2YRYA

Solution structure of the ph domain of pleckstrin homology domain-containing family a member 6 from human
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
122
structure length
122
Chain Sequence
GSSGSSGGKRSHSMKRNPNAPVTKAGWLFKQASSGVKQWNKRWFVLVDRCLFYYKDEKEESILGSIPLLSFRVAAVQPSDNISRKHTFKAEHAGVRTYFFSAESPEEQEAWIQAMGEAARVQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords Pleckstrin homology domain-containing family A member 6
publication title Solution structure of the PH domain of Pleckstrin homology domain-containing family A member 6 from human
rcsb
source organism Homo sapiens
total genus 13
structure length 122
sequence length 122
ec nomenclature
pdb deposition date 2007-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00169 PH PH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2yryA00
2Z0QA 3TW1A 2N0YA 2K00A 2R0DA 1LW3A 2D9VA 2DYNA 2COAA 2M38A 3D8EA 1ISNA 1MIZB 2J59M 3F5RA 1U5EA 2LOZA 5FI0A 5JHHA 1ZM0A 2EMSA 5DI9B 4CHMA 4KHAA 2COFA 1OMWA 2K2JA 5HE3A 2VKIA 1FHOA 1KZGA 5DHFB 3VOQA 4HAZB 4HDOA 1EAZA 4C0AA 3KY9A 4HB3B 1MKEA 1I7AA 5FI1A 2CAYA 1PLSA 3OANA 1M7RA 2LYDA 3PVUA 2VRWB 1UEFA 4Z2NA 1X1FA 2NZ8B 3A98B 5GOWB 1OY2A 3CXBB 4TYZA 1WI1A 2CODA 4DXAB 2GCLA 1GC7A 3U7DA 2D9ZA 1FOEA 4XWXA 1BAKA 1J0WA 4NY0A 2RNRB 1NU2A 2J0JA 2YT0A 1EF1A 2ROZB 1WJMA 4TKNA 2K2UA 1GG3A 2ADZA 3X23A 5JLJB 1MK9B 5C5BB 2OQBA 1DDWA 4ZRJA 3BJIA 1X05A 3LJUX 3MPXA 2LULA 1WJ1A 1XX0A 2HE7A 4HAWB 2COCA 2MWNB 3U8ZA 3CIKA 4A6FB 4F7UP 2L2IA 2P0DA 4HB2B 2D10A 3SYXA 2DHIA 2DX5A 2DKQA 2GCJA 2AEHA 1IRSA 1X11A 1MK7B 5D3WA 2Q13A 5L81A 2YS1A 2OTXA 3PSCA 4DX90 3KZ1A 1NTVA 1SGHA 2ZPYA 5J3TA 2DLWA 3DXEA 1I2HA 4ZRIA 2RVBB 3SO6A 2P0HA 2VSZA 2IFSA 2KUPA 4KVGB 4HAXB 2UZSA 4Y94A 2DFKA 2NMBA 3AU5A 1QC6A 2DN6A 1MAIA 3ODXA 5D3YA 2DX1A 1DDMA 1PFJA 4YONA 3BINA 3TFMA 5C5BA 3N7CA 4K17A 1XCGA 3PG7A 4HHVA 2UVMA 1V5PA 1X1GA 2UZRA 2P8VA 1LB1A 5DIFB 1P3RA 2ELBA 1TQZA 2D9YA 2AL6A 5KQ1A 5HE2A 4F7GA 4A6FA 2L1CA 2YSZA 3ZVRA 3TO1A 3FSSA 1ZSQA 1U27A 3AJ4A 2YS3A 1U5GA 1FAOA 1P5TA 5D27A 4A6HA 3WA0A 2Y7BA 2D9WA 2XQNM 2MFQA 1XD4A 2I1JA 4HDQA 1AQCA 1E5WA 3PVWA 3TCAA 3A8PA 4K2PA 1U5FA 2N23A 4KHBB 1U5DA 3D8FA 4BBKA 1EVHA 4B6HA 3F0WA 1XODA 1X86A 2YS5A 1H4RA 3KRWA 2DA0A 1ZVRA 5KCVA 2EC1A 3ULCA 2RLOA 5CLQB 2LG1A 5JP4A 2JP2A 4YL8A 3UZTA 2LOXA 1DROA 1W1HA 5J3QA 1NTYA 5C79A 2YVCA 1WGUA 5JHGA 2I5FA 1V5MA 2D2QA 4IOYX 2D4QA 5CLLB 1UNQA 3PZDA 1TXDA 3HK0A 5C16A 3P7ZA 2Y8GA 1GC6A 2W2WA 2I1KA 4EKUA 5LONB 5KQ4A 2CY4A 1W1GA 5C6RA 4MK0A 1Q67A 2QKLA 4GXBA 2LKOA 2PZ1A 1SHCA 2X18A 4HAUB 1WG7A 4EMOA 1P6SA 1UNRA 2RSGA 3O96A 1Y5OA 1NI2A 2YT1A 3FEHA 4H8SA 3QBVB 2RGNB 1RJ2A 3ZDTA 1TJ6A 2ELAA 4K2OA 3HQCA 3T06A 3HW2B 2R09A 4GPTB 3VIAA 2DKPA 3M1IB 3TVVA 1BTNA 5DH9B 2DYQA 5D3VA 2DHKA 2MKRA 2IYBA 4ZRKA 1MPHA 1KZ7A 2D11A 3FM8C 2RUKB 3PP2A 4WSFA 3ODOA 2G35A 1FB8A 1FGZA 2YF0A 4MT7A 4HATB 1K5GB 5J3YA 3V5WA 4GMVA 4HB0B 5HE0A 2MDXA 5LOPB 1OQNA 3ODWA 4CHJA 4L6EA 4IFSA 2W2XD 2Z0PA 1DBHA 2E2XA 2ROVA 3G9WA 1ZC3B 1BTKA 3QWMA 1V5UA 2QKMA 1UNPA 3D8DA 5EFXA 4DX8A 3AU4A 3ML4A 1H10A 4GN1A 4HAVB 2V76A 2KGXB 3P6AA 4GZUA 1XKEA 4Z2MB 1PMSA 2P0FA 2M14A 4D0NB 2H7DA 3MDBC 1FHXA 4GMXB 1FGYA 3KRXA 4WVFB 2Z0OA 5D3XA 4CYEA 3PEGA 4KHOA 4PNKA 4WJ7A 3IVFA 3KSYA 3ULBA 3NSUA 4A5KA 2D9XA 1KI1B 4K81A 1MIXA 5DHAB 4IAPA 3GYOA 4KAXB 3SUZA 1Z87A 2Y8FA 1EGXA 1U29A 2KCJA 2GJYA 3QIJA 2H7EA 2EMTA 1DDVA 4F7HA 2DTCA 3SV1A 3DXCA 1FHWA 2CY5A 1B55A 2I5CA 2CRFA 1AWEA 3A8QA 2GS0A 3WYFB 2BCJA 1QQGA 4P7IA 3RCPA 2DHJA 1V89A 1WGQA 2J0KA 3DXDA 1V88A 1W1DA 3GYPA 4A6KA 1J19A 1UPRA 2EJ8A 5HE1A 2J0MA 4EJNA 1RRPB 1U2BA 4HB4B 4DBBA 1WVHA 1M7EA 1V61A 2YRYA 2FJLA 1N3HA 3PVLA 1Y19B 1XR0B 4HAYB 2HTHB 4NSWA 2W2XC 1BWNA 3SNHA 1ZC4B 4MY6A 4PQ0A 1UPQA 1DYNA 1K5DB
chains in the Genus database with same CATH superfamily
2Z0QA 3TW1A 2N0YA 1ZYIA 2K00A 2R0DA 1LW3A 2D9VA 2DYNA 2COAA 2M38A 3D8EA 1ISNA 1MIZB 2J59M 3F5RA 1U5EA 2LOZA 5FI0A 5JHHA 1ZM0A 2EMSA 5DI9B 4CHMA 4KHAA 2COFA 4OSNA 2NBVA 1OMWA 2K2JA 5HE3A 2VKIA 1FHOA 1KZGA 5DHFB 3VOQA 4HAZB 4HDOA 1EAZA 4C0AA 3KY9A 4HB3B 1MKEA 1I7AA 3B77A 5FI1A 2Z14A 2CAYA 1PLSA 3OANA 1M7RA 2LYDA 3PVUA 2VRWB 1UEFA 4Z2NA 1X1FA 2NZ8B 3A98B 3NW8A 5GOWB 1OY2A 3CXBB 4TYZA 1WI1A 2CODA 4DXAB 2GCLA 1GC7A 3U7DA 3DCXA 2D9ZA 1FOEA 4XWXA 4CSQA 1BAKA 1J0WA 4NY0A 2RNRB 1NU2A 2J0JA 2YT0A 1EF1A 2KIGA 2ROZB 1WJMA 4TKNA 2K2UA 4D6WA 1GG3A 2ADZA 3X23A 3NWDA 5JLJB 1MK9B 5C5BB 2OQBA 1DDWA 4ZRJA 3BJIA 1X05A 3LJUX 3MPXA 2LULA 1WJ1A 1XX0A 2HE7A 4HAWB 4DIXA 2COCA 2MWNB 3HSAA 3U8ZA 3CIKA 4A6FB 4F7UP 2L2IA 2P0DA 4HB2B 5LG4B 3FVCA 2D10A 5I2MA 3SYXA 2DHIA 2DX5A 2DKQA 2GCJA 2AEHA 1IRSA 1X11A 1MK7B 5D3WA 2K8EA 2Q13A 5L81A 2YS1A 2OTXA 3PSCA 4DX90 3KZ1A 1NTVA 1SGHA 2ZPYA 5J3TA 2DLWA 3NWAA 3DXEA 1I2HA 4ZRIA 2RVBB 3SO6A 2P0HA 2VSZA 2IFSA 2KUPA 4KVGB 4HAXB 2UZSA 4Y94A 2DFKA 2NMBA 2YT2A 3AU5A 1QC6A 2DN6A 2Z4DA 1MAIA 3ODXA 5D3YA 2DX1A 1DDMA 1PFJA 4YONA 3BINA 3TFMA 5C5BA 3N7CA 4K17A 1XCGA 3PG7A 4HHVA 2UVMA 1V5PA 1X1GA 2UZRA 2P8VA 1LB1A 5DIFB 4HSIA 1P3RA 2ELBA 1TQZA 2D9YA 2AL6A 2R2YA 5KQ1A 5HE2A 4F7GA 4A6FA 2L1CA 2YSZA 3ZVRA 3TO1A 3FSSA 1ZSQA 1U27A 2Z59A 2RRFA 3AJ4A 2YS3A 1U5GA 1FAOA 1P5TA 5D27A 4A6HA 3WA0A 2Y7BA 2D9WA 2XQNM 2MFQA 1XD4A 2I1JA 4HDQA 3HIEA 1AQCA 1E5WA 3PVWA 3TCAA 3A8PA 4K2PA 1U5FA 2N23A 4KHBB 1U5DA 3D8FA 2FJUB 4BBKA 1EVHA 4B6HA 3F0WA 1XODA 1X86A 2YS5A 1H4RA 3KRWA 2DA0A 1ZVRA 5KCVA 2EC1A 3ULCA 2RLOA 5CLQB 2LG1A 5JP4A 2JP2A 4YL8A 3UZTA 2LOXA 1DROA 1W1HA 5J3QA 1NTYA 5C79A 2YVCA 1WGUA 3U12A 5JHGA 2I5FA 1V5MA 2D2QA 4IOYX 2D4QA 2ZKMX 5CLLB 1UNQA 3PZDA 1TXDA 3HK0A 5C16A 3P7ZA 2Y8GA 2Z13A 1GC6A 2W2WA 2I1KA 4L1RA 4EKUA 5LONB 5KQ4A 2CY4A 1W1GA 5C6RA 4MK0A 1Q67A 2QKLA 4GXBA 4QXAB 2K49A 4QJ4B 2LKOA 2PZ1A 1SHCA 2X18A 4HAUB 1WG7A 4EMOA 1P6SA 1UNRA 2RSGA 3O96A 1Y5OA 1NI2A 2YT1A 3FEHA 2KUQA 4H8SA 3QBVB 3NWFA 2RGNB 1RJ2A 3ZDTA 1TJ6A 2ELAA 4K2OA 3HQCA 1MI1A 3T06A 3HW2B 2R09A 4GPTB 4KHBA 3VIAA 2DKPA 3M1IB 3TVVA 1BTNA 4QJ5B 5DH9B 2KIEA 2DYQA 5D3VA 2DHKA 2MKRA 2IYBA 2GUMA 1MPHA 4ZRKA 1KZ7A 2D11A 3FM8C 2RUKB 3PP2A 4WSFA 3ODOA 2G35A 1FB8A 4GOUA 1FGZA 2YF0A 4MT7A 4HATB 1K5GB 5J3YA 3V5WA 4GMVA 4HB0B 5HE0A 1T77A 2MDXA 5LOPB 1OQNA 3ODWA 4CHJA 4L6EA 4IFSA 2W2XD 2Z0PA 1DBHA 2E2XA 2ROVA 3G9WA 1ZC3B 1BTKA 3QWMA 1V5UA 2QKMA 1UNPA 3D8DA 5EFXA 4DX8A 3AU4A 3ML4A 1H10A 4GN1A 4HAVB 2V76A 2KGXB 3P6AA 4GZUA 1XKEA 4Z2MB 5I2SA 1PMSA 2P0FA 2M14A 4GNKB 4D0NB 2H7DA 5M4YB 2KR0A 3MDBC 1FHXA 4GMXB 1FGYA 3KRXA 4WVFB 2Z0OA 5D3XA 4CYEA 3PEGA 4KHOA 4PNKA 4WJ7A 3IVFA 3KSYA 3ULBA 3NSUA 4A5KA 2D9XA 1KI1B 4K81A 1MIXA 5DHAB 4IAPA 3GYOA 4KAXB 3SUZA 1Z87A 2Y8FA 1EGXA 1U29A 2KCJA 2GJYA 3QIJA 2H7EA 2EMTA 3A58A 1DDVA 4F7HA 2DTCA 4OT1A 3SV1A 3DXCA 1FHWA 2CY5A 1B55A 2I5CA 2CRFA 1AWEA 3A8QA 2GS0A 3WYFB 2BCJA 5IRSA 1QQGA 4P7IA 4QJ3B 3RCPA 2DHJA 3OHMB 1V89A 1WGQA 2J0KA 3DXDA 1V88A 1W1DA 3GYPA 4A6KA 1J19A 1UPRA 2EJ8A 5HE1A 2J0MA 4EJNA 1RRPB 1U2BA 4HB4B 4DBBA 1WVHA 1M7EA 1V61A 2YRYA 2FJLA 1N3HA 3PVLA 1Y19B 1XR0B 4HAYB 2HTHB 4NSWA 2W2XC 1BWNA 3SNHA 1ZC4B 4MY6A 4PQ0A 1UPQA 1DYNA 1K5DB
chains in the Genus database with same CATH topology
2Z0QA 3TW1A 2N0YA 2K00A 2R0DA 1LW3A 2D9VA 2DYNA 2COAA 2M38A 3D8EA 1ISNA 1MIZB 2J59M 3F5RA 1U5EA 2LOZA 5FI0A 5JHHA 1ZM0A 2EMSA 5DI9B 4CHMA 4KHAA 2COFA 1OMWA 2K2JA 5HE3A 2VKIA 1FHOA 1KZGA 5DHFB 3VOQA 4HAZB 4HDOA 1EAZA 4C0AA 3KY9A 4HB3B 1MKEA 1I7AA 5FI1A 2CAYA 1PLSA 3OANA 1M7RA 2LYDA 3PVUA 2VRWB 1UEFA 4Z2NA 1X1FA 2NZ8B 3A98B 5GOWB 1OY2A 3CXBB 4TYZA 1WI1A 2CODA 4DXAB 2GCLA 1GC7A 3U7DA 2D9ZA 1FOEA 4XWXA 1BAKA 1J0WA 4NY0A 2RNRB 1NU2A 2J0JA 2YT0A 1EF1A 2ROZB 1WJMA 4TKNA 2K2UA 1GG3A 2ADZA 3X23A 5JLJB 1MK9B 5C5BB 2OQBA 1DDWA 4ZRJA 3BJIA 1X05A 3LJUX 3MPXA 2LULA 1WJ1A 1XX0A 2HE7A 4HAWB 2COCA 2MWNB 3U8ZA 3CIKA 4A6FB 4F7UP 2L2IA 2P0DA 4HB2B 2D10A 3SYXA 2DHIA 2DX5A 2DKQA 2GCJA 2AEHA 1IRSA 1X11A 1MK7B 5D3WA 2Q13A 5L81A 2YS1A 2OTXA 3PSCA 4DX90 3KZ1A 1NTVA 1SGHA 2ZPYA 5J3TA 2DLWA 3DXEA 1I2HA 4ZRIA 2RVBB 3SO6A 2P0HA 2VSZA 2IFSA 2KUPA 4KVGB 4HAXB 2UZSA 4Y94A 2DFKA 2NMBA 3AU5A 1QC6A 2DN6A 1MAIA 3ODXA 5D3YA 2DX1A 1DDMA 1PFJA 4YONA 3BINA 3TFMA 5C5BA 3N7CA 4K17A 1XCGA 3PG7A 4HHVA 2UVMA 1V5PA 1X1GA 2UZRA 2P8VA 1LB1A 5DIFB 1P3RA 2ELBA 1TQZA 2D9YA 2AL6A 5KQ1A 5HE2A 4F7GA 4A6FA 2L1CA 2YSZA 3ZVRA 3TO1A 3FSSA 1ZSQA 1U27A 3AJ4A 2YS3A 1U5GA 1FAOA 1P5TA 5D27A 4A6HA 3WA0A 2Y7BA 2D9WA 2XQNM 2MFQA 1XD4A 2I1JA 4HDQA 1AQCA 1E5WA 3PVWA 3TCAA 3A8PA 4K2PA 1U5FA 2N23A 4KHBB 1U5DA 3D8FA 4BBKA 1EVHA 4B6HA 3F0WA 1XODA 1X86A 2YS5A 1H4RA 3KRWA 2DA0A 1ZVRA 5KCVA 2EC1A 3ULCA 2RLOA 5CLQB 2LG1A 5JP4A 2JP2A 4YL8A 3UZTA 2LOXA 1DROA 1W1HA 5J3QA 1NTYA 5C79A 2YVCA 1WGUA 5JHGA 2I5FA 1V5MA 2D2QA 4IOYX 2D4QA 5CLLB 1UNQA 3PZDA 1TXDA 3HK0A 5C16A 3P7ZA 2Y8GA 1GC6A 2W2WA 2I1KA 4EKUA 5LONB 5KQ4A 2CY4A 1W1GA 5C6RA 4MK0A 1Q67A 2QKLA 4GXBA 2LKOA 2PZ1A 1SHCA 2X18A 4HAUB 1WG7A 4EMOA 1P6SA 1UNRA 2RSGA 3O96A 1Y5OA 1NI2A 2YT1A 3FEHA 4H8SA 3QBVB 2RGNB 1RJ2A 3ZDTA 1TJ6A 2ELAA 4K2OA 3HQCA 3T06A 3HW2B 2R09A 4GPTB 3VIAA 2DKPA 3M1IB 3TVVA 1BTNA 5DH9B 2DYQA 5D3VA 2DHKA 2MKRA 2IYBA 4ZRKA 1MPHA 1KZ7A 2D11A 3FM8C 2RUKB 3PP2A 4WSFA 3ODOA 2G35A 1FB8A 1FGZA 2YF0A 4MT7A 4HATB 1K5GB 5J3YA 3V5WA 4GMVA 4HB0B 5HE0A 2MDXA 5LOPB 1OQNA 3ODWA 4CHJA 4L6EA 4IFSA 2W2XD 2Z0PA 1DBHA 2E2XA 2ROVA 3G9WA 1ZC3B 1BTKA 3QWMA 1V5UA 2QKMA 1UNPA 3D8DA 5EFXA 4DX8A 3AU4A 3ML4A 1H10A 4GN1A 4HAVB 2V76A 2KGXB 3P6AA 4GZUA 1XKEA 4Z2MB 1PMSA 2P0FA 2M14A 4D0NB 2H7DA 3MDBC 1FHXA 4GMXB 1FGYA 3KRXA 4WVFB 2Z0OA 5D3XA 4CYEA 3PEGA 4KHOA 4PNKA 4WJ7A 3IVFA 3KSYA 3ULBA 3NSUA 4A5KA 2D9XA 1KI1B 4K81A 1MIXA 5DHAB 4IAPA 3GYOA 4KAXB 3SUZA 1Z87A 2Y8FA 1EGXA 1U29A 2KCJA 2GJYA 3QIJA 2H7EA 2EMTA 1DDVA 4F7HA 2DTCA 3SV1A 3DXCA 1FHWA 2CY5A 1B55A 2I5CA 2CRFA 1AWEA 3A8QA 2GS0A 3WYFB 2BCJA 1QQGA 4P7IA 3RCPA 2DHJA 1V89A 1WGQA 2J0KA 3DXDA 1V88A 1W1DA 3GYPA 4A6KA 1J19A 1UPRA 2EJ8A 5HE1A 2J0MA 4EJNA 1RRPB 1U2BA 4HB4B 4DBBA 1WVHA 1M7EA 1V61A 2YRYA 2FJLA 1N3HA 3PVLA 1Y19B 1XR0B 4HAYB 2HTHB 4NSWA 2W2XC 1BWNA 3SNHA 1ZC4B 4MY6A 4PQ0A 1UPQA 1DYNA 1K5DB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Z0Q A;  3TW1 A;  2N0Y A;  2K00 A;  2R0D A;  1LW3 A;  2D9V A;  2DYN A;  2COA A;  2M38 A;  3D8E A;  1ISN A;  1MIZ B;  2J59 M;  3F5R A;  1U5E A;  2LOZ A;  5FI0 A;  5JHH A;  1ZM0 A;  2EMS A;  5DI9 B;  4CHM A;  4KHA A;  2COF A;  1OMW A;  2K2J A;  5HE3 A;  2VKI A;  1FHO A;  1KZG A;  5DHF B;  3VOQ A;  4HAZ B;  4HDO A;  1EAZ A;  4C0A A;  3KY9 A;  4HB3 B;  1MKE A;  1I7A A;  5FI1 A;  2CAY A;  1PLS A;  3OAN A;  1M7R A;  2LYD A;  3PVU A;  2VRW B;  1UEF A;  4Z2N A;  1X1F A;  2NZ8 B;  3A98 B;  5GOW B;  1OY2 A;  3CXB B;  4TYZ A;  1WI1 A;  2COD A;  4DXA B;  2GCL A;  1GC7 A;  3U7D A;  2D9Z A;  1FOE A;  4XWX A;  1BAK A;  1J0W A;  4NY0 A;  2RNR B;  1NU2 A;  2J0J A;  2YT0 A;  1EF1 A;  2ROZ B;  1WJM A;  4TKN A;  2K2U A;  1GG3 A;  2ADZ A;  3X23 A;  5JLJ B;  1MK9 B;  5C5B B;  2OQB A;  1DDW A;  4ZRJ A;  3BJI A;  1X05 A;  3LJU X;  3MPX A;  2LUL A;  1WJ1 A;  1XX0 A;  2HE7 A;  4HAW B;  2COC A;  2MWN B;  3U8Z A;  3CIK A;  4A6F B;  4F7U P;  2L2I A;  2P0D A;  4HB2 B;  2D10 A;  3SYX A;  2DHI A;  2DX5 A;  2DKQ A;  2GCJ A;  2AEH A;  1IRS A;  1X11 A;  1MK7 B;  5D3W A;  2Q13 A;  5L81 A;  2YS1 A;  2OTX A;  3PSC A;  4DX9 0;  3KZ1 A;  1NTV A;  1SGH A;  2ZPY A;  5J3T A;  2DLW A;  3DXE A;  1I2H A;  4ZRI A;  2RVB B;  3SO6 A;  2P0H A;  2VSZ A;  2IFS A;  2KUP A;  4KVG B;  4HAX B;  2UZS A;  4Y94 A;  2DFK A;  2NMB A;  3AU5 A;  1QC6 A;  2DN6 A;  1MAI A;  3ODX A;  5D3Y A;  2DX1 A;  1DDM A;  1PFJ A;  4YON A;  3BIN A;  3TFM A;  5C5B A;  3N7C A;  4K17 A;  1XCG A;  3PG7 A;  4HHV A;  2UVM A;  1V5P A;  1X1G A;  2UZR A;  2P8V A;  1LB1 A;  5DIF B;  1P3R A;  2ELB A;  1TQZ A;  2D9Y A;  2AL6 A;  5KQ1 A;  5HE2 A;  4F7G A;  4A6F A;  2L1C A;  2YSZ A;  3ZVR A;  3TO1 A;  3FSS A;  1ZSQ A;  1U27 A;  3AJ4 A;  2YS3 A;  1U5G A;  1FAO A;  1P5T A;  5D27 A;  4A6H A;  3WA0 A;  2Y7B A;  2D9W A;  2XQN M;  2MFQ A;  1XD4 A;  2I1J A;  4HDQ A;  1AQC A;  1E5W A;  3PVW A;  3TCA A;  3A8P A;  4K2P A;  1U5F A;  2N23 A;  4KHB B;  1U5D A;  3D8F A;  4BBK A;  1EVH A;  4B6H A;  3F0W A;  1XOD A;  1X86 A;  2YS5 A;  1H4R A;  3KRW A;  2DA0 A;  1ZVR A;  5KCV A;  2EC1 A;  3ULC A;  2RLO A;  5CLQ B;  2LG1 A;  5JP4 A;  2JP2 A;  4YL8 A;  3UZT A;  2LOX A;  1DRO A;  1W1H A;  5J3Q A;  1NTY A;  5C79 A;  2YVC A;  1WGU A;  5JHG A;  2I5F A;  1V5M A;  2D2Q A;  4IOY X;  2D4Q A;  5CLL B;  1UNQ A;  3PZD A;  1TXD A;  3HK0 A;  5C16 A;  3P7Z A;  2Y8G A;  1GC6 A;  2W2W A;  2I1K A;  4EKU A;  5LON B;  5KQ4 A;  2CY4 A;  1W1G A;  5C6R A;  4MK0 A;  1Q67 A;  2QKL A;  4GXB A;  2LKO A;  2PZ1 A;  1SHC A;  2X18 A;  4HAU B;  1WG7 A;  4EMO A;  1P6S A;  1UNR A;  2RSG A;  3O96 A;  1Y5O A;  1NI2 A;  2YT1 A;  3FEH A;  4H8S A;  3QBV B;  2RGN B;  1RJ2 A;  3ZDT A;  1TJ6 A;  2ELA A;  4K2O A;  3HQC A;  3T06 A;  3HW2 B;  2R09 A;  4GPT B;  3VIA A;  2DKP A;  3M1I B;  3TVV A;  1BTN A;  5DH9 B;  2DYQ A;  5D3V A;  2DHK A;  2MKR A;  2IYB A;  4ZRK A;  1MPH A;  1KZ7 A;  2D11 A;  3FM8 C;  2RUK B;  3PP2 A;  4WSF A;  3ODO A;  2G35 A;  1FB8 A;  1FGZ A;  2YF0 A;  4MT7 A;  4HAT B;  1K5G B;  5J3Y A;  3V5W A;  4GMV A;  4HB0 B;  5HE0 A;  2MDX A;  5LOP B;  1OQN A;  3ODW A;  4CHJ A;  4L6E A;  4IFS A;  2W2X D;  2Z0P A;  1DBH A;  2E2X A;  2ROV A;  3G9W A;  1ZC3 B;  1BTK A;  3QWM A;  1V5U A;  2QKM A;  1UNP A;  3D8D A;  5EFX A;  4DX8 A;  3AU4 A;  3ML4 A;  1H10 A;  4GN1 A;  4HAV B;  2V76 A;  2KGX B;  3P6A A;  4GZU A;  1XKE A;  4Z2M B;  1PMS A;  2P0F A;  2M14 A;  4D0N B;  2H7D A;  3MDB C;  1FHX A;  4GMX B;  1FGY A;  3KRX A;  4WVF B;  2Z0O A;  5D3X A;  4CYE A;  3PEG A;  4KHO A;  4PNK A;  4WJ7 A;  3IVF A;  3KSY A;  3ULB A;  3NSU A;  4A5K A;  2D9X A;  1KI1 B;  4K81 A;  1MIX A;  5DHA B;  4IAP A;  3GYO A;  4KAX B;  3SUZ A;  1Z87 A;  2Y8F A;  1EGX A;  1U29 A;  2KCJ A;  2GJY A;  3QIJ A;  2H7E A;  2EMT A;  1DDV A;  4F7H A;  2DTC A;  3SV1 A;  3DXC A;  1FHW A;  2CY5 A;  1B55 A;  2I5C A;  2CRF A;  1AWE A;  3A8Q A;  2GS0 A;  3WYF B;  2BCJ A;  1QQG A;  4P7I A;  3RCP A;  2DHJ A;  1V89 A;  1WGQ A;  2J0K A;  3DXD A;  1V88 A;  1W1D A;  3GYP A;  4A6K A;  1J19 A;  1UPR A;  2EJ8 A;  5HE1 A;  2J0M A;  4EJN A;  1RRP B;  1U2B A;  4HB4 B;  4DBB A;  1WVH A;  1M7E A;  1V61 A;  2YRY A;  2FJL A;  1N3H A;  3PVL A;  1Y19 B;  1XR0 B;  4HAY B;  2HTH B;  4NSW A;  2W2X C;  1BWN A;  3SNH A;  1ZC4 B;  4MY6 A;  4PQ0 A;  1UPQ A;  1DYN A;  1K5D B; 
#chains in the Genus database with same CATH topology
 2Z0Q A;  3TW1 A;  2N0Y A;  1ZYI A;  2K00 A;  2R0D A;  1LW3 A;  2D9V A;  2DYN A;  2COA A;  2M38 A;  3D8E A;  1ISN A;  1MIZ B;  2J59 M;  3F5R A;  1U5E A;  2LOZ A;  5FI0 A;  5JHH A;  1ZM0 A;  2EMS A;  5DI9 B;  4CHM A;  4KHA A;  2COF A;  4OSN A;  2NBV A;  1OMW A;  2K2J A;  5HE3 A;  2VKI A;  1FHO A;  1KZG A;  5DHF B;  3VOQ A;  4HAZ B;  4HDO A;  1EAZ A;  4C0A A;  3KY9 A;  4HB3 B;  1MKE A;  1I7A A;  3B77 A;  5FI1 A;  2Z14 A;  2CAY A;  1PLS A;  3OAN A;  1M7R A;  2LYD A;  3PVU A;  2VRW B;  1UEF A;  4Z2N A;  1X1F A;  2NZ8 B;  3A98 B;  3NW8 A;  5GOW B;  1OY2 A;  3CXB B;  4TYZ A;  1WI1 A;  2COD A;  4DXA B;  2GCL A;  1GC7 A;  3U7D A;  3DCX A;  2D9Z A;  1FOE A;  4XWX A;  4CSQ A;  1BAK A;  1J0W A;  4NY0 A;  2RNR B;  1NU2 A;  2J0J A;  2YT0 A;  1EF1 A;  2KIG A;  2ROZ B;  1WJM A;  4TKN A;  2K2U A;  4D6W A;  1GG3 A;  2ADZ A;  3X23 A;  3NWD A;  5JLJ B;  1MK9 B;  5C5B B;  2OQB A;  1DDW A;  4ZRJ A;  3BJI A;  1X05 A;  3LJU X;  3MPX A;  2LUL A;  1WJ1 A;  1XX0 A;  2HE7 A;  4HAW B;  4DIX A;  2COC A;  2MWN B;  3HSA A;  3U8Z A;  3CIK A;  4A6F B;  4F7U P;  2L2I A;  2P0D A;  4HB2 B;  5LG4 B;  3FVC A;  2D10 A;  5I2M A;  3SYX A;  2DHI A;  2DX5 A;  2DKQ A;  2GCJ A;  2AEH A;  1IRS A;  1X11 A;  1MK7 B;  5D3W A;  2K8E A;  2Q13 A;  5L81 A;  2YS1 A;  2OTX A;  3PSC A;  4DX9 0;  3KZ1 A;  1NTV A;  1SGH A;  2ZPY A;  5J3T A;  2DLW A;  3NWA A;  3DXE A;  1I2H A;  4ZRI A;  2RVB B;  3SO6 A;  2P0H A;  2VSZ A;  2IFS A;  2KUP A;  4KVG B;  4HAX B;  2UZS A;  4Y94 A;  2DFK A;  2NMB A;  2YT2 A;  3AU5 A;  1QC6 A;  2DN6 A;  2Z4D A;  1MAI A;  3ODX A;  5D3Y A;  2DX1 A;  1DDM A;  1PFJ A;  4YON A;  3BIN A;  3TFM A;  5C5B A;  3N7C A;  4K17 A;  1XCG A;  3PG7 A;  4HHV A;  2UVM A;  1V5P A;  1X1G A;  2UZR A;  2P8V A;  1LB1 A;  5DIF B;  4HSI A;  1P3R A;  2ELB A;  1TQZ A;  2D9Y A;  2AL6 A;  2R2Y A;  5KQ1 A;  5HE2 A;  4F7G A;  4A6F A;  2L1C A;  2YSZ A;  3ZVR A;  3TO1 A;  3FSS A;  1ZSQ A;  1U27 A;  2Z59 A;  2RRF A;  3AJ4 A;  2YS3 A;  1U5G A;  1FAO A;  1P5T A;  5D27 A;  4A6H A;  3WA0 A;  2Y7B A;  2D9W A;  2XQN M;  2MFQ A;  1XD4 A;  2I1J A;  4HDQ A;  3HIE A;  1AQC A;  1E5W A;  3PVW A;  3TCA A;  3A8P A;  4K2P A;  1U5F A;  2N23 A;  4KHB B;  1U5D A;  3D8F A;  2FJU B;  4BBK A;  1EVH A;  4B6H A;  3F0W A;  1XOD A;  1X86 A;  2YS5 A;  1H4R A;  3KRW A;  2DA0 A;  1ZVR A;  5KCV A;  2EC1 A;  3ULC A;  2RLO A;  5CLQ B;  2LG1 A;  5JP4 A;  2JP2 A;  4YL8 A;  3UZT A;  2LOX A;  1DRO A;  1W1H A;  5J3Q A;  1NTY A;  5C79 A;  2YVC A;  1WGU A;  3U12 A;  5JHG A;  2I5F A;  1V5M A;  2D2Q A;  4IOY X;  2D4Q A;  2ZKM X;  5CLL B;  1UNQ A;  3PZD A;  1TXD A;  3HK0 A;  5C16 A;  3P7Z A;  2Y8G A;  2Z13 A;  1GC6 A;  2W2W A;  2I1K A;  4L1R A;  4EKU A;  5LON B;  5KQ4 A;  2CY4 A;  1W1G A;  5C6R A;  4MK0 A;  1Q67 A;  2QKL A;  4GXB A;  4QXA B;  2K49 A;  4QJ4 B;  2LKO A;  2PZ1 A;  1SHC A;  2X18 A;  4HAU B;  1WG7 A;  4EMO A;  1P6S A;  1UNR A;  2RSG A;  3O96 A;  1Y5O A;  1NI2 A;  2YT1 A;  3FEH A;  2KUQ A;  4H8S A;  3QBV B;  3NWF A;  2RGN B;  1RJ2 A;  3ZDT A;  1TJ6 A;  2ELA A;  4K2O A;  3HQC A;  1MI1 A;  3T06 A;  3HW2 B;  2R09 A;  4GPT B;  4KHB A;  3VIA A;  2DKP A;  3M1I B;  3TVV A;  1BTN A;  4QJ5 B;  5DH9 B;  2KIE A;  2DYQ A;  5D3V A;  2DHK A;  2MKR A;  2IYB A;  2GUM A;  1MPH A;  4ZRK A;  1KZ7 A;  2D11 A;  3FM8 C;  2RUK B;  3PP2 A;  4WSF A;  3ODO A;  2G35 A;  1FB8 A;  4GOU A;  1FGZ A;  2YF0 A;  4MT7 A;  4HAT B;  1K5G B;  5J3Y A;  3V5W A;  4GMV A;  4HB0 B;  5HE0 A;  1T77 A;  2MDX A;  5LOP B;  1OQN A;  3ODW A;  4CHJ A;  4L6E A;  4IFS A;  2W2X D;  2Z0P A;  1DBH A;  2E2X A;  2ROV A;  3G9W A;  1ZC3 B;  1BTK A;  3QWM A;  1V5U A;  2QKM A;  1UNP A;  3D8D A;  5EFX A;  4DX8 A;  3AU4 A;  3ML4 A;  1H10 A;  4GN1 A;  4HAV B;  2V76 A;  2KGX B;  3P6A A;  4GZU A;  1XKE A;  4Z2M B;  5I2S A;  1PMS A;  2P0F A;  2M14 A;  4GNK B;  4D0N B;  2H7D A;  5M4Y B;  2KR0 A;  3MDB C;  1FHX A;  4GMX B;  1FGY A;  3KRX A;  4WVF B;  2Z0O A;  5D3X A;  4CYE A;  3PEG A;  4KHO A;  4PNK A;  4WJ7 A;  3IVF A;  3KSY A;  3ULB A;  3NSU A;  4A5K A;  2D9X A;  1KI1 B;  4K81 A;  1MIX A;  5DHA B;  4IAP A;  3GYO A;  4KAX B;  3SUZ A;  1Z87 A;  2Y8F A;  1EGX A;  1U29 A;  2KCJ A;  2GJY A;  3QIJ A;  2H7E A;  2EMT A;  3A58 A;  1DDV A;  4F7H A;  2DTC A;  4OT1 A;  3SV1 A;  3DXC A;  1FHW A;  2CY5 A;  1B55 A;  2I5C A;  2CRF A;  1AWE A;  3A8Q A;  2GS0 A;  3WYF B;  2BCJ A;  5IRS A;  1QQG A;  4P7I A;  4QJ3 B;  3RCP A;  2DHJ A;  3OHM B;  1V89 A;  1WGQ A;  2J0K A;  3DXD A;  1V88 A;  1W1D A;  3GYP A;  4A6K A;  1J19 A;  1UPR A;  2EJ8 A;  5HE1 A;  2J0M A;  4EJN A;  1RRP B;  1U2B A;  4HB4 B;  4DBB A;  1WVH A;  1M7E A;  1V61 A;  2YRY A;  2FJL A;  1N3H A;  3PVL A;  1Y19 B;  1XR0 B;  4HAY B;  2HTH B;  4NSW A;  2W2X C;  1BWN A;  3SNH A;  1ZC4 B;  4MY6 A;  4PQ0 A;  1UPQ A;  1DYN A;  1K5D B; 
#chains in the Genus database with same CATH homology
 2Z0Q A;  3TW1 A;  2N0Y A;  2K00 A;  2R0D A;  1LW3 A;  2D9V A;  2DYN A;  2COA A;  2M38 A;  3D8E A;  1ISN A;  1MIZ B;  2J59 M;  3F5R A;  1U5E A;  2LOZ A;  5FI0 A;  5JHH A;  1ZM0 A;  2EMS A;  5DI9 B;  4CHM A;  4KHA A;  2COF A;  1OMW A;  2K2J A;  5HE3 A;  2VKI A;  1FHO A;  1KZG A;  5DHF B;  3VOQ A;  4HAZ B;  4HDO A;  1EAZ A;  4C0A A;  3KY9 A;  4HB3 B;  1MKE A;  1I7A A;  5FI1 A;  2CAY A;  1PLS A;  3OAN A;  1M7R A;  2LYD A;  3PVU A;  2VRW B;  1UEF A;  4Z2N A;  1X1F A;  2NZ8 B;  3A98 B;  5GOW B;  1OY2 A;  3CXB B;  4TYZ A;  1WI1 A;  2COD A;  4DXA B;  2GCL A;  1GC7 A;  3U7D A;  2D9Z A;  1FOE A;  4XWX A;  1BAK A;  1J0W A;  4NY0 A;  2RNR B;  1NU2 A;  2J0J A;  2YT0 A;  1EF1 A;  2ROZ B;  1WJM A;  4TKN A;  2K2U A;  1GG3 A;  2ADZ A;  3X23 A;  5JLJ B;  1MK9 B;  5C5B B;  2OQB A;  1DDW A;  4ZRJ A;  3BJI A;  1X05 A;  3LJU X;  3MPX A;  2LUL A;  1WJ1 A;  1XX0 A;  2HE7 A;  4HAW B;  2COC A;  2MWN B;  3U8Z A;  3CIK A;  4A6F B;  4F7U P;  2L2I A;  2P0D A;  4HB2 B;  2D10 A;  3SYX A;  2DHI A;  2DX5 A;  2DKQ A;  2GCJ A;  2AEH A;  1IRS A;  1X11 A;  1MK7 B;  5D3W A;  2Q13 A;  5L81 A;  2YS1 A;  2OTX A;  3PSC A;  4DX9 0;  3KZ1 A;  1NTV A;  1SGH A;  2ZPY A;  5J3T A;  2DLW A;  3DXE A;  1I2H A;  4ZRI A;  2RVB B;  3SO6 A;  2P0H A;  2VSZ A;  2IFS A;  2KUP A;  4KVG B;  4HAX B;  2UZS A;  4Y94 A;  2DFK A;  2NMB A;  3AU5 A;  1QC6 A;  2DN6 A;  1MAI A;  3ODX A;  5D3Y A;  2DX1 A;  1DDM A;  1PFJ A;  4YON A;  3BIN A;  3TFM A;  5C5B A;  3N7C A;  4K17 A;  1XCG A;  3PG7 A;  4HHV A;  2UVM A;  1V5P A;  1X1G A;  2UZR A;  2P8V A;  1LB1 A;  5DIF B;  1P3R A;  2ELB A;  1TQZ A;  2D9Y A;  2AL6 A;  5KQ1 A;  5HE2 A;  4F7G A;  4A6F A;  2L1C A;  2YSZ A;  3ZVR A;  3TO1 A;  3FSS A;  1ZSQ A;  1U27 A;  3AJ4 A;  2YS3 A;  1U5G A;  1FAO A;  1P5T A;  5D27 A;  4A6H A;  3WA0 A;  2Y7B A;  2D9W A;  2XQN M;  2MFQ A;  1XD4 A;  2I1J A;  4HDQ A;  1AQC A;  1E5W A;  3PVW A;  3TCA A;  3A8P A;  4K2P A;  1U5F A;  2N23 A;  4KHB B;  1U5D A;  3D8F A;  4BBK A;  1EVH A;  4B6H A;  3F0W A;  1XOD A;  1X86 A;  2YS5 A;  1H4R A;  3KRW A;  2DA0 A;  1ZVR A;  5KCV A;  2EC1 A;  3ULC A;  2RLO A;  5CLQ B;  2LG1 A;  5JP4 A;  2JP2 A;  4YL8 A;  3UZT A;  2LOX A;  1DRO A;  1W1H A;  5J3Q A;  1NTY A;  5C79 A;  2YVC A;  1WGU A;  5JHG A;  2I5F A;  1V5M A;  2D2Q A;  4IOY X;  2D4Q A;  5CLL B;  1UNQ A;  3PZD A;  1TXD A;  3HK0 A;  5C16 A;  3P7Z A;  2Y8G A;  1GC6 A;  2W2W A;  2I1K A;  4EKU A;  5LON B;  5KQ4 A;  2CY4 A;  1W1G A;  5C6R A;  4MK0 A;  1Q67 A;  2QKL A;  4GXB A;  2LKO A;  2PZ1 A;  1SHC A;  2X18 A;  4HAU B;  1WG7 A;  4EMO A;  1P6S A;  1UNR A;  2RSG A;  3O96 A;  1Y5O A;  1NI2 A;  2YT1 A;  3FEH A;  4H8S A;  3QBV B;  2RGN B;  1RJ2 A;  3ZDT A;  1TJ6 A;  2ELA A;  4K2O A;  3HQC A;  3T06 A;  3HW2 B;  2R09 A;  4GPT B;  3VIA A;  2DKP A;  3M1I B;  3TVV A;  1BTN A;  5DH9 B;  2DYQ A;  5D3V A;  2DHK A;  2MKR A;  2IYB A;  4ZRK A;  1MPH A;  1KZ7 A;  2D11 A;  3FM8 C;  2RUK B;  3PP2 A;  4WSF A;  3ODO A;  2G35 A;  1FB8 A;  1FGZ A;  2YF0 A;  4MT7 A;  4HAT B;  1K5G B;  5J3Y A;  3V5W A;  4GMV A;  4HB0 B;  5HE0 A;  2MDX A;  5LOP B;  1OQN A;  3ODW A;  4CHJ A;  4L6E A;  4IFS A;  2W2X D;  2Z0P A;  1DBH A;  2E2X A;  2ROV A;  3G9W A;  1ZC3 B;  1BTK A;  3QWM A;  1V5U A;  2QKM A;  1UNP A;  3D8D A;  5EFX A;  4DX8 A;  3AU4 A;  3ML4 A;  1H10 A;  4GN1 A;  4HAV B;  2V76 A;  2KGX B;  3P6A A;  4GZU A;  1XKE A;  4Z2M B;  1PMS A;  2P0F A;  2M14 A;  4D0N B;  2H7D A;  3MDB C;  1FHX A;  4GMX B;  1FGY A;  3KRX A;  4WVF B;  2Z0O A;  5D3X A;  4CYE A;  3PEG A;  4KHO A;  4PNK A;  4WJ7 A;  3IVF A;  3KSY A;  3ULB A;  3NSU A;  4A5K A;  2D9X A;  1KI1 B;  4K81 A;  1MIX A;  5DHA B;  4IAP A;  3GYO A;  4KAX B;  3SUZ A;  1Z87 A;  2Y8F A;  1EGX A;  1U29 A;  2KCJ A;  2GJY A;  3QIJ A;  2H7E A;  2EMT A;  1DDV A;  4F7H A;  2DTC A;  3SV1 A;  3DXC A;  1FHW A;  2CY5 A;  1B55 A;  2I5C A;  2CRF A;  1AWE A;  3A8Q A;  2GS0 A;  3WYF B;  2BCJ A;  1QQG A;  4P7I A;  3RCP A;  2DHJ A;  1V89 A;  1WGQ A;  2J0K A;  3DXD A;  1V88 A;  1W1D A;  3GYP A;  4A6K A;  1J19 A;  1UPR A;  2EJ8 A;  5HE1 A;  2J0M A;  4EJN A;  1RRP B;  1U2B A;  4HB4 B;  4DBB A;  1WVH A;  1M7E A;  1V61 A;  2YRY A;  2FJL A;  1N3H A;  3PVL A;  1Y19 B;  1XR0 B;  4HAY B;  2HTH B;  4NSW A;  2W2X C;  1BWN A;  3SNH A;  1ZC4 B;  4MY6 A;  4PQ0 A;  1UPQ A;  1DYN A;  1K5D B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...