
Chain Sequence
GSSGSSGGKRSHSMKRNPNAPVTKAGWLFKQASSGVKQWNKRWFVLVDRCLFYYKDEKEESILGSIPLLSFRVAAVQPSDNISRKHTFKAEHAGVRTYFFSAESPEEQEAWIQAMGEAARVQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the PH domain of Pleckstrin homology domain-containing family A member 6 from human
rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords Pleckstrin homology domain-containing family A member 6
total genus 13
structure length 122
sequence length 122
ec nomenclature
pdb deposition date 2007-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00169 PH PH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2yryA00
3PVUA 1V5UA 5JP4A 2YVCA 2QKMA 1X05A 4IOYX 1FGZA 2YS5A 3CIKA 3F0WA 1SHCA 1UPQA 1RRPB 1GC6A 2YF0A 1V89A 1Q67A 2KGXB 1LW3A 2DYNA 1XR0B 5DHFB 1NTVA 5KQ1A 4ZRJA 5LOPB 2GCJA 3VOQA 1U5EA 2W2WA 3PEGA 1UNQA 2Y8FA 2LOXA 4F7GA 1GC7A 1FHWA 2VKIA 2RSGA 3X23A 4DXAB 1DYNA 3GYPA 3RCPA 2D4QA 2VRWB 1UPRA 4IAPA 2K2JA 3QWMA 1MK9B 1K5GB 4HATB 2CAYA 2K00A 2DFKA 1EAZA 4K2PA 5HE0A 4EMOA 1W1HA 5FI1A 3PVLA 2MFQA 4HAUB 5CLQB 1E5WA 2NZ8B 5L81A 5C5BB 1B55A 2CY5A 2VSZA 1DDVA 2RLOA 2IFSA 2NMBA 1Z87A 3MPXA 1WGQA 2W2XD 1WJMA 2Z0QA 4TKNA 3MDBC 4Z2MB 3LJUX 3FEHA 2D11A 2E2XA 1XD4A 2QKLA 5EFXA 4KVGB 1P3RA 4BBKA 2I5CA 4CHMA 2Q13A 2HTHB 5J3TA 1MKEA 3PZDA 1BAKA 1WG7A 2DYQA 3TFMA 2ELBA 3V5WA 1MAIA 4WSFA 2YRYA 5CLLB 4CHJA 1EGXA 5HE3A 1Y19B 5JLJB 2W2XC 4D0NB 2HE7A 2DHKA 3KRXA 5DHAB 4GZUA 3QIJA 1J0WA 2DHJA 2COFA 4MT7A 2J0KA 3ZDTA 1EVHA 1XKEA 2ZPYA 4HAXB 3KY9A 5HE1A 2M14A 2MKRA 4GN1A 3U8ZA 4EKUA 1TJ6A 3SNHA 4HDOA 5GOWB 4XWXA 3ZVRA 2P8VA 1MK7B 2ROZB 1FB8A 3G9WA 5J3YA 5DIFB 3BJIA 3BINA 3SUZA 4GMVA 1V88A 3AU5A 1FHXA 3U7DA 2D9VA 2D9XA 3AU4A 3CXBB 1V5MA 4CYEA 2H7EA 2RNRB 5DI9B 2XQNM 4NSWA 1PLSA 1EF1A 1DDWA 2YT0A 2CODA 1ZC4B 5C5BA 3AJ4A 2D2QA 1BTKA 5LONB 1LB1A 4YONA 1U5FA 5DH9B 4KHOA 4HB4B 1ZC3B 4A6HA 4F7HA 5C79A 2Y8GA 4HB3B 1Y5OA 2JP2A 3SO6A 1P6SA 1PMSA 2YS3A 3P6AA 1X1GA 3N7CA 5D27A 4F7UP 5HE2A 4GMXB 3ULBA 1RJ2A 1QC6A 3TVVA 4Y94A 1FOEA 2GS0A 2ROVA 2COCA 4H8SA 4WVFB 1KI1B 2DA0A 2J0JA 2P0FA 3SV1A 4HDQA 3M1IB 4KAXB 1OY2A 1BTNA 4ZRKA 3OANA 2DX5A 2ADZA 3ODOA 1FAOA 3FM8C 3DXDA 1K5DB 1OQNA 2PZ1A 5D3WA 3SYXA 2Y7BA 1KZ7A 1W1DA 2BCJA 1GG3A 2G35A 1X11A 1N3HA 3D8DA 5JHHA 1U5GA 3HQCA 5D3YA 5D3VA 3PSCA 3DXCA 1DDMA 1U2BA 1TQZA 1QQGA 3ML4A 2OTXA 2P0HA 4HAYB 1X1FA 2UZRA 5KQ4A 1W1GA 2D10A 1KZGA 2KUPA 4KHAA 1U29A 1UNPA 1ZM0A 2ELAA 2EMTA 2N0YA 1MIXA 4L6EA 2YS1A 1P5TA 3PP2A 1I2HA 3A98B 4MK0A 2D9ZA 2GCLA 4K2OA 1NU2A 2M38A 2DTCA 1H10A 1WJ1A 3GYOA 5FI0A 3WYFB 1U27A 2MWNB 2AEHA 4GPTB 1ZSQA 4GXBA 2UVMA 3ODXA 2V76A 2J0MA 4C0AA 2LULA 3TW1A 1NI2A 3KSYA 1M7EA 2RUKB 3HW2B 1I7AA 2R0DA 1M7RA 3FSSA 1BWNA 4P7IA 4TYZA 3VIAA 1IRSA 2GJYA 2AL6A 2DKPA 4YL8A 2IYBA 2DLWA 4A5KA 3O96A 1WI1A 1V61A 4HAVB 2L1CA 2COAA 3DXEA 4A6KA 5C16A 4PNKA 2J59M 5KCVA 2N23A 2D9WA 4K81A 4HHVA 2H7DA 2P0DA 3UZTA 2L2IA 2UZSA 1MIZB 1FGYA 1XCGA 2I5FA 1UEFA 2D9YA 4EJNA 4NY0A 1PFJA 1DROA 1FHOA 2K2UA 3F5RA 2LKOA 3QBVB 3IVFA 3TO1A 1TXDA 3D8EA 2LOZA 1V5PA 3D8FA 2Z0OA 5C6RA 3A8QA 3WA0A 4ZRIA 4WJ7A 2I1JA 4A6FA 1X86A 4HB0B 1UNRA 1SGHA 1ZVRA 3PG7A 4IFSA 2Z0PA 1MPHA 4MY6A 4HAZB 1AWEA 4K17A 1J19A 3KZ1A 2OQBA 3HK0A 2EJ8A 2DHIA 3T06A 2KCJA 1ISNA 1H4RA 5J3QA 3A8PA 4DX90 3ULCA 4B6HA 2MDXA 3ODWA 1U5DA 4Z2NA 2R09A 1WVHA 2RVBB 2I1KA 4DBBA 1AQCA 2CY4A 2YT1A 3KRWA 4HB2B 2LYDA 5JHGA 1XODA 1WGUA 1NTYA 2EC1A 4PQ0A 2DN6A 3PVWA 4DX8A 1OMWA 2FJLA 2LG1A 2EMSA 2YSZA 2RGNB 3TCAA 4A6FB 2DKQA 3NSUA 3P7ZA 5D3XA 4KHBB 2CRFA 1XX0A 4HAWB 1DBHA 2DX1A 2X18A
chains in the Genus database with same CATH superfamily
3PVUA 1V5UA 5JP4A 2YVCA 2QKMA 1X05A 2RRFA 4QJ3B 4IOYX 1FGZA 2YS5A 3CIKA 3F0WA 5M4YB 1SHCA 1UPQA 1RRPB 4GOUA 1GC6A 2YF0A 2YT2A 1V89A 4D6WA 1Q67A 2KGXB 1LW3A 2DYNA 2R2YA 1XR0B 5DHFB 1NTVA 5KQ1A 4ZRJA 5LOPB 2GCJA 3VOQA 1U5EA 2W2WA 3PEGA 1UNQA 2Y8FA 2LOXA 4F7GA 1GC7A 1FHWA 2VKIA 2RSGA 3X23A 4DXAB 1DYNA 3GYPA 3RCPA 2D4QA 4QJ4B 2KIGA 2VRWB 1UPRA 4IAPA 2K2JA 3QWMA 2Z14A 1MK9B 1K5GB 4HATB 2CAYA 2K00A 2DFKA 1EAZA 4K2PA 5HE0A 4EMOA 1W1HA 5FI1A 3PVLA 2MFQA 4HAUB 5CLQB 1E5WA 2NZ8B 5L81A 5C5BB 1B55A 2CY5A 2VSZA 1DDVA 2RLOA 2IFSA 2NMBA 1Z87A 3MPXA 1WGQA 2W2XD 1WJMA 2Z0QA 4TKNA 3MDBC 4Z2MB 3LJUX 3FEHA 2D11A 2E2XA 1XD4A 2QKLA 5EFXA 4KVGB 1P3RA 4BBKA 2I5CA 4CHMA 2Q13A 2HTHB 5J3TA 1MKEA 3PZDA 1BAKA 1WG7A 2DYQA 3TFMA 2ELBA 3B77A 3V5WA 1MAIA 4WSFA 2YRYA 5CLLB 4CHJA 1EGXA 5HE3A 5I2MA 1Y19B 5JLJB 2W2XC 4D0NB 2HE7A 2KR0A 2DHKA 3KRXA 5DHAB 4GZUA 3QIJA 1J0WA 1ZYIA 2DHJA 2COFA 4MT7A 2J0KA 3ZDTA 1EVHA 1XKEA 2Z4DA 2ZPYA 4HAXB 3KY9A 5HE1A 4QXAB 2M14A 2GUMA 2MKRA 4GN1A 2FJUB 3U8ZA 4EKUA 1TJ6A 3SNHA 4HDOA 5GOWB 4XWXA 3ZVRA 2P8VA 1MK7B 2ROZB 1FB8A 3G9WA 3FVCA 5J3YA 5DIFB 3BJIA 3BINA 3SUZA 4GMVA 1V88A 3AU5A 1FHXA 3U7DA 2D9VA 2D9XA 3AU4A 3CXBB 1V5MA 4CYEA 2H7EA 2RNRB 5DI9B 2XQNM 4NSWA 1PLSA 1EF1A 1DDWA 2YT0A 2CODA 1ZC4B 5C5BA 2KUQA 3AJ4A 2D2QA 1BTKA 2Z13A 5LONB 1LB1A 4YONA 1U5FA 5DH9B 4KHOA 4HB4B 1ZC3B 4A6HA 4F7HA 5C79A 2Y8GA 4HB3B 1Y5OA 2ZKMX 2JP2A 3SO6A 1P6SA 1PMSA 2YS3A 3P6AA 1X1GA 3N7CA 5D27A 4F7UP 5HE2A 4GMXB 3ULBA 1RJ2A 1QC6A 3TVVA 4Y94A 1FOEA 2GS0A 2ROVA 4GNKB 2COCA 4H8SA 4WVFB 1KI1B 2DA0A 2J0JA 2P0FA 4QJ5B 3SV1A 4HDQA 3M1IB 2Z59A 4KAXB 1OY2A 4OSNA 5I2SA 1BTNA 4ZRKA 3OANA 2DX5A 2ADZA 3ODOA 1FAOA 3FM8C 3DXDA 1K5DB 1OQNA 2PZ1A 5D3WA 3SYXA 2Y7BA 4HSIA 1KZ7A 1W1DA 2BCJA 1GG3A 2G35A 1X11A 1N3HA 3D8DA 5JHHA 1U5GA 3HQCA 5D3YA 5D3VA 3HSAA 3OHMB 3PSCA 3DXCA 1DDMA 1U2BA 1TQZA 1QQGA 3ML4A 2OTXA 2P0HA 4HAYB 1X1FA 2UZRA 5KQ4A 1W1GA 2D10A 1KZGA 2KUPA 4KHAA 1U29A 1UNPA 1ZM0A 2ELAA 2EMTA 2N0YA 1MIXA 4L6EA 2YS1A 1P5TA 3PP2A 1I2HA 3A98B 4MK0A 2D9ZA 2GCLA 4K2OA 2M38A 1NU2A 2DTCA 1H10A 3GYOA 1WJ1A 5FI0A 3WYFB 1U27A 2MWNB 2AEHA 1T77A 4GPTB 1ZSQA 4GXBA 4L1RA 2UVMA 4DIXA 3ODXA 2V76A 5IRSA 2J0MA 4C0AA 2LULA 3TW1A 1NI2A 3KSYA 1M7EA 2RUKB 3HW2B 1I7AA 2R0DA 1M7RA 3FSSA 5LG4B 1BWNA 4P7IA 4TYZA 3VIAA 1IRSA 2GJYA 2AL6A 2DKPA 4YL8A 2IYBA 2DLWA 4A5KA 3O96A 4KHBA 1WI1A 1V61A 4HAVB 2L1CA 2COAA 3DXEA 4A6KA 5C16A 4PNKA 2J59M 5KCVA 3U12A 2N23A 2D9WA 4K81A 4HHVA 2H7DA 2P0DA 3UZTA 2L2IA 2UZSA 1MIZB 3NW8A 1FGYA 1XCGA 2I5FA 1UEFA 2D9YA 4EJNA 4NY0A 1PFJA 1DROA 1FHOA 2K2UA 3F5RA 2LKOA 3QBVB 2K49A 3IVFA 3TO1A 1TXDA 3D8EA 2LOZA 1V5PA 3D8FA 2Z0OA 5C6RA 3A8QA 3WA0A 4ZRIA 4WJ7A 4OT1A 2I1JA 4A6FA 1X86A 4HB0B 1UNRA 1SGHA 3PG7A 1ZVRA 4IFSA 2Z0PA 1MPHA 4MY6A 4HAZB 1AWEA 4K17A 1J19A 3KZ1A 2OQBA 3HK0A 2EJ8A 3HIEA 3NWDA 2DHIA 3T06A 2KCJA 1ISNA 1H4RA 5J3QA 3A8PA 4DX90 3ULCA 4B6HA 2MDXA 3ODWA 1U5DA 4Z2NA 2R09A 1WVHA 3NWFA 1MI1A 2RVBB 2I1KA 4DBBA 1AQCA 2K8EA 2KIEA 2CY4A 2YT1A 3KRWA 4HB2B 2LYDA 5JHGA 1XODA 1WGUA 3NWAA 1NTYA 2EC1A 4PQ0A 2DN6A 3PVWA 4DX8A 1OMWA 2FJLA 2LG1A 2EMSA 2YSZA 3A58A 2RGNB 3TCAA 4A6FB 2DKQA 3NSUA 3P7ZA 5D3XA 4CSQA 4KHBB 2CRFA 2NBVA 1XX0A 4HAWB 1DBHA 2DX1A 2X18A 3DCXA
chains in the Genus database with same CATH topology
3PVUA 1V5UA 5JP4A 2YVCA 2QKMA 1X05A 4IOYX 1FGZA 2YS5A 3CIKA 3F0WA 1SHCA 1UPQA 1RRPB 1GC6A 2YF0A 1V89A 1Q67A 2KGXB 1LW3A 2DYNA 1XR0B 5DHFB 1NTVA 5KQ1A 4ZRJA 5LOPB 2GCJA 3VOQA 1U5EA 2W2WA 3PEGA 1UNQA 2Y8FA 2LOXA 4F7GA 1GC7A 1FHWA 2VKIA 2RSGA 3X23A 4DXAB 1DYNA 3GYPA 3RCPA 2D4QA 2VRWB 1UPRA 4IAPA 2K2JA 3QWMA 1MK9B 1K5GB 4HATB 2CAYA 2K00A 2DFKA 1EAZA 4K2PA 5HE0A 4EMOA 1W1HA 5FI1A 3PVLA 2MFQA 4HAUB 5CLQB 1E5WA 2NZ8B 5L81A 5C5BB 1B55A 2CY5A 2VSZA 1DDVA 2RLOA 2IFSA 2NMBA 1Z87A 3MPXA 1WGQA 2W2XD 1WJMA 2Z0QA 4TKNA 3MDBC 4Z2MB 3LJUX 3FEHA 2D11A 2E2XA 1XD4A 2QKLA 5EFXA 4KVGB 1P3RA 4BBKA 2I5CA 4CHMA 2Q13A 2HTHB 5J3TA 1MKEA 3PZDA 1BAKA 1WG7A 2DYQA 3TFMA 2ELBA 3V5WA 1MAIA 4WSFA 2YRYA 5CLLB 4CHJA 1EGXA 5HE3A 1Y19B 5JLJB 2W2XC 4D0NB 2HE7A 2DHKA 3KRXA 5DHAB 4GZUA 3QIJA 1J0WA 2DHJA 2COFA 4MT7A 2J0KA 3ZDTA 1EVHA 1XKEA 2ZPYA 4HAXB 3KY9A 5HE1A 2M14A 2MKRA 4GN1A 3U8ZA 4EKUA 1TJ6A 3SNHA 4HDOA 5GOWB 4XWXA 3ZVRA 2P8VA 1MK7B 2ROZB 1FB8A 3G9WA 5J3YA 5DIFB 3BJIA 3BINA 3SUZA 4GMVA 1V88A 3AU5A 1FHXA 3U7DA 2D9VA 2D9XA 3AU4A 3CXBB 1V5MA 4CYEA 2H7EA 2RNRB 5DI9B 2XQNM 4NSWA 1PLSA 1EF1A 1DDWA 2YT0A 2CODA 1ZC4B 5C5BA 3AJ4A 2D2QA 1BTKA 5LONB 1LB1A 4YONA 1U5FA 5DH9B 4KHOA 4HB4B 1ZC3B 4A6HA 4F7HA 5C79A 2Y8GA 4HB3B 1Y5OA 2JP2A 3SO6A 1P6SA 1PMSA 2YS3A 3P6AA 1X1GA 3N7CA 5D27A 4F7UP 5HE2A 4GMXB 3ULBA 1RJ2A 1QC6A 3TVVA 4Y94A 1FOEA 2GS0A 2ROVA 2COCA 4H8SA 4WVFB 1KI1B 2DA0A 2J0JA 2P0FA 3SV1A 4HDQA 3M1IB 4KAXB 1OY2A 1BTNA 4ZRKA 3OANA 2DX5A 2ADZA 3ODOA 1FAOA 3FM8C 3DXDA 1K5DB 1OQNA 2PZ1A 5D3WA 3SYXA 2Y7BA 1KZ7A 1W1DA 2BCJA 1GG3A 2G35A 1X11A 1N3HA 3D8DA 5JHHA 1U5GA 3HQCA 5D3YA 5D3VA 3PSCA 3DXCA 1DDMA 1U2BA 1TQZA 1QQGA 3ML4A 2OTXA 2P0HA 4HAYB 1X1FA 2UZRA 5KQ4A 1W1GA 2D10A 1KZGA 2KUPA 4KHAA 1U29A 1UNPA 1ZM0A 2ELAA 2EMTA 2N0YA 1MIXA 4L6EA 2YS1A 1P5TA 3PP2A 1I2HA 3A98B 4MK0A 2D9ZA 2GCLA 4K2OA 1NU2A 2M38A 2DTCA 1H10A 1WJ1A 3GYOA 5FI0A 3WYFB 1U27A 2MWNB 2AEHA 4GPTB 1ZSQA 4GXBA 2UVMA 3ODXA 2V76A 2J0MA 4C0AA 2LULA 3TW1A 1NI2A 3KSYA 1M7EA 2RUKB 3HW2B 1I7AA 2R0DA 1M7RA 3FSSA 1BWNA 4P7IA 4TYZA 3VIAA 1IRSA 2GJYA 2AL6A 2DKPA 4YL8A 2IYBA 2DLWA 4A5KA 3O96A 1WI1A 1V61A 4HAVB 2L1CA 2COAA 3DXEA 4A6KA 5C16A 4PNKA 2J59M 5KCVA 2N23A 2D9WA 4K81A 4HHVA 2H7DA 2P0DA 3UZTA 2L2IA 2UZSA 1MIZB 1FGYA 1XCGA 2I5FA 1UEFA 2D9YA 4EJNA 4NY0A 1PFJA 1DROA 1FHOA 2K2UA 3F5RA 2LKOA 3QBVB 3IVFA 3TO1A 1TXDA 3D8EA 2LOZA 1V5PA 3D8FA 2Z0OA 5C6RA 3A8QA 3WA0A 4ZRIA 4WJ7A 2I1JA 4A6FA 1X86A 4HB0B 1UNRA 1SGHA 1ZVRA 3PG7A 4IFSA 2Z0PA 1MPHA 4MY6A 4HAZB 1AWEA 4K17A 1J19A 3KZ1A 2OQBA 3HK0A 2EJ8A 2DHIA 3T06A 2KCJA 1ISNA 1H4RA 5J3QA 3A8PA 4DX90 3ULCA 4B6HA 2MDXA 3ODWA 1U5DA 4Z2NA 2R09A 1WVHA 2RVBB 2I1KA 4DBBA 1AQCA 2CY4A 2YT1A 3KRWA 4HB2B 2LYDA 5JHGA 1XODA 1WGUA 1NTYA 2EC1A 4PQ0A 2DN6A 3PVWA 4DX8A 1OMWA 2FJLA 2LG1A 2EMSA 2YSZA 2RGNB 3TCAA 4A6FB 2DKQA 3NSUA 3P7ZA 5D3XA 4KHBB 2CRFA 1XX0A 4HAWB 1DBHA 2DX1A 2X18A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PVU A;  1V5U A;  5JP4 A;  2YVC A;  2QKM A;  1X05 A;  4IOY X;  1FGZ A;  2YS5 A;  3CIK A;  3F0W A;  1SHC A;  1UPQ A;  1RRP B;  1GC6 A;  2YF0 A;  1V89 A;  1Q67 A;  2KGX B;  1LW3 A;  2DYN A;  1XR0 B;  5DHF B;  1NTV A;  5KQ1 A;  4ZRJ A;  5LOP B;  2GCJ A;  3VOQ A;  1U5E A;  2W2W A;  3PEG A;  1UNQ A;  2Y8F A;  2LOX A;  4F7G A;  1GC7 A;  1FHW A;  2VKI A;  2RSG A;  3X23 A;  4DXA B;  1DYN A;  3GYP A;  3RCP A;  2D4Q A;  2VRW B;  1UPR A;  4IAP A;  2K2J A;  3QWM A;  1MK9 B;  1K5G B;  4HAT B;  2CAY A;  2K00 A;  2DFK A;  1EAZ A;  4K2P A;  5HE0 A;  4EMO A;  1W1H A;  5FI1 A;  3PVL A;  2MFQ A;  4HAU B;  5CLQ B;  1E5W A;  2NZ8 B;  5L81 A;  5C5B B;  1B55 A;  2CY5 A;  2VSZ A;  1DDV A;  2RLO A;  2IFS A;  2NMB A;  1Z87 A;  3MPX A;  1WGQ A;  2W2X D;  1WJM A;  2Z0Q A;  4TKN A;  3MDB C;  4Z2M B;  3LJU X;  3FEH A;  2D11 A;  2E2X A;  1XD4 A;  2QKL A;  5EFX A;  4KVG B;  1P3R A;  4BBK A;  2I5C A;  4CHM A;  2Q13 A;  2HTH B;  5J3T A;  1MKE A;  3PZD A;  1BAK A;  1WG7 A;  2DYQ A;  3TFM A;  2ELB A;  3V5W A;  1MAI A;  4WSF A;  2YRY A;  5CLL B;  4CHJ A;  1EGX A;  5HE3 A;  1Y19 B;  5JLJ B;  2W2X C;  4D0N B;  2HE7 A;  2DHK A;  3KRX A;  5DHA B;  4GZU A;  3QIJ A;  1J0W A;  2DHJ A;  2COF A;  4MT7 A;  2J0K A;  3ZDT A;  1EVH A;  1XKE A;  2ZPY A;  4HAX B;  3KY9 A;  5HE1 A;  2M14 A;  2MKR A;  4GN1 A;  3U8Z A;  4EKU A;  1TJ6 A;  3SNH A;  4HDO A;  5GOW B;  4XWX A;  3ZVR A;  2P8V A;  1MK7 B;  2ROZ B;  1FB8 A;  3G9W A;  5J3Y A;  5DIF B;  3BJI A;  3BIN A;  3SUZ A;  4GMV A;  1V88 A;  3AU5 A;  1FHX A;  3U7D A;  2D9V A;  2D9X A;  3AU4 A;  3CXB B;  1V5M A;  4CYE A;  2H7E A;  2RNR B;  5DI9 B;  2XQN M;  4NSW A;  1PLS A;  1EF1 A;  1DDW A;  2YT0 A;  2COD A;  1ZC4 B;  5C5B A;  3AJ4 A;  2D2Q A;  1BTK A;  5LON B;  1LB1 A;  4YON A;  1U5F A;  5DH9 B;  4KHO A;  4HB4 B;  1ZC3 B;  4A6H A;  4F7H A;  5C79 A;  2Y8G A;  4HB3 B;  1Y5O A;  2JP2 A;  3SO6 A;  1P6S A;  1PMS A;  2YS3 A;  3P6A A;  1X1G A;  3N7C A;  5D27 A;  4F7U P;  5HE2 A;  4GMX B;  3ULB A;  1RJ2 A;  1QC6 A;  3TVV A;  4Y94 A;  1FOE A;  2GS0 A;  2ROV A;  2COC A;  4H8S A;  4WVF B;  1KI1 B;  2DA0 A;  2J0J A;  2P0F A;  3SV1 A;  4HDQ A;  3M1I B;  4KAX B;  1OY2 A;  1BTN A;  4ZRK A;  3OAN A;  2DX5 A;  2ADZ A;  3ODO A;  1FAO A;  3FM8 C;  3DXD A;  1K5D B;  1OQN A;  2PZ1 A;  5D3W A;  3SYX A;  2Y7B A;  1KZ7 A;  1W1D A;  2BCJ A;  1GG3 A;  2G35 A;  1X11 A;  1N3H A;  3D8D A;  5JHH A;  1U5G A;  3HQC A;  5D3Y A;  5D3V A;  3PSC A;  3DXC A;  1DDM A;  1U2B A;  1TQZ A;  1QQG A;  3ML4 A;  2OTX A;  2P0H A;  4HAY B;  1X1F A;  2UZR A;  5KQ4 A;  1W1G A;  2D10 A;  1KZG A;  2KUP A;  4KHA A;  1U29 A;  1UNP A;  1ZM0 A;  2ELA A;  2EMT A;  2N0Y A;  1MIX A;  4L6E A;  2YS1 A;  1P5T A;  3PP2 A;  1I2H A;  3A98 B;  4MK0 A;  2D9Z A;  2GCL A;  4K2O A;  1NU2 A;  2M38 A;  2DTC A;  1H10 A;  1WJ1 A;  3GYO A;  5FI0 A;  3WYF B;  1U27 A;  2MWN B;  2AEH A;  4GPT B;  1ZSQ A;  4GXB A;  2UVM A;  3ODX A;  2V76 A;  2J0M A;  4C0A A;  2LUL A;  3TW1 A;  1NI2 A;  3KSY A;  1M7E A;  2RUK B;  3HW2 B;  1I7A A;  2R0D A;  1M7R A;  3FSS A;  1BWN A;  4P7I A;  4TYZ A;  3VIA A;  1IRS A;  2GJY A;  2AL6 A;  2DKP A;  4YL8 A;  2IYB A;  2DLW A;  4A5K A;  3O96 A;  1WI1 A;  1V61 A;  4HAV B;  2L1C A;  2COA A;  3DXE A;  4A6K A;  5C16 A;  4PNK A;  2J59 M;  5KCV A;  2N23 A;  2D9W A;  4K81 A;  4HHV A;  2H7D A;  2P0D A;  3UZT A;  2L2I A;  2UZS A;  1MIZ B;  1FGY A;  1XCG A;  2I5F A;  1UEF A;  2D9Y A;  4EJN A;  4NY0 A;  1PFJ A;  1DRO A;  1FHO A;  2K2U A;  3F5R A;  2LKO A;  3QBV B;  3IVF A;  3TO1 A;  1TXD A;  3D8E A;  2LOZ A;  1V5P A;  3D8F A;  2Z0O A;  5C6R A;  3A8Q A;  3WA0 A;  4ZRI A;  4WJ7 A;  2I1J A;  4A6F A;  1X86 A;  4HB0 B;  1UNR A;  1SGH A;  1ZVR A;  3PG7 A;  4IFS A;  2Z0P A;  1MPH A;  4MY6 A;  4HAZ B;  1AWE A;  4K17 A;  1J19 A;  3KZ1 A;  2OQB A;  3HK0 A;  2EJ8 A;  2DHI A;  3T06 A;  2KCJ A;  1ISN A;  1H4R A;  5J3Q A;  3A8P A;  4DX9 0;  3ULC A;  4B6H A;  2MDX A;  3ODW A;  1U5D A;  4Z2N A;  2R09 A;  1WVH A;  2RVB B;  2I1K A;  4DBB A;  1AQC A;  2CY4 A;  2YT1 A;  3KRW A;  4HB2 B;  2LYD A;  5JHG A;  1XOD A;  1WGU A;  1NTY A;  2EC1 A;  4PQ0 A;  2DN6 A;  3PVW A;  4DX8 A;  1OMW A;  2FJL A;  2LG1 A;  2EMS A;  2YSZ A;  2RGN B;  3TCA A;  4A6F B;  2DKQ A;  3NSU A;  3P7Z A;  5D3X A;  4KHB B;  2CRF A;  1XX0 A;  4HAW B;  1DBH A;  2DX1 A;  2X18 A; 
#chains in the Genus database with same CATH topology
 3PVU A;  1V5U A;  5JP4 A;  2YVC A;  2QKM A;  1X05 A;  2RRF A;  4QJ3 B;  4IOY X;  1FGZ A;  2YS5 A;  3CIK A;  3F0W A;  5M4Y B;  1SHC A;  1UPQ A;  1RRP B;  4GOU A;  1GC6 A;  2YF0 A;  2YT2 A;  1V89 A;  4D6W A;  1Q67 A;  2KGX B;  1LW3 A;  2DYN A;  2R2Y A;  1XR0 B;  5DHF B;  1NTV A;  5KQ1 A;  4ZRJ A;  5LOP B;  2GCJ A;  3VOQ A;  1U5E A;  2W2W A;  3PEG A;  1UNQ A;  2Y8F A;  2LOX A;  4F7G A;  1GC7 A;  1FHW A;  2VKI A;  2RSG A;  3X23 A;  4DXA B;  1DYN A;  3GYP A;  3RCP A;  2D4Q A;  4QJ4 B;  2KIG A;  2VRW B;  1UPR A;  4IAP A;  2K2J A;  3QWM A;  2Z14 A;  1MK9 B;  1K5G B;  4HAT B;  2CAY A;  2K00 A;  2DFK A;  1EAZ A;  4K2P A;  5HE0 A;  4EMO A;  1W1H A;  5FI1 A;  3PVL A;  2MFQ A;  4HAU B;  5CLQ B;  1E5W A;  2NZ8 B;  5L81 A;  5C5B B;  1B55 A;  2CY5 A;  2VSZ A;  1DDV A;  2RLO A;  2IFS A;  2NMB A;  1Z87 A;  3MPX A;  1WGQ A;  2W2X D;  1WJM A;  2Z0Q A;  4TKN A;  3MDB C;  4Z2M B;  3LJU X;  3FEH A;  2D11 A;  2E2X A;  1XD4 A;  2QKL A;  5EFX A;  4KVG B;  1P3R A;  4BBK A;  2I5C A;  4CHM A;  2Q13 A;  2HTH B;  5J3T A;  1MKE A;  3PZD A;  1BAK A;  1WG7 A;  2DYQ A;  3TFM A;  2ELB A;  3B77 A;  3V5W A;  1MAI A;  4WSF A;  2YRY A;  5CLL B;  4CHJ A;  1EGX A;  5HE3 A;  5I2M A;  1Y19 B;  5JLJ B;  2W2X C;  4D0N B;  2HE7 A;  2KR0 A;  2DHK A;  3KRX A;  5DHA B;  4GZU A;  3QIJ A;  1J0W A;  1ZYI A;  2DHJ A;  2COF A;  4MT7 A;  2J0K A;  3ZDT A;  1EVH A;  1XKE A;  2Z4D A;  2ZPY A;  4HAX B;  3KY9 A;  5HE1 A;  4QXA B;  2M14 A;  2GUM A;  2MKR A;  4GN1 A;  2FJU B;  3U8Z A;  4EKU A;  1TJ6 A;  3SNH A;  4HDO A;  5GOW B;  4XWX A;  3ZVR A;  2P8V A;  1MK7 B;  2ROZ B;  1FB8 A;  3G9W A;  3FVC A;  5J3Y A;  5DIF B;  3BJI A;  3BIN A;  3SUZ A;  4GMV A;  1V88 A;  3AU5 A;  1FHX A;  3U7D A;  2D9V A;  2D9X A;  3AU4 A;  3CXB B;  1V5M A;  4CYE A;  2H7E A;  2RNR B;  5DI9 B;  2XQN M;  4NSW A;  1PLS A;  1EF1 A;  1DDW A;  2YT0 A;  2COD A;  1ZC4 B;  5C5B A;  2KUQ A;  3AJ4 A;  2D2Q A;  1BTK A;  2Z13 A;  5LON B;  1LB1 A;  4YON A;  1U5F A;  5DH9 B;  4KHO A;  4HB4 B;  1ZC3 B;  4A6H A;  4F7H A;  5C79 A;  2Y8G A;  4HB3 B;  1Y5O A;  2ZKM X;  2JP2 A;  3SO6 A;  1P6S A;  1PMS A;  2YS3 A;  3P6A A;  1X1G A;  3N7C A;  5D27 A;  4F7U P;  5HE2 A;  4GMX B;  3ULB A;  1RJ2 A;  1QC6 A;  3TVV A;  4Y94 A;  1FOE A;  2GS0 A;  2ROV A;  4GNK B;  2COC A;  4H8S A;  4WVF B;  1KI1 B;  2DA0 A;  2J0J A;  2P0F A;  4QJ5 B;  3SV1 A;  4HDQ A;  3M1I B;  2Z59 A;  4KAX B;  1OY2 A;  4OSN A;  5I2S A;  1BTN A;  4ZRK A;  3OAN A;  2DX5 A;  2ADZ A;  3ODO A;  1FAO A;  3FM8 C;  3DXD A;  1K5D B;  1OQN A;  2PZ1 A;  5D3W A;  3SYX A;  2Y7B A;  4HSI A;  1KZ7 A;  1W1D A;  2BCJ A;  1GG3 A;  2G35 A;  1X11 A;  1N3H A;  3D8D A;  5JHH A;  1U5G A;  3HQC A;  5D3Y A;  5D3V A;  3HSA A;  3OHM B;  3PSC A;  3DXC A;  1DDM A;  1U2B A;  1TQZ A;  1QQG A;  3ML4 A;  2OTX A;  2P0H A;  4HAY B;  1X1F A;  2UZR A;  5KQ4 A;  1W1G A;  2D10 A;  1KZG A;  2KUP A;  4KHA A;  1U29 A;  1UNP A;  1ZM0 A;  2ELA A;  2EMT A;  2N0Y A;  1MIX A;  4L6E A;  2YS1 A;  1P5T A;  3PP2 A;  1I2H A;  3A98 B;  4MK0 A;  2D9Z A;  2GCL A;  4K2O A;  2M38 A;  1NU2 A;  2DTC A;  1H10 A;  3GYO A;  1WJ1 A;  5FI0 A;  3WYF B;  1U27 A;  2MWN B;  2AEH A;  1T77 A;  4GPT B;  1ZSQ A;  4GXB A;  4L1R A;  2UVM A;  4DIX A;  3ODX A;  2V76 A;  5IRS A;  2J0M A;  4C0A A;  2LUL A;  3TW1 A;  1NI2 A;  3KSY A;  1M7E A;  2RUK B;  3HW2 B;  1I7A A;  2R0D A;  1M7R A;  3FSS A;  5LG4 B;  1BWN A;  4P7I A;  4TYZ A;  3VIA A;  1IRS A;  2GJY A;  2AL6 A;  2DKP A;  4YL8 A;  2IYB A;  2DLW A;  4A5K A;  3O96 A;  4KHB A;  1WI1 A;  1V61 A;  4HAV B;  2L1C A;  2COA A;  3DXE A;  4A6K A;  5C16 A;  4PNK A;  2J59 M;  5KCV A;  3U12 A;  2N23 A;  2D9W A;  4K81 A;  4HHV A;  2H7D A;  2P0D A;  3UZT A;  2L2I A;  2UZS A;  1MIZ B;  3NW8 A;  1FGY A;  1XCG A;  2I5F A;  1UEF A;  2D9Y A;  4EJN A;  4NY0 A;  1PFJ A;  1DRO A;  1FHO A;  2K2U A;  3F5R A;  2LKO A;  3QBV B;  2K49 A;  3IVF A;  3TO1 A;  1TXD A;  3D8E A;  2LOZ A;  1V5P A;  3D8F A;  2Z0O A;  5C6R A;  3A8Q A;  3WA0 A;  4ZRI A;  4WJ7 A;  4OT1 A;  2I1J A;  4A6F A;  1X86 A;  4HB0 B;  1UNR A;  1SGH A;  3PG7 A;  1ZVR A;  4IFS A;  2Z0P A;  1MPH A;  4MY6 A;  4HAZ B;  1AWE A;  4K17 A;  1J19 A;  3KZ1 A;  2OQB A;  3HK0 A;  2EJ8 A;  3HIE A;  3NWD A;  2DHI A;  3T06 A;  2KCJ A;  1ISN A;  1H4R A;  5J3Q A;  3A8P A;  4DX9 0;  3ULC A;  4B6H A;  2MDX A;  3ODW A;  1U5D A;  4Z2N A;  2R09 A;  1WVH A;  3NWF A;  1MI1 A;  2RVB B;  2I1K A;  4DBB A;  1AQC A;  2K8E A;  2KIE A;  2CY4 A;  2YT1 A;  3KRW A;  4HB2 B;  2LYD A;  5JHG A;  1XOD A;  1WGU A;  3NWA A;  1NTY A;  2EC1 A;  4PQ0 A;  2DN6 A;  3PVW A;  4DX8 A;  1OMW A;  2FJL A;  2LG1 A;  2EMS A;  2YSZ A;  3A58 A;  2RGN B;  3TCA A;  4A6F B;  2DKQ A;  3NSU A;  3P7Z A;  5D3X A;  4CSQ A;  4KHB B;  2CRF A;  2NBV A;  1XX0 A;  4HAW B;  1DBH A;  2DX1 A;  2X18 A;  3DCX A; 
#chains in the Genus database with same CATH homology
 3PVU A;  1V5U A;  5JP4 A;  2YVC A;  2QKM A;  1X05 A;  4IOY X;  1FGZ A;  2YS5 A;  3CIK A;  3F0W A;  1SHC A;  1UPQ A;  1RRP B;  1GC6 A;  2YF0 A;  1V89 A;  1Q67 A;  2KGX B;  1LW3 A;  2DYN A;  1XR0 B;  5DHF B;  1NTV A;  5KQ1 A;  4ZRJ A;  5LOP B;  2GCJ A;  3VOQ A;  1U5E A;  2W2W A;  3PEG A;  1UNQ A;  2Y8F A;  2LOX A;  4F7G A;  1GC7 A;  1FHW A;  2VKI A;  2RSG A;  3X23 A;  4DXA B;  1DYN A;  3GYP A;  3RCP A;  2D4Q A;  2VRW B;  1UPR A;  4IAP A;  2K2J A;  3QWM A;  1MK9 B;  1K5G B;  4HAT B;  2CAY A;  2K00 A;  2DFK A;  1EAZ A;  4K2P A;  5HE0 A;  4EMO A;  1W1H A;  5FI1 A;  3PVL A;  2MFQ A;  4HAU B;  5CLQ B;  1E5W A;  2NZ8 B;  5L81 A;  5C5B B;  1B55 A;  2CY5 A;  2VSZ A;  1DDV A;  2RLO A;  2IFS A;  2NMB A;  1Z87 A;  3MPX A;  1WGQ A;  2W2X D;  1WJM A;  2Z0Q A;  4TKN A;  3MDB C;  4Z2M B;  3LJU X;  3FEH A;  2D11 A;  2E2X A;  1XD4 A;  2QKL A;  5EFX A;  4KVG B;  1P3R A;  4BBK A;  2I5C A;  4CHM A;  2Q13 A;  2HTH B;  5J3T A;  1MKE A;  3PZD A;  1BAK A;  1WG7 A;  2DYQ A;  3TFM A;  2ELB A;  3V5W A;  1MAI A;  4WSF A;  2YRY A;  5CLL B;  4CHJ A;  1EGX A;  5HE3 A;  1Y19 B;  5JLJ B;  2W2X C;  4D0N B;  2HE7 A;  2DHK A;  3KRX A;  5DHA B;  4GZU A;  3QIJ A;  1J0W A;  2DHJ A;  2COF A;  4MT7 A;  2J0K A;  3ZDT A;  1EVH A;  1XKE A;  2ZPY A;  4HAX B;  3KY9 A;  5HE1 A;  2M14 A;  2MKR A;  4GN1 A;  3U8Z A;  4EKU A;  1TJ6 A;  3SNH A;  4HDO A;  5GOW B;  4XWX A;  3ZVR A;  2P8V A;  1MK7 B;  2ROZ B;  1FB8 A;  3G9W A;  5J3Y A;  5DIF B;  3BJI A;  3BIN A;  3SUZ A;  4GMV A;  1V88 A;  3AU5 A;  1FHX A;  3U7D A;  2D9V A;  2D9X A;  3AU4 A;  3CXB B;  1V5M A;  4CYE A;  2H7E A;  2RNR B;  5DI9 B;  2XQN M;  4NSW A;  1PLS A;  1EF1 A;  1DDW A;  2YT0 A;  2COD A;  1ZC4 B;  5C5B A;  3AJ4 A;  2D2Q A;  1BTK A;  5LON B;  1LB1 A;  4YON A;  1U5F A;  5DH9 B;  4KHO A;  4HB4 B;  1ZC3 B;  4A6H A;  4F7H A;  5C79 A;  2Y8G A;  4HB3 B;  1Y5O A;  2JP2 A;  3SO6 A;  1P6S A;  1PMS A;  2YS3 A;  3P6A A;  1X1G A;  3N7C A;  5D27 A;  4F7U P;  5HE2 A;  4GMX B;  3ULB A;  1RJ2 A;  1QC6 A;  3TVV A;  4Y94 A;  1FOE A;  2GS0 A;  2ROV A;  2COC A;  4H8S A;  4WVF B;  1KI1 B;  2DA0 A;  2J0J A;  2P0F A;  3SV1 A;  4HDQ A;  3M1I B;  4KAX B;  1OY2 A;  1BTN A;  4ZRK A;  3OAN A;  2DX5 A;  2ADZ A;  3ODO A;  1FAO A;  3FM8 C;  3DXD A;  1K5D B;  1OQN A;  2PZ1 A;  5D3W A;  3SYX A;  2Y7B A;  1KZ7 A;  1W1D A;  2BCJ A;  1GG3 A;  2G35 A;  1X11 A;  1N3H A;  3D8D A;  5JHH A;  1U5G A;  3HQC A;  5D3Y A;  5D3V A;  3PSC A;  3DXC A;  1DDM A;  1U2B A;  1TQZ A;  1QQG A;  3ML4 A;  2OTX A;  2P0H A;  4HAY B;  1X1F A;  2UZR A;  5KQ4 A;  1W1G A;  2D10 A;  1KZG A;  2KUP A;  4KHA A;  1U29 A;  1UNP A;  1ZM0 A;  2ELA A;  2EMT A;  2N0Y A;  1MIX A;  4L6E A;  2YS1 A;  1P5T A;  3PP2 A;  1I2H A;  3A98 B;  4MK0 A;  2D9Z A;  2GCL A;  4K2O A;  1NU2 A;  2M38 A;  2DTC A;  1H10 A;  1WJ1 A;  3GYO A;  5FI0 A;  3WYF B;  1U27 A;  2MWN B;  2AEH A;  4GPT B;  1ZSQ A;  4GXB A;  2UVM A;  3ODX A;  2V76 A;  2J0M A;  4C0A A;  2LUL A;  3TW1 A;  1NI2 A;  3KSY A;  1M7E A;  2RUK B;  3HW2 B;  1I7A A;  2R0D A;  1M7R A;  3FSS A;  1BWN A;  4P7I A;  4TYZ A;  3VIA A;  1IRS A;  2GJY A;  2AL6 A;  2DKP A;  4YL8 A;  2IYB A;  2DLW A;  4A5K A;  3O96 A;  1WI1 A;  1V61 A;  4HAV B;  2L1C A;  2COA A;  3DXE A;  4A6K A;  5C16 A;  4PNK A;  2J59 M;  5KCV A;  2N23 A;  2D9W A;  4K81 A;  4HHV A;  2H7D A;  2P0D A;  3UZT A;  2L2I A;  2UZS A;  1MIZ B;  1FGY A;  1XCG A;  2I5F A;  1UEF A;  2D9Y A;  4EJN A;  4NY0 A;  1PFJ A;  1DRO A;  1FHO A;  2K2U A;  3F5R A;  2LKO A;  3QBV B;  3IVF A;  3TO1 A;  1TXD A;  3D8E A;  2LOZ A;  1V5P A;  3D8F A;  2Z0O A;  5C6R A;  3A8Q A;  3WA0 A;  4ZRI A;  4WJ7 A;  2I1J A;  4A6F A;  1X86 A;  4HB0 B;  1UNR A;  1SGH A;  1ZVR A;  3PG7 A;  4IFS A;  2Z0P A;  1MPH A;  4MY6 A;  4HAZ B;  1AWE A;  4K17 A;  1J19 A;  3KZ1 A;  2OQB A;  3HK0 A;  2EJ8 A;  2DHI A;  3T06 A;  2KCJ A;  1ISN A;  1H4R A;  5J3Q A;  3A8P A;  4DX9 0;  3ULC A;  4B6H A;  2MDX A;  3ODW A;  1U5D A;  4Z2N A;  2R09 A;  1WVH A;  2RVB B;  2I1K A;  4DBB A;  1AQC A;  2CY4 A;  2YT1 A;  3KRW A;  4HB2 B;  2LYD A;  5JHG A;  1XOD A;  1WGU A;  1NTY A;  2EC1 A;  4PQ0 A;  2DN6 A;  3PVW A;  4DX8 A;  1OMW A;  2FJL A;  2LG1 A;  2EMS A;  2YSZ A;  2RGN B;  3TCA A;  4A6F B;  2DKQ A;  3NSU A;  3P7Z A;  5D3X A;  4KHB B;  2CRF A;  1XX0 A;  4HAW B;  1DBH A;  2DX1 A;  2X18 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...