1ZC4B

Crystal structure of the ral-binding domain of exo84 in complex with the active rala
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
113
structure length
113
Chain Sequence
GQYLVYNGDLVEYEADHMAQLQRVHGFLMNDCLLVATWLPQRRGMYRYNALYPLDRLAVVNVKDNPPMKDMFKLLMFPESRIFQAENAKIKREWLEVLEETKRALSDKRRREQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Exo84 and Sec5 are competitive regulatory Sec6/8 effectors to the RalA GTPase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords Ras-related protein Ral-A
total genus 28
structure length 113
sequence length 113
chains with identical sequence D
ec nomenclature
pdb deposition date 2005-04-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 1zc4B00
1U5FA 5DH9B 2R09A 2EMSA 5DI9B 2P8VA 2ROVA 2N23A 2Z0QA 1TXDA 5FI0A 2RVBB 2CY5A 1KZ7A 1XCGA 1PFJA 1U5DA 2UZRA 3G9WA 2DX1A 4D0NB 3A8QA 1H10A 4C0AA 5L81A 4DX8A 1DDWA 1E5WA 4GZUA 4HB4B 3ZDTA 1UNPA 1MK9B 3FM8C 1ZC4B 1ZC3B 2ROZB 1U5GA 1DDVA 2D9WA 2COAA 5D3XA 5JP4A 5FI1A 1RJ2A 1UPQA 1W1DA 1NTYA 1X11A 5D27A 5HE2A 1WI1A 1ZM0A 4GMXB 4F7UP 2LG1A 4HAUB 3OANA 3CXBB 2J59M 2I1JA 2HTHB 3ULCA 1X05A 3U7DA 1FB8A 4HAVB 1FHOA 5GOWB 4HB2B 3O96A 3KZ1A 2X18A 5DHFB 2GCLA 2L2IA 2EJ8A 1U29A 4GN1A 1TJ6A 2W2XD 3A98B 2D2QA 4HAYB 2CODA 1FGYA 1BWNA 4K81A 4A6KA 2YF0A 4HB0B 1V88A 5HE0A 1W1HA 2LKOA 2UZSA 1P3RA 2L1CA 2YSZA 4K2OA 4NSWA 2LYDA 3ZVRA 2UVMA 1V89A 2FJLA 1V5UA 2RSGA 2VSZA 4B6HA 2K2JA 1NTVA 4ZRIA 1MKEA 1OQNA 2YVCA 3HQCA 3AU5A 5C6RA 1BAKA 5D3WA 3SYXA 4A6FB 4HAZB 1DDMA 3SV1A 1NU2A 3M1IB 2W2WA 4EMOA 2IYBA 3MDBC 1MAIA 3PVLA 2OTXA 3SUZA 4A6FA 1FOEA 3KSYA 3PEGA 3X23A 3WYFB 2H7EA 4HAXB 3QBVB 4WVFB 4CYEA 1BTNA 1UEFA 2K00A 3ML4A 1J0WA 1SGHA 3V5WA 4KHAA 1B55A 2YT0A 4EJNA 3DXCA 5HE3A 1U5EA 3TO1A 2YS1A 1UNQA 4TYZA 2KGXB 1WGQA 1LW3A 2DKPA 2KUPA 5EFXA 1ISNA 2DHJA 2GS0A 2Z0OA 2AEHA 2LOXA 1FGZA 2AL6A 1OMWA 2YS3A 3NSUA 1PMSA 5LONB 4PNKA 1MIZB 2CRFA 2EC1A 4HAWB 4WJ7A 3ODOA 3PZDA 2GJYA 2COCA 2RUKB 3FEHA 3TCAA 5KCVA 1AQCA 1GC6A 2I1KA 4P7IA 2P0FA 4DXAB 4K2PA 3VOQA 2J0KA 1Q67A 1DROA 4H8SA 2M38A 4MY6A 1WJMA 2OQBA 5CLLB 5JHHA 1XKEA 4MT7A 2IFSA 5J3TA 2XQNM 4K17A 2QKMA 3ODWA 2ADZA 1N3HA 1EVHA 2DTCA 2YT1A 3GYOA 4NY0A 2D11A 5J3YA 2D4QA 1DBHA 1H4RA 2H7DA 4BBKA 2D9VA 4KVGB 4F7HA 3LJUX 1FHWA 2J0JA 2ELAA 4EKUA 5KQ1A 1M7RA 1I2HA 1K5DB 2GCJA 1KZGA 2RNRB 2MWNB 4Z2NA 1LB1A 1SHCA 2LULA 4GPTB 4PQ0A 1V5MA 5DHAB 5C16A 1Y5OA 5J3QA 2PZ1A 5LOPB 4XWXA 2DN6A 1U27A 1MPHA 1P5TA 1Y19B 4A5KA 3HW2B 4Y94A 2Y7BA 4Z2MB 2DA0A 2VRWB 3A8PA 3IVFA 2Y8FA 5CLQB 3HK0A 5HE1A 4KHOA 1V61A 2I5FA 3ODXA 1XX0A 2MKRA 4MK0A 3GYPA 2YRYA 1MK7B 1P6SA 4IFSA 4IOYX 4YL8A 4WSFA 2D9ZA 5JLJB 3P7ZA 3KRXA 5C79A 4GXBA 2D10A 2DYQA 2DKQA 2RLOA 1DYNA 1M7EA 4A6HA 3PSCA 1IRSA 3FSSA 5D3YA 3ULBA 4HHVA 1UNRA 1AWEA 4DX90 1WG7A 1K5GB 2K2UA 2QKLA 3TVVA 3PVUA 4KHBB 1X86A 1QC6A 1QQGA 1XD4A 1EAZA 3U8ZA 2MFQA 1WJ1A 2P0HA 2N0YA 2KCJA 2HE7A 4HATB 1WVHA 4HDQA 2NMBA 1W1GA 3KY9A 4GMVA 5C5BB 1MIXA 3WA0A 3T06A 1EF1A 4DBBA 3TW1A 1X1FA 2W2XC 3QWMA 2ZPYA 5C5BA 1TQZA 2JP2A 2DHIA 2CAYA 1J19A 3DXDA 3BINA 1U2BA 4HB3B 4TKNA 3RCPA 1FAOA 1KI1B 1RRPB 2D9XA 4L6EA 3D8DA 3PP2A 1ZSQA 1EGXA 1Z87A 3D8FA 1NI2A 1X1GA 3VIAA 1BTKA 4YONA 2M14A 1WGUA 4CHJA 3PVWA 2RGNB 2YS5A 2COFA 3SO6A 2E2XA 4F7GA 2Q13A 3PG7A 3CIKA 3P6AA 3UZTA 3AJ4A 3F5RA 2P0DA 1OY2A 1GG3A 5DIFB 2EMTA 3F0WA 4ZRJA 2Z0PA 3KRWA 3QIJA 2DYNA 2I5CA 3D8EA 2DFKA 2DHKA 4CHMA 2R0DA 2Y8GA 3AU4A 3MPXA 2ELBA 1ZVRA 2G35A 4IAPA 2D9YA 3BJIA 1V5PA 2DLWA 3SNHA 1PLSA 2NZ8B 5JHGA 2CY4A 1FHXA 3N7CA 3TFMA 2J0MA 1XODA 1GC7A 2LOZA 2V76A 2VKIA 4KAXB 1I7AA 5KQ4A 2MDXA 1XR0B 2BCJA 1UPRA 2DX5A 5D3VA 4ZRKA 4HDOA 3DXEA
chains in the Genus database with same CATH superfamily
1U5FA 5DH9B 2R09A 2EMSA 5DI9B 2P8VA 2ROVA 2K8EA 2N23A 2Z0QA 1TXDA 5FI0A 2RVBB 2CY5A 1KZ7A 1XCGA 1PFJA 1U5DA 2UZRA 5IRSA 3G9WA 2DX1A 3NWFA 4D0NB 3A8QA 1H10A 3HSAA 4C0AA 5L81A 3DCXA 4DX8A 1DDWA 1E5WA 4GZUA 4HB4B 3ZDTA 1UNPA 1MK9B 3FM8C 1ZC4B 1ZC3B 2ROZB 4KHBA 3OHMB 1U5GA 1DDVA 2D9WA 2COAA 5D3XA 5JP4A 2RRFA 5FI1A 1RJ2A 1UPQA 1W1DA 1NTYA 5I2SA 1X11A 5D27A 5HE2A 1WI1A 1ZM0A 4GMXB 4F7UP 2LG1A 4HAUB 3OANA 3CXBB 3NWAA 2J59M 2I1JA 2HTHB 3ULCA 1X05A 3U7DA 1FB8A 2KR0A 4HAVB 2R2YA 1FHOA 5GOWB 4HB2B 3O96A 4OSNA 3KZ1A 2X18A 5DHFB 2Z13A 2GCLA 2L2IA 2EJ8A 1U29A 4GN1A 1TJ6A 2W2XD 3A98B 2D2QA 4HAYB 2CODA 1FGYA 1BWNA 4CSQA 4K81A 4A6KA 2YF0A 4GOUA 4HB0B 1V88A 5HE0A 1W1HA 2LKOA 2UZSA 1P3RA 2L1CA 2YSZA 4K2OA 4NSWA 2LYDA 3ZVRA 2UVMA 1V89A 2FJLA 1V5UA 2RSGA 2VSZA 4B6HA 2K2JA 1NTVA 2ZKMX 1MKEA 1OQNA 2YVCA 3HQCA 4ZRIA 3AU5A 5C6RA 1BAKA 5D3WA 3SYXA 4A6FB 4HAZB 1DDMA 3SV1A 1NU2A 3M1IB 2W2WA 4EMOA 2IYBA 3MDBC 1MAIA 3PVLA 2OTXA 3SUZA 4A6FA 1FOEA 3KSYA 3PEGA 3X23A 3WYFB 2H7EA 4HAXB 3QBVB 4WVFB 3A58A 4CYEA 1BTNA 1UEFA 2K00A 3ML4A 1J0WA 1SGHA 3V5WA 4KHAA 1B55A 2YT0A 4EJNA 3DXCA 5HE3A 1U5EA 3TO1A 2YS1A 1UNQA 4TYZA 2KGXB 1WGQA 1LW3A 2DKPA 2KUPA 5EFXA 1ISNA 2DHJA 4L1RA 2NBVA 2GS0A 2Z0OA 2AEHA 2LOXA 1FGZA 2AL6A 1OMWA 2YS3A 4QJ5B 3NSUA 1PMSA 5LONB 4OT1A 4PNKA 1MIZB 2CRFA 2EC1A 4HAWB 4WJ7A 3ODOA 3PZDA 2GJYA 2COCA 4D6WA 2RUKB 3FEHA 3TCAA 5KCVA 1AQCA 1GC6A 2I1KA 4P7IA 2P0FA 4DXAB 4K2PA 3VOQA 2J0KA 1Q67A 1DROA 4H8SA 2M38A 4MY6A 3HIEA 1WJMA 2OQBA 5CLLB 5JHHA 1XKEA 4MT7A 1ZYIA 4QXAB 2IFSA 5M4YB 5J3TA 2XQNM 4K17A 1T77A 2QKMA 4QJ4B 3ODWA 2ADZA 1N3HA 1EVHA 2DTCA 2YT1A 3GYOA 4NY0A 2D11A 5J3YA 2D4QA 1DBHA 1H4RA 2H7DA 4BBKA 2D9VA 4KVGB 4F7HA 3LJUX 1FHWA 2J0JA 2ELAA 4EKUA 5KQ1A 2KIGA 1M7RA 1I2HA 1K5DB 2GCJA 1KZGA 2RNRB 2MWNB 4Z2NA 1LB1A 4QJ3B 1SHCA 2LULA 4GPTB 4PQ0A 1V5MA 5DHAB 5C16A 1Y5OA 5J3QA 2PZ1A 5LOPB 4XWXA 2DN6A 1U27A 1MPHA 1P5TA 1Y19B 4A5KA 3HW2B 4Y94A 2Y7BA 4GNKB 4Z2MB 2DA0A 2VRWB 5I2MA 3A8PA 3IVFA 2Z59A 2Y8FA 5CLQB 3HK0A 5HE1A 4KHOA 1V61A 1MI1A 2I5FA 3ODXA 1XX0A 2MKRA 4MK0A 3GYPA 2YRYA 1MK7B 1P6SA 4IFSA 4IOYX 4YL8A 4WSFA 2D9ZA 5JLJB 3P7ZA 3KRXA 5C79A 4GXBA 2D10A 2DYQA 2DKQA 2RLOA 1DYNA 1M7EA 4A6HA 3PSCA 3B77A 1IRSA 3FSSA 5D3YA 2Z14A 3ULBA 4HHVA 1UNRA 1AWEA 4DX90 1WG7A 1K5GB 2K2UA 2QKLA 3TVVA 3PVUA 4KHBB 1X86A 1QC6A 1QQGA 1XD4A 1EAZA 3U8ZA 2MFQA 1WJ1A 2KIEA 2P0HA 2N0YA 2KCJA 3FVCA 2HE7A 4HATB 1WVHA 4HDQA 2NMBA 1W1GA 3KY9A 4GMVA 5C5BB 1MIXA 3WA0A 3T06A 1EF1A 4DBBA 3TW1A 2YT2A 1X1FA 3NW8A 2W2XC 3QWMA 2ZPYA 5C5BA 1TQZA 2JP2A 2DHIA 2CAYA 1J19A 3DXDA 3BINA 1U2BA 4HB3B 4TKNA 3RCPA 1FAOA 2Z4DA 1KI1B 1RRPB 2D9XA 5LG4B 4L6EA 3D8DA 3NWDA 4DIXA 3PP2A 1ZSQA 1EGXA 1Z87A 3D8FA 1NI2A 1X1GA 3VIAA 1BTKA 4YONA 2M14A 1WGUA 4CHJA 3PVWA 2RGNB 2YS5A 2COFA 3SO6A 2E2XA 4F7GA 3U12A 2Q13A 3PG7A 3CIKA 3P6AA 3UZTA 3AJ4A 3F5RA 2P0DA 1OY2A 1GG3A 5DIFB 2EMTA 3F0WA 4ZRJA 2FJUB 2Z0PA 3KRWA 3QIJA 2DYNA 2I5CA 3D8EA 2DFKA 2DHKA 4CHMA 2R0DA 2KUQA 2Y8GA 3AU4A 3MPXA 2ELBA 1ZVRA 2G35A 4IAPA 2D9YA 3BJIA 1V5PA 2DLWA 3SNHA 1PLSA 2NZ8B 5JHGA 2CY4A 4HSIA 1FHXA 2K49A 3N7CA 3TFMA 2J0MA 1XODA 1GC7A 2LOZA 2V76A 2VKIA 2GUMA 1I7AA 4KAXB 5KQ4A 2MDXA 1XR0B 2BCJA 1UPRA 2DX5A 5D3VA 4ZRKA 4HDOA 3DXEA
chains in the Genus database with same CATH topology
1U5FA 5DH9B 2R09A 2EMSA 5DI9B 2P8VA 2ROVA 2N23A 2Z0QA 1TXDA 5FI0A 2RVBB 2CY5A 1KZ7A 1XCGA 1PFJA 1U5DA 2UZRA 3G9WA 2DX1A 4D0NB 3A8QA 1H10A 4C0AA 5L81A 4DX8A 1DDWA 1E5WA 4GZUA 4HB4B 3ZDTA 1UNPA 1MK9B 3FM8C 1ZC4B 1ZC3B 2ROZB 1U5GA 1DDVA 2D9WA 2COAA 5D3XA 5JP4A 5FI1A 1RJ2A 1UPQA 1W1DA 1NTYA 1X11A 5D27A 5HE2A 1WI1A 1ZM0A 4GMXB 4F7UP 2LG1A 4HAUB 3OANA 3CXBB 2J59M 2I1JA 2HTHB 3ULCA 1X05A 3U7DA 1FB8A 4HAVB 1FHOA 5GOWB 4HB2B 3O96A 3KZ1A 2X18A 5DHFB 2GCLA 2L2IA 2EJ8A 1U29A 4GN1A 1TJ6A 2W2XD 3A98B 2D2QA 4HAYB 2CODA 1FGYA 1BWNA 4K81A 4A6KA 2YF0A 4HB0B 1V88A 5HE0A 1W1HA 2LKOA 2UZSA 1P3RA 2L1CA 2YSZA 4K2OA 4NSWA 2LYDA 3ZVRA 2UVMA 1V89A 2FJLA 1V5UA 2RSGA 2VSZA 4B6HA 2K2JA 1NTVA 4ZRIA 1MKEA 1OQNA 2YVCA 3HQCA 3AU5A 5C6RA 1BAKA 5D3WA 3SYXA 4A6FB 4HAZB 1DDMA 3SV1A 1NU2A 3M1IB 2W2WA 4EMOA 2IYBA 3MDBC 1MAIA 3PVLA 2OTXA 3SUZA 4A6FA 1FOEA 3KSYA 3PEGA 3X23A 3WYFB 2H7EA 4HAXB 3QBVB 4WVFB 4CYEA 1BTNA 1UEFA 2K00A 3ML4A 1J0WA 1SGHA 3V5WA 4KHAA 1B55A 2YT0A 4EJNA 3DXCA 5HE3A 1U5EA 3TO1A 2YS1A 1UNQA 4TYZA 2KGXB 1WGQA 1LW3A 2DKPA 2KUPA 5EFXA 1ISNA 2DHJA 2GS0A 2Z0OA 2AEHA 2LOXA 1FGZA 2AL6A 1OMWA 2YS3A 3NSUA 1PMSA 5LONB 4PNKA 1MIZB 2CRFA 2EC1A 4HAWB 4WJ7A 3ODOA 3PZDA 2GJYA 2COCA 2RUKB 3FEHA 3TCAA 5KCVA 1AQCA 1GC6A 2I1KA 4P7IA 2P0FA 4DXAB 4K2PA 3VOQA 2J0KA 1Q67A 1DROA 4H8SA 2M38A 4MY6A 1WJMA 2OQBA 5CLLB 5JHHA 1XKEA 4MT7A 2IFSA 5J3TA 2XQNM 4K17A 2QKMA 3ODWA 2ADZA 1N3HA 1EVHA 2DTCA 2YT1A 3GYOA 4NY0A 2D11A 5J3YA 2D4QA 1DBHA 1H4RA 2H7DA 4BBKA 2D9VA 4KVGB 4F7HA 3LJUX 1FHWA 2J0JA 2ELAA 4EKUA 5KQ1A 1M7RA 1I2HA 1K5DB 2GCJA 1KZGA 2RNRB 2MWNB 4Z2NA 1LB1A 1SHCA 2LULA 4GPTB 4PQ0A 1V5MA 5DHAB 5C16A 1Y5OA 5J3QA 2PZ1A 5LOPB 4XWXA 2DN6A 1U27A 1MPHA 1P5TA 1Y19B 4A5KA 3HW2B 4Y94A 2Y7BA 4Z2MB 2DA0A 2VRWB 3A8PA 3IVFA 2Y8FA 5CLQB 3HK0A 5HE1A 4KHOA 1V61A 2I5FA 3ODXA 1XX0A 2MKRA 4MK0A 3GYPA 2YRYA 1MK7B 1P6SA 4IFSA 4IOYX 4YL8A 4WSFA 2D9ZA 5JLJB 3P7ZA 3KRXA 5C79A 4GXBA 2D10A 2DYQA 2DKQA 2RLOA 1DYNA 1M7EA 4A6HA 3PSCA 1IRSA 3FSSA 5D3YA 3ULBA 4HHVA 1UNRA 1AWEA 4DX90 1WG7A 1K5GB 2K2UA 2QKLA 3TVVA 3PVUA 4KHBB 1X86A 1QC6A 1QQGA 1XD4A 1EAZA 3U8ZA 2MFQA 1WJ1A 2P0HA 2N0YA 2KCJA 2HE7A 4HATB 1WVHA 4HDQA 2NMBA 1W1GA 3KY9A 4GMVA 5C5BB 1MIXA 3WA0A 3T06A 1EF1A 4DBBA 3TW1A 1X1FA 2W2XC 3QWMA 2ZPYA 5C5BA 1TQZA 2JP2A 2DHIA 2CAYA 1J19A 3DXDA 3BINA 1U2BA 4HB3B 4TKNA 3RCPA 1FAOA 1KI1B 1RRPB 2D9XA 4L6EA 3D8DA 3PP2A 1ZSQA 1EGXA 1Z87A 3D8FA 1NI2A 1X1GA 3VIAA 1BTKA 4YONA 2M14A 1WGUA 4CHJA 3PVWA 2RGNB 2YS5A 2COFA 3SO6A 2E2XA 4F7GA 2Q13A 3PG7A 3CIKA 3P6AA 3UZTA 3AJ4A 3F5RA 2P0DA 1OY2A 1GG3A 5DIFB 2EMTA 3F0WA 4ZRJA 2Z0PA 3KRWA 3QIJA 2DYNA 2I5CA 3D8EA 2DFKA 2DHKA 4CHMA 2R0DA 2Y8GA 3AU4A 3MPXA 2ELBA 1ZVRA 2G35A 4IAPA 2D9YA 3BJIA 1V5PA 2DLWA 3SNHA 1PLSA 2NZ8B 5JHGA 2CY4A 1FHXA 3N7CA 3TFMA 2J0MA 1XODA 1GC7A 2LOZA 2V76A 2VKIA 4KAXB 1I7AA 5KQ4A 2MDXA 1XR0B 2BCJA 1UPRA 2DX5A 5D3VA 4ZRKA 4HDOA 3DXEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1U5F A;  5DH9 B;  2R09 A;  2EMS A;  5DI9 B;  2P8V A;  2ROV A;  2N23 A;  2Z0Q A;  1TXD A;  5FI0 A;  2RVB B;  2CY5 A;  1KZ7 A;  1XCG A;  1PFJ A;  1U5D A;  2UZR A;  3G9W A;  2DX1 A;  4D0N B;  3A8Q A;  1H10 A;  4C0A A;  5L81 A;  4DX8 A;  1DDW A;  1E5W A;  4GZU A;  4HB4 B;  3ZDT A;  1UNP A;  1MK9 B;  3FM8 C;  1ZC4 B;  1ZC3 B;  2ROZ B;  1U5G A;  1DDV A;  2D9W A;  2COA A;  5D3X A;  5JP4 A;  5FI1 A;  1RJ2 A;  1UPQ A;  1W1D A;  1NTY A;  1X11 A;  5D27 A;  5HE2 A;  1WI1 A;  1ZM0 A;  4GMX B;  4F7U P;  2LG1 A;  4HAU B;  3OAN A;  3CXB B;  2J59 M;  2I1J A;  2HTH B;  3ULC A;  1X05 A;  3U7D A;  1FB8 A;  4HAV B;  1FHO A;  5GOW B;  4HB2 B;  3O96 A;  3KZ1 A;  2X18 A;  5DHF B;  2GCL A;  2L2I A;  2EJ8 A;  1U29 A;  4GN1 A;  1TJ6 A;  2W2X D;  3A98 B;  2D2Q A;  4HAY B;  2COD A;  1FGY A;  1BWN A;  4K81 A;  4A6K A;  2YF0 A;  4HB0 B;  1V88 A;  5HE0 A;  1W1H A;  2LKO A;  2UZS A;  1P3R A;  2L1C A;  2YSZ A;  4K2O A;  4NSW A;  2LYD A;  3ZVR A;  2UVM A;  1V89 A;  2FJL A;  1V5U A;  2RSG A;  2VSZ A;  4B6H A;  2K2J A;  1NTV A;  4ZRI A;  1MKE A;  1OQN A;  2YVC A;  3HQC A;  3AU5 A;  5C6R A;  1BAK A;  5D3W A;  3SYX A;  4A6F B;  4HAZ B;  1DDM A;  3SV1 A;  1NU2 A;  3M1I B;  2W2W A;  4EMO A;  2IYB A;  3MDB C;  1MAI A;  3PVL A;  2OTX A;  3SUZ A;  4A6F A;  1FOE A;  3KSY A;  3PEG A;  3X23 A;  3WYF B;  2H7E A;  4HAX B;  3QBV B;  4WVF B;  4CYE A;  1BTN A;  1UEF A;  2K00 A;  3ML4 A;  1J0W A;  1SGH A;  3V5W A;  4KHA A;  1B55 A;  2YT0 A;  4EJN A;  3DXC A;  5HE3 A;  1U5E A;  3TO1 A;  2YS1 A;  1UNQ A;  4TYZ A;  2KGX B;  1WGQ A;  1LW3 A;  2DKP A;  2KUP A;  5EFX A;  1ISN A;  2DHJ A;  2GS0 A;  2Z0O A;  2AEH A;  2LOX A;  1FGZ A;  2AL6 A;  1OMW A;  2YS3 A;  3NSU A;  1PMS A;  5LON B;  4PNK A;  1MIZ B;  2CRF A;  2EC1 A;  4HAW B;  4WJ7 A;  3ODO A;  3PZD A;  2GJY A;  2COC A;  2RUK B;  3FEH A;  3TCA A;  5KCV A;  1AQC A;  1GC6 A;  2I1K A;  4P7I A;  2P0F A;  4DXA B;  4K2P A;  3VOQ A;  2J0K A;  1Q67 A;  1DRO A;  4H8S A;  2M38 A;  4MY6 A;  1WJM A;  2OQB A;  5CLL B;  5JHH A;  1XKE A;  4MT7 A;  2IFS A;  5J3T A;  2XQN M;  4K17 A;  2QKM A;  3ODW A;  2ADZ A;  1N3H A;  1EVH A;  2DTC A;  2YT1 A;  3GYO A;  4NY0 A;  2D11 A;  5J3Y A;  2D4Q A;  1DBH A;  1H4R A;  2H7D A;  4BBK A;  2D9V A;  4KVG B;  4F7H A;  3LJU X;  1FHW A;  2J0J A;  2ELA A;  4EKU A;  5KQ1 A;  1M7R A;  1I2H A;  1K5D B;  2GCJ A;  1KZG A;  2RNR B;  2MWN B;  4Z2N A;  1LB1 A;  1SHC A;  2LUL A;  4GPT B;  4PQ0 A;  1V5M A;  5DHA B;  5C16 A;  1Y5O A;  5J3Q A;  2PZ1 A;  5LOP B;  4XWX A;  2DN6 A;  1U27 A;  1MPH A;  1P5T A;  1Y19 B;  4A5K A;  3HW2 B;  4Y94 A;  2Y7B A;  4Z2M B;  2DA0 A;  2VRW B;  3A8P A;  3IVF A;  2Y8F A;  5CLQ B;  3HK0 A;  5HE1 A;  4KHO A;  1V61 A;  2I5F A;  3ODX A;  1XX0 A;  2MKR A;  4MK0 A;  3GYP A;  2YRY A;  1MK7 B;  1P6S A;  4IFS A;  4IOY X;  4YL8 A;  4WSF A;  2D9Z A;  5JLJ B;  3P7Z A;  3KRX A;  5C79 A;  4GXB A;  2D10 A;  2DYQ A;  2DKQ A;  2RLO A;  1DYN A;  1M7E A;  4A6H A;  3PSC A;  1IRS A;  3FSS A;  5D3Y A;  3ULB A;  4HHV A;  1UNR A;  1AWE A;  4DX9 0;  1WG7 A;  1K5G B;  2K2U A;  2QKL A;  3TVV A;  3PVU A;  4KHB B;  1X86 A;  1QC6 A;  1QQG A;  1XD4 A;  1EAZ A;  3U8Z A;  2MFQ A;  1WJ1 A;  2P0H A;  2N0Y A;  2KCJ A;  2HE7 A;  4HAT B;  1WVH A;  4HDQ A;  2NMB A;  1W1G A;  3KY9 A;  4GMV A;  5C5B B;  1MIX A;  3WA0 A;  3T06 A;  1EF1 A;  4DBB A;  3TW1 A;  1X1F A;  2W2X C;  3QWM A;  2ZPY A;  5C5B A;  1TQZ A;  2JP2 A;  2DHI A;  2CAY A;  1J19 A;  3DXD A;  3BIN A;  1U2B A;  4HB3 B;  4TKN A;  3RCP A;  1FAO A;  1KI1 B;  1RRP B;  2D9X A;  4L6E A;  3D8D A;  3PP2 A;  1ZSQ A;  1EGX A;  1Z87 A;  3D8F A;  1NI2 A;  1X1G A;  3VIA A;  1BTK A;  4YON A;  2M14 A;  1WGU A;  4CHJ A;  3PVW A;  2RGN B;  2YS5 A;  2COF A;  3SO6 A;  2E2X A;  4F7G A;  2Q13 A;  3PG7 A;  3CIK A;  3P6A A;  3UZT A;  3AJ4 A;  3F5R A;  2P0D A;  1OY2 A;  1GG3 A;  5DIF B;  2EMT A;  3F0W A;  4ZRJ A;  2Z0P A;  3KRW A;  3QIJ A;  2DYN A;  2I5C A;  3D8E A;  2DFK A;  2DHK A;  4CHM A;  2R0D A;  2Y8G A;  3AU4 A;  3MPX A;  2ELB A;  1ZVR A;  2G35 A;  4IAP A;  2D9Y A;  3BJI A;  1V5P A;  2DLW A;  3SNH A;  1PLS A;  2NZ8 B;  5JHG A;  2CY4 A;  1FHX A;  3N7C A;  3TFM A;  2J0M A;  1XOD A;  1GC7 A;  2LOZ A;  2V76 A;  2VKI A;  4KAX B;  1I7A A;  5KQ4 A;  2MDX A;  1XR0 B;  2BCJ A;  1UPR A;  2DX5 A;  5D3V A;  4ZRK A;  4HDO A;  3DXE A; 
#chains in the Genus database with same CATH topology
 1U5F A;  5DH9 B;  2R09 A;  2EMS A;  5DI9 B;  2P8V A;  2ROV A;  2K8E A;  2N23 A;  2Z0Q A;  1TXD A;  5FI0 A;  2RVB B;  2CY5 A;  1KZ7 A;  1XCG A;  1PFJ A;  1U5D A;  2UZR A;  5IRS A;  3G9W A;  2DX1 A;  3NWF A;  4D0N B;  3A8Q A;  1H10 A;  3HSA A;  4C0A A;  5L81 A;  3DCX A;  4DX8 A;  1DDW A;  1E5W A;  4GZU A;  4HB4 B;  3ZDT A;  1UNP A;  1MK9 B;  3FM8 C;  1ZC4 B;  1ZC3 B;  2ROZ B;  4KHB A;  3OHM B;  1U5G A;  1DDV A;  2D9W A;  2COA A;  5D3X A;  5JP4 A;  2RRF A;  5FI1 A;  1RJ2 A;  1UPQ A;  1W1D A;  1NTY A;  5I2S A;  1X11 A;  5D27 A;  5HE2 A;  1WI1 A;  1ZM0 A;  4GMX B;  4F7U P;  2LG1 A;  4HAU B;  3OAN A;  3CXB B;  3NWA A;  2J59 M;  2I1J A;  2HTH B;  3ULC A;  1X05 A;  3U7D A;  1FB8 A;  2KR0 A;  4HAV B;  2R2Y A;  1FHO A;  5GOW B;  4HB2 B;  3O96 A;  4OSN A;  3KZ1 A;  2X18 A;  5DHF B;  2Z13 A;  2GCL A;  2L2I A;  2EJ8 A;  1U29 A;  4GN1 A;  1TJ6 A;  2W2X D;  3A98 B;  2D2Q A;  4HAY B;  2COD A;  1FGY A;  1BWN A;  4CSQ A;  4K81 A;  4A6K A;  2YF0 A;  4GOU A;  4HB0 B;  1V88 A;  5HE0 A;  1W1H A;  2LKO A;  2UZS A;  1P3R A;  2L1C A;  2YSZ A;  4K2O A;  4NSW A;  2LYD A;  3ZVR A;  2UVM A;  1V89 A;  2FJL A;  1V5U A;  2RSG A;  2VSZ A;  4B6H A;  2K2J A;  1NTV A;  2ZKM X;  1MKE A;  1OQN A;  2YVC A;  3HQC A;  4ZRI A;  3AU5 A;  5C6R A;  1BAK A;  5D3W A;  3SYX A;  4A6F B;  4HAZ B;  1DDM A;  3SV1 A;  1NU2 A;  3M1I B;  2W2W A;  4EMO A;  2IYB A;  3MDB C;  1MAI A;  3PVL A;  2OTX A;  3SUZ A;  4A6F A;  1FOE A;  3KSY A;  3PEG A;  3X23 A;  3WYF B;  2H7E A;  4HAX B;  3QBV B;  4WVF B;  3A58 A;  4CYE A;  1BTN A;  1UEF A;  2K00 A;  3ML4 A;  1J0W A;  1SGH A;  3V5W A;  4KHA A;  1B55 A;  2YT0 A;  4EJN A;  3DXC A;  5HE3 A;  1U5E A;  3TO1 A;  2YS1 A;  1UNQ A;  4TYZ A;  2KGX B;  1WGQ A;  1LW3 A;  2DKP A;  2KUP A;  5EFX A;  1ISN A;  2DHJ A;  4L1R A;  2NBV A;  2GS0 A;  2Z0O A;  2AEH A;  2LOX A;  1FGZ A;  2AL6 A;  1OMW A;  2YS3 A;  4QJ5 B;  3NSU A;  1PMS A;  5LON B;  4OT1 A;  4PNK A;  1MIZ B;  2CRF A;  2EC1 A;  4HAW B;  4WJ7 A;  3ODO A;  3PZD A;  2GJY A;  2COC A;  4D6W A;  2RUK B;  3FEH A;  3TCA A;  5KCV A;  1AQC A;  1GC6 A;  2I1K A;  4P7I A;  2P0F A;  4DXA B;  4K2P A;  3VOQ A;  2J0K A;  1Q67 A;  1DRO A;  4H8S A;  2M38 A;  4MY6 A;  3HIE A;  1WJM A;  2OQB A;  5CLL B;  5JHH A;  1XKE A;  4MT7 A;  1ZYI A;  4QXA B;  2IFS A;  5M4Y B;  5J3T A;  2XQN M;  4K17 A;  1T77 A;  2QKM A;  4QJ4 B;  3ODW A;  2ADZ A;  1N3H A;  1EVH A;  2DTC A;  2YT1 A;  3GYO A;  4NY0 A;  2D11 A;  5J3Y A;  2D4Q A;  1DBH A;  1H4R A;  2H7D A;  4BBK A;  2D9V A;  4KVG B;  4F7H A;  3LJU X;  1FHW A;  2J0J A;  2ELA A;  4EKU A;  5KQ1 A;  2KIG A;  1M7R A;  1I2H A;  1K5D B;  2GCJ A;  1KZG A;  2RNR B;  2MWN B;  4Z2N A;  1LB1 A;  4QJ3 B;  1SHC A;  2LUL A;  4GPT B;  4PQ0 A;  1V5M A;  5DHA B;  5C16 A;  1Y5O A;  5J3Q A;  2PZ1 A;  5LOP B;  4XWX A;  2DN6 A;  1U27 A;  1MPH A;  1P5T A;  1Y19 B;  4A5K A;  3HW2 B;  4Y94 A;  2Y7B A;  4GNK B;  4Z2M B;  2DA0 A;  2VRW B;  5I2M A;  3A8P A;  3IVF A;  2Z59 A;  2Y8F A;  5CLQ B;  3HK0 A;  5HE1 A;  4KHO A;  1V61 A;  1MI1 A;  2I5F A;  3ODX A;  1XX0 A;  2MKR A;  4MK0 A;  3GYP A;  2YRY A;  1MK7 B;  1P6S A;  4IFS A;  4IOY X;  4YL8 A;  4WSF A;  2D9Z A;  5JLJ B;  3P7Z A;  3KRX A;  5C79 A;  4GXB A;  2D10 A;  2DYQ A;  2DKQ A;  2RLO A;  1DYN A;  1M7E A;  4A6H A;  3PSC A;  3B77 A;  1IRS A;  3FSS A;  5D3Y A;  2Z14 A;  3ULB A;  4HHV A;  1UNR A;  1AWE A;  4DX9 0;  1WG7 A;  1K5G B;  2K2U A;  2QKL A;  3TVV A;  3PVU A;  4KHB B;  1X86 A;  1QC6 A;  1QQG A;  1XD4 A;  1EAZ A;  3U8Z A;  2MFQ A;  1WJ1 A;  2KIE A;  2P0H A;  2N0Y A;  2KCJ A;  3FVC A;  2HE7 A;  4HAT B;  1WVH A;  4HDQ A;  2NMB A;  1W1G A;  3KY9 A;  4GMV A;  5C5B B;  1MIX A;  3WA0 A;  3T06 A;  1EF1 A;  4DBB A;  3TW1 A;  2YT2 A;  1X1F A;  3NW8 A;  2W2X C;  3QWM A;  2ZPY A;  5C5B A;  1TQZ A;  2JP2 A;  2DHI A;  2CAY A;  1J19 A;  3DXD A;  3BIN A;  1U2B A;  4HB3 B;  4TKN A;  3RCP A;  1FAO A;  2Z4D A;  1KI1 B;  1RRP B;  2D9X A;  5LG4 B;  4L6E A;  3D8D A;  3NWD A;  4DIX A;  3PP2 A;  1ZSQ A;  1EGX A;  1Z87 A;  3D8F A;  1NI2 A;  1X1G A;  3VIA A;  1BTK A;  4YON A;  2M14 A;  1WGU A;  4CHJ A;  3PVW A;  2RGN B;  2YS5 A;  2COF A;  3SO6 A;  2E2X A;  4F7G A;  3U12 A;  2Q13 A;  3PG7 A;  3CIK A;  3P6A A;  3UZT A;  3AJ4 A;  3F5R A;  2P0D A;  1OY2 A;  1GG3 A;  5DIF B;  2EMT A;  3F0W A;  4ZRJ A;  2FJU B;  2Z0P A;  3KRW A;  3QIJ A;  2DYN A;  2I5C A;  3D8E A;  2DFK A;  2DHK A;  4CHM A;  2R0D A;  2KUQ A;  2Y8G A;  3AU4 A;  3MPX A;  2ELB A;  1ZVR A;  2G35 A;  4IAP A;  2D9Y A;  3BJI A;  1V5P A;  2DLW A;  3SNH A;  1PLS A;  2NZ8 B;  5JHG A;  2CY4 A;  4HSI A;  1FHX A;  2K49 A;  3N7C A;  3TFM A;  2J0M A;  1XOD A;  1GC7 A;  2LOZ A;  2V76 A;  2VKI A;  2GUM A;  1I7A A;  4KAX B;  5KQ4 A;  2MDX A;  1XR0 B;  2BCJ A;  1UPR A;  2DX5 A;  5D3V A;  4ZRK A;  4HDO A;  3DXE A; 
#chains in the Genus database with same CATH homology
 1U5F A;  5DH9 B;  2R09 A;  2EMS A;  5DI9 B;  2P8V A;  2ROV A;  2N23 A;  2Z0Q A;  1TXD A;  5FI0 A;  2RVB B;  2CY5 A;  1KZ7 A;  1XCG A;  1PFJ A;  1U5D A;  2UZR A;  3G9W A;  2DX1 A;  4D0N B;  3A8Q A;  1H10 A;  4C0A A;  5L81 A;  4DX8 A;  1DDW A;  1E5W A;  4GZU A;  4HB4 B;  3ZDT A;  1UNP A;  1MK9 B;  3FM8 C;  1ZC4 B;  1ZC3 B;  2ROZ B;  1U5G A;  1DDV A;  2D9W A;  2COA A;  5D3X A;  5JP4 A;  5FI1 A;  1RJ2 A;  1UPQ A;  1W1D A;  1NTY A;  1X11 A;  5D27 A;  5HE2 A;  1WI1 A;  1ZM0 A;  4GMX B;  4F7U P;  2LG1 A;  4HAU B;  3OAN A;  3CXB B;  2J59 M;  2I1J A;  2HTH B;  3ULC A;  1X05 A;  3U7D A;  1FB8 A;  4HAV B;  1FHO A;  5GOW B;  4HB2 B;  3O96 A;  3KZ1 A;  2X18 A;  5DHF B;  2GCL A;  2L2I A;  2EJ8 A;  1U29 A;  4GN1 A;  1TJ6 A;  2W2X D;  3A98 B;  2D2Q A;  4HAY B;  2COD A;  1FGY A;  1BWN A;  4K81 A;  4A6K A;  2YF0 A;  4HB0 B;  1V88 A;  5HE0 A;  1W1H A;  2LKO A;  2UZS A;  1P3R A;  2L1C A;  2YSZ A;  4K2O A;  4NSW A;  2LYD A;  3ZVR A;  2UVM A;  1V89 A;  2FJL A;  1V5U A;  2RSG A;  2VSZ A;  4B6H A;  2K2J A;  1NTV A;  4ZRI A;  1MKE A;  1OQN A;  2YVC A;  3HQC A;  3AU5 A;  5C6R A;  1BAK A;  5D3W A;  3SYX A;  4A6F B;  4HAZ B;  1DDM A;  3SV1 A;  1NU2 A;  3M1I B;  2W2W A;  4EMO A;  2IYB A;  3MDB C;  1MAI A;  3PVL A;  2OTX A;  3SUZ A;  4A6F A;  1FOE A;  3KSY A;  3PEG A;  3X23 A;  3WYF B;  2H7E A;  4HAX B;  3QBV B;  4WVF B;  4CYE A;  1BTN A;  1UEF A;  2K00 A;  3ML4 A;  1J0W A;  1SGH A;  3V5W A;  4KHA A;  1B55 A;  2YT0 A;  4EJN A;  3DXC A;  5HE3 A;  1U5E A;  3TO1 A;  2YS1 A;  1UNQ A;  4TYZ A;  2KGX B;  1WGQ A;  1LW3 A;  2DKP A;  2KUP A;  5EFX A;  1ISN A;  2DHJ A;  2GS0 A;  2Z0O A;  2AEH A;  2LOX A;  1FGZ A;  2AL6 A;  1OMW A;  2YS3 A;  3NSU A;  1PMS A;  5LON B;  4PNK A;  1MIZ B;  2CRF A;  2EC1 A;  4HAW B;  4WJ7 A;  3ODO A;  3PZD A;  2GJY A;  2COC A;  2RUK B;  3FEH A;  3TCA A;  5KCV A;  1AQC A;  1GC6 A;  2I1K A;  4P7I A;  2P0F A;  4DXA B;  4K2P A;  3VOQ A;  2J0K A;  1Q67 A;  1DRO A;  4H8S A;  2M38 A;  4MY6 A;  1WJM A;  2OQB A;  5CLL B;  5JHH A;  1XKE A;  4MT7 A;  2IFS A;  5J3T A;  2XQN M;  4K17 A;  2QKM A;  3ODW A;  2ADZ A;  1N3H A;  1EVH A;  2DTC A;  2YT1 A;  3GYO A;  4NY0 A;  2D11 A;  5J3Y A;  2D4Q A;  1DBH A;  1H4R A;  2H7D A;  4BBK A;  2D9V A;  4KVG B;  4F7H A;  3LJU X;  1FHW A;  2J0J A;  2ELA A;  4EKU A;  5KQ1 A;  1M7R A;  1I2H A;  1K5D B;  2GCJ A;  1KZG A;  2RNR B;  2MWN B;  4Z2N A;  1LB1 A;  1SHC A;  2LUL A;  4GPT B;  4PQ0 A;  1V5M A;  5DHA B;  5C16 A;  1Y5O A;  5J3Q A;  2PZ1 A;  5LOP B;  4XWX A;  2DN6 A;  1U27 A;  1MPH A;  1P5T A;  1Y19 B;  4A5K A;  3HW2 B;  4Y94 A;  2Y7B A;  4Z2M B;  2DA0 A;  2VRW B;  3A8P A;  3IVF A;  2Y8F A;  5CLQ B;  3HK0 A;  5HE1 A;  4KHO A;  1V61 A;  2I5F A;  3ODX A;  1XX0 A;  2MKR A;  4MK0 A;  3GYP A;  2YRY A;  1MK7 B;  1P6S A;  4IFS A;  4IOY X;  4YL8 A;  4WSF A;  2D9Z A;  5JLJ B;  3P7Z A;  3KRX A;  5C79 A;  4GXB A;  2D10 A;  2DYQ A;  2DKQ A;  2RLO A;  1DYN A;  1M7E A;  4A6H A;  3PSC A;  1IRS A;  3FSS A;  5D3Y A;  3ULB A;  4HHV A;  1UNR A;  1AWE A;  4DX9 0;  1WG7 A;  1K5G B;  2K2U A;  2QKL A;  3TVV A;  3PVU A;  4KHB B;  1X86 A;  1QC6 A;  1QQG A;  1XD4 A;  1EAZ A;  3U8Z A;  2MFQ A;  1WJ1 A;  2P0H A;  2N0Y A;  2KCJ A;  2HE7 A;  4HAT B;  1WVH A;  4HDQ A;  2NMB A;  1W1G A;  3KY9 A;  4GMV A;  5C5B B;  1MIX A;  3WA0 A;  3T06 A;  1EF1 A;  4DBB A;  3TW1 A;  1X1F A;  2W2X C;  3QWM A;  2ZPY A;  5C5B A;  1TQZ A;  2JP2 A;  2DHI A;  2CAY A;  1J19 A;  3DXD A;  3BIN A;  1U2B A;  4HB3 B;  4TKN A;  3RCP A;  1FAO A;  1KI1 B;  1RRP B;  2D9X A;  4L6E A;  3D8D A;  3PP2 A;  1ZSQ A;  1EGX A;  1Z87 A;  3D8F A;  1NI2 A;  1X1G A;  3VIA A;  1BTK A;  4YON A;  2M14 A;  1WGU A;  4CHJ A;  3PVW A;  2RGN B;  2YS5 A;  2COF A;  3SO6 A;  2E2X A;  4F7G A;  2Q13 A;  3PG7 A;  3CIK A;  3P6A A;  3UZT A;  3AJ4 A;  3F5R A;  2P0D A;  1OY2 A;  1GG3 A;  5DIF B;  2EMT A;  3F0W A;  4ZRJ A;  2Z0P A;  3KRW A;  3QIJ A;  2DYN A;  2I5C A;  3D8E A;  2DFK A;  2DHK A;  4CHM A;  2R0D A;  2Y8G A;  3AU4 A;  3MPX A;  2ELB A;  1ZVR A;  2G35 A;  4IAP A;  2D9Y A;  3BJI A;  1V5P A;  2DLW A;  3SNH A;  1PLS A;  2NZ8 B;  5JHG A;  2CY4 A;  1FHX A;  3N7C A;  3TFM A;  2J0M A;  1XOD A;  1GC7 A;  2LOZ A;  2V76 A;  2VKI A;  4KAX B;  1I7A A;  5KQ4 A;  2MDX A;  1XR0 B;  2BCJ A;  1UPR A;  2DX5 A;  5D3V A;  4ZRK A;  4HDO A;  3DXE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...