1ZC4B

Crystal structure of the ral-binding domain of exo84 in complex with the active rala
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
113
structure length
113
Chain Sequence
b'GQYLVYNGDLVEYEADHMAQLQRVHGFLMNDCLLVATWLPQRRGMYRYNALYPLDRLAVVNVKDNPPMKDMFKLLMFPESRIFQAENAKIKREWLEVLEETKRALSDKRRREQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Ras-related protein Ral-A
publication title Exo84 and Sec5 are competitive regulatory Sec6/8 effectors to the RalA GTPase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 28
structure length 113
sequence length 113
chains with identical sequence D
ec nomenclature
pdb deposition date 2005-04-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 1zc4B00
2IYBA 5EFXA 1WI1A 3ZDTA 3HK0A 1GC7A 2L2IA 1LB1A 2LULA 2NZ8B 3PEGA 2CODA 1FHXA 1WG7A 1X11A 2YS3A 4HB0B 1ZVRA 5C6RA 2EJ8A 2M38A 4ZRJA 3ODOA 4A6FA 1Q67A 2YF0A 2ROVA 2J0MA 3VOQA 1P3RA 2MFQA 2V76A 2BCJA 2YT1A 2MDXA 4HAZB 5FI0A 4KHBB 4IOYX 2K2UA 2Z0PA 2IFSA 1OMWA 3PSCA 2VRWB 2COCA 5HE2A 1MKEA 1NTVA 1I7AA 4EJNA 1PMSA 3SYXA 2W2XD 1RJ2A 1LW3A 4YONA 4HAUB 4KHAA 3FM8C 1X05A 2DLWA 3KZ1A 4K81A 1AWEA 1W1HA 2DTCA 3DXDA 4IFSA 1XKEA 1WGUA 4IAPA 1E5WA 2ADZA 1DYNA 5D3YA 4HB4B 5LOPB 1J19A 2J59M 2DHJA 3KSYA 1FHOA 1M7EA 1EF1A 1MIZB 1NTYA 1BTKA 1V89A 4EKUA 2KGXB 4KHOA 4TKNA 4H8SA 2COFA 3PVWA 1UEFA 1X86A 4MK0A 1NI2A 4HHVA 2CY4A 2RUKB 2VSZA 2J0KA 1MK9B 1WGQA 2I5FA 2D2QA 4GN1A 1AQCA 2DHIA 4K2PA 1Y5OA 3KY9A 5KCVA 3ULCA 2CY5A 3AU4A 2YSZA 2GCJA 3PZDA 1TQZA 3A8QA 3QIJA 1H4RA 2ROZB 1K5GB 2J0JA 1XX0A 1FOEA 4GMXB 5KQ4A 4Z2NA 2YVCA 1MAIA 1MIXA 2R0DA 3HW2B 1WJMA 4HDOA 4A6FB 4WVFB 3PVLA 2P0HA 2DKPA 1DBHA 2DX1A 1UPQA 2N0YA 4HB3B 5DIFB 1MK7B 2DFKA 4HAYB 3WYFB 1DDWA 3AJ4A 3V5WA 2H7EA 3NSUA 3T06A 1IRSA 3MPXA 2MKRA 2D4QA 5J3YA 1OQNA 3A8PA 2DYQA 1NU2A 4Z2MB 4F7GA 1PFJA 3PG7A 2RNRB 3ODXA 2EC1A 4NSWA 4WJ7A 3CIKA 4KVGB 1XODA 3AU5A 4L6EA 1BAKA 1XD4A 2DA0A 3KRWA 2D11A 1XCGA 1W1DA 3KRXA 5C16A 5J3QA 1FB8A 4DBBA 3VIAA 3TFMA 1B55A 2NMBA 2UZSA 1U5FA 2QKMA 2QKLA 2LG1A 1DROA 5D3WA 5LONB 1Z87A 1V61A 3SNHA 2YRYA 2DN6A 2Z0OA 2LOXA 2EMSA 4A6KA 3FEHA 5D27A 3ULBA 1N3HA 3IVFA 4DX90 4A6HA 2D9YA 1PLSA 5J3TA 5GOWB 3HQCA 4XWXA 3WA0A 3U8ZA 2DYNA 2K00A 2ZPYA 1WVHA 2R09A 1FGZA 2X18A 2L1CA 2HE7A 3GYOA 2YT0A 4GMVA 4GPTB 1U5DA 2RGNB 1QQGA 2KCJA 3PP2A 4YL8A 1TJ6A 1XR0B 2W2WA 1ZSQA 3N7CA 3SO6A 2M14A 3OANA 3ML4A 2GS0A 2N23A 2K2JA 1Y19B 2Y8FA 3A98B 5DI9B 4HB2B 3TVVA 2PZ1A 2G35A 5C5BB 3DXCA 2H7DA 3M1IB 1BTNA 3ZVRA 4HDQA 2CRFA 1GG3A 1H10A 2GCLA 3LJUX 3D8DA 3SV1A 1TXDA 1X1FA 1DDMA 2Z0QA 1FAOA 2I1KA 2RLOA 2ELAA 3G9WA 3D8EA 1KZGA 4KAXB 4K17A 2DHKA 1GC6A 1UPRA 2CAYA 1V5PA 2DX5A 4ZRKA 5JHGA 4MY6A 4F7UP 4MT7A 4HAXB 3FSSA 4A5KA 2I5CA 3TO1A 2I1JA 4HAWB 1ZC4B 2P0FA 2D9XA 2W2XC 1ZC3B 1P5TA 4WSFA 1V88A 4GZUA 5D3VA 1K5DB 2LYDA 4DX8A 1UNPA 5L81A 1W1GA 2AL6A 2HTHB 1UNQA 4P7IA 1X1GA 1ZM0A 5FI1A 5HE3A 1QC6A 5DHAB 1SHCA 3TW1A 1SGHA 1I2HA 5CLQB 4GXBA 3CXBB 1MPHA 2P0DA 1U5GA 2VKIA 4ZRIA 2COAA 2ELBA 4PNKA 2D10A 5JLJB 2LKOA 2MWNB 1EGXA 2LOZA 5DHFB 4D0NB 1UNRA 2D9WA 3GYPA 3BJIA 4NY0A 1EVHA 4BBKA 3UZTA 4TYZA 4B6HA 3P6AA 1BWNA 3PVUA 4CYEA 4Y94A 2JP2A 2P8VA 4PQ0A 1J0WA 2RSGA 5HE0A 4CHJA 2YS5A 1ISNA 4HAVB 1KI1B 1KZ7A 1FGYA 4HATB 2OQBA 2D9ZA 1RRPB 3SUZA 3U7DA 4F7HA 1U27A 2UVMA 1DDVA 2D9VA 5JP4A 1U5EA 3D8FA 5D3XA 4CHMA 1EAZA 1P6SA 4EMOA 3F5RA 1M7RA 2YS1A 3MDBC 2E2XA 2DKQA 2UZRA 4K2OA 1U29A 4C0AA 5KQ1A 3P7ZA 1V5MA 3TCAA 1V5UA 3ODWA 2Y8GA 3RCPA 2KUPA 3DXEA 1OY2A 4DXAB 2Q13A 3QBVB 3BINA 3QWMA 1WJ1A 2FJLA 5HE1A 3X23A 2OTXA 3O96A 2RVBB 2AEHA 5CLLB 3F0WA 1U2BA 5C79A 5C5BA 2XQNM 2GJYA 5DH9B 5JHHA 2Y7BA 1FHWA 2EMTA
chains in the Genus database with same CATH superfamily
2IYBA 5EFXA 1WI1A 3ZDTA 3HK0A 4CSQA 1GC7A 2L2IA 1LB1A 2LULA 2NZ8B 3PEGA 2CODA 1FHXA 1WG7A 1X11A 2YS3A 4HB0B 1ZVRA 5C6RA 2EJ8A 2M38A 4ZRJA 3ODOA 4A6FA 1Q67A 2YF0A 2ROVA 2J0MA 3VOQA 1P3RA 2MFQA 2V76A 2BCJA 2YT1A 2MDXA 4HAZB 5FI0A 4KHBB 4IOYX 2K2UA 2Z0PA 2IFSA 1OMWA 3OHMB 3PSCA 2VRWB 2COCA 5HE2A 1MKEA 1NTVA 2Z4DA 1T77A 1I7AA 3DCXA 4EJNA 1PMSA 3SYXA 2K8EA 2W2XD 1RJ2A 1LW3A 4YONA 4HAUB 4KHAA 3FM8C 1X05A 2DLWA 3KZ1A 4K81A 1AWEA 1W1HA 2DTCA 3DXDA 4IFSA 1XKEA 1WGUA 4IAPA 1E5WA 2ADZA 2Z13A 3FVCA 1DYNA 4GOUA 2Z59A 5D3YA 4HB4B 5LOPB 1J19A 2J59M 2DHJA 3KSYA 1FHOA 4QJ5B 1M7EA 1EF1A 1MIZB 1NTYA 1BTKA 1V89A 4EKUA 2KGXB 4KHOA 4TKNA 4H8SA 2COFA 3PVWA 1UEFA 2KIEA 1X86A 3HSAA 4MK0A 1NI2A 4HHVA 2CY4A 2RUKB 2VSZA 2J0KA 1MK9B 1WGQA 5I2SA 2I5FA 2D2QA 4GN1A 1AQCA 2DHIA 5LG4B 4K2PA 1Y5OA 3KY9A 5KCVA 3ULCA 2CY5A 3AU4A 2YSZA 2GCJA 3PZDA 1TQZA 3A8QA 3QIJA 1H4RA 2ROZB 1K5GB 2J0JA 1XX0A 1FOEA 4GMXB 5KQ4A 4Z2NA 2YVCA 1MAIA 1MIXA 2R0DA 3HW2B 1WJMA 4HDOA 4A6FB 4WVFB 3PVLA 2P0HA 2DKPA 1DBHA 2DX1A 1UPQA 2N0YA 4HB3B 3HIEA 5DIFB 1MK7B 2DFKA 4HAYB 3WYFB 1DDWA 3AJ4A 3V5WA 3NWDA 2H7EA 3NSUA 3T06A 1IRSA 3MPXA 2MKRA 2D4QA 2Z14A 5J3YA 1OQNA 3A8PA 5I2MA 2DYQA 1NU2A 4Z2MB 4F7GA 1PFJA 3PG7A 2RNRB 3ODXA 2EC1A 4NSWA 4WJ7A 3CIKA 4KVGB 1XODA 3AU5A 4L6EA 1BAKA 1XD4A 2DA0A 3KRWA 2D11A 1XCGA 1W1DA 3KRXA 5C16A 5J3QA 1FB8A 4DBBA 2KR0A 3VIAA 3TFMA 3NWAA 1B55A 2NMBA 2UZSA 1U5FA 2QKMA 2QKLA 2LG1A 1DROA 5D3WA 4OSNA 5LONB 1Z87A 1V61A 2ZKMX 3SNHA 2YRYA 2DN6A 2Z0OA 2LOXA 2EMSA 4A6KA 3FEHA 3NWFA 5D27A 3ULBA 1N3HA 3IVFA 4DX90 4A6HA 2D9YA 1PLSA 5J3TA 5GOWB 3HQCA 4XWXA 3WA0A 3B77A 3U8ZA 2DYNA 2K00A 2ZPYA 1WVHA 2R09A 2KIGA 1FGZA 2X18A 2L1CA 2HE7A 2R2YA 3GYOA 2FJUB 2YT0A 4GMVA 4GPTB 1U5DA 2RGNB 1QQGA 2KCJA 3PP2A 4YL8A 1TJ6A 1XR0B 2W2WA 3U12A 1ZSQA 3N7CA 3SO6A 2M14A 3OANA 3ML4A 4DIXA 2GS0A 2N23A 2K2JA 1Y19B 3A58A 2Y8FA 3A98B 5DI9B 4HB2B 3TVVA 2PZ1A 2G35A 5C5BB 3DXCA 2H7DA 3M1IB 1BTNA 3ZVRA 4HDQA 2CRFA 1GG3A 1H10A 2GCLA 3LJUX 3D8DA 3SV1A 1TXDA 1X1FA 1DDMA 2GUMA 2Z0QA 1FAOA 2I1KA 2RLOA 2ELAA 3G9WA 3D8EA 1ZYIA 1KZGA 4KAXB 4K17A 2DHKA 1GC6A 1UPRA 2CAYA 2NBVA 1V5PA 2DX5A 4ZRKA 4QJ3B 5JHGA 4MY6A 4F7UP 4MT7A 4HAXB 3FSSA 4A5KA 2I5CA 3TO1A 2I1JA 5M4YB 4HAWB 1ZC4B 2P0FA 2D9XA 2W2XC 1ZC3B 3NW8A 4L1RA 1P5TA 4WSFA 4KHBA 1V88A 4GZUA 5D3VA 1K5DB 2LYDA 4D6WA 4DX8A 1UNPA 5L81A 1W1GA 2AL6A 2HTHB 2KUQA 1UNQA 4P7IA 1X1GA 1ZM0A 5FI1A 5HE3A 1QC6A 5DHAB 2YT2A 1SHCA 3TW1A 1SGHA 1I2HA 5CLQB 4GXBA 3CXBB 1MPHA 2P0DA 1U5GA 1MI1A 2VKIA 4ZRIA 2COAA 2ELBA 4PNKA 2D10A 5JLJB 2LKOA 2MWNB 1EGXA 2LOZA 5DHFB 4D0NB 1UNRA 2D9WA 3GYPA 3BJIA 4NY0A 1EVHA 5IRSA 4BBKA 3UZTA 4TYZA 4B6HA 3P6AA 1BWNA 3PVUA 4CYEA 4QJ4B 4Y94A 2JP2A 2P8VA 4PQ0A 4GNKB 1J0WA 2RSGA 5HE0A 4CHJA 2YS5A 1ISNA 4OT1A 4HAVB 1KI1B 1KZ7A 1FGYA 4HATB 2OQBA 2D9ZA 1RRPB 3SUZA 3U7DA 4F7HA 1U27A 2UVMA 1DDVA 2D9VA 5JP4A 1U5EA 3D8FA 5D3XA 4CHMA 1EAZA 1P6SA 4EMOA 3F5RA 1M7RA 2YS1A 3MDBC 2E2XA 2RRFA 2DKQA 2UZRA 4K2OA 1U29A 4C0AA 5KQ1A 3P7ZA 1V5MA 3TCAA 1V5UA 3ODWA 2Y8GA 3RCPA 2KUPA 3DXEA 1OY2A 4DXAB 4HSIA 2Q13A 3QBVB 3BINA 3QWMA 1WJ1A 2FJLA 5HE1A 3X23A 4QXAB 2OTXA 3O96A 2RVBB 2AEHA 5CLLB 3F0WA 1U2BA 5C79A 5C5BA 2XQNM 2GJYA 5DH9B 2K49A 5JHHA 2Y7BA 1FHWA 2EMTA
chains in the Genus database with same CATH topology
2IYBA 5EFXA 1WI1A 3ZDTA 3HK0A 1GC7A 2L2IA 1LB1A 2LULA 2NZ8B 3PEGA 2CODA 1FHXA 1WG7A 1X11A 2YS3A 4HB0B 1ZVRA 5C6RA 2EJ8A 2M38A 4ZRJA 3ODOA 4A6FA 1Q67A 2YF0A 2ROVA 2J0MA 3VOQA 1P3RA 2MFQA 2V76A 2BCJA 2YT1A 2MDXA 4HAZB 5FI0A 4KHBB 4IOYX 2K2UA 2Z0PA 2IFSA 1OMWA 3PSCA 2VRWB 2COCA 5HE2A 1MKEA 1NTVA 1I7AA 4EJNA 1PMSA 3SYXA 2W2XD 1RJ2A 1LW3A 4YONA 4HAUB 4KHAA 3FM8C 1X05A 2DLWA 3KZ1A 4K81A 1AWEA 1W1HA 2DTCA 3DXDA 4IFSA 1XKEA 1WGUA 4IAPA 1E5WA 2ADZA 1DYNA 5D3YA 4HB4B 5LOPB 1J19A 2J59M 2DHJA 3KSYA 1FHOA 1M7EA 1EF1A 1MIZB 1NTYA 1BTKA 1V89A 4EKUA 2KGXB 4KHOA 4TKNA 4H8SA 2COFA 3PVWA 1UEFA 1X86A 4MK0A 1NI2A 4HHVA 2CY4A 2RUKB 2VSZA 2J0KA 1MK9B 1WGQA 2I5FA 2D2QA 4GN1A 1AQCA 2DHIA 4K2PA 1Y5OA 3KY9A 5KCVA 3ULCA 2CY5A 3AU4A 2YSZA 2GCJA 3PZDA 1TQZA 3A8QA 3QIJA 1H4RA 2ROZB 1K5GB 2J0JA 1XX0A 1FOEA 4GMXB 5KQ4A 4Z2NA 2YVCA 1MAIA 1MIXA 2R0DA 3HW2B 1WJMA 4HDOA 4A6FB 4WVFB 3PVLA 2P0HA 2DKPA 1DBHA 2DX1A 1UPQA 2N0YA 4HB3B 5DIFB 1MK7B 2DFKA 4HAYB 3WYFB 1DDWA 3AJ4A 3V5WA 2H7EA 3NSUA 3T06A 1IRSA 3MPXA 2MKRA 2D4QA 5J3YA 1OQNA 3A8PA 2DYQA 1NU2A 4Z2MB 4F7GA 1PFJA 3PG7A 2RNRB 3ODXA 2EC1A 4NSWA 4WJ7A 3CIKA 4KVGB 1XODA 3AU5A 4L6EA 1BAKA 1XD4A 2DA0A 3KRWA 2D11A 1XCGA 1W1DA 3KRXA 5C16A 5J3QA 1FB8A 4DBBA 3VIAA 3TFMA 1B55A 2NMBA 2UZSA 1U5FA 2QKMA 2QKLA 2LG1A 1DROA 5D3WA 5LONB 1Z87A 1V61A 3SNHA 2YRYA 2DN6A 2Z0OA 2LOXA 2EMSA 4A6KA 3FEHA 5D27A 3ULBA 1N3HA 3IVFA 4DX90 4A6HA 2D9YA 1PLSA 5J3TA 5GOWB 3HQCA 4XWXA 3WA0A 3U8ZA 2DYNA 2K00A 2ZPYA 1WVHA 2R09A 1FGZA 2X18A 2L1CA 2HE7A 3GYOA 2YT0A 4GMVA 4GPTB 1U5DA 2RGNB 1QQGA 2KCJA 3PP2A 4YL8A 1TJ6A 1XR0B 2W2WA 1ZSQA 3N7CA 3SO6A 2M14A 3OANA 3ML4A 2GS0A 2N23A 2K2JA 1Y19B 2Y8FA 3A98B 5DI9B 4HB2B 3TVVA 2PZ1A 2G35A 5C5BB 3DXCA 2H7DA 3M1IB 1BTNA 3ZVRA 4HDQA 2CRFA 1GG3A 1H10A 2GCLA 3LJUX 3D8DA 3SV1A 1TXDA 1X1FA 1DDMA 2Z0QA 1FAOA 2I1KA 2RLOA 2ELAA 3G9WA 3D8EA 1KZGA 4KAXB 4K17A 2DHKA 1GC6A 1UPRA 2CAYA 1V5PA 2DX5A 4ZRKA 5JHGA 4MY6A 4F7UP 4MT7A 4HAXB 3FSSA 4A5KA 2I5CA 3TO1A 2I1JA 4HAWB 1ZC4B 2P0FA 2D9XA 2W2XC 1ZC3B 1P5TA 4WSFA 1V88A 4GZUA 5D3VA 1K5DB 2LYDA 4DX8A 1UNPA 5L81A 1W1GA 2AL6A 2HTHB 1UNQA 4P7IA 1X1GA 1ZM0A 5FI1A 5HE3A 1QC6A 5DHAB 1SHCA 3TW1A 1SGHA 1I2HA 5CLQB 4GXBA 3CXBB 1MPHA 2P0DA 1U5GA 2VKIA 4ZRIA 2COAA 2ELBA 4PNKA 2D10A 5JLJB 2LKOA 2MWNB 1EGXA 2LOZA 5DHFB 4D0NB 1UNRA 2D9WA 3GYPA 3BJIA 4NY0A 1EVHA 4BBKA 3UZTA 4TYZA 4B6HA 3P6AA 1BWNA 3PVUA 4CYEA 4Y94A 2JP2A 2P8VA 4PQ0A 1J0WA 2RSGA 5HE0A 4CHJA 2YS5A 1ISNA 4HAVB 1KI1B 1KZ7A 1FGYA 4HATB 2OQBA 2D9ZA 1RRPB 3SUZA 3U7DA 4F7HA 1U27A 2UVMA 1DDVA 2D9VA 5JP4A 1U5EA 3D8FA 5D3XA 4CHMA 1EAZA 1P6SA 4EMOA 3F5RA 1M7RA 2YS1A 3MDBC 2E2XA 2DKQA 2UZRA 4K2OA 1U29A 4C0AA 5KQ1A 3P7ZA 1V5MA 3TCAA 1V5UA 3ODWA 2Y8GA 3RCPA 2KUPA 3DXEA 1OY2A 4DXAB 2Q13A 3QBVB 3BINA 3QWMA 1WJ1A 2FJLA 5HE1A 3X23A 2OTXA 3O96A 2RVBB 2AEHA 5CLLB 3F0WA 1U2BA 5C79A 5C5BA 2XQNM 2GJYA 5DH9B 5JHHA 2Y7BA 1FHWA 2EMTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IYB A;  5EFX A;  1WI1 A;  3ZDT A;  3HK0 A;  1GC7 A;  2L2I A;  1LB1 A;  2LUL A;  2NZ8 B;  3PEG A;  2COD A;  1FHX A;  1WG7 A;  1X11 A;  2YS3 A;  4HB0 B;  1ZVR A;  5C6R A;  2EJ8 A;  2M38 A;  4ZRJ A;  3ODO A;  4A6F A;  1Q67 A;  2YF0 A;  2ROV A;  2J0M A;  3VOQ A;  1P3R A;  2MFQ A;  2V76 A;  2BCJ A;  2YT1 A;  2MDX A;  4HAZ B;  5FI0 A;  4KHB B;  4IOY X;  2K2U A;  2Z0P A;  2IFS A;  1OMW A;  3PSC A;  2VRW B;  2COC A;  5HE2 A;  1MKE A;  1NTV A;  1I7A A;  4EJN A;  1PMS A;  3SYX A;  2W2X D;  1RJ2 A;  1LW3 A;  4YON A;  4HAU B;  4KHA A;  3FM8 C;  1X05 A;  2DLW A;  3KZ1 A;  4K81 A;  1AWE A;  1W1H A;  2DTC A;  3DXD A;  4IFS A;  1XKE A;  1WGU A;  4IAP A;  1E5W A;  2ADZ A;  1DYN A;  5D3Y A;  4HB4 B;  5LOP B;  1J19 A;  2J59 M;  2DHJ A;  3KSY A;  1FHO A;  1M7E A;  1EF1 A;  1MIZ B;  1NTY A;  1BTK A;  1V89 A;  4EKU A;  2KGX B;  4KHO A;  4TKN A;  4H8S A;  2COF A;  3PVW A;  1UEF A;  1X86 A;  4MK0 A;  1NI2 A;  4HHV A;  2CY4 A;  2RUK B;  2VSZ A;  2J0K A;  1MK9 B;  1WGQ A;  2I5F A;  2D2Q A;  4GN1 A;  1AQC A;  2DHI A;  4K2P A;  1Y5O A;  3KY9 A;  5KCV A;  3ULC A;  2CY5 A;  3AU4 A;  2YSZ A;  2GCJ A;  3PZD A;  1TQZ A;  3A8Q A;  3QIJ A;  1H4R A;  2ROZ B;  1K5G B;  2J0J A;  1XX0 A;  1FOE A;  4GMX B;  5KQ4 A;  4Z2N A;  2YVC A;  1MAI A;  1MIX A;  2R0D A;  3HW2 B;  1WJM A;  4HDO A;  4A6F B;  4WVF B;  3PVL A;  2P0H A;  2DKP A;  1DBH A;  2DX1 A;  1UPQ A;  2N0Y A;  4HB3 B;  5DIF B;  1MK7 B;  2DFK A;  4HAY B;  3WYF B;  1DDW A;  3AJ4 A;  3V5W A;  2H7E A;  3NSU A;  3T06 A;  1IRS A;  3MPX A;  2MKR A;  2D4Q A;  5J3Y A;  1OQN A;  3A8P A;  2DYQ A;  1NU2 A;  4Z2M B;  4F7G A;  1PFJ A;  3PG7 A;  2RNR B;  3ODX A;  2EC1 A;  4NSW A;  4WJ7 A;  3CIK A;  4KVG B;  1XOD A;  3AU5 A;  4L6E A;  1BAK A;  1XD4 A;  2DA0 A;  3KRW A;  2D11 A;  1XCG A;  1W1D A;  3KRX A;  5C16 A;  5J3Q A;  1FB8 A;  4DBB A;  3VIA A;  3TFM A;  1B55 A;  2NMB A;  2UZS A;  1U5F A;  2QKM A;  2QKL A;  2LG1 A;  1DRO A;  5D3W A;  5LON B;  1Z87 A;  1V61 A;  3SNH A;  2YRY A;  2DN6 A;  2Z0O A;  2LOX A;  2EMS A;  4A6K A;  3FEH A;  5D27 A;  3ULB A;  1N3H A;  3IVF A;  4DX9 0;  4A6H A;  2D9Y A;  1PLS A;  5J3T A;  5GOW B;  3HQC A;  4XWX A;  3WA0 A;  3U8Z A;  2DYN A;  2K00 A;  2ZPY A;  1WVH A;  2R09 A;  1FGZ A;  2X18 A;  2L1C A;  2HE7 A;  3GYO A;  2YT0 A;  4GMV A;  4GPT B;  1U5D A;  2RGN B;  1QQG A;  2KCJ A;  3PP2 A;  4YL8 A;  1TJ6 A;  1XR0 B;  2W2W A;  1ZSQ A;  3N7C A;  3SO6 A;  2M14 A;  3OAN A;  3ML4 A;  2GS0 A;  2N23 A;  2K2J A;  1Y19 B;  2Y8F A;  3A98 B;  5DI9 B;  4HB2 B;  3TVV A;  2PZ1 A;  2G35 A;  5C5B B;  3DXC A;  2H7D A;  3M1I B;  1BTN A;  3ZVR A;  4HDQ A;  2CRF A;  1GG3 A;  1H10 A;  2GCL A;  3LJU X;  3D8D A;  3SV1 A;  1TXD A;  1X1F A;  1DDM A;  2Z0Q A;  1FAO A;  2I1K A;  2RLO A;  2ELA A;  3G9W A;  3D8E A;  1KZG A;  4KAX B;  4K17 A;  2DHK A;  1GC6 A;  1UPR A;  2CAY A;  1V5P A;  2DX5 A;  4ZRK A;  5JHG A;  4MY6 A;  4F7U P;  4MT7 A;  4HAX B;  3FSS A;  4A5K A;  2I5C A;  3TO1 A;  2I1J A;  4HAW B;  1ZC4 B;  2P0F A;  2D9X A;  2W2X C;  1ZC3 B;  1P5T A;  4WSF A;  1V88 A;  4GZU A;  5D3V A;  1K5D B;  2LYD A;  4DX8 A;  1UNP A;  5L81 A;  1W1G A;  2AL6 A;  2HTH B;  1UNQ A;  4P7I A;  1X1G A;  1ZM0 A;  5FI1 A;  5HE3 A;  1QC6 A;  5DHA B;  1SHC A;  3TW1 A;  1SGH A;  1I2H A;  5CLQ B;  4GXB A;  3CXB B;  1MPH A;  2P0D A;  1U5G A;  2VKI A;  4ZRI A;  2COA A;  2ELB A;  4PNK A;  2D10 A;  5JLJ B;  2LKO A;  2MWN B;  1EGX A;  2LOZ A;  5DHF B;  4D0N B;  1UNR A;  2D9W A;  3GYP A;  3BJI A;  4NY0 A;  1EVH A;  4BBK A;  3UZT A;  4TYZ A;  4B6H A;  3P6A A;  1BWN A;  3PVU A;  4CYE A;  4Y94 A;  2JP2 A;  2P8V A;  4PQ0 A;  1J0W A;  2RSG A;  5HE0 A;  4CHJ A;  2YS5 A;  1ISN A;  4HAV B;  1KI1 B;  1KZ7 A;  1FGY A;  4HAT B;  2OQB A;  2D9Z A;  1RRP B;  3SUZ A;  3U7D A;  4F7H A;  1U27 A;  2UVM A;  1DDV A;  2D9V A;  5JP4 A;  1U5E A;  3D8F A;  5D3X A;  4CHM A;  1EAZ A;  1P6S A;  4EMO A;  3F5R A;  1M7R A;  2YS1 A;  3MDB C;  2E2X A;  2DKQ A;  2UZR A;  4K2O A;  1U29 A;  4C0A A;  5KQ1 A;  3P7Z A;  1V5M A;  3TCA A;  1V5U A;  3ODW A;  2Y8G A;  3RCP A;  2KUP A;  3DXE A;  1OY2 A;  4DXA B;  2Q13 A;  3QBV B;  3BIN A;  3QWM A;  1WJ1 A;  2FJL A;  5HE1 A;  3X23 A;  2OTX A;  3O96 A;  2RVB B;  2AEH A;  5CLL B;  3F0W A;  1U2B A;  5C79 A;  5C5B A;  2XQN M;  2GJY A;  5DH9 B;  5JHH A;  2Y7B A;  1FHW A;  2EMT A; 
#chains in the Genus database with same CATH topology
 2IYB A;  5EFX A;  1WI1 A;  3ZDT A;  3HK0 A;  4CSQ A;  1GC7 A;  2L2I A;  1LB1 A;  2LUL A;  2NZ8 B;  3PEG A;  2COD A;  1FHX A;  1WG7 A;  1X11 A;  2YS3 A;  4HB0 B;  1ZVR A;  5C6R A;  2EJ8 A;  2M38 A;  4ZRJ A;  3ODO A;  4A6F A;  1Q67 A;  2YF0 A;  2ROV A;  2J0M A;  3VOQ A;  1P3R A;  2MFQ A;  2V76 A;  2BCJ A;  2YT1 A;  2MDX A;  4HAZ B;  5FI0 A;  4KHB B;  4IOY X;  2K2U A;  2Z0P A;  2IFS A;  1OMW A;  3OHM B;  3PSC A;  2VRW B;  2COC A;  5HE2 A;  1MKE A;  1NTV A;  2Z4D A;  1T77 A;  1I7A A;  3DCX A;  4EJN A;  1PMS A;  3SYX A;  2K8E A;  2W2X D;  1RJ2 A;  1LW3 A;  4YON A;  4HAU B;  4KHA A;  3FM8 C;  1X05 A;  2DLW A;  3KZ1 A;  4K81 A;  1AWE A;  1W1H A;  2DTC A;  3DXD A;  4IFS A;  1XKE A;  1WGU A;  4IAP A;  1E5W A;  2ADZ A;  2Z13 A;  3FVC A;  1DYN A;  4GOU A;  2Z59 A;  5D3Y A;  4HB4 B;  5LOP B;  1J19 A;  2J59 M;  2DHJ A;  3KSY A;  1FHO A;  4QJ5 B;  1M7E A;  1EF1 A;  1MIZ B;  1NTY A;  1BTK A;  1V89 A;  4EKU A;  2KGX B;  4KHO A;  4TKN A;  4H8S A;  2COF A;  3PVW A;  1UEF A;  2KIE A;  1X86 A;  3HSA A;  4MK0 A;  1NI2 A;  4HHV A;  2CY4 A;  2RUK B;  2VSZ A;  2J0K A;  1MK9 B;  1WGQ A;  5I2S A;  2I5F A;  2D2Q A;  4GN1 A;  1AQC A;  2DHI A;  5LG4 B;  4K2P A;  1Y5O A;  3KY9 A;  5KCV A;  3ULC A;  2CY5 A;  3AU4 A;  2YSZ A;  2GCJ A;  3PZD A;  1TQZ A;  3A8Q A;  3QIJ A;  1H4R A;  2ROZ B;  1K5G B;  2J0J A;  1XX0 A;  1FOE A;  4GMX B;  5KQ4 A;  4Z2N A;  2YVC A;  1MAI A;  1MIX A;  2R0D A;  3HW2 B;  1WJM A;  4HDO A;  4A6F B;  4WVF B;  3PVL A;  2P0H A;  2DKP A;  1DBH A;  2DX1 A;  1UPQ A;  2N0Y A;  4HB3 B;  3HIE A;  5DIF B;  1MK7 B;  2DFK A;  4HAY B;  3WYF B;  1DDW A;  3AJ4 A;  3V5W A;  3NWD A;  2H7E A;  3NSU A;  3T06 A;  1IRS A;  3MPX A;  2MKR A;  2D4Q A;  2Z14 A;  5J3Y A;  1OQN A;  3A8P A;  5I2M A;  2DYQ A;  1NU2 A;  4Z2M B;  4F7G A;  1PFJ A;  3PG7 A;  2RNR B;  3ODX A;  2EC1 A;  4NSW A;  4WJ7 A;  3CIK A;  4KVG B;  1XOD A;  3AU5 A;  4L6E A;  1BAK A;  1XD4 A;  2DA0 A;  3KRW A;  2D11 A;  1XCG A;  1W1D A;  3KRX A;  5C16 A;  5J3Q A;  1FB8 A;  4DBB A;  2KR0 A;  3VIA A;  3TFM A;  3NWA A;  1B55 A;  2NMB A;  2UZS A;  1U5F A;  2QKM A;  2QKL A;  2LG1 A;  1DRO A;  5D3W A;  4OSN A;  5LON B;  1Z87 A;  1V61 A;  2ZKM X;  3SNH A;  2YRY A;  2DN6 A;  2Z0O A;  2LOX A;  2EMS A;  4A6K A;  3FEH A;  3NWF A;  5D27 A;  3ULB A;  1N3H A;  3IVF A;  4DX9 0;  4A6H A;  2D9Y A;  1PLS A;  5J3T A;  5GOW B;  3HQC A;  4XWX A;  3WA0 A;  3B77 A;  3U8Z A;  2DYN A;  2K00 A;  2ZPY A;  1WVH A;  2R09 A;  2KIG A;  1FGZ A;  2X18 A;  2L1C A;  2HE7 A;  2R2Y A;  3GYO A;  2FJU B;  2YT0 A;  4GMV A;  4GPT B;  1U5D A;  2RGN B;  1QQG A;  2KCJ A;  3PP2 A;  4YL8 A;  1TJ6 A;  1XR0 B;  2W2W A;  3U12 A;  1ZSQ A;  3N7C A;  3SO6 A;  2M14 A;  3OAN A;  3ML4 A;  4DIX A;  2GS0 A;  2N23 A;  2K2J A;  1Y19 B;  3A58 A;  2Y8F A;  3A98 B;  5DI9 B;  4HB2 B;  3TVV A;  2PZ1 A;  2G35 A;  5C5B B;  3DXC A;  2H7D A;  3M1I B;  1BTN A;  3ZVR A;  4HDQ A;  2CRF A;  1GG3 A;  1H10 A;  2GCL A;  3LJU X;  3D8D A;  3SV1 A;  1TXD A;  1X1F A;  1DDM A;  2GUM A;  2Z0Q A;  1FAO A;  2I1K A;  2RLO A;  2ELA A;  3G9W A;  3D8E A;  1ZYI A;  1KZG A;  4KAX B;  4K17 A;  2DHK A;  1GC6 A;  1UPR A;  2CAY A;  2NBV A;  1V5P A;  2DX5 A;  4ZRK A;  4QJ3 B;  5JHG A;  4MY6 A;  4F7U P;  4MT7 A;  4HAX B;  3FSS A;  4A5K A;  2I5C A;  3TO1 A;  2I1J A;  5M4Y B;  4HAW B;  1ZC4 B;  2P0F A;  2D9X A;  2W2X C;  1ZC3 B;  3NW8 A;  4L1R A;  1P5T A;  4WSF A;  4KHB A;  1V88 A;  4GZU A;  5D3V A;  1K5D B;  2LYD A;  4D6W A;  4DX8 A;  1UNP A;  5L81 A;  1W1G A;  2AL6 A;  2HTH B;  2KUQ A;  1UNQ A;  4P7I A;  1X1G A;  1ZM0 A;  5FI1 A;  5HE3 A;  1QC6 A;  5DHA B;  2YT2 A;  1SHC A;  3TW1 A;  1SGH A;  1I2H A;  5CLQ B;  4GXB A;  3CXB B;  1MPH A;  2P0D A;  1U5G A;  1MI1 A;  2VKI A;  4ZRI A;  2COA A;  2ELB A;  4PNK A;  2D10 A;  5JLJ B;  2LKO A;  2MWN B;  1EGX A;  2LOZ A;  5DHF B;  4D0N B;  1UNR A;  2D9W A;  3GYP A;  3BJI A;  4NY0 A;  1EVH A;  5IRS A;  4BBK A;  3UZT A;  4TYZ A;  4B6H A;  3P6A A;  1BWN A;  3PVU A;  4CYE A;  4QJ4 B;  4Y94 A;  2JP2 A;  2P8V A;  4PQ0 A;  4GNK B;  1J0W A;  2RSG A;  5HE0 A;  4CHJ A;  2YS5 A;  1ISN A;  4OT1 A;  4HAV B;  1KI1 B;  1KZ7 A;  1FGY A;  4HAT B;  2OQB A;  2D9Z A;  1RRP B;  3SUZ A;  3U7D A;  4F7H A;  1U27 A;  2UVM A;  1DDV A;  2D9V A;  5JP4 A;  1U5E A;  3D8F A;  5D3X A;  4CHM A;  1EAZ A;  1P6S A;  4EMO A;  3F5R A;  1M7R A;  2YS1 A;  3MDB C;  2E2X A;  2RRF A;  2DKQ A;  2UZR A;  4K2O A;  1U29 A;  4C0A A;  5KQ1 A;  3P7Z A;  1V5M A;  3TCA A;  1V5U A;  3ODW A;  2Y8G A;  3RCP A;  2KUP A;  3DXE A;  1OY2 A;  4DXA B;  4HSI A;  2Q13 A;  3QBV B;  3BIN A;  3QWM A;  1WJ1 A;  2FJL A;  5HE1 A;  3X23 A;  4QXA B;  2OTX A;  3O96 A;  2RVB B;  2AEH A;  5CLL B;  3F0W A;  1U2B A;  5C79 A;  5C5B A;  2XQN M;  2GJY A;  5DH9 B;  2K49 A;  5JHH A;  2Y7B A;  1FHW A;  2EMT A; 
#chains in the Genus database with same CATH homology
 2IYB A;  5EFX A;  1WI1 A;  3ZDT A;  3HK0 A;  1GC7 A;  2L2I A;  1LB1 A;  2LUL A;  2NZ8 B;  3PEG A;  2COD A;  1FHX A;  1WG7 A;  1X11 A;  2YS3 A;  4HB0 B;  1ZVR A;  5C6R A;  2EJ8 A;  2M38 A;  4ZRJ A;  3ODO A;  4A6F A;  1Q67 A;  2YF0 A;  2ROV A;  2J0M A;  3VOQ A;  1P3R A;  2MFQ A;  2V76 A;  2BCJ A;  2YT1 A;  2MDX A;  4HAZ B;  5FI0 A;  4KHB B;  4IOY X;  2K2U A;  2Z0P A;  2IFS A;  1OMW A;  3PSC A;  2VRW B;  2COC A;  5HE2 A;  1MKE A;  1NTV A;  1I7A A;  4EJN A;  1PMS A;  3SYX A;  2W2X D;  1RJ2 A;  1LW3 A;  4YON A;  4HAU B;  4KHA A;  3FM8 C;  1X05 A;  2DLW A;  3KZ1 A;  4K81 A;  1AWE A;  1W1H A;  2DTC A;  3DXD A;  4IFS A;  1XKE A;  1WGU A;  4IAP A;  1E5W A;  2ADZ A;  1DYN A;  5D3Y A;  4HB4 B;  5LOP B;  1J19 A;  2J59 M;  2DHJ A;  3KSY A;  1FHO A;  1M7E A;  1EF1 A;  1MIZ B;  1NTY A;  1BTK A;  1V89 A;  4EKU A;  2KGX B;  4KHO A;  4TKN A;  4H8S A;  2COF A;  3PVW A;  1UEF A;  1X86 A;  4MK0 A;  1NI2 A;  4HHV A;  2CY4 A;  2RUK B;  2VSZ A;  2J0K A;  1MK9 B;  1WGQ A;  2I5F A;  2D2Q A;  4GN1 A;  1AQC A;  2DHI A;  4K2P A;  1Y5O A;  3KY9 A;  5KCV A;  3ULC A;  2CY5 A;  3AU4 A;  2YSZ A;  2GCJ A;  3PZD A;  1TQZ A;  3A8Q A;  3QIJ A;  1H4R A;  2ROZ B;  1K5G B;  2J0J A;  1XX0 A;  1FOE A;  4GMX B;  5KQ4 A;  4Z2N A;  2YVC A;  1MAI A;  1MIX A;  2R0D A;  3HW2 B;  1WJM A;  4HDO A;  4A6F B;  4WVF B;  3PVL A;  2P0H A;  2DKP A;  1DBH A;  2DX1 A;  1UPQ A;  2N0Y A;  4HB3 B;  5DIF B;  1MK7 B;  2DFK A;  4HAY B;  3WYF B;  1DDW A;  3AJ4 A;  3V5W A;  2H7E A;  3NSU A;  3T06 A;  1IRS A;  3MPX A;  2MKR A;  2D4Q A;  5J3Y A;  1OQN A;  3A8P A;  2DYQ A;  1NU2 A;  4Z2M B;  4F7G A;  1PFJ A;  3PG7 A;  2RNR B;  3ODX A;  2EC1 A;  4NSW A;  4WJ7 A;  3CIK A;  4KVG B;  1XOD A;  3AU5 A;  4L6E A;  1BAK A;  1XD4 A;  2DA0 A;  3KRW A;  2D11 A;  1XCG A;  1W1D A;  3KRX A;  5C16 A;  5J3Q A;  1FB8 A;  4DBB A;  3VIA A;  3TFM A;  1B55 A;  2NMB A;  2UZS A;  1U5F A;  2QKM A;  2QKL A;  2LG1 A;  1DRO A;  5D3W A;  5LON B;  1Z87 A;  1V61 A;  3SNH A;  2YRY A;  2DN6 A;  2Z0O A;  2LOX A;  2EMS A;  4A6K A;  3FEH A;  5D27 A;  3ULB A;  1N3H A;  3IVF A;  4DX9 0;  4A6H A;  2D9Y A;  1PLS A;  5J3T A;  5GOW B;  3HQC A;  4XWX A;  3WA0 A;  3U8Z A;  2DYN A;  2K00 A;  2ZPY A;  1WVH A;  2R09 A;  1FGZ A;  2X18 A;  2L1C A;  2HE7 A;  3GYO A;  2YT0 A;  4GMV A;  4GPT B;  1U5D A;  2RGN B;  1QQG A;  2KCJ A;  3PP2 A;  4YL8 A;  1TJ6 A;  1XR0 B;  2W2W A;  1ZSQ A;  3N7C A;  3SO6 A;  2M14 A;  3OAN A;  3ML4 A;  2GS0 A;  2N23 A;  2K2J A;  1Y19 B;  2Y8F A;  3A98 B;  5DI9 B;  4HB2 B;  3TVV A;  2PZ1 A;  2G35 A;  5C5B B;  3DXC A;  2H7D A;  3M1I B;  1BTN A;  3ZVR A;  4HDQ A;  2CRF A;  1GG3 A;  1H10 A;  2GCL A;  3LJU X;  3D8D A;  3SV1 A;  1TXD A;  1X1F A;  1DDM A;  2Z0Q A;  1FAO A;  2I1K A;  2RLO A;  2ELA A;  3G9W A;  3D8E A;  1KZG A;  4KAX B;  4K17 A;  2DHK A;  1GC6 A;  1UPR A;  2CAY A;  1V5P A;  2DX5 A;  4ZRK A;  5JHG A;  4MY6 A;  4F7U P;  4MT7 A;  4HAX B;  3FSS A;  4A5K A;  2I5C A;  3TO1 A;  2I1J A;  4HAW B;  1ZC4 B;  2P0F A;  2D9X A;  2W2X C;  1ZC3 B;  1P5T A;  4WSF A;  1V88 A;  4GZU A;  5D3V A;  1K5D B;  2LYD A;  4DX8 A;  1UNP A;  5L81 A;  1W1G A;  2AL6 A;  2HTH B;  1UNQ A;  4P7I A;  1X1G A;  1ZM0 A;  5FI1 A;  5HE3 A;  1QC6 A;  5DHA B;  1SHC A;  3TW1 A;  1SGH A;  1I2H A;  5CLQ B;  4GXB A;  3CXB B;  1MPH A;  2P0D A;  1U5G A;  2VKI A;  4ZRI A;  2COA A;  2ELB A;  4PNK A;  2D10 A;  5JLJ B;  2LKO A;  2MWN B;  1EGX A;  2LOZ A;  5DHF B;  4D0N B;  1UNR A;  2D9W A;  3GYP A;  3BJI A;  4NY0 A;  1EVH A;  4BBK A;  3UZT A;  4TYZ A;  4B6H A;  3P6A A;  1BWN A;  3PVU A;  4CYE A;  4Y94 A;  2JP2 A;  2P8V A;  4PQ0 A;  1J0W A;  2RSG A;  5HE0 A;  4CHJ A;  2YS5 A;  1ISN A;  4HAV B;  1KI1 B;  1KZ7 A;  1FGY A;  4HAT B;  2OQB A;  2D9Z A;  1RRP B;  3SUZ A;  3U7D A;  4F7H A;  1U27 A;  2UVM A;  1DDV A;  2D9V A;  5JP4 A;  1U5E A;  3D8F A;  5D3X A;  4CHM A;  1EAZ A;  1P6S A;  4EMO A;  3F5R A;  1M7R A;  2YS1 A;  3MDB C;  2E2X A;  2DKQ A;  2UZR A;  4K2O A;  1U29 A;  4C0A A;  5KQ1 A;  3P7Z A;  1V5M A;  3TCA A;  1V5U A;  3ODW A;  2Y8G A;  3RCP A;  2KUP A;  3DXE A;  1OY2 A;  4DXA B;  2Q13 A;  3QBV B;  3BIN A;  3QWM A;  1WJ1 A;  2FJL A;  5HE1 A;  3X23 A;  2OTX A;  3O96 A;  2RVB B;  2AEH A;  5CLL B;  3F0W A;  1U2B A;  5C79 A;  5C5B A;  2XQN M;  2GJY A;  5DH9 B;  5JHH A;  2Y7B A;  1FHW A;  2EMT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...