3TCAA

Crystal structure of the ras-associating and pleckstrin-homology domains of riam
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
260
structure length
246
Chain Sequence
VKKLVVKVHMDDSSTKSLMVDERQLARDVLDNLFEKTHCDCNVDWCLYEIYPELQIERVFEDHENVVEVLSDWTRDTENKVLFLEKEERYAVFKNPQNFYLMNAKNKEYLLEESFCGTSIIVPELEGALYLKEDGKKSWKRRYFLLRASGIYYVPKGKTKTSRDLACFIQFENVNIYYGIQCKMKYKAPTDHCFVLKHPQIQKESQYIKYLCCDDARTLSQWVMGIRIAKYGKTLYDNYQRAVARA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Amyloid beta A4 precursor protein-binding family B member 1-
publication title Rap1-interacting adapter molecule (RIAM) associates with the plasma membrane via a proximity detector.
pubmed doi rcsb
source organism Mus musculus
molecule tags Signaling protein
total genus 76
structure length 246
sequence length 260
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-08-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00169 PH PH domain
A PF00788 RA Ras association (RalGDS/AF-6) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 3tcaA02
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 3tcaA01
2LVPA 1WJ6A 4EUTA 2XQNM 3DVGY 2LOZA 1WI1A 3ENEA 3VIAA 4PS3A 4CHMA 3TBLD 3DPDA 3H7SA 4HAUB 3WIMA 2RGNB 3M63B 2GBMA 2J59M 4F1SA 2JF5A 2BKRB 3TIXA 2KFKA 2CAYA 1ZW7A 1OTRB 1RLFA 3ZNHB 4MK0A 2RVBB 2BGFA 1WM2A 2D11A 1I2HA 4G50A 4FA6A 3SUZA 1WGGA 1WJMA 3DDCB 2DHIA 2GBJA 3V60A 1UELA 1K5DB 3PRPB 2XK5B 2JXXA 1P3QU 2NS5A 2D2QA 2DX5A 3HQCA 2O2VA 4W9HA 2KXJA 2DFKA 5AZFA 2GCLA 2DAFA 3Q3JA 4IWPA 5EFXA 3A1QA 2DKQA 1V5TA 4XWXA 4ANWA 2D9ZA 4XC2A 2DZJA 2ASQA 2CS4A 1WZ0A 2MBQA 2J7QB 2LULA 2I5CA 3PHXB 2KO3A 2MP2B 1UEFA 5DI9B 3V5WA 3NS8A 2KNBA 2BCJA 4DHJD 1H4RA 3ZTCA 2KMCA 1H10A 4GPTB 3O96A 2Y5BB 2RD0A 4K17A 2LGYA 3A8PA 5D7GA 1X1GA 3GYPA 2KC2A 3VH4B 1MK7B 3AJ4A 2RSUA 4MJSB 5C6RA 1V5MA 1ISNA 2DZKA 2K25A 4ZDVA 4WWNA 4NY0A 2DYBA 3QJZA 2KN5A 2JT4B 4TKNA 4II3B 4DHJB 3R7RA 2K8HA 2ZNVB 1BTNA 5AEKB 3V62A 1DBHA 3VUWA 3TCAA 3VHTC 2P8VA 3ODWA 2EKEC 5J3YA 1WMHB 3SYXA 4A3PA 4BBKA 2LASA 4IW0A 2JZZA 1KZGA 1GNUA 4GIVA 4I6NB 1XCGA 3KYCD 5DPRA 1WFYA 2W9NA 3C0RB 2ZJDA 1DDWA 5KHOA 1U29A 3DBSA 4FBJB 2P0FA 3OLMD 2OJRA 2KTRB 4WAAA 4PS8A 3P6AA 1V86A 1WX9A 3TO1A 2ROVA 4F7GA 2N23A 3N30A 2BWFA 1FGYA 3QC8B 2QKLA 4WJNA 4BKGA 4GDKB 3CIKA 3DVNV 1BTKA 3DCGA 3W1YA 1EF1A 5HE3A 3RT3B 2BF8B 1UNRA 2J0KA 2P0HA 4ZRKA 3ML8A 2DAJA 1MIZB 1P0RA 4DBBA 1S3SG 2IYDB 1VD2A 2DYNA 1P9DU 2I1KA 3MHSD 5J17A 3PREA 3L54A 4ZRIA 2KTFA 2WWZA 4NSWA 2GBKA 2DHKA 2KKCA 2DENB 2VRRB 4NJ6A 3ODXA 1Z87A 4M8MA 4BKSA 3UF8A 2JRHA 2O6VB 4DDID 1GG3A 4KIKA 3T8MA 2CODA 1UBQA 3FEHA 2LKOA 2N0YA 2MKRA 4A3OA 2L2IA 2IO1B 2D9XA 3KW5B 1UNQA 1PQSA 3RZFA 1WE7A 3A9KB 4EZLA 2L0FA 4RMAA 2KHWB 3SDLC 3N32A 1MKEA 3EHVA 1J8CA 1FXTB 1IRSA 1WXMA 2LRUA 2ZCBA 3RYTA 5AZGA 4B6HA 2V3SA 1V80A 1WR6E 2ADZA 3ULCA 2KJ6A 5L95C 4HB2B 4CHKA 3ODOA 3TFMA 1GC7A 1RRBA 4DWFA 2ZVOA 2YS3A 4W9JA 1EO6A 2BYFA 4LDTD 1ZC4B 2EJ8A 4DHZE 3VOQA 1NTYA 4BBNC 1LM8B 1P1AA 1GC6A 1FHOA 1QQGA 2ZPYA 3VDZA 1KJTA 1ZM0A 4FULA 3A9JB 2YF0A 1E8ZA 2X18A 1I35A 4HCPB 3PT2B 3RULA 2MBHA 3JYUA 5IA7A 5CX3A 3KRXA 4FJYA 1EUVB 1LW3A 4URKA 2GS0A 2W2XC 2KVRA 2ZEQA 2VSZA 3ZVVA 4IWOA 3VTWA 4MT7A 2Z0OA 3PHWB 2NBUA 2L00B 5E6NA 3X23A 5G2NA 1WJUA 2KWVB 2K8BA 2XK5A 2HTHB 2V1YA 4HPMB 1GUAB 2HD5B 2GOWA 3VTVA 2A5UA 1L2NA 1Y19B 3M1IB 2D9YA 1WE6A 2R2QA 2Z0EB 2DZMA 5KCVA 2PEAA 2C5LC 3HM6X 4HAVB 1OEYA 2JRIB 3KZ1A 5D3YA 3PV1A 5D94A 1YD8U 3FSSA 2KGXB 4JLCA 2MP2A 3VUXA 3WAPA 1YJ1A 2ZZPB 3W1SC 4WSFA 1WJ1A 2GJYA 3QAQA 4HWIB 2MCNB 4A6FB 2LJ5A 4GOCA 2DTCA 4KHBB 1YX5B 4W9GA 2PPHA 4CO7A 1KI1B 2IO2B 3B08A 3KY9A 1MIXA 1ZC3B 4N9F4 4Z2NA 4W9LA 4WJPA 3TW1A 2YLMA 1FHXA 1QC6A 4DXAB 3HIZA 3NHEB 2MFQA 3GOEA 1V2YA 4MJSA 4W9FA 4MSQB 3TJPA 2C7HA 1FHWA 3LDZE 4GN1A 3A98B 3QIJA 3PSCA 3IVFA 1SHCA 1J0WA 2N4FA 4HPLB 3CSFA 2CRFA 4F7UP 1XD4A 5D2MB 2FNJB 2IZVB 4PQ0A 2L05A 2D9VA 1WMHA 2G4SA 2R2OA 2FIFA 2P0DA 4HDQA 5EDSA 2LXAA 4FADA 4BOSC 2BYEA 4TQ1A 2JVCA 5CHVC 1WM3A 1EGXA 4K7SA 2IY0B 5D6JB 2Y7BA 1MK9B 1WX7A 1XQQA 2V76A 3RUIB 2K6QA 1BAKA 4EFOA 3QWZB 4J6IA 1KLVA 5CTRC 5J3QA 3QBVB 2KTRA 5HKHA 3O65B 3ZNGC 1WGYA 2FCQA 3ZVRA 2ROZB 3OJ4B 5DCNA 2N9XA 1CMXB 2AL6A 2RNRB 3UINB 2GBRA 4GDKA 3KUZA 2M8SA 2N9EB 3LJ3A 4A6KA 3RZWC 2KLCA 4AOFA 2LXCA 4PS7A 2KX0A 1IPGA 3L17A 3PRZA 3QX1A 1P5TA 3RCZA 3ZLZA 2LYDA 4G3XB 2UYZB 3H1UA 3QA8A 3V6CB 3WAMA 2MX2A 3H6NA 2DA0A 3TMPB 3H9DA 2LVQA 3OAWA 1V9JA 1YQBA 2R0DA 2JP2A 3DBHI 5JH5C 2ELBA 2MWNB 4AUQC 1WF9A 2Y8GA 2O6VA 1RJ2A 1IYFA 1V89A 2KLGA 1XX0A 5GOWB 3F0WA 3QCAA 5LONB 4YONA 2JWZA 3NZUA 1S1QB 2D3GA 3A9KA 1I7AA 2YS5A 1UZXB 2K2JA 4IM2A 4DX90 2RSGA 4DX8A 2KD0A 1E7VA 3MPXA 3VH3B 4FN2A 4KDLB 4BOZB 3UIPB 3DXDA 5G55A 3VXWA 3ZRCA 1WX8A 2VRWB 2Y8FA 1LFDA 2KK8A 5J2RA 1WXVA 2KJHB 5GMVA 1WGRA 4DBGA 3DOWA 3LJUX 1XT9B 2NMBA 3D8DA 2CY4A 5DPWA 4EMOA 1Z2MA 4ANVA 3AI5A 2M38A 2MRPA 2BPSA 2BYVE 2QKMA 1FGZA 4IM3A 2CY5A 2KDIA 3B1LX 4K81A 4ANUA 2FCSA 4IWQA 4W9IA 1OEYJ 4AP4C 4AJYB 4HAXB 3L13A 1X1FA 2A4ZA 2M4NA 2WX1A 4II2B 2I5FA 2K6DB 4MEMA 2W2XD 3A9JA 2R09A 4HAZB 4GB9A 3PVUA 1DDVA 3G9WA 2DHZA 3PP2A 4KHAA 4WVFB 3QHTA 4EZJA 3ZDMC 3T06A 2M17A 3KSYA 1WH3A 2H7DA 4MGKE 2AYOB 4PYUA 1M7EA 1Q67A 2MW5A 1X11A 4HLEA 5LXIB 3I3TB 4PYZA 1N3HA 1WY8A 2LVOA 4HB0B 2NVUI 3R7QA 2YRYA 4NNJB 2H7EA 1ZSQA 3QARA 4HXDA 2HTHA 3KUDB 2REXA 1F9JA 1NDDA 2QHOA 1WGUA 1W1HA 5FI0A 1RFAA 1QZEA 2LRWA 3B0AA 4NAWB 2RLOA 1KM7A 3S2AA 1WIAA 1UD7A 5KQ1A 4HCNB 5D3VA 4JIOU 1TTNA 2XBBC 3DBRI 4E71A 1G6JA 1T0YA 4K2PA 4GMVA 2PE9A 2IBIB 3H7PB 2MBBB 4M0WB 1WYWB 3NOBA 4NQKE 3EECA 4A6FA 4DK5A 4LJOB 2E2XA 2JY6A 3SO6A 2YVCA 2EC1A 1J19A 2NZ8B 2KOXA 1D3ZA 4H8SA 1E8YA 3GZNI 1P98A 2Z0DB 4K7UA 2MSED 2DLWA 2AWTA 3JW0X 4KSLC 3PS6A 4DDGD 2ELAA 3ZNZB 1WI0A 2KC1A 3X0WA 2CR5A 1E8XA 4LJPB 3BINA 4JQWC 3NZSA 4F7ZA 3V61A 4RM8A 3APFA 2CHWA 3ZUNA 2OTXA 3U7DA 1TQZA 5KHQA 3PZDA 1ZGUB 3IFWB 5D27A 4ASWC 3PRMB 5JHGA 2WYQA 3RD2A 3ZO5B 1NTVA 1P3RA 2LGXA 1UNPA 3K9PB 2C7NB 3N7CA 2EMSA 1V49A 1L7YA 2FCNA 1P6SA 2PJHA 2LI5A 2AL3A 2DHJA 2COAA 2AEHA 3ULBA 2K1FA 4LDTB 4BKSD 3FM8C 1TXDA 1DROA 2KDEB 4HATB 2MBEA 2KX3A 3SU8X 1YX6B 3ZDTA 2HJ8A 4AJWA 2BKFA 3GYOA 2NPTB 1V88A 2D4QA 4WJOA 5C5BB 2M0XA 4IG7B 4GMXB 1R4MI 2Q13A 1E7UA 1X05A 4KSKC 1PLSA 4W9EA 2Z0QA 1U5GA 1XR0B 3APCA 1FB8A 1K5GB 3MDBC 4CYEA 4K2OA 1LB1A 1U27A 2L0TA 3UIOB 2KUPA 2KANA 4E3CA 2N1VA 3PGEA 4MGIE 3DXEA 1LQBA 1Z5SB 4G11A 1WR1A 2XEWA 2COCA 2LOXA 2KWUB 3A4SC 1J0GA 2MQJA 2L8JA 1OY2A 1NBFC 1WZ3A 2MWSB 4KAXB 2V4LA 4JL9A 3U30A 3VQIA 5DPSA 3DQVA 1EAZA 4MSMB 3BY4B 2NBVB 2M1MA 2KWCA 2RPQA 2FAZA 1RRPB 5AZHA 2VKIA 4FHJA 1V5PA 5C16A 4GXBA 3ZRFA 1YIWA 3L16A 3F5RA 1GJZA 4ANXA 1M7RA 1E5WA 3R3MA 1W1DA 4G0NB 1LXDA 4W9KA 1Y5OA 3KYDD 4OVUA 4D0NB 4ICVA 4WQOB 3PEGA 1U5DA 1SGHA 4A5KA 2YT1A 3DBLI 3SHQA 5JHBA 2D07B 3AU5A 3VFKA 1RAXA 3VVWB 3UZTA 1M94A 3WA0A 1OMWA 3V6EB 3CF6E 4GU2A 4TYZA 5E6PA 3WALA 3P7ZA 2ZVNA 2PE6B 2J0JA 3PPAA 1ZVRA 4A20A 3HK0A 2IO0B 3JSVB 1IP9A 3KH0A 4HAYB 3P2BA 2NR2A 1WVHA 3ZNID 5LOPB 4GDLB 4HK2A 5HE1A 4KV2A 2DX1A 2N1WA 2C7MB 1R4NI 3D8FA 2OQBA 2MA9B 5JP4A 4IM0A 1BT0A 1Y8RC 4Z2MB 1FAOA 1WJNA 2KDFB 3A33B 2Z0PA 1TGZB 2C60A 2LG1A 2CHZA 2HE7A 2K39A 4KZ0A 1UGMA 4HB4B 1MG8A 3BJIA 5CLLB 3PSEB 3M62B 1EF5A 1PMSA 1X86A 4C0AA 1DDMA 4MGYE 4ICUA 2LGDA 1MPHA 4I6LB 3UQBA 2RGFA 4XZ4A 4F8CB 2PZ1A 2JZ3B 4HAWB 4L6EA 5CLQB 4EEWA 3ZKJC 3SNHA 4NAWA 3ZTDA 4EJNA 4GSWA 2NCNA 3IG3A 1JRUA 3PVWA 2GCJA 5L83A 4HHVA 2I1JA 1VCBA 4EZKA 1U4AA 4WJQA 5J18A 3H7PA 4MELA 2L7RA 4E74A 2J0MA 5E6OA 1V5UA 3SV1A 4MY6A 1E8WA 4KDIC 3ECIA 1U5EA 3RCPA 2G3QB 1WGQA 4GZUA 4NQLB 4K7WA 3VTUA 2K2UA 3VAWA 3W1SA 3N3KB 1UPQA 5C79A 4TUUA 1U5FA 2D9WA 2WDTB 3KVFB 2GMIC 5FR6A 2KFKB 3QK0A 4ZRJA 4FJZA 4KVGB 1AQCA 1OQYA 5CHFA 2B3AA 1V5OA 1B55A 2KQSA 2K8CA 1ZKHA 2MBOA 3ZIMA 2CU1A 1UBIA 1I42A 5FI1A 2DYQA 4JGHB 3TL5A 4XX5A 2KCJA 3PLVA 2DX5B 4A6HA 1Q1OA 2COFA 2JUOA 2O2VB 1WG7A 4IFSA 1Q0WB 2N7DA 4YL8A 3A1QB 3ALBA 2UVMA 3WAOA 2G35A 1WXSA 4RM9A 4AWJA 1HE8A 2O6VD 2K00A 4HJKA 3CMMB 1V81A 2C9WB 2UZRA 2FJLA 3ONSA 2NPTA 1SE9A 5C5BA 1WJ4A 1NU2A 4NJ7A 1V61A 3A4RA 1X1MA 4X57B 2L76A 2UWQA 4BVUC 3JVZX 3MJWA 5KQ4A 2IY1B 3WANA 2N7EA 2KMAA 2W2WA 2KDBA 2LD9A 4IC7B 4W9DA 4WJ7A 1NI2A 5DPTA 4OVVA 2DN6A 3CXBB 2ZNVC 1PFJA 4WWOA 3PLUA 5J3TA 2D10A 2G45B 2NBWB 3PVLA 3DXCA 5D3XA 3HM3A 3UGBB 3IBEA 4B9KA 1A5RA 5C1ZA 4DHZB 1WXAA 1W1GA 3UQAA 5CHWA 5D3WA 4FHKA 4EKUA 2IYBA 3AXCA 4ZYNA 2YS1A 1K8RB 1C3TA 3T9LA 2YT0A 1TZ1A 1OGWA 4HVBA 1XKEA 3ZW3A 4K1RB 3DVGX 3VUYA 4MM3A 4EOYA 2KQ7A 5IAAC 4KZCA 3U8ZA 4TV3A 3DVNU 2ZCCA 3SD5A 3EFUA 5DH9B 3QWMA 1E90A 4IAPA 4TQ0A 2KFJA 2LWPA 4I6PA 5BO4B 3KRWA 1KOTA 3Q3FA 5JLJB 2MDXA 2BWES 2G4DB 4KHOA 1FOEA 4P7IA 1MAIA 1OQNA 2IFSA 3K9OB 1H8CA 4NPNA 2OOBB 3MTNB 3PTFC 1BWNA 3NSUA 3AU4A 2RUKB 5L81A 3JSVA 4B95A 3L08A 1C1YB 5HE0A 2CKHB 3IHPC 3D32A 3ML4A 4F7HA 1EVHA 2CHXA 3KUCB 3HHMA 1TBEA 4GDLA 5JZEB 4IUMB 2FUHB 2N9PC 1AWEA 2WX0A 5TR5A 4LCDE 3D8EA 1DYNA 3M3JA 4M8NA 4W9CA 2LUEA 5DIFB 1Q5WB 2GBNA 4HDOA 4KIKB 3APDA 3PG7A 3OANA 1AARA 4MDKE 4WWPA 2KZRA 4MGZE 4FJVB 3HW2B 3ML9A 3A8QA 1WGDA 2UZSA 3TVVA 5JHAA 5JHHA 2MLBA 1UH6A 2RR9A 3OJ3A 4BBNF 1SIFA 2FIDA 5C23A 2LZ6A 3NY5A 5DHAB 4Y94A 3R66C 2M14A 4PNKA 2L3ZA 2L1CA 3AULA 3L0WB 1XODA 2DZIA 1TJ6A 3L10B 4BKTA 3QQ8B 3EC8A 2Z59B 1V6EA 4HB3B 2ZPNA 2IO3B 4B6WA 2FCMA 4CHJA 1U2BA 2JPHA 2YSZA 5LXHA 3CSTA 2DYOA 1WGHA 2KJRA 5DHFB 1KZ7A 4GGQA 1WRDB 3M95A 5HE2A 4IOYX 4BFRA 4MH0E 4FLHA 1UPRA 2DKPA 2DYMA 1XD3B 3WYFB 5LLIA 2EMTA
chains in the Genus database with same CATH superfamily
1TS2A 2LVPA 1WJ6A 2FBWB 4EUTA 2XQNM 3DVGY 2LOZA 1WI1A 3ENEA 4OVZA 3VIAA 4PS3A 4CHMA 3TBLD 3DHHC 3DPDA 3H7SA 4HAUB 3WIMA 2RGNB 3M63B 2GBMA 2J59M 4F1SA 2QJLA 2JF5A 2BKRB 3TIXA 2KFKA 4OZCA 2CAYA 1P7FA 1ZW7A 2ICIA 3AH7A 4RCOA 1OTRB 1RLFA 3ZNHB 4MK0A 2RVBB 2BGFA 1C9FA 1WM2A 3B77A 2D11A 1I2HA 1CQVA 1DGJA 4G50A 1YN5A 4FA6A 3SUZA 1WGGA 3IT4B 3RPFC 1WJMA 3DDCB 2DHIA 3HIEA 1JWAD 2GBJA 3V60A 5MPOA 1UELA 4O1NA 1K5DB 3AN1A 3PRPB 2XK5B 2JXXA 1P3QU 3V05A 2NS5A 3NVYA 1C4AA 2D2QA 1QQRA 2DX5A 4L2YA 2QDFA 1L5PA 3HQCA 2O2VA 4W9HA 2KXJA 1UUPA 2DFKA 5AZFA 3B9JA 4S17A 2GCLA 2DAFA 3Q3JA 3SR6A 4KKJA 4IWPA 5EFXA 3A1QA 3RNCC 2WXQA 2N9LA 4OW0A 3GE8C 4QJ3B 2DKQA 1BMLC 4XWXA 1V5TA 3ZQ4A 1PGBA 2WXPA 4JWSC 4ANWA 2D9ZA 4XC2A 2DZJA 2YT2A 2ASQA 2CS4A 1WZ0A 2MBQA 1KLUD 2J7QB 4HRSA 1TS3A 2LULA 2I5CA 3PHXB 1WWTA 2KO3A 2MP2B 1T6BX 3BIID 1UEFA 1EWYC 5DI9B 3V5WA 3NS8A 2KNBA 2BCJA 4DHJD 3TEZA 4D6WA 1H4RA 3AV8A 3ZTCA 2KMCA 1H10A 4GPTB 2AX5A 4UDUC 1NVID 2WXIA 3AE5B 3O96A 2Y5BB 2RD0A 4K17A 4USAA 4RGOS 2LGYA 3A8PA 1UWXA 5D7GA 1X1GA 3RNGC 3GYPA 1XCQL 1IGCA 2KC2A 3VH4B 1MK7B 3AJ4A 4ZRPA 2RSUA 4MJSB 5C6RA 5EE1A 4RF1A 1V5MA 1PDXA 1ISNA 2DZKA 2K25A 4ZDVA 4WWNA 4NY0A 4XGAB 4YXDB 2FJUB 2VH1A 2DYBA 4FXCA 3QJZA 1ZE3D 2KT7A 2KN5A 2JT4B 4P1CC 4TKNA 4II3B 4DHJB 4ZRQA 3R7RA 2INPE 2K8HA 1QKZA 2Z4DA 2ZNVB 4YSYB 1BTNA 5AEKB 4MT5A 3V62A 1DBHA 3RN9C 3VUWA 3TCAA 3Q8CA 1TY2A 5G5GA 3VHTC 2P8VA 3ODWA 1EM7A 4OZAA 4LLGM 2EKEC 4KGSA 5J3YA 1WMHB 3SYXA 4A3PA 4DQOC 3LYYA 4BBKA 2LASA 4IW0A 1T0SC 2J52A 2JZZA 3SFDB 1KZGA 1GNUA 4GIVA 4NZLB 4I6NB 3CWIA 1XCGA 2PMVA 1C76A 3KYCD 2K3UA 5DPRA 1WFYA 4HROA 2W9NA 3C0RB 1QF6A 1I4GA 1MVKA 4L1RA 2ZJDA 1RFKA 1DDWA 5KHOA 1U29A 2DBYA 3DBSA 4FBJB 2HDEA 2P0FA 2X38A 3OLMD 2OJRA 2KTRB 2Y3AA 4WAAA 4PS8A 3P6AA 1V86A 1WX9A 4GLSC 3HVDA 2PTLA 1ZUD2 3U52E 3TO1A 1XLOA 2ROVA 2BVCA 4F7GA 2N23A 3N30A 2BWFA 1FGYA 2MH7A 3DWGC 1K50A 3QC8B 2QKLA 4RF0A 4WJNA 3P1MA 4L23A 4IOIE 1FXIA 4BKGA 1Q10A 2W3RA 4GDKB 3HVZA 1QOAA 4RGMA 3CIKA 1ZYIA 3DVNV 1BTKA 3DCGA 2RPVA 3W1YA 1SB3C 3URYA 1EF1A 4RGTA 1JALA 5HE3A 1E9MA 3RT3B 2BF8B 1UNRA 2J0KA 2P0HA 4ZRKA 3DBHB 2DAJA 3ML8A 1MIZB 1P0RA 5BYRA 1TT5B 4DBBA 2IGHA 1FRDA 1S3SG 3EFCA 3P4PB 2IYDB 1VD2A 2DYNA 1P9DU 1DOIA 1FM0D 2I1KA 3MHSD 5J17A 3PREA 1L0VB 3L54A 4A90A 4ZRIA 2KTFA 1SEBD 3U7ZA 2WWZA 4NSWA 2GBKA 2MJDA 2DHKA 1TIFA 2KKCA 2DENB 4OZBA 1F2RI 2VRRB 4NJ6A 1DYQA 3ODXA 1Z87A 1NYQA 4CSQA 2WXHA 3FVCA 1VJKA 1PGAA 5BMHA 4M8MA 4BKSA 3UF8A 4WURA 2JRHA 2O6VB 4DDID 1GG3A 2QEJC 4KIKA 2CODA 2FUG1 3T8MA 3MC0B 1UBQA 3FEHA 2LKOA 2N0YA 2MKRA 3IAM1 4A3OA 2L2IA 2IO1B 2D9XA 1YQ3B 3KW5B 1UNQA 1PQSA 2BTEA 2KN4A 3AEBB 3RZFA 1WE7A 3A9KB 4EZLA 2D3CA 2L0FA 4XYCA 2JYTA 4RMAA 4ARIA 1C77A 3BYTB 1ZXIA 4RGNA 2KHWB 2BW2A 3SDLC 3N32A 1MKEA 3EHVA 1J8CA 1FXTB 1FFVA 1EU4A 1MHXA 3C19A 1IRSA 1WXMA 5BYQA 2RMMA 2LRUA 2R2YA 2WQYB 2ZCBA 3RYTA 5AZGA 4B6HA 2V3SA 1FNWA 3N20C 3B2GA 5HI1A 1N61A 1V80A 1WR6E 2ADZA 1BXTA 2INDC 3ULCA 2KJ6A 4JX1C 5L95C 4HB2B 4CHKA 3ODOA 4PT5A 2Z59A 2V0GA 3TFMA 1GC7A 1RRBA 4C80A 1YJIA 4DWFA 2ZVOA 2YS3A 4KKIA 3KWLA 4W9JA 1AW7A 1EO6A 2BYFA 3Q8BA 4LDTD 4WH4A 3T3NA 1ZC4B 2EJ8A 4DHZE 3VOQA 2CU3A 3KQ4A 1NTYA 4BBNC 1LM8B 3SFEB 1TS5A 1P1AA 1GC6A 1FHOA 1QQGA 2YEPB 3VRAB 2ZPYA 3VDZA 3SEBA 1L6UA 1KJTA 1CJEA 1ZM0A 4FULA 3A9JB 2YF0A 1E8ZA 1JWBD 2QCZA 2X18A 1I4HA 1XEEA 1I35A 4HCPB 3PT2B 4REZA 3RULA 2MBHA 1SF0A 3NWDA 5HHDG 3JYUA 5IA7A 5CX3A 3KRXA 2EELA 1EUVB 4FJYA 1AWDA 1LW3A 4URKA 2GS0A 2W2XC 2KVRA 2ZEQA 3ZYYX 2VSZA 3ZVVA 1E10A 4IWOA 1RWSA 3VTWA 4MT7A 4QJ4B 2Z0OA 3PHWB 3OG5A 2NBUA 2L00B 3U4EG 3AB5A 5E6NA 3X23A 5G2NA 1WJUA 2KWVB 2K8BA 2XK5A 4JPSA 2W54A 2HTHB 1C4PA 2V1YA 4HPMB 3CIRB 3DBRB 1DOYA 1GUAB 2HD5B 2WXLA 4DXGA 2GOWA 3VTVA 2A5UA 1L2NA 1Y19B 3M1IB 3Q14C 1L0YB 2D9YA 3NVVA 1WE6A 4P6VF 2R2QA 2Z0EB 2DZMA 4XDCA 5KCVA 2Q5WD 2PEAA 2C5LC 3HM6X 4HAVB 1OEYA 1L6VA 1JWMD 2JRIB 2QILA 3KZ1A 5D3YA 3PV1A 3GZNB 5D94A 1YD8U 3T3OA 2BB6A 3FSSA 2KGXB 4JLCA 2MP2A 3VUXA 3WAPA 1E7PB 3Q2AC 1YJ1A 2ZZPB 3W1SC 2KIGA 4WSFA 1N60A 1WJ1A 2GJYA 3QAQA 3RI7C 4HWIB 4KX6B 2MCNB 3UI3A 4A6FB 3AMZA 2LJ5A 4S0RA 4GOCA 2DTCA 4KHBB 1YX5B 4W9GA 4EE2A 2PPHA 1WXQA 1QOGA 5H8YE 4HKZE 4CO7A 1KI1B 2IO2B 3B08A 4OHJA 3KY9A 1MIXA 1ZC3B 1OQRA 3R2TA 4N9F4 4Z2NA 2M56B 4W9LA 4WJPA 1RM6C 3TW1A 2YLMA 1AN8A 1FHXA 3BVGA 2QC8A 1QC6A 3J9CA 4DXAB 3HIZA 3NHEB 2MFQA 3GOEA 1V2YA 4MJSA 4W9FA 1N62A 3N9YC 4MSQB 2KACA 3TJPA 4JE3B 2C7HA 1FHWA 2I38A 5TSSA 3LDZE 4GN1A 3A98B 3QIJA 3PSCA 3IVFA 3RNEC 1SHCA 1J0WA 2N4FA 4B0MA 4HPLB 3CSFA 2CRFA 4F7UP 1XD4A 5D2MB 2FNJB 2KR0A 2MEKA 2IZVB 4PQ0A 2L05A 2RDGA 2V4IB 2D9VA 1WMHA 2G4SA 2R2OA 3I5JC 1XF5L 2FIFA 3AEDB 2P0DA 4HDQA 2D5GA 5EDSA 2LXAA 4FADA 4YT0B 4BOSC 2BYEA 4TQ1A 2JVCA 5CHVC 1GPXA 1IUEA 1WM3A 1EGXA 4K7SA 2IY0B 5D6JB 1R4MB 2Y7BA 2MJEA 1MK9B 3EA6A 2LHDA 1YN3A 1WX7A 1XQQA 3EGRA 2V76A 3RUIB 5M4YB 2K6QA 1BAKA 4EFOA 3QWZB 4J6IA 1FPYA 1I4QA 1KLVA 5CTRC 5J3QA 3QBVB 2KTRA 5HKHA 3O65B 3ZNGC 1WGYA 2FCQA 3ZVRA 2ROZB 1TKEA 3OJ4B 2VZKD 4NJCA 5DCNA 3P42A 2N9XA 4C4VB 3AEAB 1CMXB 2AL6A 3GB1A 3NZ3A 2RNRB 3UINB 2GBRA 4DIXA 4GDKA 3KUZA 1T0RC 2K8EA 1FRRA 2WS3B 2M8SA 3P4SB 4US9A 2SAKA 1JW9D 2N9EB 3LJ3A 3DHIC 4A6KA 3RZWC 2KLCA 4AOFA 2LXCA 2IGDA 2KX0A 4PS7A 1J7CA 2VH2A 1IPGA 3HUIA 3L17A 4IKGA 2SEBD 4A9AA 3PRZA 3QX1A 4WWMA 5IN7A 1P5TA 2BBCA 3RCZA 3FC4A 3ZLZA 2LYDA 3FILB 4G3XB 2UYZB 2H88B 3H1UA 3TUOA 3AEGB 4M02A 3ZJVA 3QA8A 4Q2JA 2KYWA 3BVZA 4RNAA 2AQ2B 3V6CB 3WAMA 2MX2A 2KDMA 3H6NA 2VZKB 2DA0A 4ITKA 2RRFA 3TMPB 3H9DA 2LVQA 3OAWA 1J7BA 4P1BC 4QXAB 1V9JA 1TJEA 4HPPA 2WU2B 1YQBA 2R0DA 3AECB 2JP2A 3DBHI 2NTTA 4BZAA 5JH5C 2ELBA 2MWNB 3Q8FA 4AUQC 1N5WA 2NMQA 2JWUA 1WF9A 1M4VA 2Y8GA 2O6VA 1JWUD 3AE2B 4AQ7A 5EE0A 4R3DA 3RNFC 1RJ2A 1IYFA 1V89A 2KLGA 3DBLB 1XX0A 4OT1A 5GOWB 2WXMA 3F0WA 1C79A 3QCAA 5LONB 2V3NA 3ETRA 1C78A 4YONA 4RH6A 2CJOA 2JWZA 3NZUA 1S1QB 4IDIA 2D3GA 3A9KA 5EE3A 1I7AA 2YS5A 1UZXB 2K2JA 4IM2A 1SSNA 4DX90 2RSGA 1F0ZA 4DX8A 2KD0A 3O13A 1E7VA 1HQRD 3MPXA 1KTKA 3Q3OC 3VH3B 4FN2A 4KDLB 4BOZB 3UIPB 3DXDA 5G55A 3VXWA 3RNAC 2WU5B 3ZRCA 1WX8A 2VRWB 2LMCA 2Y8FA 5BYSA 1LFDA 2KK8A 5J2RA 2IPKD 1WXVA 2KJHB 5GMVA 4LNNA 1WGRA 2BT6A 1J7AA 4DBGA 3DOWA 3LJUX 1XT9B 1ZXHA 2NMBA 3D8DA 5JXVA 3TEXA 2CY4A 3Q8EA 5DPWA 4EMOA 1Z2MA 4LK0M 4ANVA 3AI5A 2M38A 1R4NB 3IAS1 2MRPA 1PFDA 2BPSA 2BYVE 2QKMA 1FGZA 4IM3A 2CY5A 2OEDA 2KDIA 3B1LX 1WSPA 4K81A 1ACCA 4ANUA 2FCSA 4IWQA 5FK9C 4W9IA 1OFFA 1OEYJ 3PZ8A 4AP4C 4DXFA 4AJYB 2KVZA 4C00A 4HAXB 3L13A 3NJTA 1X1FA 2A4ZA 1UNSA 2PIAA 2IDYA 2M4NA 3I57A 2WX1A 1T0QC 3AEFB 4II2B 3A58A 3VR9B 2I5FA 2K6DB 4MEMA 5I2SA 2W2XD 5I2MA 3A9JA 2R09A 1T77A 2QSDA 2J4XA 4HAZB 3PVUA 4GB9A 1K52A 1DDVA 1XLNA 3G9WA 3BK1A 2DHZA 3PP2A 2JSVX 4ACFA 4XWTA 1D6EC 4KHAA 4TMAB 4WVFB 3QHTA 4EZJA 3ZDMC 3T06A 2M17A 2EKIA 3KSYA 1ZDXA 1L4DB 5EE9A 1WH3A 5BMIA 2H7DA 4MGKE 2AYOB 1GAQB 1WRIA 4PYUA 2G9HD 2L32A 1M7EA 1Q67A 2MW5A 1X11A 4HLEA 2JU6X 2K5PA 5LXIB 3I3TB 4PYZA 4A55A 4LNOA 1N3HA 1WY8A 2WXNA 2N9KA 2LVOA 4HB0B 2NVUI 2YRYA 3EUB2 4NNJB 3R7QA 2H7EA 1ZSQA 3QARA 4HXDA 4LTUA 1HZ5A 2HTHA 3KUDB 4WAFA 2REXA 2JXTA 1F9JA 1NDDA 2DLBA 2QHOA 1IBXB 1WGUA 4K3BA 1W1HA 2BS2B 1V1PB 5FI0A 1TKYA 3AE1B 1RFAA 1QZEA 2LRWA 3B0AA 2WHIA 4NAWB 1A70A 2KQ4X 2RLOA 1KM7A 2V3PA 1WIAA 3S2AA 1UD7A 1NI3A 1NYRA 5KQ1A 4HCNB 1YOVB 5D3VA 4JIOU 2LJIA 1TTNA 2XBBC 3DBRI 4E71A 5AUIA 1G6JA 1T0YA 4K2PA 4GMVA 2JX5A 2PE9A 2CJNA 2IBIB 3H7PB 1MI0A 2MBBB 4M0WB 1D5MC 4YSXB 1VR9A 1WYWB 1YQ4B 1E6EB 3NOBA 4NQKE 3EECA 4A6FA 1VZ7A 1HTQA 4DK5A 4KHBA 4LJOB 2E2XA 4RFBA 1UWMA 2JY6A 3SO6A 1SIJA 2ACZB 3FKYA 2YVCA 2EC1A 1J19A 3BVMA 2NZ8B 2KOXA 1TKGA 1D3ZA 3L4PA 4H8SA 1E8YA 3GZNI 1P98A 2Z0DB 4K7UA 3MC8A 2MSED 2DLWA 2AWTA 2TSSA 3JW0X 4KSLC 3PS6A 5IRSA 2M19A 1SJHD 2ELAA 4DDGD 3ZNZB 1I4RA 1WI0A 2KC1A 2K49A 2CR5A 3W2DA 3X0WA 1VLBA 1E8XA 4LJPB 1N6ZA 3NUHB 3BINA 4JQWC 3NZSA 1VRAB 4F7ZA 4MACA 3FAHA 3V61A 1PYWD 4RM8A 1KH0A 3APFA 2CHWA 4C56C 1I4PA 3ZUNA 2X8XX 2OTXA 4M00A 3U7DA 1HEZE 1TQZA 3RNBC 3PZDA 5KHQA 1ZGUB 5C3JB 3IFWB 5D27A 3WCQA 3NWAA 5I4DA 4ASWC 3PRMB 3RFZB 5JHGA 1MI1A 2J42A 2WYQA 3RD2A 3ZO5B 1D5ZC 5BMGA 3NG0A 1NTVA 4LNFA 2DNFA 3BWUD 1K53A 1P3RA 1YMHE 2LGXA 1UNPA 1QOBA 3K9PB 3MJ5A 3Q69A 1P7EA 2C7NB 3N7CA 2EMSA 1V49A 1JMLA 2QMTA 1L7YA 2FCNA 1I4XA 4LNKA 1P6SA 3ZJTA 2PJHA 2LI5A 2GUMA 2AL3A 2DHJA 2COAA 3P4RB 4L1BA 2AEHA 2WLBA 3ULBA 2K1FA 4LDTB 4BKSD 3W5UB 3FM8C 4WQMA 1TXDA 1DROA 2KDEB 4HATB 3NWFA 4QJ5B 2MBEA 2KX3A 2WGSA 3SU8X 4N6EB 1YX6B 3ZDTA 2HJ8A 5HFYA 4AJWA 2BKFA 3GYOA 2NPTB 4B0EA 1V88A 2D4QA 1ZDVA 4C4VA 1QT9A 4WJOA 4ZHOA 5C5BB 1GOZA 2M0XA 4IG7B 4GMXB 1R4MI 2Q13A 1E7UA 1X05A 4KSKC 1PLSA 4W9EA 2Z0QA 1U5GA 1XR0B 3APCA 1FB8A 1K5GB 3MDBC 4CYEA 4K2OA 4ZOHC 1LB1A 4GOUA 1U27A 2L0TA 3UIOB 2KUPA 2KANA 1RYJA 2PVOD 4E3CA 2N1VA 3PGEA 4MGIE 3DXEA 3KWVA 1LQBA 1VDVA 1Z5SB 2Z8LA 1FCLA 4G11A 2L52A 2BYTA 1MG4A 1WR1A 3FILA 2XEWA 2COCA 2LOXA 2KWUB 3A4SC 1J0GA 4HJGE 2MQJA 2L8JA 2IGGA 3H8HA 1XLPA 3ZXVA 1KLGD 1B1ZA 3GS2A 1OY2A 3TSSA 1NBFC 3AE3B 1WZ3A 3Q6BA 5IP4D 2MWSB 2ONQA 4KAXB 2V4LA 4HKQA 4PK1A 1VZ8A 4JL9A 1EWCA 3U30A 3VQIA 5DPSA 3DQVA 1EAZA 2D3BA 4MSMB 3BY4B 2NBVB 2HTME 3I63C 5T8IA 2M1MA 2K22A 2KWCA 2RPQA 2FAZA 1RRPB 5AZHA 1TY0A 4A6QA 2VKIA 3NRZA 1HA5A 4FHJA 1V5PA 5FKAC 5C16A 4GXBA 3ZRFA 1YIWA 3ABVB 3L16A 3NS1A 3F5RA 1GJZA 4MM3B 4ANXA 1M7RA 1E5WA 3R3MA 1W1DA 4N59A 4G0NB 1LXDA 4W9KA 2KWDA 5LNK1 1Y5OA 3KYDD 4OVUA 4D0NB 4ICVA 2IJ0A 4WQOB 4KGTA 3PEGA 1U5DA 1SGHA 4A5KA 1L0XB 2YT1A 2INNE 2KAJA 3DBLI 3MHZA 1F2RC 3SHQA 5JHBA 2D07B 3AU5A 3VFKA 1RAXA 2INCC 4XWWA 3VVWB 2WXKA 2Y5CA 1NEKB 3UZTA 1M94A 3AE8B 3WA0A 1OMWA 3V6EB 2W55A 2ZW0A 3CF6E 4GU2A 4TYZA 5E6PA 2LEKA 3WALA 3P7ZA 2ZVNA 2PE6B 3NVWA 3U12A 2J0JA 3PPAA 1ZVRA 4A20A 1JQ4A 3HK0A 2IO0B 3JSVB 1IP9A 3KH0A 5FR3A 4HAYB 1FEHA 4J3OD 2W82A 5H92C 3P2BA 2N0SB 2NR2A 1WVHA 3ZNID 4LNIA 2GB1A 3N1ZC 3DHGC 2PVGC 5LOPB 4GDLB 5AUKA 4HK2A 5HE1A 1HZ6A 1I7HA 3MFGA 4KV2A 2GLSA 5LG4B 2DX1A 3VR8B 1JROA 2N1WA 2C7MB 1R4NI 3D8FA 2OQBA 2MA9B 5JP4A 1HXYD 4IM0A 1BT0A 1Y8RC 4Z2MB 1FAOA 1WJNA 2KDFB 2WXFA 3A33B 2Z0PA 4ZHPA 1TGZB 3BYYB 1MJDA 2C60A 2LG1A 2CHZA 2HE7A 1LGRA 2K39A 1D4BA 4KZ0A 1UGMA 1GB4A 4HB4B 1MG8A 3BJIA 5CLLB 3PSEB 3M62B 1EF5A 1PMSA 3P4QB 1X86A 1V97A 4C0AA 1DDMA 2YEPF 1QILA 4MGYE 1SBBB 3OWEB 4ICUA 2LGDA 2AQ1B 5IOIA 2PLPA 1MPHA 4I6LB 3UQBA 4M01A 2RGFA 1FMAD 4XZ4A 2D3AA 4F8CB 2PZ1A 1IBXA 2JZ3B 1OQQA 4HAWB 4L6EA 1V1PA 5CLQB 4EEWA 3ZKJC 4H2AA 3SNHA 4US8A 1MFWA 4NAWA 3ZTDA 4EJNA 3GP7A 3ZJUA 4GSWA 2LGSA 1AYFA 2NCNA 3C8YA 3IG3A 1JRUA 3PVWA 2GCJA 5L83A 2V9HA 4HHVA 2I1JA 2WXRA 1VCBA 1XLQA 4EZKA 2NTSA 1YJJA 1U4AA 4ZYSA 2M0AA 4WJQA 1YN4A 2MJ3A 2R61A 5J18A 3H7PA 4MELA 2L7RA 4E74A 5IKCM 4M0WA 4YSZB 4HSIA 3N1YC 4MH8A 2J0MA 5E6OA 2WDQB 1V5UA 3SV1A 4MY6A 1E8WA 4KDIC 3ECIA 1U5EA 3RCPA 4NAMA 5D3DA 2G3QB 1WGQA 2B76B 4GZUA 4NQLB 1YNTE 4K7WA 3P63A 3VTUA 1SE3A 2K2UA 3VAWA 1V1OA 2JQRB 3W1SA 3R2IA 3N3KB 1UPQA 1CK1A 5C79A 4TUUA 1U5FA 2D9WA 4N58A 2W3SA 2WDTB 3KVFB 1MHHE 2GMIC 3DCXA 1TS4A 5FR6A 1ROEA 4YTNB 2KFKB 3QK0A 4ZRJA 4FJZA 4KVGB 1EU3A 2H89B 1KFYB 1AQCA 1OQYA 2FE8A 2BQQA 5CHFA 3V3XA 1R7SA 2B3AA 1V5OA 1B55A 2KQSA 2K8CA 1ZKHA 1F1HA 2MBOA 3NVZA 1DOXA 3ZIMA 2DWQA 1C4CA 2CU1A 2RDHA 1UBIA 1I42A 3MP9A 5FI1A 2DYQA 4JGHB 3TL5A 4XX5A 1UGJA 1FNVA 2KCJA 3PLVA 1IGDA 2DX5B 4A6HA 1Q1OA 2COFA 2JUOA 2O2VB 1QOFA 1WG7A 3E56A 4IFSA 1Q0WB 2WDVB 2N7DA 4YL8A 2WNMA 3A1QB 3ALBA 2UVMA 2BS3B 3WAOA 2G35A 1WXSA 4RM9A 4AWJA 4P16A 1ET9A 1HE8A 3RMKC 1SXTA 1SJED 1STEA 2O6VD 2GI9A 3AE9B 1SE2A 4K3CA 3I9V1 2K00A 4HJKA 2JZPA 3CMMB 3BK2A 1JRPA 1V81A 3ZGZA 2C9WB 2UZRA 3AE7B 2L1AA 1XXGA 2FJLA 3ONSA 2NPTA 3VRBB 3IT6B 2OHFA 1FD6A 1SE9A 2E3TA 1ZPSA 2E6XA 5C5BA 3PO0A 1WJ4A 1NU2A 4NJ7A 1V61A 3HSAA 3A4RA 1X1MA 4X57B 2L76A 2UWQA 4BVUC 3E9SA 3JVZX 1XO3A 3MJWA 5HG2A 5KQ4A 2IY1B 1XCTL 3OHMB 3WANA 2N7EA 2KMAA 2W2WA 2KDBA 2LD9A 4IC7B 3ZXRA 1TYGB 1FFUA 4W9DA 4WJ7A 1NI2A 5DPTA 4OVVA 2DN6A 3LXFA 3CXBB 3KLSX 4A8XC 2ON8A 2K9XA 2ZNVC 1PFJA 1T5XD 4WWOA 3PLUA 1N63A 5J3TA 2D10A 2G45B 5E6JA 3LB8C 1UF0A 3GE3C 2NBWB 3PVLA 1FO4A 3IXSA 3DXCA 1N5XA 5D3XA 3HM3A 3UGBB 2UU7A 3IBEA 1HTOA 4B9KA 1A5RA 2RDBC 5C1ZA 4DHZB 1WXAA 1W1GA 2QIEB 3Q3NC 2BB5A 3UQAA 2BS4B 5CHWA 5D3WA 4FHKA 2NBVA 1JWSD 4EKUA 3BZDB 2IYBA 1JCKB 1NENB 1ESFA 3AXCA 1D5XC 4ZYNA 2YS1A 1K8RB 2PW9A 1C3TA 1PUTA 1VZ6A 3TEYA 2WXOA 4TSSA 3T9LA 2J53A 2YT0A 1TZ1A 1OGWA 4KGRA 4HVBA 1FNUA 1XKEA 3ZW3A 3Q3MC 4K1RB 3DVGX 3VUYA 4MM3A 4EOYA 2KQ7A 5IAAC 4KZCA 3W9CB 3U8ZA 4TV3A 3DVNU 2ZCCA 1K51A 3SD5A 3EFUA 5IO9A 1FIQA 5DH9B 2PKOA 3QWMA 1E90A 4IAPA 4GNKB 4OSNA 1SE4A 4TQ0A 1KRHA 3MC9A 2KFJA 4C7ZA 2LWPA 2N7JA 4I6PA 1T3QA 5BO4B 3KRWA 4ARCA 1F52A 4WIPA 1ENFA 1KOTA 2K0PA 3Q3FA 5JLJB 1ZOYB 2MDXA 2BWES 2G4DB 4KHOA 1Y56A 1FOEA 4P7IA 5D3IB 1MAIA 1OQNA 1F77A 2IFSA 3K9OB 1H8CA 4NPNA 2OOBB 2Z14A 3MTNB 3PTFC 1BWNA 3NSUA 3AU4A 2RUKB 5L81A 3JSVA 4B95A 4HEA1 2OJWA 3L08A 1C1YB 5HE0A 2CKHB 2I2YA 2MHJA 5GXGB 3IHPC 3D32A 3ML4A 4F7HA 1EVHA 5G5HA 2CHXA 3KUCB 2L83A 1WGKA 1E0ZA 3HHMA 1TBEA 4GDLA 5C2TB 5JZEB 1LO5D 4IUMB 2G1EA 4YWGG 2WP9B 2FUHB 2N9PC 1AWEA 2WX0A 2LGIA 2JYEA 4C7YA 5TR5A 4LCDE 3D8EA 1DYNA 3M3JA 4M8NA 1TZOA 2LFIA 4W9CA 2LUEA 5DIFB 1Q5WB 2WXJA 3DWMA 1CZPA 2Z13A 3AEEB 2GBNA 2WDRB 1PGXA 4HDOA 4KIKB 3APDA 3PG7A 3OANA 1AARA 1V8CA 4MDKE 3R8BA 1KF6B 4WWPA 2KUQA 2KZRA 3AE6B 1FXAA 3AE4B 4MGZE 4FJVB 4AS1A 3B2FA 3HW2B 3ML9A 4YTPB 1BUIC 3A8QA 1WGDA 2UZSA 3TVVA 5JHAA 5JHHA 2GRIA 4YTMB 1GB1A 3PZ7A 1WYGA 2MLBA 3U2SC 4CQNA 1UH6A 4BAXA 2RR9A 3OJ3A 4JWUC 4XE0A 2KMMA 4BBNF 1SIFA 2FIDA 5C23A 1FCCC 2LZ6A 1B9RA 2Y5PA 3NY5A 5DHAB 4Y94A 3R66C 2M14A 2AQ3B 3N1XC 1ZP0B 3Q8AA 4PNKA 2L3ZA 2XNAC 2L1CA 2XN9C 3AULA 3L0WB 1ET6A 1XODA 1QLBB 1MPEA 3HRDD 2DZIA 3W5VB 1TJ6A 4D2KA 3L10B 2LUMA 4BKTA 3QQ8B 4XDDA 3EC8A 2Z59B 3TEWA 1V6EA 4HB3B 2ZPNA 2IO3B 4B6WA 3AM9A 2KIEA 2FCMA 4CHJA 2HJ1A 1U2BA 2LHEA 2JPHA 2YSZA 5LXHA 3CSTA 2DYOA 1WGHA 2KJRA 1L4ZB 2WXGA 5DHFB 4QAYA 1KZ7A 4GGQA 1WRDB 3M95A 5HE2A 2ZW1A 4IOYX 4BFRA 4MH0E 4FLHA 1UPRA 2DKPA 2DYMA 1XD3B 2ZKMX 3WYFB 5LLIA 2EMTA 3NW8A
chains in the Genus database with same CATH topology
2LVPA 1WJ6A 4EUTA 2XQNM 3DVGY 2LOZA 1WI1A 3ENEA 3VIAA 4PS3A 4CHMA 3TBLD 3DPDA 3H7SA 4HAUB 3WIMA 2RGNB 3M63B 2GBMA 2J59M 4F1SA 2JF5A 2BKRB 3TIXA 2KFKA 2CAYA 1ZW7A 1OTRB 1RLFA 3ZNHB 4MK0A 2RVBB 2BGFA 1WM2A 2D11A 1I2HA 4G50A 4FA6A 3SUZA 1WGGA 1WJMA 3DDCB 2DHIA 2GBJA 3V60A 1UELA 1K5DB 3PRPB 2XK5B 2JXXA 1P3QU 2NS5A 2D2QA 2DX5A 3HQCA 2O2VA 4W9HA 2KXJA 2DFKA 5AZFA 2GCLA 2DAFA 3Q3JA 4IWPA 5EFXA 3A1QA 2DKQA 1V5TA 4XWXA 4ANWA 2D9ZA 4XC2A 2DZJA 2ASQA 2CS4A 1WZ0A 2MBQA 2J7QB 2LULA 2I5CA 3PHXB 2KO3A 2MP2B 1UEFA 5DI9B 3V5WA 3NS8A 2KNBA 2BCJA 4DHJD 1H4RA 3ZTCA 2KMCA 1H10A 4GPTB 3O96A 2Y5BB 2RD0A 4K17A 2LGYA 3A8PA 5D7GA 1X1GA 3GYPA 2KC2A 3VH4B 1MK7B 3AJ4A 2RSUA 4MJSB 5C6RA 1V5MA 1ISNA 2DZKA 2K25A 4ZDVA 4WWNA 4NY0A 2DYBA 3QJZA 2KN5A 2JT4B 4TKNA 4II3B 4DHJB 3R7RA 2K8HA 2ZNVB 1BTNA 5AEKB 3V62A 1DBHA 3VUWA 3TCAA 3VHTC 2P8VA 3ODWA 2EKEC 5J3YA 1WMHB 3SYXA 4A3PA 4BBKA 2LASA 4IW0A 2JZZA 1KZGA 1GNUA 4GIVA 4I6NB 1XCGA 3KYCD 5DPRA 1WFYA 2W9NA 3C0RB 2ZJDA 1DDWA 5KHOA 1U29A 3DBSA 4FBJB 2P0FA 3OLMD 2OJRA 2KTRB 4WAAA 4PS8A 3P6AA 1V86A 1WX9A 3TO1A 2ROVA 4F7GA 2N23A 3N30A 2BWFA 1FGYA 3QC8B 2QKLA 4WJNA 4BKGA 4GDKB 3CIKA 3DVNV 1BTKA 3DCGA 3W1YA 1EF1A 5HE3A 3RT3B 2BF8B 1UNRA 2J0KA 2P0HA 4ZRKA 3ML8A 2DAJA 1MIZB 1P0RA 4DBBA 1S3SG 2IYDB 1VD2A 2DYNA 1P9DU 2I1KA 3MHSD 5J17A 3PREA 3L54A 4ZRIA 2KTFA 2WWZA 4NSWA 2GBKA 2DHKA 2KKCA 2DENB 2VRRB 4NJ6A 3ODXA 1Z87A 4M8MA 4BKSA 3UF8A 2JRHA 2O6VB 4DDID 1GG3A 4KIKA 3T8MA 2CODA 1UBQA 3FEHA 2LKOA 2N0YA 2MKRA 4A3OA 2L2IA 2IO1B 2D9XA 3KW5B 1UNQA 1PQSA 3RZFA 1WE7A 3A9KB 4EZLA 2L0FA 4RMAA 2KHWB 3SDLC 3N32A 1MKEA 3EHVA 1J8CA 1FXTB 1IRSA 1WXMA 2LRUA 2ZCBA 3RYTA 5AZGA 4B6HA 2V3SA 1V80A 1WR6E 2ADZA 3ULCA 2KJ6A 5L95C 4HB2B 4CHKA 3ODOA 3TFMA 1GC7A 1RRBA 4DWFA 2ZVOA 2YS3A 4W9JA 1EO6A 2BYFA 4LDTD 1ZC4B 2EJ8A 4DHZE 3VOQA 1NTYA 4BBNC 1LM8B 1P1AA 1GC6A 1FHOA 1QQGA 2ZPYA 3VDZA 1KJTA 1ZM0A 4FULA 3A9JB 2YF0A 1E8ZA 2X18A 1I35A 4HCPB 3PT2B 3RULA 2MBHA 3JYUA 5IA7A 5CX3A 3KRXA 4FJYA 1EUVB 1LW3A 4URKA 2GS0A 2W2XC 2KVRA 2ZEQA 2VSZA 3ZVVA 4IWOA 3VTWA 4MT7A 2Z0OA 3PHWB 2NBUA 2L00B 5E6NA 3X23A 5G2NA 1WJUA 2KWVB 2K8BA 2XK5A 2HTHB 2V1YA 4HPMB 1GUAB 2HD5B 2GOWA 3VTVA 2A5UA 1L2NA 1Y19B 3M1IB 2D9YA 1WE6A 2R2QA 2Z0EB 2DZMA 5KCVA 2PEAA 2C5LC 3HM6X 4HAVB 1OEYA 2JRIB 3KZ1A 5D3YA 3PV1A 5D94A 1YD8U 3FSSA 2KGXB 4JLCA 2MP2A 3VUXA 3WAPA 1YJ1A 2ZZPB 3W1SC 4WSFA 1WJ1A 2GJYA 3QAQA 4HWIB 2MCNB 4A6FB 2LJ5A 4GOCA 2DTCA 4KHBB 1YX5B 4W9GA 2PPHA 4CO7A 1KI1B 2IO2B 3B08A 3KY9A 1MIXA 1ZC3B 4N9F4 4Z2NA 4W9LA 4WJPA 3TW1A 2YLMA 1FHXA 1QC6A 4DXAB 3HIZA 3NHEB 2MFQA 3GOEA 1V2YA 4MJSA 4W9FA 4MSQB 3TJPA 2C7HA 1FHWA 3LDZE 4GN1A 3A98B 3QIJA 3PSCA 3IVFA 1SHCA 1J0WA 2N4FA 4HPLB 3CSFA 2CRFA 4F7UP 1XD4A 5D2MB 2FNJB 2IZVB 4PQ0A 2L05A 2D9VA 1WMHA 2G4SA 2R2OA 2FIFA 2P0DA 4HDQA 5EDSA 2LXAA 4FADA 4BOSC 2BYEA 4TQ1A 2JVCA 5CHVC 1WM3A 1EGXA 4K7SA 2IY0B 5D6JB 2Y7BA 1MK9B 1WX7A 1XQQA 2V76A 3RUIB 2K6QA 1BAKA 4EFOA 3QWZB 4J6IA 1KLVA 5CTRC 5J3QA 3QBVB 2KTRA 5HKHA 3O65B 3ZNGC 1WGYA 2FCQA 3ZVRA 2ROZB 3OJ4B 5DCNA 2N9XA 1CMXB 2AL6A 2RNRB 3UINB 2GBRA 4GDKA 3KUZA 2M8SA 2N9EB 3LJ3A 4A6KA 3RZWC 2KLCA 4AOFA 2LXCA 4PS7A 2KX0A 1IPGA 3L17A 3PRZA 3QX1A 1P5TA 3RCZA 3ZLZA 2LYDA 4G3XB 2UYZB 3H1UA 3QA8A 3V6CB 3WAMA 2MX2A 3H6NA 2DA0A 3TMPB 3H9DA 2LVQA 3OAWA 1V9JA 1YQBA 2R0DA 2JP2A 3DBHI 5JH5C 2ELBA 2MWNB 4AUQC 1WF9A 2Y8GA 2O6VA 1RJ2A 1IYFA 1V89A 2KLGA 1XX0A 5GOWB 3F0WA 3QCAA 5LONB 4YONA 2JWZA 3NZUA 1S1QB 2D3GA 3A9KA 1I7AA 2YS5A 1UZXB 2K2JA 4IM2A 4DX90 2RSGA 4DX8A 2KD0A 1E7VA 3MPXA 3VH3B 4FN2A 4KDLB 4BOZB 3UIPB 3DXDA 5G55A 3VXWA 3ZRCA 1WX8A 2VRWB 2Y8FA 1LFDA 2KK8A 5J2RA 1WXVA 2KJHB 5GMVA 1WGRA 4DBGA 3DOWA 3LJUX 1XT9B 2NMBA 3D8DA 2CY4A 5DPWA 4EMOA 1Z2MA 4ANVA 3AI5A 2M38A 2MRPA 2BPSA 2BYVE 2QKMA 1FGZA 4IM3A 2CY5A 2KDIA 3B1LX 4K81A 4ANUA 2FCSA 4IWQA 4W9IA 1OEYJ 4AP4C 4AJYB 4HAXB 3L13A 1X1FA 2A4ZA 2M4NA 2WX1A 4II2B 2I5FA 2K6DB 4MEMA 2W2XD 3A9JA 2R09A 4HAZB 4GB9A 3PVUA 1DDVA 3G9WA 2DHZA 3PP2A 4KHAA 4WVFB 3QHTA 4EZJA 3ZDMC 3T06A 2M17A 3KSYA 1WH3A 2H7DA 4MGKE 2AYOB 4PYUA 1M7EA 1Q67A 2MW5A 1X11A 4HLEA 5LXIB 3I3TB 4PYZA 1N3HA 1WY8A 2LVOA 4HB0B 2NVUI 3R7QA 2YRYA 4NNJB 2H7EA 1ZSQA 3QARA 4HXDA 2HTHA 3KUDB 2REXA 1F9JA 1NDDA 2QHOA 1WGUA 1W1HA 5FI0A 1RFAA 1QZEA 2LRWA 3B0AA 4NAWB 2RLOA 1KM7A 3S2AA 1WIAA 1UD7A 5KQ1A 4HCNB 5D3VA 4JIOU 1TTNA 2XBBC 3DBRI 4E71A 1G6JA 1T0YA 4K2PA 4GMVA 2PE9A 2IBIB 3H7PB 2MBBB 4M0WB 1WYWB 3NOBA 4NQKE 3EECA 4A6FA 4DK5A 4LJOB 2E2XA 2JY6A 3SO6A 2YVCA 2EC1A 1J19A 2NZ8B 2KOXA 1D3ZA 4H8SA 1E8YA 3GZNI 1P98A 2Z0DB 4K7UA 2MSED 2DLWA 2AWTA 3JW0X 4KSLC 3PS6A 4DDGD 2ELAA 3ZNZB 1WI0A 2KC1A 3X0WA 2CR5A 1E8XA 4LJPB 3BINA 4JQWC 3NZSA 4F7ZA 3V61A 4RM8A 3APFA 2CHWA 3ZUNA 2OTXA 3U7DA 1TQZA 5KHQA 3PZDA 1ZGUB 3IFWB 5D27A 4ASWC 3PRMB 5JHGA 2WYQA 3RD2A 3ZO5B 1NTVA 1P3RA 2LGXA 1UNPA 3K9PB 2C7NB 3N7CA 2EMSA 1V49A 1L7YA 2FCNA 1P6SA 2PJHA 2LI5A 2AL3A 2DHJA 2COAA 2AEHA 3ULBA 2K1FA 4LDTB 4BKSD 3FM8C 1TXDA 1DROA 2KDEB 4HATB 2MBEA 2KX3A 3SU8X 1YX6B 3ZDTA 2HJ8A 4AJWA 2BKFA 3GYOA 2NPTB 1V88A 2D4QA 4WJOA 5C5BB 2M0XA 4IG7B 4GMXB 1R4MI 2Q13A 1E7UA 1X05A 4KSKC 1PLSA 4W9EA 2Z0QA 1U5GA 1XR0B 3APCA 1FB8A 1K5GB 3MDBC 4CYEA 4K2OA 1LB1A 1U27A 2L0TA 3UIOB 2KUPA 2KANA 4E3CA 2N1VA 3PGEA 4MGIE 3DXEA 1LQBA 1Z5SB 4G11A 1WR1A 2XEWA 2COCA 2LOXA 2KWUB 3A4SC 1J0GA 2MQJA 2L8JA 1OY2A 1NBFC 1WZ3A 2MWSB 4KAXB 2V4LA 4JL9A 3U30A 3VQIA 5DPSA 3DQVA 1EAZA 4MSMB 3BY4B 2NBVB 2M1MA 2KWCA 2RPQA 2FAZA 1RRPB 5AZHA 2VKIA 4FHJA 1V5PA 5C16A 4GXBA 3ZRFA 1YIWA 3L16A 3F5RA 1GJZA 4ANXA 1M7RA 1E5WA 3R3MA 1W1DA 4G0NB 1LXDA 4W9KA 1Y5OA 3KYDD 4OVUA 4D0NB 4ICVA 4WQOB 3PEGA 1U5DA 1SGHA 4A5KA 2YT1A 3DBLI 3SHQA 5JHBA 2D07B 3AU5A 3VFKA 1RAXA 3VVWB 3UZTA 1M94A 3WA0A 1OMWA 3V6EB 3CF6E 4GU2A 4TYZA 5E6PA 3WALA 3P7ZA 2ZVNA 2PE6B 2J0JA 3PPAA 1ZVRA 4A20A 3HK0A 2IO0B 3JSVB 1IP9A 3KH0A 4HAYB 3P2BA 2NR2A 1WVHA 3ZNID 5LOPB 4GDLB 4HK2A 5HE1A 4KV2A 2DX1A 2N1WA 2C7MB 1R4NI 3D8FA 2OQBA 2MA9B 5JP4A 4IM0A 1BT0A 1Y8RC 4Z2MB 1FAOA 1WJNA 2KDFB 3A33B 2Z0PA 1TGZB 2C60A 2LG1A 2CHZA 2HE7A 2K39A 4KZ0A 1UGMA 4HB4B 1MG8A 3BJIA 5CLLB 3PSEB 3M62B 1EF5A 1PMSA 1X86A 4C0AA 1DDMA 4MGYE 4ICUA 2LGDA 1MPHA 4I6LB 3UQBA 2RGFA 4XZ4A 4F8CB 2PZ1A 2JZ3B 4HAWB 4L6EA 5CLQB 4EEWA 3ZKJC 3SNHA 4NAWA 3ZTDA 4EJNA 4GSWA 2NCNA 3IG3A 1JRUA 3PVWA 2GCJA 5L83A 4HHVA 2I1JA 1VCBA 4EZKA 1U4AA 4WJQA 5J18A 3H7PA 4MELA 2L7RA 4E74A 2J0MA 5E6OA 1V5UA 3SV1A 4MY6A 1E8WA 4KDIC 3ECIA 1U5EA 3RCPA 2G3QB 1WGQA 4GZUA 4NQLB 4K7WA 3VTUA 2K2UA 3VAWA 3W1SA 3N3KB 1UPQA 5C79A 4TUUA 1U5FA 2D9WA 2WDTB 3KVFB 2GMIC 5FR6A 2KFKB 3QK0A 4ZRJA 4FJZA 4KVGB 1AQCA 1OQYA 5CHFA 2B3AA 1V5OA 1B55A 2KQSA 2K8CA 1ZKHA 2MBOA 3ZIMA 2CU1A 1UBIA 1I42A 5FI1A 2DYQA 4JGHB 3TL5A 4XX5A 2KCJA 3PLVA 2DX5B 4A6HA 1Q1OA 2COFA 2JUOA 2O2VB 1WG7A 4IFSA 1Q0WB 2N7DA 4YL8A 3A1QB 3ALBA 2UVMA 3WAOA 2G35A 1WXSA 4RM9A 4AWJA 1HE8A 2O6VD 2K00A 4HJKA 3CMMB 1V81A 2C9WB 2UZRA 2FJLA 3ONSA 2NPTA 1SE9A 5C5BA 1WJ4A 1NU2A 4NJ7A 1V61A 3A4RA 1X1MA 4X57B 2L76A 2UWQA 4BVUC 3JVZX 3MJWA 5KQ4A 2IY1B 3WANA 2N7EA 2KMAA 2W2WA 2KDBA 2LD9A 4IC7B 4W9DA 4WJ7A 1NI2A 5DPTA 4OVVA 2DN6A 3CXBB 2ZNVC 1PFJA 4WWOA 3PLUA 5J3TA 2D10A 2G45B 2NBWB 3PVLA 3DXCA 5D3XA 3HM3A 3UGBB 3IBEA 4B9KA 1A5RA 5C1ZA 4DHZB 1WXAA 1W1GA 3UQAA 5CHWA 5D3WA 4FHKA 4EKUA 2IYBA 3AXCA 4ZYNA 2YS1A 1K8RB 1C3TA 3T9LA 2YT0A 1TZ1A 1OGWA 4HVBA 1XKEA 3ZW3A 4K1RB 3DVGX 3VUYA 4MM3A 4EOYA 2KQ7A 5IAAC 4KZCA 3U8ZA 4TV3A 3DVNU 2ZCCA 3SD5A 3EFUA 5DH9B 3QWMA 1E90A 4IAPA 4TQ0A 2KFJA 2LWPA 4I6PA 5BO4B 3KRWA 1KOTA 3Q3FA 5JLJB 2MDXA 2BWES 2G4DB 4KHOA 1FOEA 4P7IA 1MAIA 1OQNA 2IFSA 3K9OB 1H8CA 4NPNA 2OOBB 3MTNB 3PTFC 1BWNA 3NSUA 3AU4A 2RUKB 5L81A 3JSVA 4B95A 3L08A 1C1YB 5HE0A 2CKHB 3IHPC 3D32A 3ML4A 4F7HA 1EVHA 2CHXA 3KUCB 3HHMA 1TBEA 4GDLA 5JZEB 4IUMB 2FUHB 2N9PC 1AWEA 2WX0A 5TR5A 4LCDE 3D8EA 1DYNA 3M3JA 4M8NA 4W9CA 2LUEA 5DIFB 1Q5WB 2GBNA 4HDOA 4KIKB 3APDA 3PG7A 3OANA 1AARA 4MDKE 4WWPA 2KZRA 4MGZE 4FJVB 3HW2B 3ML9A 3A8QA 1WGDA 2UZSA 3TVVA 5JHAA 5JHHA 2MLBA 1UH6A 2RR9A 3OJ3A 4BBNF 1SIFA 2FIDA 5C23A 2LZ6A 3NY5A 5DHAB 4Y94A 3R66C 2M14A 4PNKA 2L3ZA 2L1CA 3AULA 3L0WB 1XODA 2DZIA 1TJ6A 3L10B 4BKTA 3QQ8B 3EC8A 2Z59B 1V6EA 4HB3B 2ZPNA 2IO3B 4B6WA 2FCMA 4CHJA 1U2BA 2JPHA 2YSZA 5LXHA 3CSTA 2DYOA 1WGHA 2KJRA 5DHFB 1KZ7A 4GGQA 1WRDB 3M95A 5HE2A 4IOYX 4BFRA 4MH0E 4FLHA 1UPRA 2DKPA 2DYMA 1XD3B 3WYFB 5LLIA 2EMTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LVP A;  1WJ6 A;  4EUT A;  2XQN M;  3DVG Y;  2LOZ A;  1WI1 A;  3ENE A;  3VIA A;  4PS3 A;  4CHM A;  3TBL D;  3DPD A;  3H7S A;  4HAU B;  3WIM A;  2RGN B;  3M63 B;  2GBM A;  2J59 M;  4F1S A;  2JF5 A;  2BKR B;  3TIX A;  2KFK A;  2CAY A;  1ZW7 A;  1OTR B;  1RLF A;  3ZNH B;  4MK0 A;  2RVB B;  2BGF A;  1WM2 A;  2D11 A;  1I2H A;  4G50 A;  4FA6 A;  3SUZ A;  1WGG A;  1WJM A;  3DDC B;  2DHI A;  2GBJ A;  3V60 A;  1UEL A;  1K5D B;  3PRP B;  2XK5 B;  2JXX A;  1P3Q U;  2NS5 A;  2D2Q A;  2DX5 A;  3HQC A;  2O2V A;  4W9H A;  2KXJ A;  2DFK A;  5AZF A;  2GCL A;  2DAF A;  3Q3J A;  4IWP A;  5EFX A;  3A1Q A;  2DKQ A;  1V5T A;  4XWX A;  4ANW A;  2D9Z A;  4XC2 A;  2DZJ A;  2ASQ A;  2CS4 A;  1WZ0 A;  2MBQ A;  2J7Q B;  2LUL A;  2I5C A;  3PHX B;  2KO3 A;  2MP2 B;  1UEF A;  5DI9 B;  3V5W A;  3NS8 A;  2KNB A;  2BCJ A;  4DHJ D;  1H4R A;  3ZTC A;  2KMC A;  1H10 A;  4GPT B;  3O96 A;  2Y5B B;  2RD0 A;  4K17 A;  2LGY A;  3A8P A;  5D7G A;  1X1G A;  3GYP A;  2KC2 A;  3VH4 B;  1MK7 B;  3AJ4 A;  2RSU A;  4MJS B;  5C6R A;  1V5M A;  1ISN A;  2DZK A;  2K25 A;  4ZDV A;  4WWN A;  4NY0 A;  2DYB A;  3QJZ A;  2KN5 A;  2JT4 B;  4TKN A;  4II3 B;  4DHJ B;  3R7R A;  2K8H A;  2ZNV B;  1BTN A;  5AEK B;  3V62 A;  1DBH A;  3VUW A;  3TCA A;  3VHT C;  2P8V A;  3ODW A;  2EKE C;  5J3Y A;  1WMH B;  3SYX A;  4A3P A;  4BBK A;  2LAS A;  4IW0 A;  2JZZ A;  1KZG A;  1GNU A;  4GIV A;  4I6N B;  1XCG A;  3KYC D;  5DPR A;  1WFY A;  2W9N A;  3C0R B;  2ZJD A;  1DDW A;  5KHO A;  1U29 A;  3DBS A;  4FBJ B;  2P0F A;  3OLM D;  2OJR A;  2KTR B;  4WAA A;  4PS8 A;  3P6A A;  1V86 A;  1WX9 A;  3TO1 A;  2ROV A;  4F7G A;  2N23 A;  3N30 A;  2BWF A;  1FGY A;  3QC8 B;  2QKL A;  4WJN A;  4BKG A;  4GDK B;  3CIK A;  3DVN V;  1BTK A;  3DCG A;  3W1Y A;  1EF1 A;  5HE3 A;  3RT3 B;  2BF8 B;  1UNR A;  2J0K A;  2P0H A;  4ZRK A;  3ML8 A;  2DAJ A;  1MIZ B;  1P0R A;  4DBB A;  1S3S G;  2IYD B;  1VD2 A;  2DYN A;  1P9D U;  2I1K A;  3MHS D;  5J17 A;  3PRE A;  3L54 A;  4ZRI A;  2KTF A;  2WWZ A;  4NSW A;  2GBK A;  2DHK A;  2KKC A;  2DEN B;  2VRR B;  4NJ6 A;  3ODX A;  1Z87 A;  4M8M A;  4BKS A;  3UF8 A;  2JRH A;  2O6V B;  4DDI D;  1GG3 A;  4KIK A;  3T8M A;  2COD A;  1UBQ A;  3FEH A;  2LKO A;  2N0Y A;  2MKR A;  4A3O A;  2L2I A;  2IO1 B;  2D9X A;  3KW5 B;  1UNQ A;  1PQS A;  3RZF A;  1WE7 A;  3A9K B;  4EZL A;  2L0F A;  4RMA A;  2KHW B;  3SDL C;  3N32 A;  1MKE A;  3EHV A;  1J8C A;  1FXT B;  1IRS A;  1WXM A;  2LRU A;  2ZCB A;  3RYT A;  5AZG A;  4B6H A;  2V3S A;  1V80 A;  1WR6 E;  2ADZ A;  3ULC A;  2KJ6 A;  5L95 C;  4HB2 B;  4CHK A;  3ODO A;  3TFM A;  1GC7 A;  1RRB A;  4DWF A;  2ZVO A;  2YS3 A;  4W9J A;  1EO6 A;  2BYF A;  4LDT D;  1ZC4 B;  2EJ8 A;  4DHZ E;  3VOQ A;  1NTY A;  4BBN C;  1LM8 B;  1P1A A;  1GC6 A;  1FHO A;  1QQG A;  2ZPY A;  3VDZ A;  1KJT A;  1ZM0 A;  4FUL A;  3A9J B;  2YF0 A;  1E8Z A;  2X18 A;  1I35 A;  4HCP B;  3PT2 B;  3RUL A;  2MBH A;  3JYU A;  5IA7 A;  5CX3 A;  3KRX A;  4FJY A;  1EUV B;  1LW3 A;  4URK A;  2GS0 A;  2W2X C;  2KVR A;  2ZEQ A;  2VSZ A;  3ZVV A;  4IWO A;  3VTW A;  4MT7 A;  2Z0O A;  3PHW B;  2NBU A;  2L00 B;  5E6N A;  3X23 A;  5G2N A;  1WJU A;  2KWV B;  2K8B A;  2XK5 A;  2HTH B;  2V1Y A;  4HPM B;  1GUA B;  2HD5 B;  2GOW A;  3VTV A;  2A5U A;  1L2N A;  1Y19 B;  3M1I B;  2D9Y A;  1WE6 A;  2R2Q A;  2Z0E B;  2DZM A;  5KCV A;  2PEA A;  2C5L C;  3HM6 X;  4HAV B;  1OEY A;  2JRI B;  3KZ1 A;  5D3Y A;  3PV1 A;  5D94 A;  1YD8 U;  3FSS A;  2KGX B;  4JLC A;  2MP2 A;  3VUX A;  3WAP A;  1YJ1 A;  2ZZP B;  3W1S C;  4WSF A;  1WJ1 A;  2GJY A;  3QAQ A;  4HWI B;  2MCN B;  4A6F B;  2LJ5 A;  4GOC A;  2DTC A;  4KHB B;  1YX5 B;  4W9G A;  2PPH A;  4CO7 A;  1KI1 B;  2IO2 B;  3B08 A;  3KY9 A;  1MIX A;  1ZC3 B;  4N9F 4;  4Z2N A;  4W9L A;  4WJP A;  3TW1 A;  2YLM A;  1FHX A;  1QC6 A;  4DXA B;  3HIZ A;  3NHE B;  2MFQ A;  3GOE A;  1V2Y A;  4MJS A;  4W9F A;  4MSQ B;  3TJP A;  2C7H A;  1FHW A;  3LDZ E;  4GN1 A;  3A98 B;  3QIJ A;  3PSC A;  3IVF A;  1SHC A;  1J0W A;  2N4F A;  4HPL B;  3CSF A;  2CRF A;  4F7U P;  1XD4 A;  5D2M B;  2FNJ B;  2IZV B;  4PQ0 A;  2L05 A;  2D9V A;  1WMH A;  2G4S A;  2R2O A;  2FIF A;  2P0D A;  4HDQ A;  5EDS A;  2LXA A;  4FAD A;  4BOS C;  2BYE A;  4TQ1 A;  2JVC A;  5CHV C;  1WM3 A;  1EGX A;  4K7S A;  2IY0 B;  5D6J B;  2Y7B A;  1MK9 B;  1WX7 A;  1XQQ A;  2V76 A;  3RUI B;  2K6Q A;  1BAK A;  4EFO A;  3QWZ B;  4J6I A;  1KLV A;  5CTR C;  5J3Q A;  3QBV B;  2KTR A;  5HKH A;  3O65 B;  3ZNG C;  1WGY A;  2FCQ A;  3ZVR A;  2ROZ B;  3OJ4 B;  5DCN A;  2N9X A;  1CMX B;  2AL6 A;  2RNR B;  3UIN B;  2GBR A;  4GDK A;  3KUZ A;  2M8S A;  2N9E B;  3LJ3 A;  4A6K A;  3RZW C;  2KLC A;  4AOF A;  2LXC A;  4PS7 A;  2KX0 A;  1IPG A;  3L17 A;  3PRZ A;  3QX1 A;  1P5T A;  3RCZ A;  3ZLZ A;  2LYD A;  4G3X B;  2UYZ B;  3H1U A;  3QA8 A;  3V6C B;  3WAM A;  2MX2 A;  3H6N A;  2DA0 A;  3TMP B;  3H9D A;  2LVQ A;  3OAW A;  1V9J A;  1YQB A;  2R0D A;  2JP2 A;  3DBH I;  5JH5 C;  2ELB A;  2MWN B;  4AUQ C;  1WF9 A;  2Y8G A;  2O6V A;  1RJ2 A;  1IYF A;  1V89 A;  2KLG A;  1XX0 A;  5GOW B;  3F0W A;  3QCA A;  5LON B;  4YON A;  2JWZ A;  3NZU A;  1S1Q B;  2D3G A;  3A9K A;  1I7A A;  2YS5 A;  1UZX B;  2K2J A;  4IM2 A;  4DX9 0;  2RSG A;  4DX8 A;  2KD0 A;  1E7V A;  3MPX A;  3VH3 B;  4FN2 A;  4KDL B;  4BOZ B;  3UIP B;  3DXD A;  5G55 A;  3VXW A;  3ZRC A;  1WX8 A;  2VRW B;  2Y8F A;  1LFD A;  2KK8 A;  5J2R A;  1WXV A;  2KJH B;  5GMV A;  1WGR A;  4DBG A;  3DOW A;  3LJU X;  1XT9 B;  2NMB A;  3D8D A;  2CY4 A;  5DPW A;  4EMO A;  1Z2M A;  4ANV A;  3AI5 A;  2M38 A;  2MRP A;  2BPS A;  2BYV E;  2QKM A;  1FGZ A;  4IM3 A;  2CY5 A;  2KDI A;  3B1L X;  4K81 A;  4ANU A;  2FCS A;  4IWQ A;  4W9I A;  1OEY J;  4AP4 C;  4AJY B;  4HAX B;  3L13 A;  1X1F A;  2A4Z A;  2M4N A;  2WX1 A;  4II2 B;  2I5F A;  2K6D B;  4MEM A;  2W2X D;  3A9J A;  2R09 A;  4HAZ B;  4GB9 A;  3PVU A;  1DDV A;  3G9W A;  2DHZ A;  3PP2 A;  4KHA A;  4WVF B;  3QHT A;  4EZJ A;  3ZDM C;  3T06 A;  2M17 A;  3KSY A;  1WH3 A;  2H7D A;  4MGK E;  2AYO B;  4PYU A;  1M7E A;  1Q67 A;  2MW5 A;  1X11 A;  4HLE A;  5LXI B;  3I3T B;  4PYZ A;  1N3H A;  1WY8 A;  2LVO A;  4HB0 B;  2NVU I;  3R7Q A;  2YRY A;  4NNJ B;  2H7E A;  1ZSQ A;  3QAR A;  4HXD A;  2HTH A;  3KUD B;  2REX A;  1F9J A;  1NDD A;  2QHO A;  1WGU A;  1W1H A;  5FI0 A;  1RFA A;  1QZE A;  2LRW A;  3B0A A;  4NAW B;  2RLO A;  1KM7 A;  3S2A A;  1WIA A;  1UD7 A;  5KQ1 A;  4HCN B;  5D3V A;  4JIO U;  1TTN A;  2XBB C;  3DBR I;  4E71 A;  1G6J A;  1T0Y A;  4K2P A;  4GMV A;  2PE9 A;  2IBI B;  3H7P B;  2MBB B;  4M0W B;  1WYW B;  3NOB A;  4NQK E;  3EEC A;  4A6F A;  4DK5 A;  4LJO B;  2E2X A;  2JY6 A;  3SO6 A;  2YVC A;  2EC1 A;  1J19 A;  2NZ8 B;  2KOX A;  1D3Z A;  4H8S A;  1E8Y A;  3GZN I;  1P98 A;  2Z0D B;  4K7U A;  2MSE D;  2DLW A;  2AWT A;  3JW0 X;  4KSL C;  3PS6 A;  4DDG D;  2ELA A;  3ZNZ B;  1WI0 A;  2KC1 A;  3X0W A;  2CR5 A;  1E8X A;  4LJP B;  3BIN A;  4JQW C;  3NZS A;  4F7Z A;  3V61 A;  4RM8 A;  3APF A;  2CHW A;  3ZUN A;  2OTX A;  3U7D A;  1TQZ A;  5KHQ A;  3PZD A;  1ZGU B;  3IFW B;  5D27 A;  4ASW C;  3PRM B;  5JHG A;  2WYQ A;  3RD2 A;  3ZO5 B;  1NTV A;  1P3R A;  2LGX A;  1UNP A;  3K9P B;  2C7N B;  3N7C A;  2EMS A;  1V49 A;  1L7Y A;  2FCN A;  1P6S A;  2PJH A;  2LI5 A;  2AL3 A;  2DHJ A;  2COA A;  2AEH A;  3ULB A;  2K1F A;  4LDT B;  4BKS D;  3FM8 C;  1TXD A;  1DRO A;  2KDE B;  4HAT B;  2MBE A;  2KX3 A;  3SU8 X;  1YX6 B;  3ZDT A;  2HJ8 A;  4AJW A;  2BKF A;  3GYO A;  2NPT B;  1V88 A;  2D4Q A;  4WJO A;  5C5B B;  2M0X A;  4IG7 B;  4GMX B;  1R4M I;  2Q13 A;  1E7U A;  1X05 A;  4KSK C;  1PLS A;  4W9E A;  2Z0Q A;  1U5G A;  1XR0 B;  3APC A;  1FB8 A;  1K5G B;  3MDB C;  4CYE A;  4K2O A;  1LB1 A;  1U27 A;  2L0T A;  3UIO B;  2KUP A;  2KAN A;  4E3C A;  2N1V A;  3PGE A;  4MGI E;  3DXE A;  1LQB A;  1Z5S B;  4G11 A;  1WR1 A;  2XEW A;  2COC A;  2LOX A;  2KWU B;  3A4S C;  1J0G A;  2MQJ A;  2L8J A;  1OY2 A;  1NBF C;  1WZ3 A;  2MWS B;  4KAX B;  2V4L A;  4JL9 A;  3U30 A;  3VQI A;  5DPS A;  3DQV A;  1EAZ A;  4MSM B;  3BY4 B;  2NBV B;  2M1M A;  2KWC A;  2RPQ A;  2FAZ A;  1RRP B;  5AZH A;  2VKI A;  4FHJ A;  1V5P A;  5C16 A;  4GXB A;  3ZRF A;  1YIW A;  3L16 A;  3F5R A;  1GJZ A;  4ANX A;  1M7R A;  1E5W A;  3R3M A;  1W1D A;  4G0N B;  1LXD A;  4W9K A;  1Y5O A;  3KYD D;  4OVU A;  4D0N B;  4ICV A;  4WQO B;  3PEG A;  1U5D A;  1SGH A;  4A5K A;  2YT1 A;  3DBL I;  3SHQ A;  5JHB A;  2D07 B;  3AU5 A;  3VFK A;  1RAX A;  3VVW B;  3UZT A;  1M94 A;  3WA0 A;  1OMW A;  3V6E B;  3CF6 E;  4GU2 A;  4TYZ A;  5E6P A;  3WAL A;  3P7Z A;  2ZVN A;  2PE6 B;  2J0J A;  3PPA A;  1ZVR A;  4A20 A;  3HK0 A;  2IO0 B;  3JSV B;  1IP9 A;  3KH0 A;  4HAY B;  3P2B A;  2NR2 A;  1WVH A;  3ZNI D;  5LOP B;  4GDL B;  4HK2 A;  5HE1 A;  4KV2 A;  2DX1 A;  2N1W A;  2C7M B;  1R4N I;  3D8F A;  2OQB A;  2MA9 B;  5JP4 A;  4IM0 A;  1BT0 A;  1Y8R C;  4Z2M B;  1FAO A;  1WJN A;  2KDF B;  3A33 B;  2Z0P A;  1TGZ B;  2C60 A;  2LG1 A;  2CHZ A;  2HE7 A;  2K39 A;  4KZ0 A;  1UGM A;  4HB4 B;  1MG8 A;  3BJI A;  5CLL B;  3PSE B;  3M62 B;  1EF5 A;  1PMS A;  1X86 A;  4C0A A;  1DDM A;  4MGY E;  4ICU A;  2LGD A;  1MPH A;  4I6L B;  3UQB A;  2RGF A;  4XZ4 A;  4F8C B;  2PZ1 A;  2JZ3 B;  4HAW B;  4L6E A;  5CLQ B;  4EEW A;  3ZKJ C;  3SNH A;  4NAW A;  3ZTD A;  4EJN A;  4GSW A;  2NCN A;  3IG3 A;  1JRU A;  3PVW A;  2GCJ A;  5L83 A;  4HHV A;  2I1J A;  1VCB A;  4EZK A;  1U4A A;  4WJQ A;  5J18 A;  3H7P A;  4MEL A;  2L7R A;  4E74 A;  2J0M A;  5E6O A;  1V5U A;  3SV1 A;  4MY6 A;  1E8W A;  4KDI C;  3ECI A;  1U5E A;  3RCP A;  2G3Q B;  1WGQ A;  4GZU A;  4NQL B;  4K7W A;  3VTU A;  2K2U A;  3VAW A;  3W1S A;  3N3K B;  1UPQ A;  5C79 A;  4TUU A;  1U5F A;  2D9W A;  2WDT B;  3KVF B;  2GMI C;  5FR6 A;  2KFK B;  3QK0 A;  4ZRJ A;  4FJZ A;  4KVG B;  1AQC A;  1OQY A;  5CHF A;  2B3A A;  1V5O A;  1B55 A;  2KQS A;  2K8C A;  1ZKH A;  2MBO A;  3ZIM A;  2CU1 A;  1UBI A;  1I42 A;  5FI1 A;  2DYQ A;  4JGH B;  3TL5 A;  4XX5 A;  2KCJ A;  3PLV A;  2DX5 B;  4A6H A;  1Q1O A;  2COF A;  2JUO A;  2O2V B;  1WG7 A;  4IFS A;  1Q0W B;  2N7D A;  4YL8 A;  3A1Q B;  3ALB A;  2UVM A;  3WAO A;  2G35 A;  1WXS A;  4RM9 A;  4AWJ A;  1HE8 A;  2O6V D;  2K00 A;  4HJK A;  3CMM B;  1V81 A;  2C9W B;  2UZR A;  2FJL A;  3ONS A;  2NPT A;  1SE9 A;  5C5B A;  1WJ4 A;  1NU2 A;  4NJ7 A;  1V61 A;  3A4R A;  1X1M A;  4X57 B;  2L76 A;  2UWQ A;  4BVU C;  3JVZ X;  3MJW A;  5KQ4 A;  2IY1 B;  3WAN A;  2N7E A;  2KMA A;  2W2W A;  2KDB A;  2LD9 A;  4IC7 B;  4W9D A;  4WJ7 A;  1NI2 A;  5DPT A;  4OVV A;  2DN6 A;  3CXB B;  2ZNV C;  1PFJ A;  4WWO A;  3PLU A;  5J3T A;  2D10 A;  2G45 B;  2NBW B;  3PVL A;  3DXC A;  5D3X A;  3HM3 A;  3UGB B;  3IBE A;  4B9K A;  1A5R A;  5C1Z A;  4DHZ B;  1WXA A;  1W1G A;  3UQA A;  5CHW A;  5D3W A;  4FHK A;  4EKU A;  2IYB A;  3AXC A;  4ZYN A;  2YS1 A;  1K8R B;  1C3T A;  3T9L A;  2YT0 A;  1TZ1 A;  1OGW A;  4HVB A;  1XKE A;  3ZW3 A;  4K1R B;  3DVG X;  3VUY A;  4MM3 A;  4EOY A;  2KQ7 A;  5IAA C;  4KZC A;  3U8Z A;  4TV3 A;  3DVN U;  2ZCC A;  3SD5 A;  3EFU A;  5DH9 B;  3QWM A;  1E90 A;  4IAP A;  4TQ0 A;  2KFJ A;  2LWP A;  4I6P A;  5BO4 B;  3KRW A;  1KOT A;  3Q3F A;  5JLJ B;  2MDX A;  2BWE S;  2G4D B;  4KHO A;  1FOE A;  4P7I A;  1MAI A;  1OQN A;  2IFS A;  3K9O B;  1H8C A;  4NPN A;  2OOB B;  3MTN B;  3PTF C;  1BWN A;  3NSU A;  3AU4 A;  2RUK B;  5L81 A;  3JSV A;  4B95 A;  3L08 A;  1C1Y B;  5HE0 A;  2CKH B;  3IHP C;  3D32 A;  3ML4 A;  4F7H A;  1EVH A;  2CHX A;  3KUC B;  3HHM A;  1TBE A;  4GDL A;  5JZE B;  4IUM B;  2FUH B;  2N9P C;  1AWE A;  2WX0 A;  5TR5 A;  4LCD E;  3D8E A;  1DYN A;  3M3J A;  4M8N A;  4W9C A;  2LUE A;  5DIF B;  1Q5W B;  2GBN A;  4HDO A;  4KIK B;  3APD A;  3PG7 A;  3OAN A;  1AAR A;  4MDK E;  4WWP A;  2KZR A;  4MGZ E;  4FJV B;  3HW2 B;  3ML9 A;  3A8Q A;  1WGD A;  2UZS A;  3TVV A;  5JHA A;  5JHH A;  2MLB A;  1UH6 A;  2RR9 A;  3OJ3 A;  4BBN F;  1SIF A;  2FID A;  5C23 A;  2LZ6 A;  3NY5 A;  5DHA B;  4Y94 A;  3R66 C;  2M14 A;  4PNK A;  2L3Z A;  2L1C A;  3AUL A;  3L0W B;  1XOD A;  2DZI A;  1TJ6 A;  3L10 B;  4BKT A;  3QQ8 B;  3EC8 A;  2Z59 B;  1V6E A;  4HB3 B;  2ZPN A;  2IO3 B;  4B6W A;  2FCM A;  4CHJ A;  1U2B A;  2JPH A;  2YSZ A;  5LXH A;  3CST A;  2DYO A;  1WGH A;  2KJR A;  5DHF B;  1KZ7 A;  4GGQ A;  1WRD B;  3M95 A;  5HE2 A;  4IOY X;  4BFR A;  4MH0 E;  4FLH A;  1UPR A;  2DKP A;  2DYM A;  1XD3 B;  3WYF B;  5LLI A;  2EMT A; 
#chains in the Genus database with same CATH topology
 1TS2 A;  2LVP A;  1WJ6 A;  2FBW B;  4EUT A;  2XQN M;  3DVG Y;  2LOZ A;  1WI1 A;  3ENE A;  4OVZ A;  3VIA A;  4PS3 A;  4CHM A;  3TBL D;  3DHH C;  3DPD A;  3H7S A;  4HAU B;  3WIM A;  2RGN B;  3M63 B;  2GBM A;  2J59 M;  4F1S A;  2QJL A;  2JF5 A;  2BKR B;  3TIX A;  2KFK A;  4OZC A;  2CAY A;  1P7F A;  1ZW7 A;  2ICI A;  3AH7 A;  4RCO A;  1OTR B;  1RLF A;  3ZNH B;  4MK0 A;  2RVB B;  2BGF A;  1C9F A;  1WM2 A;  3B77 A;  2D11 A;  1I2H A;  1CQV A;  1DGJ A;  4G50 A;  1YN5 A;  4FA6 A;  3SUZ A;  1WGG A;  3IT4 B;  3RPF C;  1WJM A;  3DDC B;  2DHI A;  3HIE A;  1JWA D;  2GBJ A;  3V60 A;  5MPO A;  1UEL A;  4O1N A;  1K5D B;  3AN1 A;  3PRP B;  2XK5 B;  2JXX A;  1P3Q U;  3V05 A;  2NS5 A;  3NVY A;  1C4A A;  2D2Q A;  1QQR A;  2DX5 A;  4L2Y A;  2QDF A;  1L5P A;  3HQC A;  2O2V A;  4W9H A;  2KXJ A;  1UUP A;  2DFK A;  5AZF A;  3B9J A;  4S17 A;  2GCL A;  2DAF A;  3Q3J A;  3SR6 A;  4KKJ A;  4IWP A;  5EFX A;  3A1Q A;  3RNC C;  2WXQ A;  2N9L A;  4OW0 A;  3GE8 C;  4QJ3 B;  2DKQ A;  1BML C;  4XWX A;  1V5T A;  3ZQ4 A;  1PGB A;  2WXP A;  4JWS C;  4ANW A;  2D9Z A;  4XC2 A;  2DZJ A;  2YT2 A;  2ASQ A;  2CS4 A;  1WZ0 A;  2MBQ A;  1KLU D;  2J7Q B;  4HRS A;  1TS3 A;  2LUL A;  2I5C A;  3PHX B;  1WWT A;  2KO3 A;  2MP2 B;  1T6B X;  3BII D;  1UEF A;  1EWY C;  5DI9 B;  3V5W A;  3NS8 A;  2KNB A;  2BCJ A;  4DHJ D;  3TEZ A;  4D6W A;  1H4R A;  3AV8 A;  3ZTC A;  2KMC A;  1H10 A;  4GPT B;  2AX5 A;  4UDU C;  1NVI D;  2WXI A;  3AE5 B;  3O96 A;  2Y5B B;  2RD0 A;  4K17 A;  4USA A;  4RGO S;  2LGY A;  3A8P A;  1UWX A;  5D7G A;  1X1G A;  3RNG C;  3GYP A;  1XCQ L;  1IGC A;  2KC2 A;  3VH4 B;  1MK7 B;  3AJ4 A;  4ZRP A;  2RSU A;  4MJS B;  5C6R A;  5EE1 A;  4RF1 A;  1V5M A;  1PDX A;  1ISN A;  2DZK A;  2K25 A;  4ZDV A;  4WWN A;  4NY0 A;  4XGA B;  4YXD B;  2FJU B;  2VH1 A;  2DYB A;  4FXC A;  3QJZ A;  1ZE3 D;  2KT7 A;  2KN5 A;  2JT4 B;  4P1C C;  4TKN A;  4II3 B;  4DHJ B;  4ZRQ A;  3R7R A;  2INP E;  2K8H A;  1QKZ A;  2Z4D A;  2ZNV B;  4YSY B;  1BTN A;  5AEK B;  4MT5 A;  3V62 A;  1DBH A;  3RN9 C;  3VUW A;  3TCA A;  3Q8C A;  1TY2 A;  5G5G A;  3VHT C;  2P8V A;  3ODW A;  1EM7 A;  4OZA A;  4LLG M;  2EKE C;  4KGS A;  5J3Y A;  1WMH B;  3SYX A;  4A3P A;  4DQO C;  3LYY A;  4BBK A;  2LAS A;  4IW0 A;  1T0S C;  2J52 A;  2JZZ A;  3SFD B;  1KZG A;  1GNU A;  4GIV A;  4NZL B;  4I6N B;  3CWI A;  1XCG A;  2PMV A;  1C76 A;  3KYC D;  2K3U A;  5DPR A;  1WFY A;  4HRO A;  2W9N A;  3C0R B;  1QF6 A;  1I4G A;  1MVK A;  4L1R A;  2ZJD A;  1RFK A;  1DDW A;  5KHO A;  1U29 A;  2DBY A;  3DBS A;  4FBJ B;  2HDE A;  2P0F A;  2X38 A;  3OLM D;  2OJR A;  2KTR B;  2Y3A A;  4WAA A;  4PS8 A;  3P6A A;  1V86 A;  1WX9 A;  4GLS C;  3HVD A;  2PTL A;  1ZUD 2;  3U52 E;  3TO1 A;  1XLO A;  2ROV A;  2BVC A;  4F7G A;  2N23 A;  3N30 A;  2BWF A;  1FGY A;  2MH7 A;  3DWG C;  1K50 A;  3QC8 B;  2QKL A;  4RF0 A;  4WJN A;  3P1M A;  4L23 A;  4IOI E;  1FXI A;  4BKG A;  1Q10 A;  2W3R A;  4GDK B;  3HVZ A;  1QOA A;  4RGM A;  3CIK A;  1ZYI A;  3DVN V;  1BTK A;  3DCG A;  2RPV A;  3W1Y A;  1SB3 C;  3URY A;  1EF1 A;  4RGT A;  1JAL A;  5HE3 A;  1E9M A;  3RT3 B;  2BF8 B;  1UNR A;  2J0K A;  2P0H A;  4ZRK A;  3DBH B;  2DAJ A;  3ML8 A;  1MIZ B;  1P0R A;  5BYR A;  1TT5 B;  4DBB A;  2IGH A;  1FRD A;  1S3S G;  3EFC A;  3P4P B;  2IYD B;  1VD2 A;  2DYN A;  1P9D U;  1DOI A;  1FM0 D;  2I1K A;  3MHS D;  5J17 A;  3PRE A;  1L0V B;  3L54 A;  4A90 A;  4ZRI A;  2KTF A;  1SEB D;  3U7Z A;  2WWZ A;  4NSW A;  2GBK A;  2MJD A;  2DHK A;  1TIF A;  2KKC A;  2DEN B;  4OZB A;  1F2R I;  2VRR B;  4NJ6 A;  1DYQ A;  3ODX A;  1Z87 A;  1NYQ A;  4CSQ A;  2WXH A;  3FVC A;  1VJK A;  1PGA A;  5BMH A;  4M8M A;  4BKS A;  3UF8 A;  4WUR A;  2JRH A;  2O6V B;  4DDI D;  1GG3 A;  2QEJ C;  4KIK A;  2COD A;  2FUG 1;  3T8M A;  3MC0 B;  1UBQ A;  3FEH A;  2LKO A;  2N0Y A;  2MKR A;  3IAM 1;  4A3O A;  2L2I A;  2IO1 B;  2D9X A;  1YQ3 B;  3KW5 B;  1UNQ A;  1PQS A;  2BTE A;  2KN4 A;  3AEB B;  3RZF A;  1WE7 A;  3A9K B;  4EZL A;  2D3C A;  2L0F A;  4XYC A;  2JYT A;  4RMA A;  4ARI A;  1C77 A;  3BYT B;  1ZXI A;  4RGN A;  2KHW B;  2BW2 A;  3SDL C;  3N32 A;  1MKE A;  3EHV A;  1J8C A;  1FXT B;  1FFV A;  1EU4 A;  1MHX A;  3C19 A;  1IRS A;  1WXM A;  5BYQ A;  2RMM A;  2LRU A;  2R2Y A;  2WQY B;  2ZCB A;  3RYT A;  5AZG A;  4B6H A;  2V3S A;  1FNW A;  3N20 C;  3B2G A;  5HI1 A;  1N61 A;  1V80 A;  1WR6 E;  2ADZ A;  1BXT A;  2IND C;  3ULC A;  2KJ6 A;  4JX1 C;  5L95 C;  4HB2 B;  4CHK A;  3ODO A;  4PT5 A;  2Z59 A;  2V0G A;  3TFM A;  1GC7 A;  1RRB A;  4C80 A;  1YJI A;  4DWF A;  2ZVO A;  2YS3 A;  4KKI A;  3KWL A;  4W9J A;  1AW7 A;  1EO6 A;  2BYF A;  3Q8B A;  4LDT D;  4WH4 A;  3T3N A;  1ZC4 B;  2EJ8 A;  4DHZ E;  3VOQ A;  2CU3 A;  3KQ4 A;  1NTY A;  4BBN C;  1LM8 B;  3SFE B;  1TS5 A;  1P1A A;  1GC6 A;  1FHO A;  1QQG A;  2YEP B;  3VRA B;  2ZPY A;  3VDZ A;  3SEB A;  1L6U A;  1KJT A;  1CJE A;  1ZM0 A;  4FUL A;  3A9J B;  2YF0 A;  1E8Z A;  1JWB D;  2QCZ A;  2X18 A;  1I4H A;  1XEE A;  1I35 A;  4HCP B;  3PT2 B;  4REZ A;  3RUL A;  2MBH A;  1SF0 A;  3NWD A;  5HHD G;  3JYU A;  5IA7 A;  5CX3 A;  3KRX A;  2EEL A;  1EUV B;  4FJY A;  1AWD A;  1LW3 A;  4URK A;  2GS0 A;  2W2X C;  2KVR A;  2ZEQ A;  3ZYY X;  2VSZ A;  3ZVV A;  1E10 A;  4IWO A;  1RWS A;  3VTW A;  4MT7 A;  4QJ4 B;  2Z0O A;  3PHW B;  3OG5 A;  2NBU A;  2L00 B;  3U4E G;  3AB5 A;  5E6N A;  3X23 A;  5G2N A;  1WJU A;  2KWV B;  2K8B A;  2XK5 A;  4JPS A;  2W54 A;  2HTH B;  1C4P A;  2V1Y A;  4HPM B;  3CIR B;  3DBR B;  1DOY A;  1GUA B;  2HD5 B;  2WXL A;  4DXG A;  2GOW A;  3VTV A;  2A5U A;  1L2N A;  1Y19 B;  3M1I B;  3Q14 C;  1L0Y B;  2D9Y A;  3NVV A;  1WE6 A;  4P6V F;  2R2Q A;  2Z0E B;  2DZM A;  4XDC A;  5KCV A;  2Q5W D;  2PEA A;  2C5L C;  3HM6 X;  4HAV B;  1OEY A;  1L6V A;  1JWM D;  2JRI B;  2QIL A;  3KZ1 A;  5D3Y A;  3PV1 A;  3GZN B;  5D94 A;  1YD8 U;  3T3O A;  2BB6 A;  3FSS A;  2KGX B;  4JLC A;  2MP2 A;  3VUX A;  3WAP A;  1E7P B;  3Q2A C;  1YJ1 A;  2ZZP B;  3W1S C;  2KIG A;  4WSF A;  1N60 A;  1WJ1 A;  2GJY A;  3QAQ A;  3RI7 C;  4HWI B;  4KX6 B;  2MCN B;  3UI3 A;  4A6F B;  3AMZ A;  2LJ5 A;  4S0R A;  4GOC A;  2DTC A;  4KHB B;  1YX5 B;  4W9G A;  4EE2 A;  2PPH A;  1WXQ A;  1QOG A;  5H8Y E;  4HKZ E;  4CO7 A;  1KI1 B;  2IO2 B;  3B08 A;  4OHJ A;  3KY9 A;  1MIX A;  1ZC3 B;  1OQR A;  3R2T A;  4N9F 4;  4Z2N A;  2M56 B;  4W9L A;  4WJP A;  1RM6 C;  3TW1 A;  2YLM A;  1AN8 A;  1FHX A;  3BVG A;  2QC8 A;  1QC6 A;  3J9C A;  4DXA B;  3HIZ A;  3NHE B;  2MFQ A;  3GOE A;  1V2Y A;  4MJS A;  4W9F A;  1N62 A;  3N9Y C;  4MSQ B;  2KAC A;  3TJP A;  4JE3 B;  2C7H A;  1FHW A;  2I38 A;  5TSS A;  3LDZ E;  4GN1 A;  3A98 B;  3QIJ A;  3PSC A;  3IVF A;  3RNE C;  1SHC A;  1J0W A;  2N4F A;  4B0M A;  4HPL B;  3CSF A;  2CRF A;  4F7U P;  1XD4 A;  5D2M B;  2FNJ B;  2KR0 A;  2MEK A;  2IZV B;  4PQ0 A;  2L05 A;  2RDG A;  2V4I B;  2D9V A;  1WMH A;  2G4S A;  2R2O A;  3I5J C;  1XF5 L;  2FIF A;  3AED B;  2P0D A;  4HDQ A;  2D5G A;  5EDS A;  2LXA A;  4FAD A;  4YT0 B;  4BOS C;  2BYE A;  4TQ1 A;  2JVC A;  5CHV C;  1GPX A;  1IUE A;  1WM3 A;  1EGX A;  4K7S A;  2IY0 B;  5D6J B;  1R4M B;  2Y7B A;  2MJE A;  1MK9 B;  3EA6 A;  2LHD A;  1YN3 A;  1WX7 A;  1XQQ A;  3EGR A;  2V76 A;  3RUI B;  5M4Y B;  2K6Q A;  1BAK A;  4EFO A;  3QWZ B;  4J6I A;  1FPY A;  1I4Q A;  1KLV A;  5CTR C;  5J3Q A;  3QBV B;  2KTR A;  5HKH A;  3O65 B;  3ZNG C;  1WGY A;  2FCQ A;  3ZVR A;  2ROZ B;  1TKE A;  3OJ4 B;  2VZK D;  4NJC A;  5DCN A;  3P42 A;  2N9X A;  4C4V B;  3AEA B;  1CMX B;  2AL6 A;  3GB1 A;  3NZ3 A;  2RNR B;  3UIN B;  2GBR A;  4DIX A;  4GDK A;  3KUZ A;  1T0R C;  2K8E A;  1FRR A;  2WS3 B;  2M8S A;  3P4S B;  4US9 A;  2SAK A;  1JW9 D;  2N9E B;  3LJ3 A;  3DHI C;  4A6K A;  3RZW C;  2KLC A;  4AOF A;  2LXC A;  2IGD A;  2KX0 A;  4PS7 A;  1J7C A;  2VH2 A;  1IPG A;  3HUI A;  3L17 A;  4IKG A;  2SEB D;  4A9A A;  3PRZ A;  3QX1 A;  4WWM A;  5IN7 A;  1P5T A;  2BBC A;  3RCZ A;  3FC4 A;  3ZLZ A;  2LYD A;  3FIL B;  4G3X B;  2UYZ B;  2H88 B;  3H1U A;  3TUO A;  3AEG B;  4M02 A;  3ZJV A;  3QA8 A;  4Q2J A;  2KYW A;  3BVZ A;  4RNA A;  2AQ2 B;  3V6C B;  3WAM A;  2MX2 A;  2KDM A;  3H6N A;  2VZK B;  2DA0 A;  4ITK A;  2RRF A;  3TMP B;  3H9D A;  2LVQ A;  3OAW A;  1J7B A;  4P1B C;  4QXA B;  1V9J A;  1TJE A;  4HPP A;  2WU2 B;  1YQB A;  2R0D A;  3AEC B;  2JP2 A;  3DBH I;  2NTT A;  4BZA A;  5JH5 C;  2ELB A;  2MWN B;  3Q8F A;  4AUQ C;  1N5W A;  2NMQ A;  2JWU A;  1WF9 A;  1M4V A;  2Y8G A;  2O6V A;  1JWU D;  3AE2 B;  4AQ7 A;  5EE0 A;  4R3D A;  3RNF C;  1RJ2 A;  1IYF A;  1V89 A;  2KLG A;  3DBL B;  1XX0 A;  4OT1 A;  5GOW B;  2WXM A;  3F0W A;  1C79 A;  3QCA A;  5LON B;  2V3N A;  3ETR A;  1C78 A;  4YON A;  4RH6 A;  2CJO A;  2JWZ A;  3NZU A;  1S1Q B;  4IDI A;  2D3G A;  3A9K A;  5EE3 A;  1I7A A;  2YS5 A;  1UZX B;  2K2J A;  4IM2 A;  1SSN A;  4DX9 0;  2RSG A;  1F0Z A;  4DX8 A;  2KD0 A;  3O13 A;  1E7V A;  1HQR D;  3MPX A;  1KTK A;  3Q3O C;  3VH3 B;  4FN2 A;  4KDL B;  4BOZ B;  3UIP B;  3DXD A;  5G55 A;  3VXW A;  3RNA C;  2WU5 B;  3ZRC A;  1WX8 A;  2VRW B;  2LMC A;  2Y8F A;  5BYS A;  1LFD A;  2KK8 A;  5J2R A;  2IPK D;  1WXV A;  2KJH B;  5GMV A;  4LNN A;  1WGR A;  2BT6 A;  1J7A A;  4DBG A;  3DOW A;  3LJU X;  1XT9 B;  1ZXH A;  2NMB A;  3D8D A;  5JXV A;  3TEX A;  2CY4 A;  3Q8E A;  5DPW A;  4EMO A;  1Z2M A;  4LK0 M;  4ANV A;  3AI5 A;  2M38 A;  1R4N B;  3IAS 1;  2MRP A;  1PFD A;  2BPS A;  2BYV E;  2QKM A;  1FGZ A;  4IM3 A;  2CY5 A;  2OED A;  2KDI A;  3B1L X;  1WSP A;  4K81 A;  1ACC A;  4ANU A;  2FCS A;  4IWQ A;  5FK9 C;  4W9I A;  1OFF A;  1OEY J;  3PZ8 A;  4AP4 C;  4DXF A;  4AJY B;  2KVZ A;  4C00 A;  4HAX B;  3L13 A;  3NJT A;  1X1F A;  2A4Z A;  1UNS A;  2PIA A;  2IDY A;  2M4N A;  3I57 A;  2WX1 A;  1T0Q C;  3AEF B;  4II2 B;  3A58 A;  3VR9 B;  2I5F A;  2K6D B;  4MEM A;  5I2S A;  2W2X D;  5I2M A;  3A9J A;  2R09 A;  1T77 A;  2QSD A;  2J4X A;  4HAZ B;  3PVU A;  4GB9 A;  1K52 A;  1DDV A;  1XLN A;  3G9W A;  3BK1 A;  2DHZ A;  3PP2 A;  2JSV X;  4ACF A;  4XWT A;  1D6E C;  4KHA A;  4TMA B;  4WVF B;  3QHT A;  4EZJ A;  3ZDM C;  3T06 A;  2M17 A;  2EKI A;  3KSY A;  1ZDX A;  1L4D B;  5EE9 A;  1WH3 A;  5BMI A;  2H7D A;  4MGK E;  2AYO B;  1GAQ B;  1WRI A;  4PYU A;  2G9H D;  2L32 A;  1M7E A;  1Q67 A;  2MW5 A;  1X11 A;  4HLE A;  2JU6 X;  2K5P A;  5LXI B;  3I3T B;  4PYZ A;  4A55 A;  4LNO A;  1N3H A;  1WY8 A;  2WXN A;  2N9K A;  2LVO A;  4HB0 B;  2NVU I;  2YRY A;  3EUB 2;  4NNJ B;  3R7Q A;  2H7E A;  1ZSQ A;  3QAR A;  4HXD A;  4LTU A;  1HZ5 A;  2HTH A;  3KUD B;  4WAF A;  2REX A;  2JXT A;  1F9J A;  1NDD A;  2DLB A;  2QHO A;  1IBX B;  1WGU A;  4K3B A;  1W1H A;  2BS2 B;  1V1P B;  5FI0 A;  1TKY A;  3AE1 B;  1RFA A;  1QZE A;  2LRW A;  3B0A A;  2WHI A;  4NAW B;  1A70 A;  2KQ4 X;  2RLO A;  1KM7 A;  2V3P A;  1WIA A;  3S2A A;  1UD7 A;  1NI3 A;  1NYR A;  5KQ1 A;  4HCN B;  1YOV B;  5D3V A;  4JIO U;  2LJI A;  1TTN A;  2XBB C;  3DBR I;  4E71 A;  5AUI A;  1G6J A;  1T0Y A;  4K2P A;  4GMV A;  2JX5 A;  2PE9 A;  2CJN A;  2IBI B;  3H7P B;  1MI0 A;  2MBB B;  4M0W B;  1D5M C;  4YSX B;  1VR9 A;  1WYW B;  1YQ4 B;  1E6E B;  3NOB A;  4NQK E;  3EEC A;  4A6F A;  1VZ7 A;  1HTQ A;  4DK5 A;  4KHB A;  4LJO B;  2E2X A;  4RFB A;  1UWM A;  2JY6 A;  3SO6 A;  1SIJ A;  2ACZ B;  3FKY A;  2YVC A;  2EC1 A;  1J19 A;  3BVM A;  2NZ8 B;  2KOX A;  1TKG A;  1D3Z A;  3L4P A;  4H8S A;  1E8Y A;  3GZN I;  1P98 A;  2Z0D B;  4K7U A;  3MC8 A;  2MSE D;  2DLW A;  2AWT A;  2TSS A;  3JW0 X;  4KSL C;  3PS6 A;  5IRS A;  2M19 A;  1SJH D;  2ELA A;  4DDG D;  3ZNZ B;  1I4R A;  1WI0 A;  2KC1 A;  2K49 A;  2CR5 A;  3W2D A;  3X0W A;  1VLB A;  1E8X A;  4LJP B;  1N6Z A;  3NUH B;  3BIN A;  4JQW C;  3NZS A;  1VRA B;  4F7Z A;  4MAC A;  3FAH A;  3V61 A;  1PYW D;  4RM8 A;  1KH0 A;  3APF A;  2CHW A;  4C56 C;  1I4P A;  3ZUN A;  2X8X X;  2OTX A;  4M00 A;  3U7D A;  1HEZ E;  1TQZ A;  3RNB C;  3PZD A;  5KHQ A;  1ZGU B;  5C3J B;  3IFW B;  5D27 A;  3WCQ A;  3NWA A;  5I4D A;  4ASW C;  3PRM B;  3RFZ B;  5JHG A;  1MI1 A;  2J42 A;  2WYQ A;  3RD2 A;  3ZO5 B;  1D5Z C;  5BMG A;  3NG0 A;  1NTV A;  4LNF A;  2DNF A;  3BWU D;  1K53 A;  1P3R A;  1YMH E;  2LGX A;  1UNP A;  1QOB A;  3K9P B;  3MJ5 A;  3Q69 A;  1P7E A;  2C7N B;  3N7C A;  2EMS A;  1V49 A;  1JML A;  2QMT A;  1L7Y A;  2FCN A;  1I4X A;  4LNK A;  1P6S A;  3ZJT A;  2PJH A;  2LI5 A;  2GUM A;  2AL3 A;  2DHJ A;  2COA A;  3P4R B;  4L1B A;  2AEH A;  2WLB A;  3ULB A;  2K1F A;  4LDT B;  4BKS D;  3W5U B;  3FM8 C;  4WQM A;  1TXD A;  1DRO A;  2KDE B;  4HAT B;  3NWF A;  4QJ5 B;  2MBE A;  2KX3 A;  2WGS A;  3SU8 X;  4N6E B;  1YX6 B;  3ZDT A;  2HJ8 A;  5HFY A;  4AJW A;  2BKF A;  3GYO A;  2NPT B;  4B0E A;  1V88 A;  2D4Q A;  1ZDV A;  4C4V A;  1QT9 A;  4WJO A;  4ZHO A;  5C5B B;  1GOZ A;  2M0X A;  4IG7 B;  4GMX B;  1R4M I;  2Q13 A;  1E7U A;  1X05 A;  4KSK C;  1PLS A;  4W9E A;  2Z0Q A;  1U5G A;  1XR0 B;  3APC A;  1FB8 A;  1K5G B;  3MDB C;  4CYE A;  4K2O A;  4ZOH C;  1LB1 A;  4GOU A;  1U27 A;  2L0T A;  3UIO B;  2KUP A;  2KAN A;  1RYJ A;  2PVO D;  4E3C A;  2N1V A;  3PGE A;  4MGI E;  3DXE A;  3KWV A;  1LQB A;  1VDV A;  1Z5S B;  2Z8L A;  1FCL A;  4G11 A;  2L52 A;  2BYT A;  1MG4 A;  1WR1 A;  3FIL A;  2XEW A;  2COC A;  2LOX A;  2KWU B;  3A4S C;  1J0G A;  4HJG E;  2MQJ A;  2L8J A;  2IGG A;  3H8H A;  1XLP A;  3ZXV A;  1KLG D;  1B1Z A;  3GS2 A;  1OY2 A;  3TSS A;  1NBF C;  3AE3 B;  1WZ3 A;  3Q6B A;  5IP4 D;  2MWS B;  2ONQ A;  4KAX B;  2V4L A;  4HKQ A;  4PK1 A;  1VZ8 A;  4JL9 A;  1EWC A;  3U30 A;  3VQI A;  5DPS A;  3DQV A;  1EAZ A;  2D3B A;  4MSM B;  3BY4 B;  2NBV B;  2HTM E;  3I63 C;  5T8I A;  2M1M A;  2K22 A;  2KWC A;  2RPQ A;  2FAZ A;  1RRP B;  5AZH A;  1TY0 A;  4A6Q A;  2VKI A;  3NRZ A;  1HA5 A;  4FHJ A;  1V5P A;  5FKA C;  5C16 A;  4GXB A;  3ZRF A;  1YIW A;  3ABV B;  3L16 A;  3NS1 A;  3F5R A;  1GJZ A;  4MM3 B;  4ANX A;  1M7R A;  1E5W A;  3R3M A;  1W1D A;  4N59 A;  4G0N B;  1LXD A;  4W9K A;  2KWD A;  5LNK 1;  1Y5O A;  3KYD D;  4OVU A;  4D0N B;  4ICV A;  2IJ0 A;  4WQO B;  4KGT A;  3PEG A;  1U5D A;  1SGH A;  4A5K A;  1L0X B;  2YT1 A;  2INN E;  2KAJ A;  3DBL I;  3MHZ A;  1F2R C;  3SHQ A;  5JHB A;  2D07 B;  3AU5 A;  3VFK A;  1RAX A;  2INC C;  4XWW A;  3VVW B;  2WXK A;  2Y5C A;  1NEK B;  3UZT A;  1M94 A;  3AE8 B;  3WA0 A;  1OMW A;  3V6E B;  2W55 A;  2ZW0 A;  3CF6 E;  4GU2 A;  4TYZ A;  5E6P A;  2LEK A;  3WAL A;  3P7Z A;  2ZVN A;  2PE6 B;  3NVW A;  3U12 A;  2J0J A;  3PPA A;  1ZVR A;  4A20 A;  1JQ4 A;  3HK0 A;  2IO0 B;  3JSV B;  1IP9 A;  3KH0 A;  5FR3 A;  4HAY B;  1FEH A;  4J3O D;  2W82 A;  5H92 C;  3P2B A;  2N0S B;  2NR2 A;  1WVH A;  3ZNI D;  4LNI A;  2GB1 A;  3N1Z C;  3DHG C;  2PVG C;  5LOP B;  4GDL B;  5AUK A;  4HK2 A;  5HE1 A;  1HZ6 A;  1I7H A;  3MFG A;  4KV2 A;  2GLS A;  5LG4 B;  2DX1 A;  3VR8 B;  1JRO A;  2N1W A;  2C7M B;  1R4N I;  3D8F A;  2OQB A;  2MA9 B;  5JP4 A;  1HXY D;  4IM0 A;  1BT0 A;  1Y8R C;  4Z2M B;  1FAO A;  1WJN A;  2KDF B;  2WXF A;  3A33 B;  2Z0P A;  4ZHP A;  1TGZ B;  3BYY B;  1MJD A;  2C60 A;  2LG1 A;  2CHZ A;  2HE7 A;  1LGR A;  2K39 A;  1D4B A;  4KZ0 A;  1UGM A;  1GB4 A;  4HB4 B;  1MG8 A;  3BJI A;  5CLL B;  3PSE B;  3M62 B;  1EF5 A;  1PMS A;  3P4Q B;  1X86 A;  1V97 A;  4C0A A;  1DDM A;  2YEP F;  1QIL A;  4MGY E;  1SBB B;  3OWE B;  4ICU A;  2LGD A;  2AQ1 B;  5IOI A;  2PLP A;  1MPH A;  4I6L B;  3UQB A;  4M01 A;  2RGF A;  1FMA D;  4XZ4 A;  2D3A A;  4F8C B;  2PZ1 A;  1IBX A;  2JZ3 B;  1OQQ A;  4HAW B;  4L6E A;  1V1P A;  5CLQ B;  4EEW A;  3ZKJ C;  4H2A A;  3SNH A;  4US8 A;  1MFW A;  4NAW A;  3ZTD A;  4EJN A;  3GP7 A;  3ZJU A;  4GSW A;  2LGS A;  1AYF A;  2NCN A;  3C8Y A;  3IG3 A;  1JRU A;  3PVW A;  2GCJ A;  5L83 A;  2V9H A;  4HHV A;  2I1J A;  2WXR A;  1VCB A;  1XLQ A;  4EZK A;  2NTS A;  1YJJ A;  1U4A A;  4ZYS A;  2M0A A;  4WJQ A;  1YN4 A;  2MJ3 A;  2R61 A;  5J18 A;  3H7P A;  4MEL A;  2L7R A;  4E74 A;  5IKC M;  4M0W A;  4YSZ B;  4HSI A;  3N1Y C;  4MH8 A;  2J0M A;  5E6O A;  2WDQ B;  1V5U A;  3SV1 A;  4MY6 A;  1E8W A;  4KDI C;  3ECI A;  1U5E A;  3RCP A;  4NAM A;  5D3D A;  2G3Q B;  1WGQ A;  2B76 B;  4GZU A;  4NQL B;  1YNT E;  4K7W A;  3P63 A;  3VTU A;  1SE3 A;  2K2U A;  3VAW A;  1V1O A;  2JQR B;  3W1S A;  3R2I A;  3N3K B;  1UPQ A;  1CK1 A;  5C79 A;  4TUU A;  1U5F A;  2D9W A;  4N58 A;  2W3S A;  2WDT B;  3KVF B;  1MHH E;  2GMI C;  3DCX A;  1TS4 A;  5FR6 A;  1ROE A;  4YTN B;  2KFK B;  3QK0 A;  4ZRJ A;  4FJZ A;  4KVG B;  1EU3 A;  2H89 B;  1KFY B;  1AQC A;  1OQY A;  2FE8 A;  2BQQ A;  5CHF A;  3V3X A;  1R7S A;  2B3A A;  1V5O A;  1B55 A;  2KQS A;  2K8C A;  1ZKH A;  1F1H A;  2MBO A;  3NVZ A;  1DOX A;  3ZIM A;  2DWQ A;  1C4C A;  2CU1 A;  2RDH A;  1UBI A;  1I42 A;  3MP9 A;  5FI1 A;  2DYQ A;  4JGH B;  3TL5 A;  4XX5 A;  1UGJ A;  1FNV A;  2KCJ A;  3PLV A;  1IGD A;  2DX5 B;  4A6H A;  1Q1O A;  2COF A;  2JUO A;  2O2V B;  1QOF A;  1WG7 A;  3E56 A;  4IFS A;  1Q0W B;  2WDV B;  2N7D A;  4YL8 A;  2WNM A;  3A1Q B;  3ALB A;  2UVM A;  2BS3 B;  3WAO A;  2G35 A;  1WXS A;  4RM9 A;  4AWJ A;  4P16 A;  1ET9 A;  1HE8 A;  3RMK C;  1SXT A;  1SJE D;  1STE A;  2O6V D;  2GI9 A;  3AE9 B;  1SE2 A;  4K3C A;  3I9V 1;  2K00 A;  4HJK A;  2JZP A;  3CMM B;  3BK2 A;  1JRP A;  1V81 A;  3ZGZ A;  2C9W B;  2UZR A;  3AE7 B;  2L1A A;  1XXG A;  2FJL A;  3ONS A;  2NPT A;  3VRB B;  3IT6 B;  2OHF A;  1FD6 A;  1SE9 A;  2E3T A;  1ZPS A;  2E6X A;  5C5B A;  3PO0 A;  1WJ4 A;  1NU2 A;  4NJ7 A;  1V61 A;  3HSA A;  3A4R A;  1X1M A;  4X57 B;  2L76 A;  2UWQ A;  4BVU C;  3E9S A;  3JVZ X;  1XO3 A;  3MJW A;  5HG2 A;  5KQ4 A;  2IY1 B;  1XCT L;  3OHM B;  3WAN A;  2N7E A;  2KMA A;  2W2W A;  2KDB A;  2LD9 A;  4IC7 B;  3ZXR A;  1TYG B;  1FFU A;  4W9D A;  4WJ7 A;  1NI2 A;  5DPT A;  4OVV A;  2DN6 A;  3LXF A;  3CXB B;  3KLS X;  4A8X C;  2ON8 A;  2K9X A;  2ZNV C;  1PFJ A;  1T5X D;  4WWO A;  3PLU A;  1N63 A;  5J3T A;  2D10 A;  2G45 B;  5E6J A;  3LB8 C;  1UF0 A;  3GE3 C;  2NBW B;  3PVL A;  1FO4 A;  3IXS A;  3DXC A;  1N5X A;  5D3X A;  3HM3 A;  3UGB B;  2UU7 A;  3IBE A;  1HTO A;  4B9K A;  1A5R A;  2RDB C;  5C1Z A;  4DHZ B;  1WXA A;  1W1G A;  2QIE B;  3Q3N C;  2BB5 A;  3UQA A;  2BS4 B;  5CHW A;  5D3W A;  4FHK A;  2NBV A;  1JWS D;  4EKU A;  3BZD B;  2IYB A;  1JCK B;  1NEN B;  1ESF A;  3AXC A;  1D5X C;  4ZYN A;  2YS1 A;  1K8R B;  2PW9 A;  1C3T A;  1PUT A;  1VZ6 A;  3TEY A;  2WXO A;  4TSS A;  3T9L A;  2J53 A;  2YT0 A;  1TZ1 A;  1OGW A;  4KGR A;  4HVB A;  1FNU A;  1XKE A;  3ZW3 A;  3Q3M C;  4K1R B;  3DVG X;  3VUY A;  4MM3 A;  4EOY A;  2KQ7 A;  5IAA C;  4KZC A;  3W9C B;  3U8Z A;  4TV3 A;  3DVN U;  2ZCC A;  1K51 A;  3SD5 A;  3EFU A;  5IO9 A;  1FIQ A;  5DH9 B;  2PKO A;  3QWM A;  1E90 A;  4IAP A;  4GNK B;  4OSN A;  1SE4 A;  4TQ0 A;  1KRH A;  3MC9 A;  2KFJ A;  4C7Z A;  2LWP A;  2N7J A;  4I6P A;  1T3Q A;  5BO4 B;  3KRW A;  4ARC A;  1F52 A;  4WIP A;  1ENF A;  1KOT A;  2K0P A;  3Q3F A;  5JLJ B;  1ZOY B;  2MDX A;  2BWE S;  2G4D B;  4KHO A;  1Y56 A;  1FOE A;  4P7I A;  5D3I B;  1MAI A;  1OQN A;  1F77 A;  2IFS A;  3K9O B;  1H8C A;  4NPN A;  2OOB B;  2Z14 A;  3MTN B;  3PTF C;  1BWN A;  3NSU A;  3AU4 A;  2RUK B;  5L81 A;  3JSV A;  4B95 A;  4HEA 1;  2OJW A;  3L08 A;  1C1Y B;  5HE0 A;  2CKH B;  2I2Y A;  2MHJ A;  5GXG B;  3IHP C;  3D32 A;  3ML4 A;  4F7H A;  1EVH A;  5G5H A;  2CHX A;  3KUC B;  2L83 A;  1WGK A;  1E0Z A;  3HHM A;  1TBE A;  4GDL A;  5C2T B;  5JZE B;  1LO5 D;  4IUM B;  2G1E A;  4YWG G;  2WP9 B;  2FUH B;  2N9P C;  1AWE A;  2WX0 A;  2LGI A;  2JYE A;  4C7Y A;  5TR5 A;  4LCD E;  3D8E A;  1DYN A;  3M3J A;  4M8N A;  1TZO A;  2LFI A;  4W9C A;  2LUE A;  5DIF B;  1Q5W B;  2WXJ A;  3DWM A;  1CZP A;  2Z13 A;  3AEE B;  2GBN A;  2WDR B;  1PGX A;  4HDO A;  4KIK B;  3APD A;  3PG7 A;  3OAN A;  1AAR A;  1V8C A;  4MDK E;  3R8B A;  1KF6 B;  4WWP A;  2KUQ A;  2KZR A;  3AE6 B;  1FXA A;  3AE4 B;  4MGZ E;  4FJV B;  4AS1 A;  3B2F A;  3HW2 B;  3ML9 A;  4YTP B;  1BUI C;  3A8Q A;  1WGD A;  2UZS A;  3TVV A;  5JHA A;  5JHH A;  2GRI A;  4YTM B;  1GB1 A;  3PZ7 A;  1WYG A;  2MLB A;  3U2S C;  4CQN A;  1UH6 A;  4BAX A;  2RR9 A;  3OJ3 A;  4JWU C;  4XE0 A;  2KMM A;  4BBN F;  1SIF A;  2FID A;  5C23 A;  1FCC C;  2LZ6 A;  1B9R A;  2Y5P A;  3NY5 A;  5DHA B;  4Y94 A;  3R66 C;  2M14 A;  2AQ3 B;  3N1X C;  1ZP0 B;  3Q8A A;  4PNK A;  2L3Z A;  2XNA C;  2L1C A;  2XN9 C;  3AUL A;  3L0W B;  1ET6 A;  1XOD A;  1QLB B;  1MPE A;  3HRD D;  2DZI A;  3W5V B;  1TJ6 A;  4D2K A;  3L10 B;  2LUM A;  4BKT A;  3QQ8 B;  4XDD A;  3EC8 A;  2Z59 B;  3TEW A;  1V6E A;  4HB3 B;  2ZPN A;  2IO3 B;  4B6W A;  3AM9 A;  2KIE A;  2FCM A;  4CHJ A;  2HJ1 A;  1U2B A;  2LHE A;  2JPH A;  2YSZ A;  5LXH A;  3CST A;  2DYO A;  1WGH A;  2KJR A;  1L4Z B;  2WXG A;  5DHF B;  4QAY A;  1KZ7 A;  4GGQ A;  1WRD B;  3M95 A;  5HE2 A;  2ZW1 A;  4IOY X;  4BFR A;  4MH0 E;  4FLH A;  1UPR A;  2DKP A;  2DYM A;  1XD3 B;  2ZKM X;  3WYF B;  5LLI A;  2EMT A;  3NW8 A; 
#chains in the Genus database with same CATH homology
 2LVP A;  1WJ6 A;  4EUT A;  2XQN M;  3DVG Y;  2LOZ A;  1WI1 A;  3ENE A;  3VIA A;  4PS3 A;  4CHM A;  3TBL D;  3DPD A;  3H7S A;  4HAU B;  3WIM A;  2RGN B;  3M63 B;  2GBM A;  2J59 M;  4F1S A;  2JF5 A;  2BKR B;  3TIX A;  2KFK A;  2CAY A;  1ZW7 A;  1OTR B;  1RLF A;  3ZNH B;  4MK0 A;  2RVB B;  2BGF A;  1WM2 A;  2D11 A;  1I2H A;  4G50 A;  4FA6 A;  3SUZ A;  1WGG A;  1WJM A;  3DDC B;  2DHI A;  2GBJ A;  3V60 A;  1UEL A;  1K5D B;  3PRP B;  2XK5 B;  2JXX A;  1P3Q U;  2NS5 A;  2D2Q A;  2DX5 A;  3HQC A;  2O2V A;  4W9H A;  2KXJ A;  2DFK A;  5AZF A;  2GCL A;  2DAF A;  3Q3J A;  4IWP A;  5EFX A;  3A1Q A;  2DKQ A;  1V5T A;  4XWX A;  4ANW A;  2D9Z A;  4XC2 A;  2DZJ A;  2ASQ A;  2CS4 A;  1WZ0 A;  2MBQ A;  2J7Q B;  2LUL A;  2I5C A;  3PHX B;  2KO3 A;  2MP2 B;  1UEF A;  5DI9 B;  3V5W A;  3NS8 A;  2KNB A;  2BCJ A;  4DHJ D;  1H4R A;  3ZTC A;  2KMC A;  1H10 A;  4GPT B;  3O96 A;  2Y5B B;  2RD0 A;  4K17 A;  2LGY A;  3A8P A;  5D7G A;  1X1G A;  3GYP A;  2KC2 A;  3VH4 B;  1MK7 B;  3AJ4 A;  2RSU A;  4MJS B;  5C6R A;  1V5M A;  1ISN A;  2DZK A;  2K25 A;  4ZDV A;  4WWN A;  4NY0 A;  2DYB A;  3QJZ A;  2KN5 A;  2JT4 B;  4TKN A;  4II3 B;  4DHJ B;  3R7R A;  2K8H A;  2ZNV B;  1BTN A;  5AEK B;  3V62 A;  1DBH A;  3VUW A;  3TCA A;  3VHT C;  2P8V A;  3ODW A;  2EKE C;  5J3Y A;  1WMH B;  3SYX A;  4A3P A;  4BBK A;  2LAS A;  4IW0 A;  2JZZ A;  1KZG A;  1GNU A;  4GIV A;  4I6N B;  1XCG A;  3KYC D;  5DPR A;  1WFY A;  2W9N A;  3C0R B;  2ZJD A;  1DDW A;  5KHO A;  1U29 A;  3DBS A;  4FBJ B;  2P0F A;  3OLM D;  2OJR A;  2KTR B;  4WAA A;  4PS8 A;  3P6A A;  1V86 A;  1WX9 A;  3TO1 A;  2ROV A;  4F7G A;  2N23 A;  3N30 A;  2BWF A;  1FGY A;  3QC8 B;  2QKL A;  4WJN A;  4BKG A;  4GDK B;  3CIK A;  3DVN V;  1BTK A;  3DCG A;  3W1Y A;  1EF1 A;  5HE3 A;  3RT3 B;  2BF8 B;  1UNR A;  2J0K A;  2P0H A;  4ZRK A;  3ML8 A;  2DAJ A;  1MIZ B;  1P0R A;  4DBB A;  1S3S G;  2IYD B;  1VD2 A;  2DYN A;  1P9D U;  2I1K A;  3MHS D;  5J17 A;  3PRE A;  3L54 A;  4ZRI A;  2KTF A;  2WWZ A;  4NSW A;  2GBK A;  2DHK A;  2KKC A;  2DEN B;  2VRR B;  4NJ6 A;  3ODX A;  1Z87 A;  4M8M A;  4BKS A;  3UF8 A;  2JRH A;  2O6V B;  4DDI D;  1GG3 A;  4KIK A;  3T8M A;  2COD A;  1UBQ A;  3FEH A;  2LKO A;  2N0Y A;  2MKR A;  4A3O A;  2L2I A;  2IO1 B;  2D9X A;  3KW5 B;  1UNQ A;  1PQS A;  3RZF A;  1WE7 A;  3A9K B;  4EZL A;  2L0F A;  4RMA A;  2KHW B;  3SDL C;  3N32 A;  1MKE A;  3EHV A;  1J8C A;  1FXT B;  1IRS A;  1WXM A;  2LRU A;  2ZCB A;  3RYT A;  5AZG A;  4B6H A;  2V3S A;  1V80 A;  1WR6 E;  2ADZ A;  3ULC A;  2KJ6 A;  5L95 C;  4HB2 B;  4CHK A;  3ODO A;  3TFM A;  1GC7 A;  1RRB A;  4DWF A;  2ZVO A;  2YS3 A;  4W9J A;  1EO6 A;  2BYF A;  4LDT D;  1ZC4 B;  2EJ8 A;  4DHZ E;  3VOQ A;  1NTY A;  4BBN C;  1LM8 B;  1P1A A;  1GC6 A;  1FHO A;  1QQG A;  2ZPY A;  3VDZ A;  1KJT A;  1ZM0 A;  4FUL A;  3A9J B;  2YF0 A;  1E8Z A;  2X18 A;  1I35 A;  4HCP B;  3PT2 B;  3RUL A;  2MBH A;  3JYU A;  5IA7 A;  5CX3 A;  3KRX A;  4FJY A;  1EUV B;  1LW3 A;  4URK A;  2GS0 A;  2W2X C;  2KVR A;  2ZEQ A;  2VSZ A;  3ZVV A;  4IWO A;  3VTW A;  4MT7 A;  2Z0O A;  3PHW B;  2NBU A;  2L00 B;  5E6N A;  3X23 A;  5G2N A;  1WJU A;  2KWV B;  2K8B A;  2XK5 A;  2HTH B;  2V1Y A;  4HPM B;  1GUA B;  2HD5 B;  2GOW A;  3VTV A;  2A5U A;  1L2N A;  1Y19 B;  3M1I B;  2D9Y A;  1WE6 A;  2R2Q A;  2Z0E B;  2DZM A;  5KCV A;  2PEA A;  2C5L C;  3HM6 X;  4HAV B;  1OEY A;  2JRI B;  3KZ1 A;  5D3Y A;  3PV1 A;  5D94 A;  1YD8 U;  3FSS A;  2KGX B;  4JLC A;  2MP2 A;  3VUX A;  3WAP A;  1YJ1 A;  2ZZP B;  3W1S C;  4WSF A;  1WJ1 A;  2GJY A;  3QAQ A;  4HWI B;  2MCN B;  4A6F B;  2LJ5 A;  4GOC A;  2DTC A;  4KHB B;  1YX5 B;  4W9G A;  2PPH A;  4CO7 A;  1KI1 B;  2IO2 B;  3B08 A;  3KY9 A;  1MIX A;  1ZC3 B;  4N9F 4;  4Z2N A;  4W9L A;  4WJP A;  3TW1 A;  2YLM A;  1FHX A;  1QC6 A;  4DXA B;  3HIZ A;  3NHE B;  2MFQ A;  3GOE A;  1V2Y A;  4MJS A;  4W9F A;  4MSQ B;  3TJP A;  2C7H A;  1FHW A;  3LDZ E;  4GN1 A;  3A98 B;  3QIJ A;  3PSC A;  3IVF A;  1SHC A;  1J0W A;  2N4F A;  4HPL B;  3CSF A;  2CRF A;  4F7U P;  1XD4 A;  5D2M B;  2FNJ B;  2IZV B;  4PQ0 A;  2L05 A;  2D9V A;  1WMH A;  2G4S A;  2R2O A;  2FIF A;  2P0D A;  4HDQ A;  5EDS A;  2LXA A;  4FAD A;  4BOS C;  2BYE A;  4TQ1 A;  2JVC A;  5CHV C;  1WM3 A;  1EGX A;  4K7S A;  2IY0 B;  5D6J B;  2Y7B A;  1MK9 B;  1WX7 A;  1XQQ A;  2V76 A;  3RUI B;  2K6Q A;  1BAK A;  4EFO A;  3QWZ B;  4J6I A;  1KLV A;  5CTR C;  5J3Q A;  3QBV B;  2KTR A;  5HKH A;  3O65 B;  3ZNG C;  1WGY A;  2FCQ A;  3ZVR A;  2ROZ B;  3OJ4 B;  5DCN A;  2N9X A;  1CMX B;  2AL6 A;  2RNR B;  3UIN B;  2GBR A;  4GDK A;  3KUZ A;  2M8S A;  2N9E B;  3LJ3 A;  4A6K A;  3RZW C;  2KLC A;  4AOF A;  2LXC A;  4PS7 A;  2KX0 A;  1IPG A;  3L17 A;  3PRZ A;  3QX1 A;  1P5T A;  3RCZ A;  3ZLZ A;  2LYD A;  4G3X B;  2UYZ B;  3H1U A;  3QA8 A;  3V6C B;  3WAM A;  2MX2 A;  3H6N A;  2DA0 A;  3TMP B;  3H9D A;  2LVQ A;  3OAW A;  1V9J A;  1YQB A;  2R0D A;  2JP2 A;  3DBH I;  5JH5 C;  2ELB A;  2MWN B;  4AUQ C;  1WF9 A;  2Y8G A;  2O6V A;  1RJ2 A;  1IYF A;  1V89 A;  2KLG A;  1XX0 A;  5GOW B;  3F0W A;  3QCA A;  5LON B;  4YON A;  2JWZ A;  3NZU A;  1S1Q B;  2D3G A;  3A9K A;  1I7A A;  2YS5 A;  1UZX B;  2K2J A;  4IM2 A;  4DX9 0;  2RSG A;  4DX8 A;  2KD0 A;  1E7V A;  3MPX A;  3VH3 B;  4FN2 A;  4KDL B;  4BOZ B;  3UIP B;  3DXD A;  5G55 A;  3VXW A;  3ZRC A;  1WX8 A;  2VRW B;  2Y8F A;  1LFD A;  2KK8 A;  5J2R A;  1WXV A;  2KJH B;  5GMV A;  1WGR A;  4DBG A;  3DOW A;  3LJU X;  1XT9 B;  2NMB A;  3D8D A;  2CY4 A;  5DPW A;  4EMO A;  1Z2M A;  4ANV A;  3AI5 A;  2M38 A;  2MRP A;  2BPS A;  2BYV E;  2QKM A;  1FGZ A;  4IM3 A;  2CY5 A;  2KDI A;  3B1L X;  4K81 A;  4ANU A;  2FCS A;  4IWQ A;  4W9I A;  1OEY J;  4AP4 C;  4AJY B;  4HAX B;  3L13 A;  1X1F A;  2A4Z A;  2M4N A;  2WX1 A;  4II2 B;  2I5F A;  2K6D B;  4MEM A;  2W2X D;  3A9J A;  2R09 A;  4HAZ B;  4GB9 A;  3PVU A;  1DDV A;  3G9W A;  2DHZ A;  3PP2 A;  4KHA A;  4WVF B;  3QHT A;  4EZJ A;  3ZDM C;  3T06 A;  2M17 A;  3KSY A;  1WH3 A;  2H7D A;  4MGK E;  2AYO B;  4PYU A;  1M7E A;  1Q67 A;  2MW5 A;  1X11 A;  4HLE A;  5LXI B;  3I3T B;  4PYZ A;  1N3H A;  1WY8 A;  2LVO A;  4HB0 B;  2NVU I;  3R7Q A;  2YRY A;  4NNJ B;  2H7E A;  1ZSQ A;  3QAR A;  4HXD A;  2HTH A;  3KUD B;  2REX A;  1F9J A;  1NDD A;  2QHO A;  1WGU A;  1W1H A;  5FI0 A;  1RFA A;  1QZE A;  2LRW A;  3B0A A;  4NAW B;  2RLO A;  1KM7 A;  3S2A A;  1WIA A;  1UD7 A;  5KQ1 A;  4HCN B;  5D3V A;  4JIO U;  1TTN A;  2XBB C;  3DBR I;  4E71 A;  1G6J A;  1T0Y A;  4K2P A;  4GMV A;  2PE9 A;  2IBI B;  3H7P B;  2MBB B;  4M0W B;  1WYW B;  3NOB A;  4NQK E;  3EEC A;  4A6F A;  4DK5 A;  4LJO B;  2E2X A;  2JY6 A;  3SO6 A;  2YVC A;  2EC1 A;  1J19 A;  2NZ8 B;  2KOX A;  1D3Z A;  4H8S A;  1E8Y A;  3GZN I;  1P98 A;  2Z0D B;  4K7U A;  2MSE D;  2DLW A;  2AWT A;  3JW0 X;  4KSL C;  3PS6 A;  4DDG D;  2ELA A;  3ZNZ B;  1WI0 A;  2KC1 A;  3X0W A;  2CR5 A;  1E8X A;  4LJP B;  3BIN A;  4JQW C;  3NZS A;  4F7Z A;  3V61 A;  4RM8 A;  3APF A;  2CHW A;  3ZUN A;  2OTX A;  3U7D A;  1TQZ A;  5KHQ A;  3PZD A;  1ZGU B;  3IFW B;  5D27 A;  4ASW C;  3PRM B;  5JHG A;  2WYQ A;  3RD2 A;  3ZO5 B;  1NTV A;  1P3R A;  2LGX A;  1UNP A;  3K9P B;  2C7N B;  3N7C A;  2EMS A;  1V49 A;  1L7Y A;  2FCN A;  1P6S A;  2PJH A;  2LI5 A;  2AL3 A;  2DHJ A;  2COA A;  2AEH A;  3ULB A;  2K1F A;  4LDT B;  4BKS D;  3FM8 C;  1TXD A;  1DRO A;  2KDE B;  4HAT B;  2MBE A;  2KX3 A;  3SU8 X;  1YX6 B;  3ZDT A;  2HJ8 A;  4AJW A;  2BKF A;  3GYO A;  2NPT B;  1V88 A;  2D4Q A;  4WJO A;  5C5B B;  2M0X A;  4IG7 B;  4GMX B;  1R4M I;  2Q13 A;  1E7U A;  1X05 A;  4KSK C;  1PLS A;  4W9E A;  2Z0Q A;  1U5G A;  1XR0 B;  3APC A;  1FB8 A;  1K5G B;  3MDB C;  4CYE A;  4K2O A;  1LB1 A;  1U27 A;  2L0T A;  3UIO B;  2KUP A;  2KAN A;  4E3C A;  2N1V A;  3PGE A;  4MGI E;  3DXE A;  1LQB A;  1Z5S B;  4G11 A;  1WR1 A;  2XEW A;  2COC A;  2LOX A;  2KWU B;  3A4S C;  1J0G A;  2MQJ A;  2L8J A;  1OY2 A;  1NBF C;  1WZ3 A;  2MWS B;  4KAX B;  2V4L A;  4JL9 A;  3U30 A;  3VQI A;  5DPS A;  3DQV A;  1EAZ A;  4MSM B;  3BY4 B;  2NBV B;  2M1M A;  2KWC A;  2RPQ A;  2FAZ A;  1RRP B;  5AZH A;  2VKI A;  4FHJ A;  1V5P A;  5C16 A;  4GXB A;  3ZRF A;  1YIW A;  3L16 A;  3F5R A;  1GJZ A;  4ANX A;  1M7R A;  1E5W A;  3R3M A;  1W1D A;  4G0N B;  1LXD A;  4W9K A;  1Y5O A;  3KYD D;  4OVU A;  4D0N B;  4ICV A;  4WQO B;  3PEG A;  1U5D A;  1SGH A;  4A5K A;  2YT1 A;  3DBL I;  3SHQ A;  5JHB A;  2D07 B;  3AU5 A;  3VFK A;  1RAX A;  3VVW B;  3UZT A;  1M94 A;  3WA0 A;  1OMW A;  3V6E B;  3CF6 E;  4GU2 A;  4TYZ A;  5E6P A;  3WAL A;  3P7Z A;  2ZVN A;  2PE6 B;  2J0J A;  3PPA A;  1ZVR A;  4A20 A;  3HK0 A;  2IO0 B;  3JSV B;  1IP9 A;  3KH0 A;  4HAY B;  3P2B A;  2NR2 A;  1WVH A;  3ZNI D;  5LOP B;  4GDL B;  4HK2 A;  5HE1 A;  4KV2 A;  2DX1 A;  2N1W A;  2C7M B;  1R4N I;  3D8F A;  2OQB A;  2MA9 B;  5JP4 A;  4IM0 A;  1BT0 A;  1Y8R C;  4Z2M B;  1FAO A;  1WJN A;  2KDF B;  3A33 B;  2Z0P A;  1TGZ B;  2C60 A;  2LG1 A;  2CHZ A;  2HE7 A;  2K39 A;  4KZ0 A;  1UGM A;  4HB4 B;  1MG8 A;  3BJI A;  5CLL B;  3PSE B;  3M62 B;  1EF5 A;  1PMS A;  1X86 A;  4C0A A;  1DDM A;  4MGY E;  4ICU A;  2LGD A;  1MPH A;  4I6L B;  3UQB A;  2RGF A;  4XZ4 A;  4F8C B;  2PZ1 A;  2JZ3 B;  4HAW B;  4L6E A;  5CLQ B;  4EEW A;  3ZKJ C;  3SNH A;  4NAW A;  3ZTD A;  4EJN A;  4GSW A;  2NCN A;  3IG3 A;  1JRU A;  3PVW A;  2GCJ A;  5L83 A;  4HHV A;  2I1J A;  1VCB A;  4EZK A;  1U4A A;  4WJQ A;  5J18 A;  3H7P A;  4MEL A;  2L7R A;  4E74 A;  2J0M A;  5E6O A;  1V5U A;  3SV1 A;  4MY6 A;  1E8W A;  4KDI C;  3ECI A;  1U5E A;  3RCP A;  2G3Q B;  1WGQ A;  4GZU A;  4NQL B;  4K7W A;  3VTU A;  2K2U A;  3VAW A;  3W1S A;  3N3K B;  1UPQ A;  5C79 A;  4TUU A;  1U5F A;  2D9W A;  2WDT B;  3KVF B;  2GMI C;  5FR6 A;  2KFK B;  3QK0 A;  4ZRJ A;  4FJZ A;  4KVG B;  1AQC A;  1OQY A;  5CHF A;  2B3A A;  1V5O A;  1B55 A;  2KQS A;  2K8C A;  1ZKH A;  2MBO A;  3ZIM A;  2CU1 A;  1UBI A;  1I42 A;  5FI1 A;  2DYQ A;  4JGH B;  3TL5 A;  4XX5 A;  2KCJ A;  3PLV A;  2DX5 B;  4A6H A;  1Q1O A;  2COF A;  2JUO A;  2O2V B;  1WG7 A;  4IFS A;  1Q0W B;  2N7D A;  4YL8 A;  3A1Q B;  3ALB A;  2UVM A;  3WAO A;  2G35 A;  1WXS A;  4RM9 A;  4AWJ A;  1HE8 A;  2O6V D;  2K00 A;  4HJK A;  3CMM B;  1V81 A;  2C9W B;  2UZR A;  2FJL A;  3ONS A;  2NPT A;  1SE9 A;  5C5B A;  1WJ4 A;  1NU2 A;  4NJ7 A;  1V61 A;  3A4R A;  1X1M A;  4X57 B;  2L76 A;  2UWQ A;  4BVU C;  3JVZ X;  3MJW A;  5KQ4 A;  2IY1 B;  3WAN A;  2N7E A;  2KMA A;  2W2W A;  2KDB A;  2LD9 A;  4IC7 B;  4W9D A;  4WJ7 A;  1NI2 A;  5DPT A;  4OVV A;  2DN6 A;  3CXB B;  2ZNV C;  1PFJ A;  4WWO A;  3PLU A;  5J3T A;  2D10 A;  2G45 B;  2NBW B;  3PVL A;  3DXC A;  5D3X A;  3HM3 A;  3UGB B;  3IBE A;  4B9K A;  1A5R A;  5C1Z A;  4DHZ B;  1WXA A;  1W1G A;  3UQA A;  5CHW A;  5D3W A;  4FHK A;  4EKU A;  2IYB A;  3AXC A;  4ZYN A;  2YS1 A;  1K8R B;  1C3T A;  3T9L A;  2YT0 A;  1TZ1 A;  1OGW A;  4HVB A;  1XKE A;  3ZW3 A;  4K1R B;  3DVG X;  3VUY A;  4MM3 A;  4EOY A;  2KQ7 A;  5IAA C;  4KZC A;  3U8Z A;  4TV3 A;  3DVN U;  2ZCC A;  3SD5 A;  3EFU A;  5DH9 B;  3QWM A;  1E90 A;  4IAP A;  4TQ0 A;  2KFJ A;  2LWP A;  4I6P A;  5BO4 B;  3KRW A;  1KOT A;  3Q3F A;  5JLJ B;  2MDX A;  2BWE S;  2G4D B;  4KHO A;  1FOE A;  4P7I A;  1MAI A;  1OQN A;  2IFS A;  3K9O B;  1H8C A;  4NPN A;  2OOB B;  3MTN B;  3PTF C;  1BWN A;  3NSU A;  3AU4 A;  2RUK B;  5L81 A;  3JSV A;  4B95 A;  3L08 A;  1C1Y B;  5HE0 A;  2CKH B;  3IHP C;  3D32 A;  3ML4 A;  4F7H A;  1EVH A;  2CHX A;  3KUC B;  3HHM A;  1TBE A;  4GDL A;  5JZE B;  4IUM B;  2FUH B;  2N9P C;  1AWE A;  2WX0 A;  5TR5 A;  4LCD E;  3D8E A;  1DYN A;  3M3J A;  4M8N A;  4W9C A;  2LUE A;  5DIF B;  1Q5W B;  2GBN A;  4HDO A;  4KIK B;  3APD A;  3PG7 A;  3OAN A;  1AAR A;  4MDK E;  4WWP A;  2KZR A;  4MGZ E;  4FJV B;  3HW2 B;  3ML9 A;  3A8Q A;  1WGD A;  2UZS A;  3TVV A;  5JHA A;  5JHH A;  2MLB A;  1UH6 A;  2RR9 A;  3OJ3 A;  4BBN F;  1SIF A;  2FID A;  5C23 A;  2LZ6 A;  3NY5 A;  5DHA B;  4Y94 A;  3R66 C;  2M14 A;  4PNK A;  2L3Z A;  2L1C A;  3AUL A;  3L0W B;  1XOD A;  2DZI A;  1TJ6 A;  3L10 B;  4BKT A;  3QQ8 B;  3EC8 A;  2Z59 B;  1V6E A;  4HB3 B;  2ZPN A;  2IO3 B;  4B6W A;  2FCM A;  4CHJ A;  1U2B A;  2JPH A;  2YSZ A;  5LXH A;  3CST A;  2DYO A;  1WGH A;  2KJR A;  5DHF B;  1KZ7 A;  4GGQ A;  1WRD B;  3M95 A;  5HE2 A;  4IOY X;  4BFR A;  4MH0 E;  4FLH A;  1UPR A;  2DKP A;  2DYM A;  1XD3 B;  3WYF B;  5LLI A;  2EMT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...