1ZC4B

Crystal structure of the ral-binding domain of exo84 in complex with the active rala
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
113
structure length
113
Chain Sequence
GQYLVYNGDLVEYEADHMAQLQRVHGFLMNDCLLVATWLPQRRGMYRYNALYPLDRLAVVNVKDNPPMKDMFKLLMFPESRIFQAENAKIKREWLEVLEETKRALSDKRRREQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Signaling protein
molecule keywords Ras-related protein Ral-A
publication title Exo84 and Sec5 are competitive regulatory Sec6/8 effectors to the RalA GTPase.
pubmed doi rcsb
source organism Homo sapiens
total genus 28
structure length 113
sequence length 113
chains with identical sequence D
ec nomenclature
pdb deposition date 2005-04-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 1zc4B00
1X86A 4Y94A 2J59M 5HE2A 2P8VA 2YT1A 3SO6A 2Z0PA 2DX5A 1MK9B 3AU5A 1UPQA 5HE0A 3PVWA 3FM8C 1UEFA 4MT7A 2OTXA 3FSSA 1WG7A 3ML4A 1P5TA 4K81A 1PLSA 3KRWA 1XCGA 2LOXA 2RGNB 4GMXB 2CY4A 1NTYA 1N3HA 2Y8FA 4HHVA 1ZM0A 1XD4A 4HDOA 3MPXA 1EGXA 1Z87A 3V5WA 1DDMA 4A6HA 3BINA 2N23A 2YS3A 4HAWB 3D8EA 1NI2A 2CRFA 3D8DA 2EMTA 3KSYA 2ROVA 1PMSA 3AJ4A 1QQGA 1BWNA 4WJ7A 4HB2B 1FHOA 2LULA 5J3YA 5JLJB 1I7AA 1E5WA 1FGYA 3HK0A 4HB0B 5DHFB 1U27A 1TJ6A 1V5UA 2DYNA 3QWMA 3SV1A 2KUPA 2QKLA 3FEHA 2ELBA 2J0JA 1K5DB 4NY0A 1V88A 1OQNA 5C5BB 2D10A 1LB1A 1FAOA 1W1DA 3ZDTA 1MKEA 4HAZB 2OQBA 1U5GA 2LOZA 5JHHA 2LKOA 2Y8GA 2W2WA 3HW2B 2DHKA 2YS1A 4HB3B 4XWXA 4DBBA 3SNHA 2UZSA 2J0MA 1FOEA 2RSGA 2XQNM 1J19A 3PP2A 1TXDA 2LYDA 2AEHA 3ZVRA 3O96A 3T06A 4YONA 2J0KA 2VSZA 3VIAA 2PZ1A 2W2XC 3VOQA 2I1JA 2V76A 5HE3A 1U5EA 4K17A 1MAIA 2L2IA 1NTVA 1V5MA 2H7EA 3WYFB 2P0DA 4ZRKA 2GCJA 3P6AA 2E2XA 2NZ8B 4KHBB 3GYPA 3X23A 1UNPA 4IAPA 2ELAA 2YS5A 4GXBA 5C5BA 2VKIA 2MWNB 2CY5A 1WGQA 4HAVB 3D8FA 1ZC3B 2ZPYA 2K2UA 4F7UP 3PVLA 4HDQA 1Y19B 2DHJA 3SUZA 2AL6A 1KZ7A 2COFA 2CAYA 4Z2MB 3IVFA 1X1FA 3KRXA 2I5FA 4A6FA 1Y5OA 4HATB 4F7GA 2ADZA 5C6RA 2P0FA 2COAA 5JP4A 1M7EA 1FHXA 2RLOA 1DDVA 4ZRJA 4CHMA 4DXAB 1BTKA 1XX0A 3A8PA 4C0AA 3BJIA 4KHAA 1X05A 1QC6A 3F5RA 2W2XD 1NU2A 3TFMA 1WVHA 1UPRA 1Q67A 1H4RA 3TVVA 4DX90 2D9WA 2RVBB 1GC7A 4HAYB 4B6HA 5LONB 2H7DA 2NMBA 4K2PA 4EJNA 1XKEA 5HE1A 5KQ4A 2Q13A 1FGZA 2QKMA 4GPTB 3SYXA 1GC6A 2M14A 2UZRA 1WJMA 1XODA 1B55A 3CXBB 3ODOA 4ZRIA 3OANA 1U5DA 4GZUA 5GOWB 1UNQA 3DXCA 2M38A 1TQZA 1V89A 1EF1A 1KZGA 1DYNA 5EFXA 4CYEA 1BAKA 5D27A 3TO1A 4TYZA 2GJYA 3NSUA 3P7ZA 3ULBA 2DA0A 5D3VA 1DBHA 3TW1A 2RNRB 5DIFB 2YF0A 3QIJA 3HQCA 1RRPB 2Z0QA 3UZTA 3PG7A 1AQCA 2COCA 2VRWB 4H8SA 2Z0OA 4PQ0A 5D3WA 2JP2A 4EKUA 5L81A 5DH9B 2YRYA 1EVHA 4L6EA 1FHWA 1OMWA 4GMVA 2R0DA 2D9VA 3A98B 2DLWA 3MDBC 5C79A 2YSZA 2IFSA 5C16A 3G9WA 5KQ1A 2EJ8A 1P6SA 4MK0A 1IRSA 4A6KA 4PNKA 2D9ZA 3ODWA 2EMSA 1P3RA 2DX1A 1ZVRA 1MK7B 5D3XA 4CHJA 4DX8A 5LOPB 3ULCA 5FI0A 2DKQA 3N7CA 5J3TA 1AWEA 4D0NB 5CLLB 1BTNA 3PEGA 2RUKB 4KVGB 1W1HA 4HAXB 3AU4A 3QBVB 1X11A 2D9XA 3U7DA 1PFJA 1K5GB 2GCLA 2KCJA 1LW3A 1U5FA 1W1GA 1MPHA 4GN1A 5CLQB 2P0HA 1OY2A 1FB8A 4F7HA 4IFSA 1GG3A 5J3QA 1ZC4B 2I1KA 2DKPA 4P7IA 3PVUA 1J0WA 1SGHA 1MIXA 2GS0A 2ROZB 2DYQA 2MFQA 2Y7BA 3KY9A 3F0WA 1XR0B 1WI1A 3RCPA 2DFKA 2IYBA 3LJUX 1DDWA 2K2JA 2X18A 4YL8A 4MY6A 4WVFB 1RJ2A 4NSWA 4EMOA 5DHAB 1X1GA 2CODA 2MDXA 5JHGA 1ZSQA 1ISNA 1WGUA 3PZDA 3TCAA 3GYOA 1M7RA 2YVCA 2DTCA 4K2OA 5FI1A 4TKNA 4KHOA 2MKRA 2R09A 3CIKA 5DI9B 4WSFA 1DROA 5KCVA 4A5KA 2DHIA 1U29A 2D4QA 3KZ1A 2N0YA 2D9YA 1MIZB 1H10A 2UVMA 4A6FB 2FJLA 4HB4B 3PSCA 2EC1A 4IOYX 2BCJA 1WJ1A 4BBKA 5D3YA 2KGXB 4Z2NA 1SHCA 3ODXA 1UNRA 2K00A 4HAUB 2HE7A 3WA0A 2HTHB 4KAXB 1U2BA 2D11A 3U8ZA 3DXDA 2YT0A 1V61A 2I5CA 2G35A 2L1CA 3DXEA 2DN6A 1EAZA 2LG1A 2D2QA 3A8QA 1I2HA 3M1IB 1KI1B 1V5PA
chains in the Genus database with same CATH superfamily
1X86A 4Y94A 2J59M 5HE2A 4D6WA 2P8VA 2YT1A 3SO6A 2Z0PA 2DX5A 1MK9B 3AU5A 1UPQA 5HE0A 3PVWA 5M4YB 3FM8C 1UEFA 4MT7A 2OTXA 3FSSA 1WG7A 3ML4A 1P5TA 4K81A 5I2MA 2YT2A 1PLSA 3KRWA 1XCGA 2LOXA 2RGNB 4GMXB 4QJ3B 2CY4A 1NTYA 1N3HA 2Y8FA 1MI1A 4HHVA 1ZM0A 1XD4A 4HDOA 3MPXA 1EGXA 2RRFA 1Z87A 3NW8A 3V5WA 4L1RA 4A6HA 1DDMA 3BINA 2N23A 2YS3A 4HAWB 3D8EA 1NI2A 2CRFA 3D8DA 2EMTA 3KSYA 2ROVA 3U12A 1PMSA 3AJ4A 1QQGA 4CSQA 1BWNA 4WJ7A 4HB2B 1FHOA 2LULA 5J3YA 5JLJB 1I7AA 1E5WA 1FGYA 3HK0A 4HB0B 5DHFB 1U27A 1TJ6A 1V5UA 2KIGA 2DYNA 3QWMA 3SV1A 2KUPA 2QKLA 3FEHA 2ELBA 2J0JA 1K5DB 2Z59A 4NY0A 1V88A 1OQNA 5C5BB 2D10A 1LB1A 2ZKMX 1FAOA 1W1DA 3ZDTA 1MKEA 4HAZB 2OQBA 1U5GA 2LOZA 5JHHA 2LKOA 2Z13A 2Y8GA 2W2WA 3HW2B 4QJ4B 2DHKA 2YS1A 4HB3B 4XWXA 4DBBA 3SNHA 2UZSA 2J0MA 1FOEA 2RSGA 2XQNM 1J19A 1TXDA 2LYDA 3PP2A 2AEHA 3ZVRA 3O96A 3T06A 4YONA 3NWDA 2J0KA 2VSZA 3OHMB 4GNKB 3VIAA 2PZ1A 2W2XC 3VOQA 2I1JA 2V76A 5HE3A 1U5EA 4K17A 1MAIA 2L2IA 1NTVA 1V5MA 2H7EA 3WYFB 2P0DA 4ZRKA 2GCJA 3P6AA 2E2XA 2NZ8B 4KHBB 3GYPA 3X23A 1UNPA 2R2YA 4IAPA 3DCXA 2ELAA 2YS5A 4GXBA 5C5BA 2VKIA 2MWNB 2CY5A 1WGQA 4HAVB 3FVCA 3D8FA 1ZC3B 2ZPYA 2K2UA 4F7UP 2Z14A 3PVLA 4HDQA 1Y19B 2DHJA 3SUZA 2AL6A 1KZ7A 2COFA 2CAYA 4Z2MB 3IVFA 1X1FA 3KRXA 2I5FA 4A6FA 1Y5OA 4HATB 4F7GA 2ADZA 5C6RA 2P0FA 2COAA 5JP4A 1M7EA 1FHXA 5I2SA 2RLOA 1DDVA 4ZRJA 4CHMA 4DXAB 1BTKA 1XX0A 3A8PA 4C0AA 3BJIA 4KHAA 1X05A 1QC6A 3A58A 3F5RA 2W2XD 1NU2A 3TFMA 1WVHA 1UPRA 1Q67A 1H4RA 2K49A 3TVVA 4DX90 2D9WA 2RVBB 1GC7A 4HAYB 4B6HA 5LONB 4OSNA 2H7DA 2NMBA 4K2PA 4EJNA 1XKEA 5HE1A 5KQ4A 2Q13A 1FGZA 2QKMA 4GPTB 3SYXA 1GC6A 2M14A 2UZRA 1WJMA 1XODA 1B55A 2GUMA 3CXBB 3ODOA 3NWAA 2KIEA 4ZRIA 3OANA 1U5DA 4GZUA 5GOWB 1UNQA 3DXCA 2M38A 3HSAA 1TQZA 1V89A 1EF1A 1KZGA 1DYNA 5EFXA 4CYEA 1BAKA 5D27A 3TO1A 3B77A 4TYZA 2GJYA 3NSUA 3P7ZA 3ULBA 2DA0A 5D3VA 1DBHA 3TW1A 4DIXA 2RNRB 5DIFB 2YF0A 3QIJA 3HQCA 1RRPB 2Z0QA 3UZTA 3PG7A 1AQCA 2COCA 2VRWB 4H8SA 2Z0OA 4PQ0A 5D3WA 2JP2A 4EKUA 5L81A 5DH9B 4OT1A 2YRYA 1EVHA 2KUQA 4L6EA 1FHWA 1OMWA 4GMVA 2R0DA 2D9VA 3A98B 2DLWA 3MDBC 5C79A 2YSZA 2IFSA 5C16A 3G9WA 5KQ1A 2EJ8A 1P6SA 4MK0A 1IRSA 4A6KA 4PNKA 2D9ZA 3ODWA 2EMSA 1P3RA 2DX1A 1ZVRA 1MK7B 5D3XA 4CHJA 4DX8A 5LOPB 2NBVA 3ULCA 3HIEA 5FI0A 2DKQA 3N7CA 5J3TA 1AWEA 4D0NB 5CLLB 1BTNA 3PEGA 2RUKB 4KVGB 1W1HA 4HAXB 2Z4DA 3AU4A 3QBVB 1X11A 2D9XA 3U7DA 4QJ5B 1PFJA 1K5GB 2GCLA 2KCJA 1LW3A 1U5FA 1W1GA 1MPHA 4GN1A 5CLQB 2P0HA 1OY2A 4KHBA 1FB8A 1T77A 4F7HA 4IFSA 1GG3A 5J3QA 1ZC4B 2I1KA 2DKPA 4P7IA 3PVUA 1J0WA 1SGHA 1MIXA 2GS0A 2ROZB 2DYQA 2MFQA 2Y7BA 3KY9A 3F0WA 1XR0B 1WI1A 3RCPA 2DFKA 4HSIA 2IYBA 3LJUX 1DDWA 2K2JA 2X18A 4YL8A 4MY6A 4WVFB 1RJ2A 4NSWA 4EMOA 5DHAB 1X1GA 2CODA 2MDXA 5JHGA 1ZSQA 5LG4B 1ISNA 1WGUA 3PZDA 3TCAA 3GYOA 1M7RA 2YVCA 2DTCA 4K2OA 5FI1A 4TKNA 4KHOA 2MKRA 2R09A 3CIKA 5DI9B 4WSFA 1DROA 4QXAB 5KCVA 4A5KA 2DHIA 1U29A 2D4QA 3KZ1A 2N0YA 2D9YA 1MIZB 2FJUB 1H10A 2UVMA 4A6FB 2FJLA 4HB4B 3PSCA 2EC1A 2KR0A 4IOYX 2BCJA 1WJ1A 4BBKA 5D3YA 2KGXB 4Z2NA 1SHCA 3ODXA 1ZYIA 1UNRA 4GOUA 2K00A 4HAUB 2HE7A 3WA0A 2HTHB 3NWFA 4KAXB 2K8EA 1U2BA 2D11A 3U8ZA 3DXDA 2YT0A 1V61A 2I5CA 2G35A 2L1CA 3DXEA 2DN6A 1EAZA 2LG1A 2D2QA 3A8QA 5IRSA 1I2HA 3M1IB 1KI1B 1V5PA
chains in the Genus database with same CATH topology
1X86A 4Y94A 2J59M 5HE2A 2P8VA 2YT1A 3SO6A 2Z0PA 2DX5A 1MK9B 3AU5A 1UPQA 5HE0A 3PVWA 3FM8C 1UEFA 4MT7A 2OTXA 3FSSA 1WG7A 3ML4A 1P5TA 4K81A 1PLSA 3KRWA 1XCGA 2LOXA 2RGNB 4GMXB 2CY4A 1NTYA 1N3HA 2Y8FA 4HHVA 1ZM0A 1XD4A 4HDOA 3MPXA 1EGXA 1Z87A 3V5WA 1DDMA 4A6HA 3BINA 2N23A 2YS3A 4HAWB 3D8EA 1NI2A 2CRFA 3D8DA 2EMTA 3KSYA 2ROVA 1PMSA 3AJ4A 1QQGA 1BWNA 4WJ7A 4HB2B 1FHOA 2LULA 5J3YA 5JLJB 1I7AA 1E5WA 1FGYA 3HK0A 4HB0B 5DHFB 1U27A 1TJ6A 1V5UA 2DYNA 3QWMA 3SV1A 2KUPA 2QKLA 3FEHA 2ELBA 2J0JA 1K5DB 4NY0A 1V88A 1OQNA 5C5BB 2D10A 1LB1A 1FAOA 1W1DA 3ZDTA 1MKEA 4HAZB 2OQBA 1U5GA 2LOZA 5JHHA 2LKOA 2Y8GA 2W2WA 3HW2B 2DHKA 2YS1A 4HB3B 4XWXA 4DBBA 3SNHA 2UZSA 2J0MA 1FOEA 2RSGA 2XQNM 1J19A 3PP2A 1TXDA 2LYDA 2AEHA 3ZVRA 3O96A 3T06A 4YONA 2J0KA 2VSZA 3VIAA 2PZ1A 2W2XC 3VOQA 2I1JA 2V76A 5HE3A 1U5EA 4K17A 1MAIA 2L2IA 1NTVA 1V5MA 2H7EA 3WYFB 2P0DA 4ZRKA 2GCJA 3P6AA 2E2XA 2NZ8B 4KHBB 3GYPA 3X23A 1UNPA 4IAPA 2ELAA 2YS5A 4GXBA 5C5BA 2VKIA 2MWNB 2CY5A 1WGQA 4HAVB 3D8FA 1ZC3B 2ZPYA 2K2UA 4F7UP 3PVLA 4HDQA 1Y19B 2DHJA 3SUZA 2AL6A 1KZ7A 2COFA 2CAYA 4Z2MB 3IVFA 1X1FA 3KRXA 2I5FA 4A6FA 1Y5OA 4HATB 4F7GA 2ADZA 5C6RA 2P0FA 2COAA 5JP4A 1M7EA 1FHXA 2RLOA 1DDVA 4ZRJA 4CHMA 4DXAB 1BTKA 1XX0A 3A8PA 4C0AA 3BJIA 4KHAA 1X05A 1QC6A 3F5RA 2W2XD 1NU2A 3TFMA 1WVHA 1UPRA 1Q67A 1H4RA 3TVVA 4DX90 2D9WA 2RVBB 1GC7A 4HAYB 4B6HA 5LONB 2H7DA 2NMBA 4K2PA 4EJNA 1XKEA 5HE1A 5KQ4A 2Q13A 1FGZA 2QKMA 4GPTB 3SYXA 1GC6A 2M14A 2UZRA 1WJMA 1XODA 1B55A 3CXBB 3ODOA 4ZRIA 3OANA 1U5DA 4GZUA 5GOWB 1UNQA 3DXCA 2M38A 1TQZA 1V89A 1EF1A 1KZGA 1DYNA 5EFXA 4CYEA 1BAKA 5D27A 3TO1A 4TYZA 2GJYA 3NSUA 3P7ZA 3ULBA 2DA0A 5D3VA 1DBHA 3TW1A 2RNRB 5DIFB 2YF0A 3QIJA 3HQCA 1RRPB 2Z0QA 3UZTA 3PG7A 1AQCA 2COCA 2VRWB 4H8SA 2Z0OA 4PQ0A 5D3WA 2JP2A 4EKUA 5L81A 5DH9B 2YRYA 1EVHA 4L6EA 1FHWA 1OMWA 4GMVA 2R0DA 2D9VA 3A98B 2DLWA 3MDBC 5C79A 2YSZA 2IFSA 5C16A 3G9WA 5KQ1A 2EJ8A 1P6SA 4MK0A 1IRSA 4A6KA 4PNKA 2D9ZA 3ODWA 2EMSA 1P3RA 2DX1A 1ZVRA 1MK7B 5D3XA 4CHJA 4DX8A 5LOPB 3ULCA 5FI0A 2DKQA 3N7CA 5J3TA 1AWEA 4D0NB 5CLLB 1BTNA 3PEGA 2RUKB 4KVGB 1W1HA 4HAXB 3AU4A 3QBVB 1X11A 2D9XA 3U7DA 1PFJA 1K5GB 2GCLA 2KCJA 1LW3A 1U5FA 1W1GA 1MPHA 4GN1A 5CLQB 2P0HA 1OY2A 1FB8A 4F7HA 4IFSA 1GG3A 5J3QA 1ZC4B 2I1KA 2DKPA 4P7IA 3PVUA 1J0WA 1SGHA 1MIXA 2GS0A 2ROZB 2DYQA 2MFQA 2Y7BA 3KY9A 3F0WA 1XR0B 1WI1A 3RCPA 2DFKA 2IYBA 3LJUX 1DDWA 2K2JA 2X18A 4YL8A 4MY6A 4WVFB 1RJ2A 4NSWA 4EMOA 5DHAB 1X1GA 2CODA 2MDXA 5JHGA 1ZSQA 1ISNA 1WGUA 3PZDA 3TCAA 3GYOA 1M7RA 2YVCA 2DTCA 4K2OA 5FI1A 4TKNA 4KHOA 2MKRA 2R09A 3CIKA 5DI9B 4WSFA 1DROA 5KCVA 4A5KA 2DHIA 1U29A 2D4QA 3KZ1A 2N0YA 2D9YA 1MIZB 1H10A 2UVMA 4A6FB 2FJLA 4HB4B 3PSCA 2EC1A 4IOYX 2BCJA 1WJ1A 4BBKA 5D3YA 2KGXB 4Z2NA 1SHCA 3ODXA 1UNRA 2K00A 4HAUB 2HE7A 3WA0A 2HTHB 4KAXB 1U2BA 2D11A 3U8ZA 3DXDA 2YT0A 1V61A 2I5CA 2G35A 2L1CA 3DXEA 2DN6A 1EAZA 2LG1A 2D2QA 3A8QA 1I2HA 3M1IB 1KI1B 1V5PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1X86 A;  4Y94 A;  2J59 M;  5HE2 A;  2P8V A;  2YT1 A;  3SO6 A;  2Z0P A;  2DX5 A;  1MK9 B;  3AU5 A;  1UPQ A;  5HE0 A;  3PVW A;  3FM8 C;  1UEF A;  4MT7 A;  2OTX A;  3FSS A;  1WG7 A;  3ML4 A;  1P5T A;  4K81 A;  1PLS A;  3KRW A;  1XCG A;  2LOX A;  2RGN B;  4GMX B;  2CY4 A;  1NTY A;  1N3H A;  2Y8F A;  4HHV A;  1ZM0 A;  1XD4 A;  4HDO A;  3MPX A;  1EGX A;  1Z87 A;  3V5W A;  1DDM A;  4A6H A;  3BIN A;  2N23 A;  2YS3 A;  4HAW B;  3D8E A;  1NI2 A;  2CRF A;  3D8D A;  2EMT A;  3KSY A;  2ROV A;  1PMS A;  3AJ4 A;  1QQG A;  1BWN A;  4WJ7 A;  4HB2 B;  1FHO A;  2LUL A;  5J3Y A;  5JLJ B;  1I7A A;  1E5W A;  1FGY A;  3HK0 A;  4HB0 B;  5DHF B;  1U27 A;  1TJ6 A;  1V5U A;  2DYN A;  3QWM A;  3SV1 A;  2KUP A;  2QKL A;  3FEH A;  2ELB A;  2J0J A;  1K5D B;  4NY0 A;  1V88 A;  1OQN A;  5C5B B;  2D10 A;  1LB1 A;  1FAO A;  1W1D A;  3ZDT A;  1MKE A;  4HAZ B;  2OQB A;  1U5G A;  2LOZ A;  5JHH A;  2LKO A;  2Y8G A;  2W2W A;  3HW2 B;  2DHK A;  2YS1 A;  4HB3 B;  4XWX A;  4DBB A;  3SNH A;  2UZS A;  2J0M A;  1FOE A;  2RSG A;  2XQN M;  1J19 A;  3PP2 A;  1TXD A;  2LYD A;  2AEH A;  3ZVR A;  3O96 A;  3T06 A;  4YON A;  2J0K A;  2VSZ A;  3VIA A;  2PZ1 A;  2W2X C;  3VOQ A;  2I1J A;  2V76 A;  5HE3 A;  1U5E A;  4K17 A;  1MAI A;  2L2I A;  1NTV A;  1V5M A;  2H7E A;  3WYF B;  2P0D A;  4ZRK A;  2GCJ A;  3P6A A;  2E2X A;  2NZ8 B;  4KHB B;  3GYP A;  3X23 A;  1UNP A;  4IAP A;  2ELA A;  2YS5 A;  4GXB A;  5C5B A;  2VKI A;  2MWN B;  2CY5 A;  1WGQ A;  4HAV B;  3D8F A;  1ZC3 B;  2ZPY A;  2K2U A;  4F7U P;  3PVL A;  4HDQ A;  1Y19 B;  2DHJ A;  3SUZ A;  2AL6 A;  1KZ7 A;  2COF A;  2CAY A;  4Z2M B;  3IVF A;  1X1F A;  3KRX A;  2I5F A;  4A6F A;  1Y5O A;  4HAT B;  4F7G A;  2ADZ A;  5C6R A;  2P0F A;  2COA A;  5JP4 A;  1M7E A;  1FHX A;  2RLO A;  1DDV A;  4ZRJ A;  4CHM A;  4DXA B;  1BTK A;  1XX0 A;  3A8P A;  4C0A A;  3BJI A;  4KHA A;  1X05 A;  1QC6 A;  3F5R A;  2W2X D;  1NU2 A;  3TFM A;  1WVH A;  1UPR A;  1Q67 A;  1H4R A;  3TVV A;  4DX9 0;  2D9W A;  2RVB B;  1GC7 A;  4HAY B;  4B6H A;  5LON B;  2H7D A;  2NMB A;  4K2P A;  4EJN A;  1XKE A;  5HE1 A;  5KQ4 A;  2Q13 A;  1FGZ A;  2QKM A;  4GPT B;  3SYX A;  1GC6 A;  2M14 A;  2UZR A;  1WJM A;  1XOD A;  1B55 A;  3CXB B;  3ODO A;  4ZRI A;  3OAN A;  1U5D A;  4GZU A;  5GOW B;  1UNQ A;  3DXC A;  2M38 A;  1TQZ A;  1V89 A;  1EF1 A;  1KZG A;  1DYN A;  5EFX A;  4CYE A;  1BAK A;  5D27 A;  3TO1 A;  4TYZ A;  2GJY A;  3NSU A;  3P7Z A;  3ULB A;  2DA0 A;  5D3V A;  1DBH A;  3TW1 A;  2RNR B;  5DIF B;  2YF0 A;  3QIJ A;  3HQC A;  1RRP B;  2Z0Q A;  3UZT A;  3PG7 A;  1AQC A;  2COC A;  2VRW B;  4H8S A;  2Z0O A;  4PQ0 A;  5D3W A;  2JP2 A;  4EKU A;  5L81 A;  5DH9 B;  2YRY A;  1EVH A;  4L6E A;  1FHW A;  1OMW A;  4GMV A;  2R0D A;  2D9V A;  3A98 B;  2DLW A;  3MDB C;  5C79 A;  2YSZ A;  2IFS A;  5C16 A;  3G9W A;  5KQ1 A;  2EJ8 A;  1P6S A;  4MK0 A;  1IRS A;  4A6K A;  4PNK A;  2D9Z A;  3ODW A;  2EMS A;  1P3R A;  2DX1 A;  1ZVR A;  1MK7 B;  5D3X A;  4CHJ A;  4DX8 A;  5LOP B;  3ULC A;  5FI0 A;  2DKQ A;  3N7C A;  5J3T A;  1AWE A;  4D0N B;  5CLL B;  1BTN A;  3PEG A;  2RUK B;  4KVG B;  1W1H A;  4HAX B;  3AU4 A;  3QBV B;  1X11 A;  2D9X A;  3U7D A;  1PFJ A;  1K5G B;  2GCL A;  2KCJ A;  1LW3 A;  1U5F A;  1W1G A;  1MPH A;  4GN1 A;  5CLQ B;  2P0H A;  1OY2 A;  1FB8 A;  4F7H A;  4IFS A;  1GG3 A;  5J3Q A;  1ZC4 B;  2I1K A;  2DKP A;  4P7I A;  3PVU A;  1J0W A;  1SGH A;  1MIX A;  2GS0 A;  2ROZ B;  2DYQ A;  2MFQ A;  2Y7B A;  3KY9 A;  3F0W A;  1XR0 B;  1WI1 A;  3RCP A;  2DFK A;  2IYB A;  3LJU X;  1DDW A;  2K2J A;  2X18 A;  4YL8 A;  4MY6 A;  4WVF B;  1RJ2 A;  4NSW A;  4EMO A;  5DHA B;  1X1G A;  2COD A;  2MDX A;  5JHG A;  1ZSQ A;  1ISN A;  1WGU A;  3PZD A;  3TCA A;  3GYO A;  1M7R A;  2YVC A;  2DTC A;  4K2O A;  5FI1 A;  4TKN A;  4KHO A;  2MKR A;  2R09 A;  3CIK A;  5DI9 B;  4WSF A;  1DRO A;  5KCV A;  4A5K A;  2DHI A;  1U29 A;  2D4Q A;  3KZ1 A;  2N0Y A;  2D9Y A;  1MIZ B;  1H10 A;  2UVM A;  4A6F B;  2FJL A;  4HB4 B;  3PSC A;  2EC1 A;  4IOY X;  2BCJ A;  1WJ1 A;  4BBK A;  5D3Y A;  2KGX B;  4Z2N A;  1SHC A;  3ODX A;  1UNR A;  2K00 A;  4HAU B;  2HE7 A;  3WA0 A;  2HTH B;  4KAX B;  1U2B A;  2D11 A;  3U8Z A;  3DXD A;  2YT0 A;  1V61 A;  2I5C A;  2G35 A;  2L1C A;  3DXE A;  2DN6 A;  1EAZ A;  2LG1 A;  2D2Q A;  3A8Q A;  1I2H A;  3M1I B;  1KI1 B;  1V5P A; 
#chains in the Genus database with same CATH topology
 1X86 A;  4Y94 A;  2J59 M;  5HE2 A;  4D6W A;  2P8V A;  2YT1 A;  3SO6 A;  2Z0P A;  2DX5 A;  1MK9 B;  3AU5 A;  1UPQ A;  5HE0 A;  3PVW A;  5M4Y B;  3FM8 C;  1UEF A;  4MT7 A;  2OTX A;  3FSS A;  1WG7 A;  3ML4 A;  1P5T A;  4K81 A;  5I2M A;  2YT2 A;  1PLS A;  3KRW A;  1XCG A;  2LOX A;  2RGN B;  4GMX B;  4QJ3 B;  2CY4 A;  1NTY A;  1N3H A;  2Y8F A;  1MI1 A;  4HHV A;  1ZM0 A;  1XD4 A;  4HDO A;  3MPX A;  1EGX A;  2RRF A;  1Z87 A;  3NW8 A;  3V5W A;  4L1R A;  4A6H A;  1DDM A;  3BIN A;  2N23 A;  2YS3 A;  4HAW B;  3D8E A;  1NI2 A;  2CRF A;  3D8D A;  2EMT A;  3KSY A;  2ROV A;  3U12 A;  1PMS A;  3AJ4 A;  1QQG A;  4CSQ A;  1BWN A;  4WJ7 A;  4HB2 B;  1FHO A;  2LUL A;  5J3Y A;  5JLJ B;  1I7A A;  1E5W A;  1FGY A;  3HK0 A;  4HB0 B;  5DHF B;  1U27 A;  1TJ6 A;  1V5U A;  2KIG A;  2DYN A;  3QWM A;  3SV1 A;  2KUP A;  2QKL A;  3FEH A;  2ELB A;  2J0J A;  1K5D B;  2Z59 A;  4NY0 A;  1V88 A;  1OQN A;  5C5B B;  2D10 A;  1LB1 A;  2ZKM X;  1FAO A;  1W1D A;  3ZDT A;  1MKE A;  4HAZ B;  2OQB A;  1U5G A;  2LOZ A;  5JHH A;  2LKO A;  2Z13 A;  2Y8G A;  2W2W A;  3HW2 B;  4QJ4 B;  2DHK A;  2YS1 A;  4HB3 B;  4XWX A;  4DBB A;  3SNH A;  2UZS A;  2J0M A;  1FOE A;  2RSG A;  2XQN M;  1J19 A;  1TXD A;  2LYD A;  3PP2 A;  2AEH A;  3ZVR A;  3O96 A;  3T06 A;  4YON A;  3NWD A;  2J0K A;  2VSZ A;  3OHM B;  4GNK B;  3VIA A;  2PZ1 A;  2W2X C;  3VOQ A;  2I1J A;  2V76 A;  5HE3 A;  1U5E A;  4K17 A;  1MAI A;  2L2I A;  1NTV A;  1V5M A;  2H7E A;  3WYF B;  2P0D A;  4ZRK A;  2GCJ A;  3P6A A;  2E2X A;  2NZ8 B;  4KHB B;  3GYP A;  3X23 A;  1UNP A;  2R2Y A;  4IAP A;  3DCX A;  2ELA A;  2YS5 A;  4GXB A;  5C5B A;  2VKI A;  2MWN B;  2CY5 A;  1WGQ A;  4HAV B;  3FVC A;  3D8F A;  1ZC3 B;  2ZPY A;  2K2U A;  4F7U P;  2Z14 A;  3PVL A;  4HDQ A;  1Y19 B;  2DHJ A;  3SUZ A;  2AL6 A;  1KZ7 A;  2COF A;  2CAY A;  4Z2M B;  3IVF A;  1X1F A;  3KRX A;  2I5F A;  4A6F A;  1Y5O A;  4HAT B;  4F7G A;  2ADZ A;  5C6R A;  2P0F A;  2COA A;  5JP4 A;  1M7E A;  1FHX A;  5I2S A;  2RLO A;  1DDV A;  4ZRJ A;  4CHM A;  4DXA B;  1BTK A;  1XX0 A;  3A8P A;  4C0A A;  3BJI A;  4KHA A;  1X05 A;  1QC6 A;  3A58 A;  3F5R A;  2W2X D;  1NU2 A;  3TFM A;  1WVH A;  1UPR A;  1Q67 A;  1H4R A;  2K49 A;  3TVV A;  4DX9 0;  2D9W A;  2RVB B;  1GC7 A;  4HAY B;  4B6H A;  5LON B;  4OSN A;  2H7D A;  2NMB A;  4K2P A;  4EJN A;  1XKE A;  5HE1 A;  5KQ4 A;  2Q13 A;  1FGZ A;  2QKM A;  4GPT B;  3SYX A;  1GC6 A;  2M14 A;  2UZR A;  1WJM A;  1XOD A;  1B55 A;  2GUM A;  3CXB B;  3ODO A;  3NWA A;  2KIE A;  4ZRI A;  3OAN A;  1U5D A;  4GZU A;  5GOW B;  1UNQ A;  3DXC A;  2M38 A;  3HSA A;  1TQZ A;  1V89 A;  1EF1 A;  1KZG A;  1DYN A;  5EFX A;  4CYE A;  1BAK A;  5D27 A;  3TO1 A;  3B77 A;  4TYZ A;  2GJY A;  3NSU A;  3P7Z A;  3ULB A;  2DA0 A;  5D3V A;  1DBH A;  3TW1 A;  4DIX A;  2RNR B;  5DIF B;  2YF0 A;  3QIJ A;  3HQC A;  1RRP B;  2Z0Q A;  3UZT A;  3PG7 A;  1AQC A;  2COC A;  2VRW B;  4H8S A;  2Z0O A;  4PQ0 A;  5D3W A;  2JP2 A;  4EKU A;  5L81 A;  5DH9 B;  4OT1 A;  2YRY A;  1EVH A;  2KUQ A;  4L6E A;  1FHW A;  1OMW A;  4GMV A;  2R0D A;  2D9V A;  3A98 B;  2DLW A;  3MDB C;  5C79 A;  2YSZ A;  2IFS A;  5C16 A;  3G9W A;  5KQ1 A;  2EJ8 A;  1P6S A;  4MK0 A;  1IRS A;  4A6K A;  4PNK A;  2D9Z A;  3ODW A;  2EMS A;  1P3R A;  2DX1 A;  1ZVR A;  1MK7 B;  5D3X A;  4CHJ A;  4DX8 A;  5LOP B;  2NBV A;  3ULC A;  3HIE A;  5FI0 A;  2DKQ A;  3N7C A;  5J3T A;  1AWE A;  4D0N B;  5CLL B;  1BTN A;  3PEG A;  2RUK B;  4KVG B;  1W1H A;  4HAX B;  2Z4D A;  3AU4 A;  3QBV B;  1X11 A;  2D9X A;  3U7D A;  4QJ5 B;  1PFJ A;  1K5G B;  2GCL A;  2KCJ A;  1LW3 A;  1U5F A;  1W1G A;  1MPH A;  4GN1 A;  5CLQ B;  2P0H A;  1OY2 A;  4KHB A;  1FB8 A;  1T77 A;  4F7H A;  4IFS A;  1GG3 A;  5J3Q A;  1ZC4 B;  2I1K A;  2DKP A;  4P7I A;  3PVU A;  1J0W A;  1SGH A;  1MIX A;  2GS0 A;  2ROZ B;  2DYQ A;  2MFQ A;  2Y7B A;  3KY9 A;  3F0W A;  1XR0 B;  1WI1 A;  3RCP A;  2DFK A;  4HSI A;  2IYB A;  3LJU X;  1DDW A;  2K2J A;  2X18 A;  4YL8 A;  4MY6 A;  4WVF B;  1RJ2 A;  4NSW A;  4EMO A;  5DHA B;  1X1G A;  2COD A;  2MDX A;  5JHG A;  1ZSQ A;  5LG4 B;  1ISN A;  1WGU A;  3PZD A;  3TCA A;  3GYO A;  1M7R A;  2YVC A;  2DTC A;  4K2O A;  5FI1 A;  4TKN A;  4KHO A;  2MKR A;  2R09 A;  3CIK A;  5DI9 B;  4WSF A;  1DRO A;  4QXA B;  5KCV A;  4A5K A;  2DHI A;  1U29 A;  2D4Q A;  3KZ1 A;  2N0Y A;  2D9Y A;  1MIZ B;  2FJU B;  1H10 A;  2UVM A;  4A6F B;  2FJL A;  4HB4 B;  3PSC A;  2EC1 A;  2KR0 A;  4IOY X;  2BCJ A;  1WJ1 A;  4BBK A;  5D3Y A;  2KGX B;  4Z2N A;  1SHC A;  3ODX A;  1ZYI A;  1UNR A;  4GOU A;  2K00 A;  4HAU B;  2HE7 A;  3WA0 A;  2HTH B;  3NWF A;  4KAX B;  2K8E A;  1U2B A;  2D11 A;  3U8Z A;  3DXD A;  2YT0 A;  1V61 A;  2I5C A;  2G35 A;  2L1C A;  3DXE A;  2DN6 A;  1EAZ A;  2LG1 A;  2D2Q A;  3A8Q A;  5IRS A;  1I2H A;  3M1I B;  1KI1 B;  1V5P A; 
#chains in the Genus database with same CATH homology
 1X86 A;  4Y94 A;  2J59 M;  5HE2 A;  2P8V A;  2YT1 A;  3SO6 A;  2Z0P A;  2DX5 A;  1MK9 B;  3AU5 A;  1UPQ A;  5HE0 A;  3PVW A;  3FM8 C;  1UEF A;  4MT7 A;  2OTX A;  3FSS A;  1WG7 A;  3ML4 A;  1P5T A;  4K81 A;  1PLS A;  3KRW A;  1XCG A;  2LOX A;  2RGN B;  4GMX B;  2CY4 A;  1NTY A;  1N3H A;  2Y8F A;  4HHV A;  1ZM0 A;  1XD4 A;  4HDO A;  3MPX A;  1EGX A;  1Z87 A;  3V5W A;  1DDM A;  4A6H A;  3BIN A;  2N23 A;  2YS3 A;  4HAW B;  3D8E A;  1NI2 A;  2CRF A;  3D8D A;  2EMT A;  3KSY A;  2ROV A;  1PMS A;  3AJ4 A;  1QQG A;  1BWN A;  4WJ7 A;  4HB2 B;  1FHO A;  2LUL A;  5J3Y A;  5JLJ B;  1I7A A;  1E5W A;  1FGY A;  3HK0 A;  4HB0 B;  5DHF B;  1U27 A;  1TJ6 A;  1V5U A;  2DYN A;  3QWM A;  3SV1 A;  2KUP A;  2QKL A;  3FEH A;  2ELB A;  2J0J A;  1K5D B;  4NY0 A;  1V88 A;  1OQN A;  5C5B B;  2D10 A;  1LB1 A;  1FAO A;  1W1D A;  3ZDT A;  1MKE A;  4HAZ B;  2OQB A;  1U5G A;  2LOZ A;  5JHH A;  2LKO A;  2Y8G A;  2W2W A;  3HW2 B;  2DHK A;  2YS1 A;  4HB3 B;  4XWX A;  4DBB A;  3SNH A;  2UZS A;  2J0M A;  1FOE A;  2RSG A;  2XQN M;  1J19 A;  3PP2 A;  1TXD A;  2LYD A;  2AEH A;  3ZVR A;  3O96 A;  3T06 A;  4YON A;  2J0K A;  2VSZ A;  3VIA A;  2PZ1 A;  2W2X C;  3VOQ A;  2I1J A;  2V76 A;  5HE3 A;  1U5E A;  4K17 A;  1MAI A;  2L2I A;  1NTV A;  1V5M A;  2H7E A;  3WYF B;  2P0D A;  4ZRK A;  2GCJ A;  3P6A A;  2E2X A;  2NZ8 B;  4KHB B;  3GYP A;  3X23 A;  1UNP A;  4IAP A;  2ELA A;  2YS5 A;  4GXB A;  5C5B A;  2VKI A;  2MWN B;  2CY5 A;  1WGQ A;  4HAV B;  3D8F A;  1ZC3 B;  2ZPY A;  2K2U A;  4F7U P;  3PVL A;  4HDQ A;  1Y19 B;  2DHJ A;  3SUZ A;  2AL6 A;  1KZ7 A;  2COF A;  2CAY A;  4Z2M B;  3IVF A;  1X1F A;  3KRX A;  2I5F A;  4A6F A;  1Y5O A;  4HAT B;  4F7G A;  2ADZ A;  5C6R A;  2P0F A;  2COA A;  5JP4 A;  1M7E A;  1FHX A;  2RLO A;  1DDV A;  4ZRJ A;  4CHM A;  4DXA B;  1BTK A;  1XX0 A;  3A8P A;  4C0A A;  3BJI A;  4KHA A;  1X05 A;  1QC6 A;  3F5R A;  2W2X D;  1NU2 A;  3TFM A;  1WVH A;  1UPR A;  1Q67 A;  1H4R A;  3TVV A;  4DX9 0;  2D9W A;  2RVB B;  1GC7 A;  4HAY B;  4B6H A;  5LON B;  2H7D A;  2NMB A;  4K2P A;  4EJN A;  1XKE A;  5HE1 A;  5KQ4 A;  2Q13 A;  1FGZ A;  2QKM A;  4GPT B;  3SYX A;  1GC6 A;  2M14 A;  2UZR A;  1WJM A;  1XOD A;  1B55 A;  3CXB B;  3ODO A;  4ZRI A;  3OAN A;  1U5D A;  4GZU A;  5GOW B;  1UNQ A;  3DXC A;  2M38 A;  1TQZ A;  1V89 A;  1EF1 A;  1KZG A;  1DYN A;  5EFX A;  4CYE A;  1BAK A;  5D27 A;  3TO1 A;  4TYZ A;  2GJY A;  3NSU A;  3P7Z A;  3ULB A;  2DA0 A;  5D3V A;  1DBH A;  3TW1 A;  2RNR B;  5DIF B;  2YF0 A;  3QIJ A;  3HQC A;  1RRP B;  2Z0Q A;  3UZT A;  3PG7 A;  1AQC A;  2COC A;  2VRW B;  4H8S A;  2Z0O A;  4PQ0 A;  5D3W A;  2JP2 A;  4EKU A;  5L81 A;  5DH9 B;  2YRY A;  1EVH A;  4L6E A;  1FHW A;  1OMW A;  4GMV A;  2R0D A;  2D9V A;  3A98 B;  2DLW A;  3MDB C;  5C79 A;  2YSZ A;  2IFS A;  5C16 A;  3G9W A;  5KQ1 A;  2EJ8 A;  1P6S A;  4MK0 A;  1IRS A;  4A6K A;  4PNK A;  2D9Z A;  3ODW A;  2EMS A;  1P3R A;  2DX1 A;  1ZVR A;  1MK7 B;  5D3X A;  4CHJ A;  4DX8 A;  5LOP B;  3ULC A;  5FI0 A;  2DKQ A;  3N7C A;  5J3T A;  1AWE A;  4D0N B;  5CLL B;  1BTN A;  3PEG A;  2RUK B;  4KVG B;  1W1H A;  4HAX B;  3AU4 A;  3QBV B;  1X11 A;  2D9X A;  3U7D A;  1PFJ A;  1K5G B;  2GCL A;  2KCJ A;  1LW3 A;  1U5F A;  1W1G A;  1MPH A;  4GN1 A;  5CLQ B;  2P0H A;  1OY2 A;  1FB8 A;  4F7H A;  4IFS A;  1GG3 A;  5J3Q A;  1ZC4 B;  2I1K A;  2DKP A;  4P7I A;  3PVU A;  1J0W A;  1SGH A;  1MIX A;  2GS0 A;  2ROZ B;  2DYQ A;  2MFQ A;  2Y7B A;  3KY9 A;  3F0W A;  1XR0 B;  1WI1 A;  3RCP A;  2DFK A;  2IYB A;  3LJU X;  1DDW A;  2K2J A;  2X18 A;  4YL8 A;  4MY6 A;  4WVF B;  1RJ2 A;  4NSW A;  4EMO A;  5DHA B;  1X1G A;  2COD A;  2MDX A;  5JHG A;  1ZSQ A;  1ISN A;  1WGU A;  3PZD A;  3TCA A;  3GYO A;  1M7R A;  2YVC A;  2DTC A;  4K2O A;  5FI1 A;  4TKN A;  4KHO A;  2MKR A;  2R09 A;  3CIK A;  5DI9 B;  4WSF A;  1DRO A;  5KCV A;  4A5K A;  2DHI A;  1U29 A;  2D4Q A;  3KZ1 A;  2N0Y A;  2D9Y A;  1MIZ B;  1H10 A;  2UVM A;  4A6F B;  2FJL A;  4HB4 B;  3PSC A;  2EC1 A;  4IOY X;  2BCJ A;  1WJ1 A;  4BBK A;  5D3Y A;  2KGX B;  4Z2N A;  1SHC A;  3ODX A;  1UNR A;  2K00 A;  4HAU B;  2HE7 A;  3WA0 A;  2HTH B;  4KAX B;  1U2B A;  2D11 A;  3U8Z A;  3DXD A;  2YT0 A;  1V61 A;  2I5C A;  2G35 A;  2L1C A;  3DXE A;  2DN6 A;  1EAZ A;  2LG1 A;  2D2Q A;  3A8Q A;  1I2H A;  3M1I B;  1KI1 B;  1V5P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...