2YRYA

Solution structure of the ph domain of pleckstrin homology domain-containing family a member 6 from human
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
122
structure length
122
Chain Sequence
GSSGSSGGKRSHSMKRNPNAPVTKAGWLFKQASSGVKQWNKRWFVLVDRCLFYYKDEKEESILGSIPLLSFRVAAVQPSDNISRKHTFKAEHAGVRTYFFSAESPEEQEAWIQAMGEAARVQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pleckstrin homology domain-containing family A member 6
publication title Solution structure of the PH domain of Pleckstrin homology domain-containing family A member 6 from human
rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 13
structure length 122
sequence length 122
ec nomenclature
pdb deposition date 2007-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00169 PH PH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2yryA00
4HAZB 2YSZA 5KCVA 1XODA 3IVFA 2EC1A 5L81A 3F0WA 3HW2B 3ZDTA 3AU4A 2I5CA 3SYXA 1I7AA 1SHCA 4XWXA 2EJ8A 1X1GA 2KUPA 3OANA 3P7ZA 1SGHA 3U8ZA 2D9WA 1MAIA 1U5FA 3TO1A 2MKRA 2DKQA 1V5UA 3NSUA 1TQZA 1N3HA 3KRWA 3BINA 3PVWA 4MY6A 5JP4A 4MT7A 1Y5OA 4HHVA 1W1GA 2DHJA 2ROZB 3SO6A 1J0WA 2DA0A 2YRYA 1AWEA 4L6EA 1X1FA 4PNKA 4MK0A 2BCJA 4YL8A 1KZGA 1XKEA 5D3WA 4EKUA 1U5EA 1XR0B 1NI2A 2ELAA 3FEHA 3ML4A 4TKNA 1U2BA 1P5TA 2H7EA 5J3TA 4GPTB 1XCGA 1UEFA 1LW3A 4NSWA 1MIZB 5HE3A 1EVHA 2J0KA 1ZC4B 4GMVA 2JP2A 4A6FA 4Z2NA 1TJ6A 5KQ1A 5CLLB 2DKPA 1DDWA 1QQGA 4GN1A 1K5DB 3A98B 1W1DA 1FGYA 4F7UP 1U27A 3ULBA 5FI0A 5J3QA 4HAVB 2FJLA 1FOEA 4ZRJA 1IRSA 5D3YA 2XQNM 4K2PA 3TW1A 1Y19B 3VOQA 4D0NB 2GCJA 1DYNA 3ODXA 2HE7A 2MFQA 5D27A 5JHHA 3CXBB 1WG7A 1WGQA 1XX0A 3BJIA 1GC7A 1GG3A 1KZ7A 2KCJA 1V61A 2RVBB 4WJ7A 2W2WA 2LG1A 1EGXA 2J0MA 2AEHA 3DXCA 1OY2A 5DH9B 1UNRA 2CAYA 2LOXA 1WJMA 1MK9B 5CLQB 5D3VA 5DIFB 1P3RA 3PVLA 2QKMA 2DFKA 3ODWA 1W1HA 1B55A 2Z0OA 2D9YA 1BWNA 1J19A 4H8SA 2ROVA 2AL6A 1NU2A 2D11A 2D2QA 3KRXA 2DX5A 4C0AA 4EMOA 5EFXA 2LULA 1DDMA 3PVUA 3T06A 1H4RA 3D8FA 3ULCA 4CHMA 3F5RA 4Z2MB 5J3YA 3KSYA 2YT1A 3SUZA 3D8DA 1M7EA 2EMSA 3PP2A 1FB8A 2MWNB 2DX1A 1K5GB 2D4QA 2EMTA 1FGZA 3QIJA 4HDQA 2YS5A 3GYPA 5DHAB 2I1JA 3MDBC 1PMSA 3O96A 2H7DA 2CY5A 3TVVA 5FI1A 2W2XD 4NY0A 2K00A 3UZTA 2YVCA 3FM8C 5C5BB 3QBVB 2N23A 2P0DA 1WI1A 3FSSA 5GOWB 2UZSA 1FAOA 2DYNA 3G9WA 3X23A 1BAKA 2W2XC 2COAA 1V5MA 2CY4A 1QC6A 1UNQA 1X86A 2CRFA 2LKOA 5C6RA 1X05A 4HB0B 1PLSA 1TXDA 3U7DA 2P8VA 1Z87A 1P6SA 2GJYA 4KHBB 2Z0PA 1LB1A 2D9XA 4KVGB 2X18A 5HE2A 1FHWA 3PEGA 2Y8GA 2OTXA 4ZRKA 5C79A 2YF0A 2D9ZA 2VKIA 2PZ1A 4F7GA 2ZPYA 2CODA 3TFMA 3A8QA 1V5PA 3N7CA 2N0YA 1U29A 2YS1A 4Y94A 2G35A 2Y8FA 1EF1A 2IFSA 1KI1B 2KGXB 1DDVA 3KZ1A 4IAPA 2VRWB 3A8PA 2M14A 2E2XA 1H10A 2D9VA 1U5DA 1NTVA 3WA0A 5JHGA 3V5WA 4K17A 2ELBA 2L2IA 2DN6A 4DX90 1ZSQA 1GC6A 3AJ4A 4YONA 1V89A 1UPRA 4HDOA 4K2OA 1XD4A 4DX8A 2K2UA 2QKLA 1E5WA 1NTYA 2NMBA 2J59M 3ODOA 2RUKB 1DBHA 4HAUB 4GZUA 1V88A 2DHIA 4BBKA 1UNPA 3P6AA 4CHJA 1X11A 3M1IB 3DXDA 1I2HA 2LYDA 5C5BA 4KHOA 4HB2B 4KAXB 2P0HA 1BTNA 1MIXA 1Q67A 2NZ8B 3PSCA 2R0DA 1WVHA 4DBBA 1FHXA 2RNRB 3AU5A 4WSFA 5C16A 4CYEA 1ZVRA 4EJNA 1EAZA 4HAWB 4HAYB 2OQBA 4ZRIA 3PZDA 5DHFB 2Z0QA 2I5FA 2DTCA 1ZM0A 3CIKA 4K81A 2DHKA 2IYBA 1OQNA 2Q13A 4HAXB 2R09A 4A6KA 4B6HA 1MPHA 2GCLA 5JLJB 4KHAA 2K2JA 3WYFB 2L1CA 3HK0A 4F7HA 3PG7A 1MKEA 5D3XA 2P0FA 1ZC3B 2ADZA 4HB3B 1BTKA 1OMWA 4TYZA 4WVFB 4DXAB 1M7RA 4GXBA 3D8EA 4HB4B 3HQCA 1FHOA 5LONB 2UZRA 4A6FB 3RCPA 2Y7BA 1UPQA 2UVMA 4PQ0A 2RLOA 1U5GA 4A5KA 2RGNB 2VSZA 4GMXB 3SV1A 2M38A 5DI9B 2I1KA 3ZVRA 1ISNA 3GYOA 4IFSA 2YS3A 2J0JA 5KQ4A 1MK7B 4IOYX 2LOZA 1DROA 2RSGA 3DXEA 1PFJA 2V76A 3LJUX 3KY9A 4A6HA 1RRPB 3SNHA 4HATB 5HE0A 5HE1A 5LOPB 2COCA 2HTHB 2DLWA 2MDXA 3QWMA 4P7IA 1WJ1A 2GS0A 3VIAA 2D10A 2YT0A 1WGUA 2COFA 1AQCA 1RJ2A 3MPXA 3TCAA 2DYQA
chains in the Genus database with same CATH superfamily
4HAZB 2YSZA 5KCVA 1XODA 3IVFA 2EC1A 5L81A 3F0WA 3HW2B 3ZDTA 3AU4A 2I5CA 3SYXA 1I7AA 1SHCA 4XWXA 2EJ8A 1X1GA 2KUPA 3OANA 3P7ZA 1SGHA 3U8ZA 2D9WA 1MAIA 1U5FA 3TO1A 2MKRA 2DKQA 1V5UA 3NSUA 1TQZA 1N3HA 3KRWA 3NWFA 3BINA 3PVWA 4CSQA 4MY6A 5JP4A 2Z14A 4MT7A 1Y5OA 4HHVA 1W1GA 2ZKMX 2DHJA 2ROZB 3SO6A 3NWAA 1J0WA 3NWDA 2DA0A 2YRYA 1AWEA 4L6EA 1X1FA 4PNKA 4MK0A 2BCJA 4YL8A 1KZGA 1XKEA 5D3WA 4EKUA 1U5EA 1XR0B 1NI2A 2ELAA 3FEHA 3ML4A 4TKNA 1U2BA 4OT1A 1P5TA 2H7EA 5J3TA 4GPTB 1XCGA 1UEFA 1LW3A 4NSWA 1MIZB 5HE3A 1EVHA 2J0KA 1ZC4B 4GMVA 2JP2A 4A6FA 4Z2NA 1TJ6A 5KQ1A 5CLLB 2DKPA 2KIEA 1DDWA 1QQGA 4GN1A 1K5DB 3A98B 1W1DA 1FGYA 4F7UP 1U27A 3ULBA 5FI0A 5J3QA 4HAVB 2FJLA 1FOEA 4ZRJA 1IRSA 5D3YA 2XQNM 4K2PA 3TW1A 1Y19B 3VOQA 4D0NB 2GCJA 1DYNA 2YT2A 3ODXA 2HE7A 1ZYIA 3HIEA 2MFQA 4OSNA 5D27A 5JHHA 4QJ4B 5IRSA 3CXBB 1WG7A 1WGQA 1XX0A 3BJIA 1GC7A 1GG3A 1KZ7A 2KCJA 1V61A 2RVBB 4WJ7A 2W2WA 2KUQA 2LG1A 1EGXA 2J0MA 2AEHA 3B77A 3DXCA 1OY2A 5DH9B 1UNRA 2CAYA 2LOXA 1WJMA 1MK9B 5CLQB 5D3VA 5DIFB 1P3RA 3PVLA 2QKMA 2DFKA 5LG4B 3ODWA 1W1HA 1B55A 4HSIA 2Z0OA 2R2YA 2D9YA 1BWNA 1J19A 4H8SA 3U12A 2ROVA 2AL6A 1NU2A 2D11A 2D2QA 3KRXA 2DX5A 4C0AA 4EMOA 5EFXA 2LULA 1DDMA 3PVUA 3T06A 1H4RA 3D8FA 3ULCA 4CHMA 3F5RA 4Z2MB 5J3YA 3KSYA 2YT1A 3SUZA 3D8DA 1M7EA 2EMSA 3PP2A 1FB8A 2MWNB 2DX1A 1K5GB 2K8EA 2D4QA 2EMTA 1FGZA 3QIJA 4HDQA 2YS5A 3GYPA 5DHAB 2I1JA 3MDBC 1PMSA 3O96A 2H7DA 2CY5A 3TVVA 5FI1A 2W2XD 4NY0A 4DIXA 2K00A 3UZTA 2YVCA 3FM8C 5C5BB 3QBVB 2N23A 4QJ5B 2P0DA 1WI1A 3FSSA 5GOWB 2UZSA 1FAOA 2DYNA 3G9WA 3A58A 5I2SA 3X23A 1BAKA 2W2XC 4KHBA 2COAA 1V5MA 2CY4A 1QC6A 1UNQA 1X86A 2CRFA 2LKOA 5C6RA 1X05A 4HB0B 1PLSA 1TXDA 3HSAA 3U7DA 2P8VA 1Z87A 1P6SA 2GJYA 4KHBB 2Z0PA 4GOUA 1LB1A 2D9XA 4KVGB 2X18A 5HE2A 2Z59A 4QXAB 1FHWA 3PEGA 2Y8GA 2OTXA 4ZRKA 5C79A 2YF0A 2KIGA 2D9ZA 2VKIA 2PZ1A 4F7GA 2ZPYA 2CODA 3TFMA 3A8QA 1V5PA 3N7CA 2N0YA 1U29A 2YS1A 4Y94A 2G35A 2Y8FA 4GNKB 1EF1A 2IFSA 1KI1B 2KGXB 1DDVA 3KZ1A 4IAPA 2VRWB 3A8PA 2M14A 2E2XA 1H10A 2D9VA 1U5DA 1NTVA 3WA0A 4L1RA 5JHGA 3V5WA 4K17A 2ELBA 2L2IA 2DN6A 4DX90 1ZSQA 2FJUB 1GC6A 3AJ4A 4YONA 1V89A 1UPRA 4HDOA 5I2MA 4K2OA 1XD4A 4DX8A 2KR0A 2K2UA 2QKLA 1E5WA 1NTYA 2NMBA 2J59M 3ODOA 2RUKB 1DBHA 4HAUB 4GZUA 1V88A 2DHIA 4BBKA 1UNPA 2Z4DA 3P6AA 4CHJA 1X11A 3M1IB 3DXDA 1I2HA 2LYDA 5C5BA 4KHOA 4HB2B 4KAXB 2P0HA 1BTNA 1MIXA 1Q67A 2NZ8B 3PSCA 2R0DA 1WVHA 2GUMA 4DBBA 1FHXA 2RRFA 2RNRB 3AU5A 4WSFA 5C16A 4CYEA 1ZVRA 4EJNA 1EAZA 4HAWB 4HAYB 2OQBA 4ZRIA 3PZDA 5DHFB 2Z0QA 2I5FA 2DTCA 1ZM0A 3CIKA 4K81A 2DHKA 5M4YB 2IYBA 1OQNA 2Q13A 4HAXB 2R09A 4A6KA 4B6HA 1MPHA 4QJ3B 2GCLA 5JLJB 4KHAA 2K2JA 3WYFB 2L1CA 3HK0A 4F7HA 3PG7A 1MKEA 5D3XA 2P0FA 1ZC3B 2ADZA 4HB3B 1BTKA 1OMWA 3NW8A 4TYZA 4WVFB 4DXAB 2Z13A 1M7RA 4GXBA 3D8EA 4HB4B 3HQCA 1T77A 1FHOA 5LONB 2UZRA 4A6FB 3RCPA 2Y7BA 1UPQA 2UVMA 4PQ0A 2RLOA 1U5GA 3OHMB 4A5KA 1MI1A 2RGNB 2VSZA 4GMXB 3SV1A 2M38A 5DI9B 2I1KA 3ZVRA 1ISNA 3GYOA 4IFSA 2YS3A 2J0JA 4D6WA 2K49A 5KQ4A 1MK7B 4IOYX 2LOZA 1DROA 2RSGA 3DXEA 1PFJA 2V76A 3LJUX 3KY9A 4A6HA 1RRPB 3SNHA 2NBVA 3DCXA 4HATB 3FVCA 5HE0A 5HE1A 5LOPB 2COCA 2HTHB 2DLWA 2MDXA 3QWMA 4P7IA 1WJ1A 2GS0A 3VIAA 2D10A 2YT0A 1WGUA 2COFA 1AQCA 1RJ2A 3MPXA 3TCAA 2DYQA
chains in the Genus database with same CATH topology
4HAZB 2YSZA 5KCVA 1XODA 3IVFA 2EC1A 5L81A 3F0WA 3HW2B 3ZDTA 3AU4A 2I5CA 3SYXA 1I7AA 1SHCA 4XWXA 2EJ8A 1X1GA 2KUPA 3OANA 3P7ZA 1SGHA 3U8ZA 2D9WA 1MAIA 1U5FA 3TO1A 2MKRA 2DKQA 1V5UA 3NSUA 1TQZA 1N3HA 3KRWA 3BINA 3PVWA 4MY6A 5JP4A 4MT7A 1Y5OA 4HHVA 1W1GA 2DHJA 2ROZB 3SO6A 1J0WA 2DA0A 2YRYA 1AWEA 4L6EA 1X1FA 4PNKA 4MK0A 2BCJA 4YL8A 1KZGA 1XKEA 5D3WA 4EKUA 1U5EA 1XR0B 1NI2A 2ELAA 3FEHA 3ML4A 4TKNA 1U2BA 1P5TA 2H7EA 5J3TA 4GPTB 1XCGA 1UEFA 1LW3A 4NSWA 1MIZB 5HE3A 1EVHA 2J0KA 1ZC4B 4GMVA 2JP2A 4A6FA 4Z2NA 1TJ6A 5KQ1A 5CLLB 2DKPA 1DDWA 1QQGA 4GN1A 1K5DB 3A98B 1W1DA 1FGYA 4F7UP 1U27A 3ULBA 5FI0A 5J3QA 4HAVB 2FJLA 1FOEA 4ZRJA 1IRSA 5D3YA 2XQNM 4K2PA 3TW1A 1Y19B 3VOQA 4D0NB 2GCJA 1DYNA 3ODXA 2HE7A 2MFQA 5D27A 5JHHA 3CXBB 1WG7A 1WGQA 1XX0A 3BJIA 1GC7A 1GG3A 1KZ7A 2KCJA 1V61A 2RVBB 4WJ7A 2W2WA 2LG1A 1EGXA 2J0MA 2AEHA 3DXCA 1OY2A 5DH9B 1UNRA 2CAYA 2LOXA 1WJMA 1MK9B 5CLQB 5D3VA 5DIFB 1P3RA 3PVLA 2QKMA 2DFKA 3ODWA 1W1HA 1B55A 2Z0OA 2D9YA 1BWNA 1J19A 4H8SA 2ROVA 2AL6A 1NU2A 2D11A 2D2QA 3KRXA 2DX5A 4C0AA 4EMOA 5EFXA 2LULA 1DDMA 3PVUA 3T06A 1H4RA 3D8FA 3ULCA 4CHMA 3F5RA 4Z2MB 5J3YA 3KSYA 2YT1A 3SUZA 3D8DA 1M7EA 2EMSA 3PP2A 1FB8A 2MWNB 2DX1A 1K5GB 2D4QA 2EMTA 1FGZA 3QIJA 4HDQA 2YS5A 3GYPA 5DHAB 2I1JA 3MDBC 1PMSA 3O96A 2H7DA 2CY5A 3TVVA 5FI1A 2W2XD 4NY0A 2K00A 3UZTA 2YVCA 3FM8C 5C5BB 3QBVB 2N23A 2P0DA 1WI1A 3FSSA 5GOWB 2UZSA 1FAOA 2DYNA 3G9WA 3X23A 1BAKA 2W2XC 2COAA 1V5MA 2CY4A 1QC6A 1UNQA 1X86A 2CRFA 2LKOA 5C6RA 1X05A 4HB0B 1PLSA 1TXDA 3U7DA 2P8VA 1Z87A 1P6SA 2GJYA 4KHBB 2Z0PA 1LB1A 2D9XA 4KVGB 2X18A 5HE2A 1FHWA 3PEGA 2Y8GA 2OTXA 4ZRKA 5C79A 2YF0A 2D9ZA 2VKIA 2PZ1A 4F7GA 2ZPYA 2CODA 3TFMA 3A8QA 1V5PA 3N7CA 2N0YA 1U29A 2YS1A 4Y94A 2G35A 2Y8FA 1EF1A 2IFSA 1KI1B 2KGXB 1DDVA 3KZ1A 4IAPA 2VRWB 3A8PA 2M14A 2E2XA 1H10A 2D9VA 1U5DA 1NTVA 3WA0A 5JHGA 3V5WA 4K17A 2ELBA 2L2IA 2DN6A 4DX90 1ZSQA 1GC6A 3AJ4A 4YONA 1V89A 1UPRA 4HDOA 4K2OA 1XD4A 4DX8A 2K2UA 2QKLA 1E5WA 1NTYA 2NMBA 2J59M 3ODOA 2RUKB 1DBHA 4HAUB 4GZUA 1V88A 2DHIA 4BBKA 1UNPA 3P6AA 4CHJA 1X11A 3M1IB 3DXDA 1I2HA 2LYDA 5C5BA 4KHOA 4HB2B 4KAXB 2P0HA 1BTNA 1MIXA 1Q67A 2NZ8B 3PSCA 2R0DA 1WVHA 4DBBA 1FHXA 2RNRB 3AU5A 4WSFA 5C16A 4CYEA 1ZVRA 4EJNA 1EAZA 4HAWB 4HAYB 2OQBA 4ZRIA 3PZDA 5DHFB 2Z0QA 2I5FA 2DTCA 1ZM0A 3CIKA 4K81A 2DHKA 2IYBA 1OQNA 2Q13A 4HAXB 2R09A 4A6KA 4B6HA 1MPHA 2GCLA 5JLJB 4KHAA 2K2JA 3WYFB 2L1CA 3HK0A 4F7HA 3PG7A 1MKEA 5D3XA 2P0FA 1ZC3B 2ADZA 4HB3B 1BTKA 1OMWA 4TYZA 4WVFB 4DXAB 1M7RA 4GXBA 3D8EA 4HB4B 3HQCA 1FHOA 5LONB 2UZRA 4A6FB 3RCPA 2Y7BA 1UPQA 2UVMA 4PQ0A 2RLOA 1U5GA 4A5KA 2RGNB 2VSZA 4GMXB 3SV1A 2M38A 5DI9B 2I1KA 3ZVRA 1ISNA 3GYOA 4IFSA 2YS3A 2J0JA 5KQ4A 1MK7B 4IOYX 2LOZA 1DROA 2RSGA 3DXEA 1PFJA 2V76A 3LJUX 3KY9A 4A6HA 1RRPB 3SNHA 4HATB 5HE0A 5HE1A 5LOPB 2COCA 2HTHB 2DLWA 2MDXA 3QWMA 4P7IA 1WJ1A 2GS0A 3VIAA 2D10A 2YT0A 1WGUA 2COFA 1AQCA 1RJ2A 3MPXA 3TCAA 2DYQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HAZ B;  2YSZ A;  5KCV A;  1XOD A;  3IVF A;  2EC1 A;  5L81 A;  3F0W A;  3HW2 B;  3ZDT A;  3AU4 A;  2I5C A;  3SYX A;  1I7A A;  1SHC A;  4XWX A;  2EJ8 A;  1X1G A;  2KUP A;  3OAN A;  3P7Z A;  1SGH A;  3U8Z A;  2D9W A;  1MAI A;  1U5F A;  3TO1 A;  2MKR A;  2DKQ A;  1V5U A;  3NSU A;  1TQZ A;  1N3H A;  3KRW A;  3BIN A;  3PVW A;  4MY6 A;  5JP4 A;  4MT7 A;  1Y5O A;  4HHV A;  1W1G A;  2DHJ A;  2ROZ B;  3SO6 A;  1J0W A;  2DA0 A;  2YRY A;  1AWE A;  4L6E A;  1X1F A;  4PNK A;  4MK0 A;  2BCJ A;  4YL8 A;  1KZG A;  1XKE A;  5D3W A;  4EKU A;  1U5E A;  1XR0 B;  1NI2 A;  2ELA A;  3FEH A;  3ML4 A;  4TKN A;  1U2B A;  1P5T A;  2H7E A;  5J3T A;  4GPT B;  1XCG A;  1UEF A;  1LW3 A;  4NSW A;  1MIZ B;  5HE3 A;  1EVH A;  2J0K A;  1ZC4 B;  4GMV A;  2JP2 A;  4A6F A;  4Z2N A;  1TJ6 A;  5KQ1 A;  5CLL B;  2DKP A;  1DDW A;  1QQG A;  4GN1 A;  1K5D B;  3A98 B;  1W1D A;  1FGY A;  4F7U P;  1U27 A;  3ULB A;  5FI0 A;  5J3Q A;  4HAV B;  2FJL A;  1FOE A;  4ZRJ A;  1IRS A;  5D3Y A;  2XQN M;  4K2P A;  3TW1 A;  1Y19 B;  3VOQ A;  4D0N B;  2GCJ A;  1DYN A;  3ODX A;  2HE7 A;  2MFQ A;  5D27 A;  5JHH A;  3CXB B;  1WG7 A;  1WGQ A;  1XX0 A;  3BJI A;  1GC7 A;  1GG3 A;  1KZ7 A;  2KCJ A;  1V61 A;  2RVB B;  4WJ7 A;  2W2W A;  2LG1 A;  1EGX A;  2J0M A;  2AEH A;  3DXC A;  1OY2 A;  5DH9 B;  1UNR A;  2CAY A;  2LOX A;  1WJM A;  1MK9 B;  5CLQ B;  5D3V A;  5DIF B;  1P3R A;  3PVL A;  2QKM A;  2DFK A;  3ODW A;  1W1H A;  1B55 A;  2Z0O A;  2D9Y A;  1BWN A;  1J19 A;  4H8S A;  2ROV A;  2AL6 A;  1NU2 A;  2D11 A;  2D2Q A;  3KRX A;  2DX5 A;  4C0A A;  4EMO A;  5EFX A;  2LUL A;  1DDM A;  3PVU A;  3T06 A;  1H4R A;  3D8F A;  3ULC A;  4CHM A;  3F5R A;  4Z2M B;  5J3Y A;  3KSY A;  2YT1 A;  3SUZ A;  3D8D A;  1M7E A;  2EMS A;  3PP2 A;  1FB8 A;  2MWN B;  2DX1 A;  1K5G B;  2D4Q A;  2EMT A;  1FGZ A;  3QIJ A;  4HDQ A;  2YS5 A;  3GYP A;  5DHA B;  2I1J A;  3MDB C;  1PMS A;  3O96 A;  2H7D A;  2CY5 A;  3TVV A;  5FI1 A;  2W2X D;  4NY0 A;  2K00 A;  3UZT A;  2YVC A;  3FM8 C;  5C5B B;  3QBV B;  2N23 A;  2P0D A;  1WI1 A;  3FSS A;  5GOW B;  2UZS A;  1FAO A;  2DYN A;  3G9W A;  3X23 A;  1BAK A;  2W2X C;  2COA A;  1V5M A;  2CY4 A;  1QC6 A;  1UNQ A;  1X86 A;  2CRF A;  2LKO A;  5C6R A;  1X05 A;  4HB0 B;  1PLS A;  1TXD A;  3U7D A;  2P8V A;  1Z87 A;  1P6S A;  2GJY A;  4KHB B;  2Z0P A;  1LB1 A;  2D9X A;  4KVG B;  2X18 A;  5HE2 A;  1FHW A;  3PEG A;  2Y8G A;  2OTX A;  4ZRK A;  5C79 A;  2YF0 A;  2D9Z A;  2VKI A;  2PZ1 A;  4F7G A;  2ZPY A;  2COD A;  3TFM A;  3A8Q A;  1V5P A;  3N7C A;  2N0Y A;  1U29 A;  2YS1 A;  4Y94 A;  2G35 A;  2Y8F A;  1EF1 A;  2IFS A;  1KI1 B;  2KGX B;  1DDV A;  3KZ1 A;  4IAP A;  2VRW B;  3A8P A;  2M14 A;  2E2X A;  1H10 A;  2D9V A;  1U5D A;  1NTV A;  3WA0 A;  5JHG A;  3V5W A;  4K17 A;  2ELB A;  2L2I A;  2DN6 A;  4DX9 0;  1ZSQ A;  1GC6 A;  3AJ4 A;  4YON A;  1V89 A;  1UPR A;  4HDO A;  4K2O A;  1XD4 A;  4DX8 A;  2K2U A;  2QKL A;  1E5W A;  1NTY A;  2NMB A;  2J59 M;  3ODO A;  2RUK B;  1DBH A;  4HAU B;  4GZU A;  1V88 A;  2DHI A;  4BBK A;  1UNP A;  3P6A A;  4CHJ A;  1X11 A;  3M1I B;  3DXD A;  1I2H A;  2LYD A;  5C5B A;  4KHO A;  4HB2 B;  4KAX B;  2P0H A;  1BTN A;  1MIX A;  1Q67 A;  2NZ8 B;  3PSC A;  2R0D A;  1WVH A;  4DBB A;  1FHX A;  2RNR B;  3AU5 A;  4WSF A;  5C16 A;  4CYE A;  1ZVR A;  4EJN A;  1EAZ A;  4HAW B;  4HAY B;  2OQB A;  4ZRI A;  3PZD A;  5DHF B;  2Z0Q A;  2I5F A;  2DTC A;  1ZM0 A;  3CIK A;  4K81 A;  2DHK A;  2IYB A;  1OQN A;  2Q13 A;  4HAX B;  2R09 A;  4A6K A;  4B6H A;  1MPH A;  2GCL A;  5JLJ B;  4KHA A;  2K2J A;  3WYF B;  2L1C A;  3HK0 A;  4F7H A;  3PG7 A;  1MKE A;  5D3X A;  2P0F A;  1ZC3 B;  2ADZ A;  4HB3 B;  1BTK A;  1OMW A;  4TYZ A;  4WVF B;  4DXA B;  1M7R A;  4GXB A;  3D8E A;  4HB4 B;  3HQC A;  1FHO A;  5LON B;  2UZR A;  4A6F B;  3RCP A;  2Y7B A;  1UPQ A;  2UVM A;  4PQ0 A;  2RLO A;  1U5G A;  4A5K A;  2RGN B;  2VSZ A;  4GMX B;  3SV1 A;  2M38 A;  5DI9 B;  2I1K A;  3ZVR A;  1ISN A;  3GYO A;  4IFS A;  2YS3 A;  2J0J A;  5KQ4 A;  1MK7 B;  4IOY X;  2LOZ A;  1DRO A;  2RSG A;  3DXE A;  1PFJ A;  2V76 A;  3LJU X;  3KY9 A;  4A6H A;  1RRP B;  3SNH A;  4HAT B;  5HE0 A;  5HE1 A;  5LOP B;  2COC A;  2HTH B;  2DLW A;  2MDX A;  3QWM A;  4P7I A;  1WJ1 A;  2GS0 A;  3VIA A;  2D10 A;  2YT0 A;  1WGU A;  2COF A;  1AQC A;  1RJ2 A;  3MPX A;  3TCA A;  2DYQ A; 
#chains in the Genus database with same CATH topology
 4HAZ B;  2YSZ A;  5KCV A;  1XOD A;  3IVF A;  2EC1 A;  5L81 A;  3F0W A;  3HW2 B;  3ZDT A;  3AU4 A;  2I5C A;  3SYX A;  1I7A A;  1SHC A;  4XWX A;  2EJ8 A;  1X1G A;  2KUP A;  3OAN A;  3P7Z A;  1SGH A;  3U8Z A;  2D9W A;  1MAI A;  1U5F A;  3TO1 A;  2MKR A;  2DKQ A;  1V5U A;  3NSU A;  1TQZ A;  1N3H A;  3KRW A;  3NWF A;  3BIN A;  3PVW A;  4CSQ A;  4MY6 A;  5JP4 A;  2Z14 A;  4MT7 A;  1Y5O A;  4HHV A;  1W1G A;  2ZKM X;  2DHJ A;  2ROZ B;  3SO6 A;  3NWA A;  1J0W A;  3NWD A;  2DA0 A;  2YRY A;  1AWE A;  4L6E A;  1X1F A;  4PNK A;  4MK0 A;  2BCJ A;  4YL8 A;  1KZG A;  1XKE A;  5D3W A;  4EKU A;  1U5E A;  1XR0 B;  1NI2 A;  2ELA A;  3FEH A;  3ML4 A;  4TKN A;  1U2B A;  4OT1 A;  1P5T A;  2H7E A;  5J3T A;  4GPT B;  1XCG A;  1UEF A;  1LW3 A;  4NSW A;  1MIZ B;  5HE3 A;  1EVH A;  2J0K A;  1ZC4 B;  4GMV A;  2JP2 A;  4A6F A;  4Z2N A;  1TJ6 A;  5KQ1 A;  5CLL B;  2DKP A;  2KIE A;  1DDW A;  1QQG A;  4GN1 A;  1K5D B;  3A98 B;  1W1D A;  1FGY A;  4F7U P;  1U27 A;  3ULB A;  5FI0 A;  5J3Q A;  4HAV B;  2FJL A;  1FOE A;  4ZRJ A;  1IRS A;  5D3Y A;  2XQN M;  4K2P A;  3TW1 A;  1Y19 B;  3VOQ A;  4D0N B;  2GCJ A;  1DYN A;  2YT2 A;  3ODX A;  2HE7 A;  1ZYI A;  3HIE A;  2MFQ A;  4OSN A;  5D27 A;  5JHH A;  4QJ4 B;  5IRS A;  3CXB B;  1WG7 A;  1WGQ A;  1XX0 A;  3BJI A;  1GC7 A;  1GG3 A;  1KZ7 A;  2KCJ A;  1V61 A;  2RVB B;  4WJ7 A;  2W2W A;  2KUQ A;  2LG1 A;  1EGX A;  2J0M A;  2AEH A;  3B77 A;  3DXC A;  1OY2 A;  5DH9 B;  1UNR A;  2CAY A;  2LOX A;  1WJM A;  1MK9 B;  5CLQ B;  5D3V A;  5DIF B;  1P3R A;  3PVL A;  2QKM A;  2DFK A;  5LG4 B;  3ODW A;  1W1H A;  1B55 A;  4HSI A;  2Z0O A;  2R2Y A;  2D9Y A;  1BWN A;  1J19 A;  4H8S A;  3U12 A;  2ROV A;  2AL6 A;  1NU2 A;  2D11 A;  2D2Q A;  3KRX A;  2DX5 A;  4C0A A;  4EMO A;  5EFX A;  2LUL A;  1DDM A;  3PVU A;  3T06 A;  1H4R A;  3D8F A;  3ULC A;  4CHM A;  3F5R A;  4Z2M B;  5J3Y A;  3KSY A;  2YT1 A;  3SUZ A;  3D8D A;  1M7E A;  2EMS A;  3PP2 A;  1FB8 A;  2MWN B;  2DX1 A;  1K5G B;  2K8E A;  2D4Q A;  2EMT A;  1FGZ A;  3QIJ A;  4HDQ A;  2YS5 A;  3GYP A;  5DHA B;  2I1J A;  3MDB C;  1PMS A;  3O96 A;  2H7D A;  2CY5 A;  3TVV A;  5FI1 A;  2W2X D;  4NY0 A;  4DIX A;  2K00 A;  3UZT A;  2YVC A;  3FM8 C;  5C5B B;  3QBV B;  2N23 A;  4QJ5 B;  2P0D A;  1WI1 A;  3FSS A;  5GOW B;  2UZS A;  1FAO A;  2DYN A;  3G9W A;  3A58 A;  5I2S A;  3X23 A;  1BAK A;  2W2X C;  4KHB A;  2COA A;  1V5M A;  2CY4 A;  1QC6 A;  1UNQ A;  1X86 A;  2CRF A;  2LKO A;  5C6R A;  1X05 A;  4HB0 B;  1PLS A;  1TXD A;  3HSA A;  3U7D A;  2P8V A;  1Z87 A;  1P6S A;  2GJY A;  4KHB B;  2Z0P A;  4GOU A;  1LB1 A;  2D9X A;  4KVG B;  2X18 A;  5HE2 A;  2Z59 A;  4QXA B;  1FHW A;  3PEG A;  2Y8G A;  2OTX A;  4ZRK A;  5C79 A;  2YF0 A;  2KIG A;  2D9Z A;  2VKI A;  2PZ1 A;  4F7G A;  2ZPY A;  2COD A;  3TFM A;  3A8Q A;  1V5P A;  3N7C A;  2N0Y A;  1U29 A;  2YS1 A;  4Y94 A;  2G35 A;  2Y8F A;  4GNK B;  1EF1 A;  2IFS A;  1KI1 B;  2KGX B;  1DDV A;  3KZ1 A;  4IAP A;  2VRW B;  3A8P A;  2M14 A;  2E2X A;  1H10 A;  2D9V A;  1U5D A;  1NTV A;  3WA0 A;  4L1R A;  5JHG A;  3V5W A;  4K17 A;  2ELB A;  2L2I A;  2DN6 A;  4DX9 0;  1ZSQ A;  2FJU B;  1GC6 A;  3AJ4 A;  4YON A;  1V89 A;  1UPR A;  4HDO A;  5I2M A;  4K2O A;  1XD4 A;  4DX8 A;  2KR0 A;  2K2U A;  2QKL A;  1E5W A;  1NTY A;  2NMB A;  2J59 M;  3ODO A;  2RUK B;  1DBH A;  4HAU B;  4GZU A;  1V88 A;  2DHI A;  4BBK A;  1UNP A;  2Z4D A;  3P6A A;  4CHJ A;  1X11 A;  3M1I B;  3DXD A;  1I2H A;  2LYD A;  5C5B A;  4KHO A;  4HB2 B;  4KAX B;  2P0H A;  1BTN A;  1MIX A;  1Q67 A;  2NZ8 B;  3PSC A;  2R0D A;  1WVH A;  2GUM A;  4DBB A;  1FHX A;  2RRF A;  2RNR B;  3AU5 A;  4WSF A;  5C16 A;  4CYE A;  1ZVR A;  4EJN A;  1EAZ A;  4HAW B;  4HAY B;  2OQB A;  4ZRI A;  3PZD A;  5DHF B;  2Z0Q A;  2I5F A;  2DTC A;  1ZM0 A;  3CIK A;  4K81 A;  2DHK A;  5M4Y B;  2IYB A;  1OQN A;  2Q13 A;  4HAX B;  2R09 A;  4A6K A;  4B6H A;  1MPH A;  4QJ3 B;  2GCL A;  5JLJ B;  4KHA A;  2K2J A;  3WYF B;  2L1C A;  3HK0 A;  4F7H A;  3PG7 A;  1MKE A;  5D3X A;  2P0F A;  1ZC3 B;  2ADZ A;  4HB3 B;  1BTK A;  1OMW A;  3NW8 A;  4TYZ A;  4WVF B;  4DXA B;  2Z13 A;  1M7R A;  4GXB A;  3D8E A;  4HB4 B;  3HQC A;  1T77 A;  1FHO A;  5LON B;  2UZR A;  4A6F B;  3RCP A;  2Y7B A;  1UPQ A;  2UVM A;  4PQ0 A;  2RLO A;  1U5G A;  3OHM B;  4A5K A;  1MI1 A;  2RGN B;  2VSZ A;  4GMX B;  3SV1 A;  2M38 A;  5DI9 B;  2I1K A;  3ZVR A;  1ISN A;  3GYO A;  4IFS A;  2YS3 A;  2J0J A;  4D6W A;  2K49 A;  5KQ4 A;  1MK7 B;  4IOY X;  2LOZ A;  1DRO A;  2RSG A;  3DXE A;  1PFJ A;  2V76 A;  3LJU X;  3KY9 A;  4A6H A;  1RRP B;  3SNH A;  2NBV A;  3DCX A;  4HAT B;  3FVC A;  5HE0 A;  5HE1 A;  5LOP B;  2COC A;  2HTH B;  2DLW A;  2MDX A;  3QWM A;  4P7I A;  1WJ1 A;  2GS0 A;  3VIA A;  2D10 A;  2YT0 A;  1WGU A;  2COF A;  1AQC A;  1RJ2 A;  3MPX A;  3TCA A;  2DYQ A; 
#chains in the Genus database with same CATH homology
 4HAZ B;  2YSZ A;  5KCV A;  1XOD A;  3IVF A;  2EC1 A;  5L81 A;  3F0W A;  3HW2 B;  3ZDT A;  3AU4 A;  2I5C A;  3SYX A;  1I7A A;  1SHC A;  4XWX A;  2EJ8 A;  1X1G A;  2KUP A;  3OAN A;  3P7Z A;  1SGH A;  3U8Z A;  2D9W A;  1MAI A;  1U5F A;  3TO1 A;  2MKR A;  2DKQ A;  1V5U A;  3NSU A;  1TQZ A;  1N3H A;  3KRW A;  3BIN A;  3PVW A;  4MY6 A;  5JP4 A;  4MT7 A;  1Y5O A;  4HHV A;  1W1G A;  2DHJ A;  2ROZ B;  3SO6 A;  1J0W A;  2DA0 A;  2YRY A;  1AWE A;  4L6E A;  1X1F A;  4PNK A;  4MK0 A;  2BCJ A;  4YL8 A;  1KZG A;  1XKE A;  5D3W A;  4EKU A;  1U5E A;  1XR0 B;  1NI2 A;  2ELA A;  3FEH A;  3ML4 A;  4TKN A;  1U2B A;  1P5T A;  2H7E A;  5J3T A;  4GPT B;  1XCG A;  1UEF A;  1LW3 A;  4NSW A;  1MIZ B;  5HE3 A;  1EVH A;  2J0K A;  1ZC4 B;  4GMV A;  2JP2 A;  4A6F A;  4Z2N A;  1TJ6 A;  5KQ1 A;  5CLL B;  2DKP A;  1DDW A;  1QQG A;  4GN1 A;  1K5D B;  3A98 B;  1W1D A;  1FGY A;  4F7U P;  1U27 A;  3ULB A;  5FI0 A;  5J3Q A;  4HAV B;  2FJL A;  1FOE A;  4ZRJ A;  1IRS A;  5D3Y A;  2XQN M;  4K2P A;  3TW1 A;  1Y19 B;  3VOQ A;  4D0N B;  2GCJ A;  1DYN A;  3ODX A;  2HE7 A;  2MFQ A;  5D27 A;  5JHH A;  3CXB B;  1WG7 A;  1WGQ A;  1XX0 A;  3BJI A;  1GC7 A;  1GG3 A;  1KZ7 A;  2KCJ A;  1V61 A;  2RVB B;  4WJ7 A;  2W2W A;  2LG1 A;  1EGX A;  2J0M A;  2AEH A;  3DXC A;  1OY2 A;  5DH9 B;  1UNR A;  2CAY A;  2LOX A;  1WJM A;  1MK9 B;  5CLQ B;  5D3V A;  5DIF B;  1P3R A;  3PVL A;  2QKM A;  2DFK A;  3ODW A;  1W1H A;  1B55 A;  2Z0O A;  2D9Y A;  1BWN A;  1J19 A;  4H8S A;  2ROV A;  2AL6 A;  1NU2 A;  2D11 A;  2D2Q A;  3KRX A;  2DX5 A;  4C0A A;  4EMO A;  5EFX A;  2LUL A;  1DDM A;  3PVU A;  3T06 A;  1H4R A;  3D8F A;  3ULC A;  4CHM A;  3F5R A;  4Z2M B;  5J3Y A;  3KSY A;  2YT1 A;  3SUZ A;  3D8D A;  1M7E A;  2EMS A;  3PP2 A;  1FB8 A;  2MWN B;  2DX1 A;  1K5G B;  2D4Q A;  2EMT A;  1FGZ A;  3QIJ A;  4HDQ A;  2YS5 A;  3GYP A;  5DHA B;  2I1J A;  3MDB C;  1PMS A;  3O96 A;  2H7D A;  2CY5 A;  3TVV A;  5FI1 A;  2W2X D;  4NY0 A;  2K00 A;  3UZT A;  2YVC A;  3FM8 C;  5C5B B;  3QBV B;  2N23 A;  2P0D A;  1WI1 A;  3FSS A;  5GOW B;  2UZS A;  1FAO A;  2DYN A;  3G9W A;  3X23 A;  1BAK A;  2W2X C;  2COA A;  1V5M A;  2CY4 A;  1QC6 A;  1UNQ A;  1X86 A;  2CRF A;  2LKO A;  5C6R A;  1X05 A;  4HB0 B;  1PLS A;  1TXD A;  3U7D A;  2P8V A;  1Z87 A;  1P6S A;  2GJY A;  4KHB B;  2Z0P A;  1LB1 A;  2D9X A;  4KVG B;  2X18 A;  5HE2 A;  1FHW A;  3PEG A;  2Y8G A;  2OTX A;  4ZRK A;  5C79 A;  2YF0 A;  2D9Z A;  2VKI A;  2PZ1 A;  4F7G A;  2ZPY A;  2COD A;  3TFM A;  3A8Q A;  1V5P A;  3N7C A;  2N0Y A;  1U29 A;  2YS1 A;  4Y94 A;  2G35 A;  2Y8F A;  1EF1 A;  2IFS A;  1KI1 B;  2KGX B;  1DDV A;  3KZ1 A;  4IAP A;  2VRW B;  3A8P A;  2M14 A;  2E2X A;  1H10 A;  2D9V A;  1U5D A;  1NTV A;  3WA0 A;  5JHG A;  3V5W A;  4K17 A;  2ELB A;  2L2I A;  2DN6 A;  4DX9 0;  1ZSQ A;  1GC6 A;  3AJ4 A;  4YON A;  1V89 A;  1UPR A;  4HDO A;  4K2O A;  1XD4 A;  4DX8 A;  2K2U A;  2QKL A;  1E5W A;  1NTY A;  2NMB A;  2J59 M;  3ODO A;  2RUK B;  1DBH A;  4HAU B;  4GZU A;  1V88 A;  2DHI A;  4BBK A;  1UNP A;  3P6A A;  4CHJ A;  1X11 A;  3M1I B;  3DXD A;  1I2H A;  2LYD A;  5C5B A;  4KHO A;  4HB2 B;  4KAX B;  2P0H A;  1BTN A;  1MIX A;  1Q67 A;  2NZ8 B;  3PSC A;  2R0D A;  1WVH A;  4DBB A;  1FHX A;  2RNR B;  3AU5 A;  4WSF A;  5C16 A;  4CYE A;  1ZVR A;  4EJN A;  1EAZ A;  4HAW B;  4HAY B;  2OQB A;  4ZRI A;  3PZD A;  5DHF B;  2Z0Q A;  2I5F A;  2DTC A;  1ZM0 A;  3CIK A;  4K81 A;  2DHK A;  2IYB A;  1OQN A;  2Q13 A;  4HAX B;  2R09 A;  4A6K A;  4B6H A;  1MPH A;  2GCL A;  5JLJ B;  4KHA A;  2K2J A;  3WYF B;  2L1C A;  3HK0 A;  4F7H A;  3PG7 A;  1MKE A;  5D3X A;  2P0F A;  1ZC3 B;  2ADZ A;  4HB3 B;  1BTK A;  1OMW A;  4TYZ A;  4WVF B;  4DXA B;  1M7R A;  4GXB A;  3D8E A;  4HB4 B;  3HQC A;  1FHO A;  5LON B;  2UZR A;  4A6F B;  3RCP A;  2Y7B A;  1UPQ A;  2UVM A;  4PQ0 A;  2RLO A;  1U5G A;  4A5K A;  2RGN B;  2VSZ A;  4GMX B;  3SV1 A;  2M38 A;  5DI9 B;  2I1K A;  3ZVR A;  1ISN A;  3GYO A;  4IFS A;  2YS3 A;  2J0J A;  5KQ4 A;  1MK7 B;  4IOY X;  2LOZ A;  1DRO A;  2RSG A;  3DXE A;  1PFJ A;  2V76 A;  3LJU X;  3KY9 A;  4A6H A;  1RRP B;  3SNH A;  4HAT B;  5HE0 A;  5HE1 A;  5LOP B;  2COC A;  2HTH B;  2DLW A;  2MDX A;  3QWM A;  4P7I A;  1WJ1 A;  2GS0 A;  3VIA A;  2D10 A;  2YT0 A;  1WGU A;  2COF A;  1AQC A;  1RJ2 A;  3MPX A;  3TCA A;  2DYQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...