1ZC4B

Crystal structure of the ral-binding domain of exo84 in complex with the active rala
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
113
structure length
113
Chain Sequence
GQYLVYNGDLVEYEADHMAQLQRVHGFLMNDCLLVATWLPQRRGMYRYNALYPLDRLAVVNVKDNPPMKDMFKLLMFPESRIFQAENAKIKREWLEVLEETKRALSDKRRREQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Ras-related protein Ral-A
publication title Exo84 and Sec5 are competitive regulatory Sec6/8 effectors to the RalA GTPase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 28
structure length 113
sequence length 113
chains with identical sequence D
ec nomenclature
pdb deposition date 2005-04-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 1zc4B00
4TKNA 1U5EA 3G9WA 1V89A 2ROVA 2Y7BA 3NSUA 3SNHA 2KUPA 4H8SA 2KGXB 3AU4A 1WGQA 3VOQA 5JHGA 3X23A 3A98B 1X05A 1I7AA 2COCA 2EC1A 1K5DB 4NSWA 3P6AA 1MKEA 4GPTB 3ULCA 2YS5A 2YT0A 1V61A 4GN1A 2G35A 1U29A 2N0YA 2DHKA 2D9YA 1UPQA 4YONA 5JLJB 5D3VA 3AU5A 5DHAB 2YVCA 3D8FA 5FI0A 1MPHA 2P0DA 1B55A 4HAUB 3UZTA 3HW2B 2YS1A 3SV1A 3DXDA 4GXBA 1NI2A 1U5GA 1ZC3B 5C6RA 5C79A 3V5WA 1MIZB 2RGNB 1PMSA 4HATB 5EFXA 3PVLA 1M7RA 3SUZA 2P0HA 3KRXA 5J3TA 2ELAA 2OTXA 4L6EA 1GC7A 2UZRA 1KI1B 3FSSA 4GMVA 2CY4A 2D10A 1V5MA 1W1GA 1DDMA 1ZVRA 5C5BA 4CHJA 1MIXA 2DKQA 5D27A 1AWEA 2QKLA 2YS3A 1MAIA 3F0WA 4HB0B 4ZRIA 5HE2A 2J0KA 2ROZB 1U5DA 4K17A 4Y94A 4A6FB 5HE1A 3TO1A 2RLOA 2D9VA 3BJIA 1WJMA 1FB8A 5FI1A 1FGZA 5KQ1A 2YF0A 3A8PA 4A6HA 3QWMA 1XX0A 2L1CA 3TFMA 1EGXA 1BTNA 5J3QA 2RNRB 5LONB 2GS0A 4HB2B 4TYZA 4KHOA 3ZVRA 2EMTA 3BINA 2ADZA 4DX8A 2DA0A 4BBKA 2QKMA 4K81A 1PFJA 2UVMA 2D2QA 1AQCA 2H7EA 5HE3A 1BWNA 1TXDA 2ELBA 2LYDA 5C16A 2H7DA 1U5FA 2VSZA 5GOWB 1H4RA 1FHOA 2I5CA 3PZDA 4XWXA 3TW1A 3ULBA 2I1JA 5JP4A 4EKUA 1MK7B 4HB3B 1ISNA 4DX90 3PP2A 5CLQB 1ZSQA 3D8EA 2PZ1A 2MWNB 3FM8C 2M14A 2R0DA 4A6FA 1IRSA 1FGYA 2LKOA 4ZRKA 5KQ4A 1K5GB 1SHCA 1FHXA 4HAZB 4IAPA 2BCJA 1ZM0A 3ZDTA 1E5WA 3FEHA 4MY6A 2R09A 1NU2A 1EVHA 1FOEA 2D9ZA 3PVWA 1MK9B 2X18A 2D4QA 1J0WA 1U2BA 1UNPA 2EMSA 4WSFA 1WVHA 2RVBB 1WI1A 2Z0QA 4KHBB 3IVFA 1KZGA 3SYXA 1WJ1A 3ODWA 2CODA 4HAVB 4KAXB 2KCJA 5D3XA 1DDVA 4Z2MB 2DTCA 2COFA 4F7GA 5DHFB 3QIJA 3LJUX 3ODXA 2M38A 3N7CA 3GYPA 1DDWA 3A8QA 4WVFB 3M1IB 1OMWA 3GYOA 4IOYX 1UPRA 2K2UA 1V88A 4NY0A 1DBHA 3F5RA 3RCPA 2MDXA 3CXBB 4F7UP 2XQNM 2HE7A 1UNRA 1WGUA 2COAA 2DFKA 5D3WA 5JHHA 1X1FA 4GZUA 2RUKB 1XODA 1V5UA 4HDOA 1BAKA 2GCLA 1Y5OA 2CRFA 5J3YA 2V76A 2Z0OA 5HE0A 2CAYA 1OQNA 2YRYA 1XD4A 5D3YA 2MFQA 1N3HA 2D9XA 1NTYA 1GG3A 5LOPB 3ML4A 4KHAA 2W2XD 3CIKA 1Q67A 4HAXB 2NMBA 2LOXA 2L2IA 3HQCA 3WA0A 3HK0A 3TVVA 2GCJA 2Y8GA 1QC6A 3ODOA 2LG1A 3T06A 4EMOA 2Z0PA 2DLWA 2Q13A 3WYFB 2DX5A 1DYNA 2HTHB 1RJ2A 1EF1A 2VKIA 2E2XA 4CYEA 4HB4B 1V5PA 2EJ8A 4K2OA 3DXEA 1XKEA 1W1DA 3OANA 2IFSA 1FHWA 4DXAB 2MKRA 4C0AA 1FAOA 1H10A 1QQGA 2J59M 1I2HA 3KZ1A 2IYBA 4ZRJA 2RSGA 2OQBA 4HAYB 1RRPB 2DYNA 1X11A 2K00A 2GJYA 1UEFA 3D8DA 1Z87A 4HAWB 2YSZA 4WJ7A 1U27A 3O96A 4PQ0A 3SO6A 1X1GA 2UZSA 1SGHA 3U7DA 1GC6A 1Y19B 2AL6A 4IFSA 2DYQA 3KRWA 5L81A 5DH9B 2JP2A 1UNQA 2J0JA 4PNKA 4MK0A 1OY2A 1J19A 2DN6A 3PG7A 3MDBC 1P6SA 4EJNA 1LW3A 3PVUA 4Z2NA 1W1HA 1NTVA 3KSYA 4MT7A 2DHIA 5CLLB 2P0FA 3KY9A 2CY5A 2LOZA 2W2XC 4F7HA 2YT1A 3TCAA 1M7EA 2DX1A 3PEGA 1ZC4B 3QBVB 4P7IA 4K2PA 5DIFB 2N23A 4CHMA 2I1KA 1TJ6A 1WG7A 2ZPYA 2DKPA 4HDQA 1EAZA 4YL8A 3MPXA 1P5TA 1LB1A 2NZ8B 3DXCA 2LULA 4HHVA 1DROA 5DI9B 4B6HA 5KCVA 2AEHA 4KVGB 4DBBA 1BTKA 4GMXB 2P8VA 2D11A 3AJ4A 1KZ7A 3PSCA 3U8ZA 4A6KA 4A5KA 1XCGA 1XR0B 2D9WA 3VIAA 1TQZA 4D0NB 2W2WA 1X86A 3P7ZA 2Y8FA 2DHJA 1P3RA 1PLSA 2I5FA 5C5BB 2FJLA 2K2JA 2VRWB 2J0MA
chains in the Genus database with same CATH superfamily
4TKNA 1U5EA 3G9WA 1V89A 2ROVA 2Y7BA 3NSUA 3SNHA 2KUPA 4H8SA 2KGXB 2RRFA 3AU4A 1WGQA 3VOQA 5JHGA 3X23A 1MI1A 3A98B 1X05A 1I7AA 2COCA 2EC1A 1K5DB 4NSWA 3P6AA 1MKEA 4GPTB 3FVCA 3ULCA 2YS5A 2YT0A 1V61A 4GN1A 2G35A 1U29A 4GNKB 2N0YA 2DHKA 2D9YA 1UPQA 4YONA 5JLJB 5D3VA 3AU5A 5DHAB 3NW8A 2YVCA 3D8FA 5FI0A 1MPHA 2P0DA 1B55A 4HAUB 3UZTA 3HW2B 2YS1A 3SV1A 3DXDA 4GXBA 1NI2A 1U5GA 1ZC3B 5C6RA 5C79A 3V5WA 2Z59A 1MIZB 2RGNB 1PMSA 4HATB 5EFXA 3PVLA 1M7RA 3SUZA 2P0HA 3KRXA 5J3TA 2ELAA 2OTXA 4L6EA 1GC7A 2UZRA 1KI1B 3FSSA 4GMVA 2CY4A 2D10A 1V5MA 1W1GA 2KR0A 1DDMA 1ZVRA 5C5BA 4CHJA 1MIXA 2DKQA 5D27A 4QJ3B 2QKLA 5IRSA 1AWEA 2YS3A 1MAIA 3F0WA 4HB0B 4ZRIA 5HE2A 2J0KA 2ROZB 1U5DA 4K17A 4Y94A 4A6FB 5HE1A 5I2MA 3TO1A 2RLOA 2D9VA 3BJIA 2Z4DA 1WJMA 1FB8A 5FI1A 1FGZA 5KQ1A 2YF0A 3A8PA 4A6HA 3QWMA 1XX0A 2L1CA 3TFMA 1EGXA 1BTNA 5J3QA 2RNRB 5LONB 2GS0A 4HB2B 4TYZA 4KHOA 3ZVRA 2EMTA 3BINA 2ADZA 4DX8A 2DA0A 4BBKA 2QKMA 4K81A 1PFJA 2UVMA 2D2QA 1AQCA 2NBVA 2H7EA 5HE3A 1BWNA 1TXDA 2ELBA 2LYDA 5C16A 2H7DA 1U5FA 2VSZA 5GOWB 1H4RA 1FHOA 2I5CA 3PZDA 4XWXA 3TW1A 3ULBA 2I1JA 5JP4A 4EKUA 1MK7B 4HB3B 1ISNA 4DX90 3PP2A 5CLQB 3U12A 1ZSQA 3D8EA 2PZ1A 2MWNB 3FM8C 2M14A 4OT1A 2R0DA 4A6FA 1IRSA 2KIEA 1FGYA 2LKOA 4ZRKA 5KQ4A 1K5GB 1SHCA 1FHXA 4HAZB 4IAPA 4L1RA 2BCJA 1ZM0A 3ZDTA 1E5WA 4D6WA 3FEHA 4MY6A 2R09A 1NU2A 2KUQA 1EVHA 1FOEA 2D9ZA 3PVWA 4OSNA 1MK9B 2X18A 2D4QA 1J0WA 1U2BA 1UNPA 2EMSA 4WSFA 1WVHA 2RVBB 1WI1A 2Z0QA 4KHBB 3IVFA 1KZGA 3SYXA 3DCXA 1WJ1A 2R2YA 3ODWA 2CODA 4HAVB 4KAXB 2KCJA 5D3XA 5LG4B 1DDVA 4Z2MB 2DTCA 2COFA 4F7GA 5DHFB 3QIJA 3LJUX 3ODXA 2M38A 3N7CA 3GYPA 1DDWA 3A8QA 4WVFB 3M1IB 1OMWA 3GYOA 4IOYX 4DIXA 1UPRA 2K2UA 1V88A 4NY0A 1DBHA 3F5RA 3RCPA 2MDXA 3CXBB 4F7UP 2XQNM 2HE7A 1UNRA 1WGUA 2COAA 2DFKA 5D3WA 5JHHA 1X1FA 4GZUA 2KIGA 2RUKB 1XODA 2K8EA 1V5UA 3HSAA 4HDOA 1BAKA 2GCLA 1Y5OA 2CRFA 2GUMA 5J3YA 2V76A 2Z0OA 5HE0A 2CAYA 1OQNA 2YRYA 1XD4A 4KHBA 1T77A 5D3YA 3HIEA 2MFQA 1N3HA 4QXAB 2D9XA 1NTYA 1GG3A 5LOPB 3ML4A 4KHAA 2W2XD 3CIKA 1Q67A 4HAXB 2NMBA 2LOXA 2L2IA 3HQCA 3WA0A 3HK0A 3TVVA 2GCJA 2Y8GA 1QC6A 3ODOA 2LG1A 2Z13A 3T06A 4QJ5B 4EMOA 2Z0PA 3NWDA 2DLWA 2Q13A 3WYFB 2DX5A 1DYNA 2HTHB 1RJ2A 1EF1A 2VKIA 2E2XA 4CYEA 4HB4B 5I2SA 1V5PA 2EJ8A 4K2OA 3DXEA 1XKEA 1W1DA 3OANA 2IFSA 1FHWA 4DXAB 2MKRA 4C0AA 1FAOA 1H10A 1QQGA 2J59M 1I2HA 3KZ1A 2IYBA 4HSIA 4ZRJA 1ZYIA 2RSGA 2OQBA 4HAYB 1RRPB 2DYNA 4QJ4B 1X11A 2K00A 2GJYA 1UEFA 3D8DA 1Z87A 4HAWB 3OHMB 2YSZA 4WJ7A 1U27A 3O96A 4PQ0A 3SO6A 1X1GA 2UZSA 1SGHA 3U7DA 1GC6A 1Y19B 2AL6A 4IFSA 2DYQA 3KRWA 5L81A 2FJUB 5DH9B 2JP2A 1UNQA 2J0JA 4PNKA 4CSQA 4MK0A 1OY2A 1J19A 2DN6A 3PG7A 3MDBC 1P6SA 4EJNA 1LW3A 2Z14A 3PVUA 2YT2A 4Z2NA 1W1HA 1NTVA 3KSYA 4MT7A 2DHIA 5CLLB 2P0FA 3KY9A 2CY5A 2LOZA 2W2XC 4F7HA 2YT1A 3TCAA 1M7EA 2DX1A 2K49A 3PEGA 1ZC4B 3QBVB 4P7IA 4K2PA 5DIFB 2N23A 3A58A 4CHMA 2I1KA 1TJ6A 1WG7A 2ZPYA 2DKPA 4HDQA 1EAZA 4YL8A 3NWAA 3B77A 3DXCA 1P5TA 1LB1A 2NZ8B 3MPXA 2LULA 4HHVA 1DROA 5DI9B 4B6HA 5KCVA 2AEHA 4KVGB 4DBBA 2ZKMX 1BTKA 4GMXB 2P8VA 2D11A 3AJ4A 1KZ7A 3PSCA 4GOUA 3U8ZA 4A6KA 4A5KA 1XCGA 1XR0B 2D9WA 3VIAA 1TQZA 4D0NB 2W2WA 1X86A 3P7ZA 2Y8FA 2DHJA 1P3RA 3NWFA 1PLSA 2I5FA 5C5BB 2FJLA 2K2JA 2VRWB 2J0MA 5M4YB
chains in the Genus database with same CATH topology
4TKNA 1U5EA 3G9WA 1V89A 2ROVA 2Y7BA 3NSUA 3SNHA 2KUPA 4H8SA 2KGXB 3AU4A 1WGQA 3VOQA 5JHGA 3X23A 3A98B 1X05A 1I7AA 2COCA 2EC1A 1K5DB 4NSWA 3P6AA 1MKEA 4GPTB 3ULCA 2YS5A 2YT0A 1V61A 4GN1A 2G35A 1U29A 2N0YA 2DHKA 2D9YA 1UPQA 4YONA 5JLJB 5D3VA 3AU5A 5DHAB 2YVCA 3D8FA 5FI0A 1MPHA 2P0DA 1B55A 4HAUB 3UZTA 3HW2B 2YS1A 3SV1A 3DXDA 4GXBA 1NI2A 1U5GA 1ZC3B 5C6RA 5C79A 3V5WA 1MIZB 2RGNB 1PMSA 4HATB 5EFXA 3PVLA 1M7RA 3SUZA 2P0HA 3KRXA 5J3TA 2ELAA 2OTXA 4L6EA 1GC7A 2UZRA 1KI1B 3FSSA 4GMVA 2CY4A 2D10A 1V5MA 1W1GA 1DDMA 1ZVRA 5C5BA 4CHJA 1MIXA 2DKQA 5D27A 1AWEA 2QKLA 2YS3A 1MAIA 3F0WA 4HB0B 4ZRIA 5HE2A 2J0KA 2ROZB 1U5DA 4K17A 4Y94A 4A6FB 5HE1A 3TO1A 2RLOA 2D9VA 3BJIA 1WJMA 1FB8A 5FI1A 1FGZA 5KQ1A 2YF0A 3A8PA 4A6HA 3QWMA 1XX0A 2L1CA 3TFMA 1EGXA 1BTNA 5J3QA 2RNRB 5LONB 2GS0A 4HB2B 4TYZA 4KHOA 3ZVRA 2EMTA 3BINA 2ADZA 4DX8A 2DA0A 4BBKA 2QKMA 4K81A 1PFJA 2UVMA 2D2QA 1AQCA 2H7EA 5HE3A 1BWNA 1TXDA 2ELBA 2LYDA 5C16A 2H7DA 1U5FA 2VSZA 5GOWB 1H4RA 1FHOA 2I5CA 3PZDA 4XWXA 3TW1A 3ULBA 2I1JA 5JP4A 4EKUA 1MK7B 4HB3B 1ISNA 4DX90 3PP2A 5CLQB 1ZSQA 3D8EA 2PZ1A 2MWNB 3FM8C 2M14A 2R0DA 4A6FA 1IRSA 1FGYA 2LKOA 4ZRKA 5KQ4A 1K5GB 1SHCA 1FHXA 4HAZB 4IAPA 2BCJA 1ZM0A 3ZDTA 1E5WA 3FEHA 4MY6A 2R09A 1NU2A 1EVHA 1FOEA 2D9ZA 3PVWA 1MK9B 2X18A 2D4QA 1J0WA 1U2BA 1UNPA 2EMSA 4WSFA 1WVHA 2RVBB 1WI1A 2Z0QA 4KHBB 3IVFA 1KZGA 3SYXA 1WJ1A 3ODWA 2CODA 4HAVB 4KAXB 2KCJA 5D3XA 1DDVA 4Z2MB 2DTCA 2COFA 4F7GA 5DHFB 3QIJA 3LJUX 3ODXA 2M38A 3N7CA 3GYPA 1DDWA 3A8QA 4WVFB 3M1IB 1OMWA 3GYOA 4IOYX 1UPRA 2K2UA 1V88A 4NY0A 1DBHA 3F5RA 3RCPA 2MDXA 3CXBB 4F7UP 2XQNM 2HE7A 1UNRA 1WGUA 2COAA 2DFKA 5D3WA 5JHHA 1X1FA 4GZUA 2RUKB 1XODA 1V5UA 4HDOA 1BAKA 2GCLA 1Y5OA 2CRFA 5J3YA 2V76A 2Z0OA 5HE0A 2CAYA 1OQNA 2YRYA 1XD4A 5D3YA 2MFQA 1N3HA 2D9XA 1NTYA 1GG3A 5LOPB 3ML4A 4KHAA 2W2XD 3CIKA 1Q67A 4HAXB 2NMBA 2LOXA 2L2IA 3HQCA 3WA0A 3HK0A 3TVVA 2GCJA 2Y8GA 1QC6A 3ODOA 2LG1A 3T06A 4EMOA 2Z0PA 2DLWA 2Q13A 3WYFB 2DX5A 1DYNA 2HTHB 1RJ2A 1EF1A 2VKIA 2E2XA 4CYEA 4HB4B 1V5PA 2EJ8A 4K2OA 3DXEA 1XKEA 1W1DA 3OANA 2IFSA 1FHWA 4DXAB 2MKRA 4C0AA 1FAOA 1H10A 1QQGA 2J59M 1I2HA 3KZ1A 2IYBA 4ZRJA 2RSGA 2OQBA 4HAYB 1RRPB 2DYNA 1X11A 2K00A 2GJYA 1UEFA 3D8DA 1Z87A 4HAWB 2YSZA 4WJ7A 1U27A 3O96A 4PQ0A 3SO6A 1X1GA 2UZSA 1SGHA 3U7DA 1GC6A 1Y19B 2AL6A 4IFSA 2DYQA 3KRWA 5L81A 5DH9B 2JP2A 1UNQA 2J0JA 4PNKA 4MK0A 1OY2A 1J19A 2DN6A 3PG7A 3MDBC 1P6SA 4EJNA 1LW3A 3PVUA 4Z2NA 1W1HA 1NTVA 3KSYA 4MT7A 2DHIA 5CLLB 2P0FA 3KY9A 2CY5A 2LOZA 2W2XC 4F7HA 2YT1A 3TCAA 1M7EA 2DX1A 3PEGA 1ZC4B 3QBVB 4P7IA 4K2PA 5DIFB 2N23A 4CHMA 2I1KA 1TJ6A 1WG7A 2ZPYA 2DKPA 4HDQA 1EAZA 4YL8A 3MPXA 1P5TA 1LB1A 2NZ8B 3DXCA 2LULA 4HHVA 1DROA 5DI9B 4B6HA 5KCVA 2AEHA 4KVGB 4DBBA 1BTKA 4GMXB 2P8VA 2D11A 3AJ4A 1KZ7A 3PSCA 3U8ZA 4A6KA 4A5KA 1XCGA 1XR0B 2D9WA 3VIAA 1TQZA 4D0NB 2W2WA 1X86A 3P7ZA 2Y8FA 2DHJA 1P3RA 1PLSA 2I5FA 5C5BB 2FJLA 2K2JA 2VRWB 2J0MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4TKN A;  1U5E A;  3G9W A;  1V89 A;  2ROV A;  2Y7B A;  3NSU A;  3SNH A;  2KUP A;  4H8S A;  2KGX B;  3AU4 A;  1WGQ A;  3VOQ A;  5JHG A;  3X23 A;  3A98 B;  1X05 A;  1I7A A;  2COC A;  2EC1 A;  1K5D B;  4NSW A;  3P6A A;  1MKE A;  4GPT B;  3ULC A;  2YS5 A;  2YT0 A;  1V61 A;  4GN1 A;  2G35 A;  1U29 A;  2N0Y A;  2DHK A;  2D9Y A;  1UPQ A;  4YON A;  5JLJ B;  5D3V A;  3AU5 A;  5DHA B;  2YVC A;  3D8F A;  5FI0 A;  1MPH A;  2P0D A;  1B55 A;  4HAU B;  3UZT A;  3HW2 B;  2YS1 A;  3SV1 A;  3DXD A;  4GXB A;  1NI2 A;  1U5G A;  1ZC3 B;  5C6R A;  5C79 A;  3V5W A;  1MIZ B;  2RGN B;  1PMS A;  4HAT B;  5EFX A;  3PVL A;  1M7R A;  3SUZ A;  2P0H A;  3KRX A;  5J3T A;  2ELA A;  2OTX A;  4L6E A;  1GC7 A;  2UZR A;  1KI1 B;  3FSS A;  4GMV A;  2CY4 A;  2D10 A;  1V5M A;  1W1G A;  1DDM A;  1ZVR A;  5C5B A;  4CHJ A;  1MIX A;  2DKQ A;  5D27 A;  1AWE A;  2QKL A;  2YS3 A;  1MAI A;  3F0W A;  4HB0 B;  4ZRI A;  5HE2 A;  2J0K A;  2ROZ B;  1U5D A;  4K17 A;  4Y94 A;  4A6F B;  5HE1 A;  3TO1 A;  2RLO A;  2D9V A;  3BJI A;  1WJM A;  1FB8 A;  5FI1 A;  1FGZ A;  5KQ1 A;  2YF0 A;  3A8P A;  4A6H A;  3QWM A;  1XX0 A;  2L1C A;  3TFM A;  1EGX A;  1BTN A;  5J3Q A;  2RNR B;  5LON B;  2GS0 A;  4HB2 B;  4TYZ A;  4KHO A;  3ZVR A;  2EMT A;  3BIN A;  2ADZ A;  4DX8 A;  2DA0 A;  4BBK A;  2QKM A;  4K81 A;  1PFJ A;  2UVM A;  2D2Q A;  1AQC A;  2H7E A;  5HE3 A;  1BWN A;  1TXD A;  2ELB A;  2LYD A;  5C16 A;  2H7D A;  1U5F A;  2VSZ A;  5GOW B;  1H4R A;  1FHO A;  2I5C A;  3PZD A;  4XWX A;  3TW1 A;  3ULB A;  2I1J A;  5JP4 A;  4EKU A;  1MK7 B;  4HB3 B;  1ISN A;  4DX9 0;  3PP2 A;  5CLQ B;  1ZSQ A;  3D8E A;  2PZ1 A;  2MWN B;  3FM8 C;  2M14 A;  2R0D A;  4A6F A;  1IRS A;  1FGY A;  2LKO A;  4ZRK A;  5KQ4 A;  1K5G B;  1SHC A;  1FHX A;  4HAZ B;  4IAP A;  2BCJ A;  1ZM0 A;  3ZDT A;  1E5W A;  3FEH A;  4MY6 A;  2R09 A;  1NU2 A;  1EVH A;  1FOE A;  2D9Z A;  3PVW A;  1MK9 B;  2X18 A;  2D4Q A;  1J0W A;  1U2B A;  1UNP A;  2EMS A;  4WSF A;  1WVH A;  2RVB B;  1WI1 A;  2Z0Q A;  4KHB B;  3IVF A;  1KZG A;  3SYX A;  1WJ1 A;  3ODW A;  2COD A;  4HAV B;  4KAX B;  2KCJ A;  5D3X A;  1DDV A;  4Z2M B;  2DTC A;  2COF A;  4F7G A;  5DHF B;  3QIJ A;  3LJU X;  3ODX A;  2M38 A;  3N7C A;  3GYP A;  1DDW A;  3A8Q A;  4WVF B;  3M1I B;  1OMW A;  3GYO A;  4IOY X;  1UPR A;  2K2U A;  1V88 A;  4NY0 A;  1DBH A;  3F5R A;  3RCP A;  2MDX A;  3CXB B;  4F7U P;  2XQN M;  2HE7 A;  1UNR A;  1WGU A;  2COA A;  2DFK A;  5D3W A;  5JHH A;  1X1F A;  4GZU A;  2RUK B;  1XOD A;  1V5U A;  4HDO A;  1BAK A;  2GCL A;  1Y5O A;  2CRF A;  5J3Y A;  2V76 A;  2Z0O A;  5HE0 A;  2CAY A;  1OQN A;  2YRY A;  1XD4 A;  5D3Y A;  2MFQ A;  1N3H A;  2D9X A;  1NTY A;  1GG3 A;  5LOP B;  3ML4 A;  4KHA A;  2W2X D;  3CIK A;  1Q67 A;  4HAX B;  2NMB A;  2LOX A;  2L2I A;  3HQC A;  3WA0 A;  3HK0 A;  3TVV A;  2GCJ A;  2Y8G A;  1QC6 A;  3ODO A;  2LG1 A;  3T06 A;  4EMO A;  2Z0P A;  2DLW A;  2Q13 A;  3WYF B;  2DX5 A;  1DYN A;  2HTH B;  1RJ2 A;  1EF1 A;  2VKI A;  2E2X A;  4CYE A;  4HB4 B;  1V5P A;  2EJ8 A;  4K2O A;  3DXE A;  1XKE A;  1W1D A;  3OAN A;  2IFS A;  1FHW A;  4DXA B;  2MKR A;  4C0A A;  1FAO A;  1H10 A;  1QQG A;  2J59 M;  1I2H A;  3KZ1 A;  2IYB A;  4ZRJ A;  2RSG A;  2OQB A;  4HAY B;  1RRP B;  2DYN A;  1X11 A;  2K00 A;  2GJY A;  1UEF A;  3D8D A;  1Z87 A;  4HAW B;  2YSZ A;  4WJ7 A;  1U27 A;  3O96 A;  4PQ0 A;  3SO6 A;  1X1G A;  2UZS A;  1SGH A;  3U7D A;  1GC6 A;  1Y19 B;  2AL6 A;  4IFS A;  2DYQ A;  3KRW A;  5L81 A;  5DH9 B;  2JP2 A;  1UNQ A;  2J0J A;  4PNK A;  4MK0 A;  1OY2 A;  1J19 A;  2DN6 A;  3PG7 A;  3MDB C;  1P6S A;  4EJN A;  1LW3 A;  3PVU A;  4Z2N A;  1W1H A;  1NTV A;  3KSY A;  4MT7 A;  2DHI A;  5CLL B;  2P0F A;  3KY9 A;  2CY5 A;  2LOZ A;  2W2X C;  4F7H A;  2YT1 A;  3TCA A;  1M7E A;  2DX1 A;  3PEG A;  1ZC4 B;  3QBV B;  4P7I A;  4K2P A;  5DIF B;  2N23 A;  4CHM A;  2I1K A;  1TJ6 A;  1WG7 A;  2ZPY A;  2DKP A;  4HDQ A;  1EAZ A;  4YL8 A;  3MPX A;  1P5T A;  1LB1 A;  2NZ8 B;  3DXC A;  2LUL A;  4HHV A;  1DRO A;  5DI9 B;  4B6H A;  5KCV A;  2AEH A;  4KVG B;  4DBB A;  1BTK A;  4GMX B;  2P8V A;  2D11 A;  3AJ4 A;  1KZ7 A;  3PSC A;  3U8Z A;  4A6K A;  4A5K A;  1XCG A;  1XR0 B;  2D9W A;  3VIA A;  1TQZ A;  4D0N B;  2W2W A;  1X86 A;  3P7Z A;  2Y8F A;  2DHJ A;  1P3R A;  1PLS A;  2I5F A;  5C5B B;  2FJL A;  2K2J A;  2VRW B;  2J0M A; 
#chains in the Genus database with same CATH topology
 4TKN A;  1U5E A;  3G9W A;  1V89 A;  2ROV A;  2Y7B A;  3NSU A;  3SNH A;  2KUP A;  4H8S A;  2KGX B;  2RRF A;  3AU4 A;  1WGQ A;  3VOQ A;  5JHG A;  3X23 A;  1MI1 A;  3A98 B;  1X05 A;  1I7A A;  2COC A;  2EC1 A;  1K5D B;  4NSW A;  3P6A A;  1MKE A;  4GPT B;  3FVC A;  3ULC A;  2YS5 A;  2YT0 A;  1V61 A;  4GN1 A;  2G35 A;  1U29 A;  4GNK B;  2N0Y A;  2DHK A;  2D9Y A;  1UPQ A;  4YON A;  5JLJ B;  5D3V A;  3AU5 A;  5DHA B;  3NW8 A;  2YVC A;  3D8F A;  5FI0 A;  1MPH A;  2P0D A;  1B55 A;  4HAU B;  3UZT A;  3HW2 B;  2YS1 A;  3SV1 A;  3DXD A;  4GXB A;  1NI2 A;  1U5G A;  1ZC3 B;  5C6R A;  5C79 A;  3V5W A;  2Z59 A;  1MIZ B;  2RGN B;  1PMS A;  4HAT B;  5EFX A;  3PVL A;  1M7R A;  3SUZ A;  2P0H A;  3KRX A;  5J3T A;  2ELA A;  2OTX A;  4L6E A;  1GC7 A;  2UZR A;  1KI1 B;  3FSS A;  4GMV A;  2CY4 A;  2D10 A;  1V5M A;  1W1G A;  2KR0 A;  1DDM A;  1ZVR A;  5C5B A;  4CHJ A;  1MIX A;  2DKQ A;  5D27 A;  4QJ3 B;  2QKL A;  5IRS A;  1AWE A;  2YS3 A;  1MAI A;  3F0W A;  4HB0 B;  4ZRI A;  5HE2 A;  2J0K A;  2ROZ B;  1U5D A;  4K17 A;  4Y94 A;  4A6F B;  5HE1 A;  5I2M A;  3TO1 A;  2RLO A;  2D9V A;  3BJI A;  2Z4D A;  1WJM A;  1FB8 A;  5FI1 A;  1FGZ A;  5KQ1 A;  2YF0 A;  3A8P A;  4A6H A;  3QWM A;  1XX0 A;  2L1C A;  3TFM A;  1EGX A;  1BTN A;  5J3Q A;  2RNR B;  5LON B;  2GS0 A;  4HB2 B;  4TYZ A;  4KHO A;  3ZVR A;  2EMT A;  3BIN A;  2ADZ A;  4DX8 A;  2DA0 A;  4BBK A;  2QKM A;  4K81 A;  1PFJ A;  2UVM A;  2D2Q A;  1AQC A;  2NBV A;  2H7E A;  5HE3 A;  1BWN A;  1TXD A;  2ELB A;  2LYD A;  5C16 A;  2H7D A;  1U5F A;  2VSZ A;  5GOW B;  1H4R A;  1FHO A;  2I5C A;  3PZD A;  4XWX A;  3TW1 A;  3ULB A;  2I1J A;  5JP4 A;  4EKU A;  1MK7 B;  4HB3 B;  1ISN A;  4DX9 0;  3PP2 A;  5CLQ B;  3U12 A;  1ZSQ A;  3D8E A;  2PZ1 A;  2MWN B;  3FM8 C;  2M14 A;  4OT1 A;  2R0D A;  4A6F A;  1IRS A;  2KIE A;  1FGY A;  2LKO A;  4ZRK A;  5KQ4 A;  1K5G B;  1SHC A;  1FHX A;  4HAZ B;  4IAP A;  4L1R A;  2BCJ A;  1ZM0 A;  3ZDT A;  1E5W A;  4D6W A;  3FEH A;  4MY6 A;  2R09 A;  1NU2 A;  2KUQ A;  1EVH A;  1FOE A;  2D9Z A;  3PVW A;  4OSN A;  1MK9 B;  2X18 A;  2D4Q A;  1J0W A;  1U2B A;  1UNP A;  2EMS A;  4WSF A;  1WVH A;  2RVB B;  1WI1 A;  2Z0Q A;  4KHB B;  3IVF A;  1KZG A;  3SYX A;  3DCX A;  1WJ1 A;  2R2Y A;  3ODW A;  2COD A;  4HAV B;  4KAX B;  2KCJ A;  5D3X A;  5LG4 B;  1DDV A;  4Z2M B;  2DTC A;  2COF A;  4F7G A;  5DHF B;  3QIJ A;  3LJU X;  3ODX A;  2M38 A;  3N7C A;  3GYP A;  1DDW A;  3A8Q A;  4WVF B;  3M1I B;  1OMW A;  3GYO A;  4IOY X;  4DIX A;  1UPR A;  2K2U A;  1V88 A;  4NY0 A;  1DBH A;  3F5R A;  3RCP A;  2MDX A;  3CXB B;  4F7U P;  2XQN M;  2HE7 A;  1UNR A;  1WGU A;  2COA A;  2DFK A;  5D3W A;  5JHH A;  1X1F A;  4GZU A;  2KIG A;  2RUK B;  1XOD A;  2K8E A;  1V5U A;  3HSA A;  4HDO A;  1BAK A;  2GCL A;  1Y5O A;  2CRF A;  2GUM A;  5J3Y A;  2V76 A;  2Z0O A;  5HE0 A;  2CAY A;  1OQN A;  2YRY A;  1XD4 A;  4KHB A;  1T77 A;  5D3Y A;  3HIE A;  2MFQ A;  1N3H A;  4QXA B;  2D9X A;  1NTY A;  1GG3 A;  5LOP B;  3ML4 A;  4KHA A;  2W2X D;  3CIK A;  1Q67 A;  4HAX B;  2NMB A;  2LOX A;  2L2I A;  3HQC A;  3WA0 A;  3HK0 A;  3TVV A;  2GCJ A;  2Y8G A;  1QC6 A;  3ODO A;  2LG1 A;  2Z13 A;  3T06 A;  4QJ5 B;  4EMO A;  2Z0P A;  3NWD A;  2DLW A;  2Q13 A;  3WYF B;  2DX5 A;  1DYN A;  2HTH B;  1RJ2 A;  1EF1 A;  2VKI A;  2E2X A;  4CYE A;  4HB4 B;  5I2S A;  1V5P A;  2EJ8 A;  4K2O A;  3DXE A;  1XKE A;  1W1D A;  3OAN A;  2IFS A;  1FHW A;  4DXA B;  2MKR A;  4C0A A;  1FAO A;  1H10 A;  1QQG A;  2J59 M;  1I2H A;  3KZ1 A;  2IYB A;  4HSI A;  4ZRJ A;  1ZYI A;  2RSG A;  2OQB A;  4HAY B;  1RRP B;  2DYN A;  4QJ4 B;  1X11 A;  2K00 A;  2GJY A;  1UEF A;  3D8D A;  1Z87 A;  4HAW B;  3OHM B;  2YSZ A;  4WJ7 A;  1U27 A;  3O96 A;  4PQ0 A;  3SO6 A;  1X1G A;  2UZS A;  1SGH A;  3U7D A;  1GC6 A;  1Y19 B;  2AL6 A;  4IFS A;  2DYQ A;  3KRW A;  5L81 A;  2FJU B;  5DH9 B;  2JP2 A;  1UNQ A;  2J0J A;  4PNK A;  4CSQ A;  4MK0 A;  1OY2 A;  1J19 A;  2DN6 A;  3PG7 A;  3MDB C;  1P6S A;  4EJN A;  1LW3 A;  2Z14 A;  3PVU A;  2YT2 A;  4Z2N A;  1W1H A;  1NTV A;  3KSY A;  4MT7 A;  2DHI A;  5CLL B;  2P0F A;  3KY9 A;  2CY5 A;  2LOZ A;  2W2X C;  4F7H A;  2YT1 A;  3TCA A;  1M7E A;  2DX1 A;  2K49 A;  3PEG A;  1ZC4 B;  3QBV B;  4P7I A;  4K2P A;  5DIF B;  2N23 A;  3A58 A;  4CHM A;  2I1K A;  1TJ6 A;  1WG7 A;  2ZPY A;  2DKP A;  4HDQ A;  1EAZ A;  4YL8 A;  3NWA A;  3B77 A;  3DXC A;  1P5T A;  1LB1 A;  2NZ8 B;  3MPX A;  2LUL A;  4HHV A;  1DRO A;  5DI9 B;  4B6H A;  5KCV A;  2AEH A;  4KVG B;  4DBB A;  2ZKM X;  1BTK A;  4GMX B;  2P8V A;  2D11 A;  3AJ4 A;  1KZ7 A;  3PSC A;  4GOU A;  3U8Z A;  4A6K A;  4A5K A;  1XCG A;  1XR0 B;  2D9W A;  3VIA A;  1TQZ A;  4D0N B;  2W2W A;  1X86 A;  3P7Z A;  2Y8F A;  2DHJ A;  1P3R A;  3NWF A;  1PLS A;  2I5F A;  5C5B B;  2FJL A;  2K2J A;  2VRW B;  2J0M A;  5M4Y B; 
#chains in the Genus database with same CATH homology
 4TKN A;  1U5E A;  3G9W A;  1V89 A;  2ROV A;  2Y7B A;  3NSU A;  3SNH A;  2KUP A;  4H8S A;  2KGX B;  3AU4 A;  1WGQ A;  3VOQ A;  5JHG A;  3X23 A;  3A98 B;  1X05 A;  1I7A A;  2COC A;  2EC1 A;  1K5D B;  4NSW A;  3P6A A;  1MKE A;  4GPT B;  3ULC A;  2YS5 A;  2YT0 A;  1V61 A;  4GN1 A;  2G35 A;  1U29 A;  2N0Y A;  2DHK A;  2D9Y A;  1UPQ A;  4YON A;  5JLJ B;  5D3V A;  3AU5 A;  5DHA B;  2YVC A;  3D8F A;  5FI0 A;  1MPH A;  2P0D A;  1B55 A;  4HAU B;  3UZT A;  3HW2 B;  2YS1 A;  3SV1 A;  3DXD A;  4GXB A;  1NI2 A;  1U5G A;  1ZC3 B;  5C6R A;  5C79 A;  3V5W A;  1MIZ B;  2RGN B;  1PMS A;  4HAT B;  5EFX A;  3PVL A;  1M7R A;  3SUZ A;  2P0H A;  3KRX A;  5J3T A;  2ELA A;  2OTX A;  4L6E A;  1GC7 A;  2UZR A;  1KI1 B;  3FSS A;  4GMV A;  2CY4 A;  2D10 A;  1V5M A;  1W1G A;  1DDM A;  1ZVR A;  5C5B A;  4CHJ A;  1MIX A;  2DKQ A;  5D27 A;  1AWE A;  2QKL A;  2YS3 A;  1MAI A;  3F0W A;  4HB0 B;  4ZRI A;  5HE2 A;  2J0K A;  2ROZ B;  1U5D A;  4K17 A;  4Y94 A;  4A6F B;  5HE1 A;  3TO1 A;  2RLO A;  2D9V A;  3BJI A;  1WJM A;  1FB8 A;  5FI1 A;  1FGZ A;  5KQ1 A;  2YF0 A;  3A8P A;  4A6H A;  3QWM A;  1XX0 A;  2L1C A;  3TFM A;  1EGX A;  1BTN A;  5J3Q A;  2RNR B;  5LON B;  2GS0 A;  4HB2 B;  4TYZ A;  4KHO A;  3ZVR A;  2EMT A;  3BIN A;  2ADZ A;  4DX8 A;  2DA0 A;  4BBK A;  2QKM A;  4K81 A;  1PFJ A;  2UVM A;  2D2Q A;  1AQC A;  2H7E A;  5HE3 A;  1BWN A;  1TXD A;  2ELB A;  2LYD A;  5C16 A;  2H7D A;  1U5F A;  2VSZ A;  5GOW B;  1H4R A;  1FHO A;  2I5C A;  3PZD A;  4XWX A;  3TW1 A;  3ULB A;  2I1J A;  5JP4 A;  4EKU A;  1MK7 B;  4HB3 B;  1ISN A;  4DX9 0;  3PP2 A;  5CLQ B;  1ZSQ A;  3D8E A;  2PZ1 A;  2MWN B;  3FM8 C;  2M14 A;  2R0D A;  4A6F A;  1IRS A;  1FGY A;  2LKO A;  4ZRK A;  5KQ4 A;  1K5G B;  1SHC A;  1FHX A;  4HAZ B;  4IAP A;  2BCJ A;  1ZM0 A;  3ZDT A;  1E5W A;  3FEH A;  4MY6 A;  2R09 A;  1NU2 A;  1EVH A;  1FOE A;  2D9Z A;  3PVW A;  1MK9 B;  2X18 A;  2D4Q A;  1J0W A;  1U2B A;  1UNP A;  2EMS A;  4WSF A;  1WVH A;  2RVB B;  1WI1 A;  2Z0Q A;  4KHB B;  3IVF A;  1KZG A;  3SYX A;  1WJ1 A;  3ODW A;  2COD A;  4HAV B;  4KAX B;  2KCJ A;  5D3X A;  1DDV A;  4Z2M B;  2DTC A;  2COF A;  4F7G A;  5DHF B;  3QIJ A;  3LJU X;  3ODX A;  2M38 A;  3N7C A;  3GYP A;  1DDW A;  3A8Q A;  4WVF B;  3M1I B;  1OMW A;  3GYO A;  4IOY X;  1UPR A;  2K2U A;  1V88 A;  4NY0 A;  1DBH A;  3F5R A;  3RCP A;  2MDX A;  3CXB B;  4F7U P;  2XQN M;  2HE7 A;  1UNR A;  1WGU A;  2COA A;  2DFK A;  5D3W A;  5JHH A;  1X1F A;  4GZU A;  2RUK B;  1XOD A;  1V5U A;  4HDO A;  1BAK A;  2GCL A;  1Y5O A;  2CRF A;  5J3Y A;  2V76 A;  2Z0O A;  5HE0 A;  2CAY A;  1OQN A;  2YRY A;  1XD4 A;  5D3Y A;  2MFQ A;  1N3H A;  2D9X A;  1NTY A;  1GG3 A;  5LOP B;  3ML4 A;  4KHA A;  2W2X D;  3CIK A;  1Q67 A;  4HAX B;  2NMB A;  2LOX A;  2L2I A;  3HQC A;  3WA0 A;  3HK0 A;  3TVV A;  2GCJ A;  2Y8G A;  1QC6 A;  3ODO A;  2LG1 A;  3T06 A;  4EMO A;  2Z0P A;  2DLW A;  2Q13 A;  3WYF B;  2DX5 A;  1DYN A;  2HTH B;  1RJ2 A;  1EF1 A;  2VKI A;  2E2X A;  4CYE A;  4HB4 B;  1V5P A;  2EJ8 A;  4K2O A;  3DXE A;  1XKE A;  1W1D A;  3OAN A;  2IFS A;  1FHW A;  4DXA B;  2MKR A;  4C0A A;  1FAO A;  1H10 A;  1QQG A;  2J59 M;  1I2H A;  3KZ1 A;  2IYB A;  4ZRJ A;  2RSG A;  2OQB A;  4HAY B;  1RRP B;  2DYN A;  1X11 A;  2K00 A;  2GJY A;  1UEF A;  3D8D A;  1Z87 A;  4HAW B;  2YSZ A;  4WJ7 A;  1U27 A;  3O96 A;  4PQ0 A;  3SO6 A;  1X1G A;  2UZS A;  1SGH A;  3U7D A;  1GC6 A;  1Y19 B;  2AL6 A;  4IFS A;  2DYQ A;  3KRW A;  5L81 A;  5DH9 B;  2JP2 A;  1UNQ A;  2J0J A;  4PNK A;  4MK0 A;  1OY2 A;  1J19 A;  2DN6 A;  3PG7 A;  3MDB C;  1P6S A;  4EJN A;  1LW3 A;  3PVU A;  4Z2N A;  1W1H A;  1NTV A;  3KSY A;  4MT7 A;  2DHI A;  5CLL B;  2P0F A;  3KY9 A;  2CY5 A;  2LOZ A;  2W2X C;  4F7H A;  2YT1 A;  3TCA A;  1M7E A;  2DX1 A;  3PEG A;  1ZC4 B;  3QBV B;  4P7I A;  4K2P A;  5DIF B;  2N23 A;  4CHM A;  2I1K A;  1TJ6 A;  1WG7 A;  2ZPY A;  2DKP A;  4HDQ A;  1EAZ A;  4YL8 A;  3MPX A;  1P5T A;  1LB1 A;  2NZ8 B;  3DXC A;  2LUL A;  4HHV A;  1DRO A;  5DI9 B;  4B6H A;  5KCV A;  2AEH A;  4KVG B;  4DBB A;  1BTK A;  4GMX B;  2P8V A;  2D11 A;  3AJ4 A;  1KZ7 A;  3PSC A;  3U8Z A;  4A6K A;  4A5K A;  1XCG A;  1XR0 B;  2D9W A;  3VIA A;  1TQZ A;  4D0N B;  2W2W A;  1X86 A;  3P7Z A;  2Y8F A;  2DHJ A;  1P3R A;  1PLS A;  2I5F A;  5C5B B;  2FJL A;  2K2J A;  2VRW B;  2J0M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...