3TCAA

Crystal structure of the ras-associating and pleckstrin-homology domains of riam
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
260
structure length
246
Chain Sequence
VKKLVVKVHMDDSSTKSLMVDERQLARDVLDNLFEKTHCDCNVDWCLYEIYPELQIERVFEDHENVVEVLSDWTRDTENKVLFLEKEERYAVFKNPQNFYLMNAKNKEYLLEESFCGTSIIVPELEGALYLKEDGKKSWKRRYFLLRASGIYYVPKGKTKTSRDLACFIQFENVNIYYGIQCKMKYKAPTDHCFVLKHPQIQKESQYIKYLCCDDARTLSQWVMGIRIAKYGKTLYDNYQRAVARA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Rap1-interacting adapter molecule (RIAM) associates with the plasma membrane via a proximity detector.
pubmed doi rcsb
source organism Mus musculus
molecule tags Signaling protein
molecule keywords Amyloid beta A4 precursor protein-binding family B member 1-
total genus 76
structure length 246
sequence length 260
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-08-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00169 PH PH domain
A PF00788 RA Ras association (RalGDS/AF-6) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 3tcaA02
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 3tcaA01
4HAZB 2AL3A 4HJKA 3TJPA 4ANVA 4NSWA 1SIFA 2O6VB 2K00A 3ZW3A 3TO1A 2NS5A 1V86A 4BOSC 1NTVA 1ZVRA 1K8RB 3QWMA 4GDLA 3T9LA 4A3PA 1X86A 4YL8A 3JVZX 4DDGD 3ENEA 3IHPC 1WJ4A 4K1RB 2KVRA 4EFOA 2W2XD 3N7CA 4IM0A 1SGHA 2KOXA 3HM6X 3QCAA 4ZYNA 2D10A 1DROA 2DKQA 1U2BA 3MDBC 3QBVB 3SUZA 1P3QU 1S1QB 1WMHA 2DYBA 2FCQA 2K8BA 4I6PA 2RPQA 3SD5A 4EZLA 3M95A 1WM2A 3KRWA 2GBMA 3BJIA 4PQ0A 1TBEA 2BYFA 2C7MB 4DBBA 2MP2B 3WA0A 4HWIB 2KMAA 1NTYA 2AYOB 1E8XA 3PGEA 4IWQA 2VSZA 2JZ3B 2KC1A 4HAWB 3VXWA 1GJZA 3PS6A 2LYDA 5DHAB 5FI0A 1BAKA 1UBQA 4FULA 4NJ7A 4BKGA 4P7IA 1E8WA 2K6QA 3Q3FA 5DPWA 1KZGA 3H1UA 3SHQA 4MEMA 2BYEA 4EUTA 3DVNU 2WX1A 2KDFB 1WE6A 3VH4B 2FAZA 3TMPB 4NQLB 2KQSA 4ANXA 2EMSA 2LG1A 1Y8RC 3KYCD 1WYWB 4GIVA 2Z0DB 3DBSA 4FLHA 4MELA 4BBNF 3WYFB 2KTRB 2CODA 4ANUA 2EMTA 1J8CA 4FHJA 1WGQA 4WJNA 4B95A 2PEAA 3BY4B 1LM8B 2MWNB 2MDXA 4GU2A 3PPAA 3L10B 4W9HA 1GC6A 2HD5B 3TBLD 2RLOA 2CAYA 1OY2A 4EKUA 1OEYA 3HW2B 2C7HA 2G45B 2K39A 3V5WA 2P0FA 5G2NA 3UINB 3LJUX 2ZEQA 1OGWA 4HVBA 2HE7A 4FJVB 4JIOU 2MSED 2DYMA 5G55A 2KNBA 1XCGA 4A6KA 1EUVB 1RFAA 1V5UA 2DX5B 3IFWB 3V61A 3U8ZA 2N1WA 2FUHB 2WWZA 4ZRKA 4DWFA 5J18A 4WJ7A 4A5KA 5JP4A 3OANA 1UD7A 2JVCA 1UELA 4B6HA 2MP2A 4KHBB 2LGDA 4TKNA 4ZDVA 2D9VA 1OTRB 3ZRCA 4KHOA 3R7RA 3VAWA 2IYBA 1YX5B 2NBVB 4MGZE 1MK9B 1W1DA 3B1LX 1V5PA 2AEHA 5AZHA 2ADZA 4TUUA 4E71A 1E7UA 1IPGA 1XQQA 2MBQA 2P0DA 2LXCA 3CF6E 3ZIMA 2CRFA 2IY1B 1H8CA 2LJ5A 2H7EA 4DX90 2IO0B 1UGMA 2KUPA 4W9LA 1NI2A 5D3YA 4M8NA 2LZ6A 4HCNB 3MTNB 4OVUA 4BOZB 2I1JA 2KC2A 4IFSA 2FCNA 1WJ1A 1CMXB 1KLVA 1XX0A 1YJ1A 3KUZA 1V61A 1X1GA 2LKOA 3DVNV 4WJOA 1E8ZA 3JYUA 4EZKA 3D8DA 2KX0A 3H7SA 4M8MA 1VCBA 1AWEA 1KI1B 2NR2A 1M7RA 1UH6A 1OQNA 2ZPYA 4NJ6A 2G4DB 2JF5A 1ZM0A 5LONB 3N30A 1YIWA 3HQCA 3ML9A 4DDID 4DHJB 3L16A 5J3TA 2KZRA 2LVPA 3VUXA 2KWVB 2QKMA 1Q0WB 5CLQB 2DX5A 1WXVA 3DVGY 1V80A 3PHXB 3QQ8B 2JPHA 3RUIB 3UF8A 1S3SG 4XC2A 2LULA 1V81A 2IZVB 4FJZA 1P1AA 4FJYA 4GGQA 2GOWA 2CHXA 4BBKA 5JHGA 3A4SC 4I6NB 4MGYE 2KLGA 4GMVA 1RRPB 3QIJA 1Q5WB 2IY0B 3NHEB 4PS8A 3RZFA 3SDLC 5JZEB 2L0FA 3ZDMC 5D27A 2JT4B 2YSZA 4LJPB 3DQVA 4FHKA 4H8SA 2DAJA 4XX5A 3D32A 1J0GA 2RR9A 2M4NA 5AZGA 1FGZA 4NY0A 1V89A 4ZRJA 4E74A 4HLEA 4FADA 4HB3B 1Y5OA 4Y94A 2BYVE 5EDSA 3VIAA 1C3TA 5GMVA 4HXDA 2C60A 1FB8A 1J19A 2HTHB 4TQ0A 4BVUC 2K6DB 2L05A 1LW3A 3EC8A 3X0WA 2W2WA 4E3CA 5AEKB 2Y7BA 4URKA 1MIZB 5DCNA 2CS4A 2L00B 5J2RA 1MKEA 2DTCA 3PT2B 3GZNI 4AUQC 4ASWC 1PFJA 2K8HA 1WM3A 4JLCA 5KQ4A 4ANWA 1WR1A 1WGHA 2MCNB 4A6HA 2AWTA 2K2JA 3ZVRA 2KTFA 2REXA 2WX0A 3ONSA 3PRMB 4W9FA 3DVGX 4EOYA 4F7ZA 1D3ZA 1OMWA 1GG3A 3ZUNA 3U7DA 3P7ZA 2LOXA 1BT0A 2IBIB 3B08A 2N23A 2CY4A 1WY8A 2KN5A 1P3RA 2Y8FA 2R2OA 1AQCA 5KQ1A 2B3AA 1UNQA 2BF8B 4XWXA 1E90A 2NMBA 4HATB 1X05A 3QX1A 2YVCA 1P9DU 4CHJA 1WJMA 5CX3A 2W9NA 1B55A 4LDTD 1WIAA 2LRUA 3O96A 5DI9B 2UWQA 3AU5A 3OAWA 2ELBA 3RCPA 3GYPA 3ZDTA 1I42A 1U5FA 2JWZA 1WXMA 1IYFA 2C5LC 5EFXA 4HDQA 3QC8B 3QAQA 2HTHA 2COAA 4DBGA 2D9WA 2MBHA 2ZJDA 3M62B 1WJNA 2DZKA 3TL5A 1TQZA 2GBKA 5LXIB 2OOBB 1W1HA 5C5BA 3CIKA 2M8SA 5C16A 1WX7A 2RGNB 3JSVA 3ZNZB 3NZUA 5FI1A 3ECIA 3Q3JA 3W1SC 3MPXA 4NQKE 5CHWA 1QZEA 3UGBB 3PRZA 3L13A 2YF0A 5D2MB 1P0RA 1EVHA 4IUMB 4GXBA 3P2BA 1P5TA 2UZRA 4MK0A 3K9OB 2PPHA 2M38A 2KK8A 5E6OA 3ZTDA 4AP4C 4CO7A 4IAPA 3AULA 2BGFA 3GYOA 1NDDA 3KYDD 2RNRB 2PE6B 3PSEB 4HPLB 2MFQA 4F1SA 3D8EA 2IO2B 4G3XB 3RCZA 2JRIB 1WJUA 1DYNA 3NY5A 3IVFA 3UQBA 2V3SA 5FR6A 1GUAB 1LFDA 2O6VD 1XR0B 2IYDB 2BWFA 1WGUA 5DH9B 2DAFA 2MRPA 2GMIC 3FM8C 5HE0A 2ZVNA 2FIFA 2G3QB 5D3WA 3PHWB 1WG7A 2GBNA 4GSWA 3WIMA 5IA7A 2DENB 4ICUA 3R7QA 2MWSB 4BKSD 2KD0A 2MKRA 2DHKA 5JHAA 4PS7A 2GS0A 2ZCCA 2N0YA 1WR6E 2BCJA 3RZWC 2DHIA 1HE8A 2MBBB 2ROZB 1V5TA 1U29A 2O2VB 4WSFA 1XD3B 2NPTA 2K25A 2KQ7A 2LXAA 2JXXA 3PSCA 5C5BB 1WGRA 1WXAA 4KDLB 3JSVB 5D6JB 2I5FA 2K8CA 4WQOB 1U4AA 2E2XA 2Z0QA 4W9EA 2CKHB 2C9WB 4LDTB 4BKSA 2LD9A 1EO6A 4KZ0A 2DN6A 3UZTA 3ULBA 2LGYA 1XD4A 3QARA 5JH5C 2J7QB 3RT3B 1Q67A 2ZNVC 1V9JA 2D07B 3ODWA 5E6PA 1FHXA 3M1IB 4HK2A 4NAWA 3DXEA 5HKHA 1V88A 4AJYB 4EZJA 3ML8A 2L1CA 4HAUB 4M0WB 3DXCA 3QA8A 1R4MI 2D11A 4W9IA 1UNRA 2D2QA 2COFA 1MIXA 3CXBB 4GPTB 2BPSA 2MBOA 3PREA 4IOYX 2JP2A 5DPRA 4IWPA 4IM3A 4TQ1A 4D0NB 3KUDB 3ZO5B 3NSUA 2OJRA 2V1YA 1QC6A 4HCPB 2LOZA 2DHJA 3CMMB 1H4RA 1YQBA 1ISNA 1XT9B 2LVOA 4K7SA 4NPNA 5AZFA 2P0HA 3PVLA 2OTXA 3O65B 2EC1A 4ICVA 2K2UA 2LI5A 2ZCBA 2N7EA 4II3B 2J0KA 2Z0PA 5GOWB 3LJ3A 1JRUA 2ASQA 1P6SA 3EFUA 4GOCA 1U5GA 3H9DA 2O2VA 2UYZB 2GBJA 2Y5BB 4KIKB 1LB1A 4ZRIA 2KFKB 2NPTB 4LCDE 3IBEA 2RUKB 1WGDA 2N1VA 5HE3A 3VH3B 2YS5A 1EGXA 4K81A 4WWPA 3VTUA 1RAXA 1UPRA 3N3KB 1LXDA 1XODA 4EMOA 2KLCA 2MQJA 2D9ZA 1EAZA 3PEGA 1RLFA 1TTNA 1VD2A 3KW5B 3RD2A 3OLMD 1X1MA 2G4SA 4B9KA 4DHZB 1L2NA 2ZZPB 3PP2A 2KWUB 4GDKA 3QK0A 4IM2A 3PLVA 1Z87A 5C6RA 4MGKE 1ZC3B 3H6NA 2D9XA 4N9F4 2XQNM 3D8FA 3PV1A 4NAWB 4HB0B 2DYOA 4HHVA 2R2QA 2M0XA 2BKRB 3G9WA 1MAIA 3NZSA 3ZNID 4EEWA 2ZNVB 1DDWA 1WF9A 2V76A 4W9KA 4W9DA 4HPMB 3KSYA 5IAAC 3T06A 2DZIA 2J0JA 2KMCA 2L0TA 2LUEA 2KFJA 4DXAB 1U27A 1WH3A 4PYZA 2KJHB 2X18A 4NNJB 3DDCB 1W1GA 2EJ8A 2ROVA 2YRYA 4F7GA 1WJ6A 4W9CA 1GC7A 3UIOB 4DHJD 3TW1A 1EF5A 1LQBA 2M17A 3H7PB 1E8YA 1N3HA 3OJ4B 5L83A 1TZ1A 2D9YA 2MX2A 3PLUA 1M7EA 3TCAA 2JUOA 2KANA 4W9GA 3SU8X 4KV2A 4KVGB 3SV1A 1Z5SB 2Z0EB 5CTRC 2MBEA 5C23A 2PE9A 3VUYA 1E5WA 1FGYA 4FN2A 4KIKA 2KFKA 3A98B 1DBHA 1DDVA 3APFA 4LJOB 3P6AA 5DPSA 4AOFA 2AL6A 5JHBA 2YLMA 2VRWB 4I6LB 5KHQA 4TYZA 3VUWA 1T0YA 4TV3A 3PG7A 1YD8U 3KH0A 2BKFA 1G6JA 2LRWA 5BO4B 3FEHA 3BINA 4HAVB 3R3MA 2RSGA 3A8PA 4G0NB 3JW0X 3LDZE 3C0RB 3V62A 2CHZA 1PQSA 2FNJB 4GDKB 4MH0E 3U30A 5CHVC 3DCGA 3NS8A 3DXDA 4MSMB 3L54A 3M63B 2N4FA 1WGYA 2DX1A 2L7RA 2Q13A 1EF1A 3SYXA 2XEWA 1A5RA 3ODOA 4K7UA 1WVHA 4CYEA 3NOBA 1WX9A 4IWOA 3AI5A 5DPTA 3WANA 2L3ZA 1UNPA 4II2B 4L6EA 4W9JA 3VQIA 2KDIA 2YT0A 3M3JA 1KM7A 1ZGUB 4BFRA 4CHKA 1U5DA 4HB4B 4KAXB 2KCJA 2NZ8B 2ELAA 1NBFC 2VRRB 1X1FA 3CSTA 2I1KA 5D3VA 5J3QA 3DBRI 3H7PA 2LGXA 3V6EB 2M1MA 2UVMA 4KZCA 1WE7A 2J0MA 3IG3A 1WI0A 3RYTA 2XK5B 4MGIE 2PZ1A 1ZKHA 1L7YA 4IW0A 1FOEA 1AARA 4F7UP 4AWJA 1V5OA 4FA6A 2M14A 3DBLI 5D7GA 1H10A 5J3YA 3HK0A 2KGXB 3X23A 1FHOA 3KUCB 2L8JA 5CHFA 2QHOA 4KSLC 4KSKC 2R0DA 4A6FA 5JHHA 2L2IA 1Z2MA 1WRDB 3A9KB 2D4QA 1C1YB 1X11A 5DIFB 3EHVA 4XZ4A 1SE9A 3L08A 3AJ4A 2KJRA 2QKLA 2VKIA 4GMXB 4CHMA 4WVFB 2CY5A 3ZNHB 3B0AA 2RGFA 3HHMA 4KHAA 3F5RA 5LLIA 4KDIC 4GN1A 4B6WA 4BKTA 2RVBB 5J17A 1XKEA 2JY6A 4F7HA 3OJ3A 3RULA 3APCA 4OVVA 2FCSA 4IG7B 1PLSA 1PMSA 2YT1A 3ML4A 2IO3B 1FHWA 1QQGA 1U5EA 3A1QA 4A3OA 4C0AA 4EJNA 2H7DA 3ULCA 2CHWA 2FCMA 2K1FA 2KDEB 3A4RA 4MY6A 1OQYA 2COCA 4JL9A 3MHSD 1P98A 3APDA 1J0WA 2DFKA 3QWZB 1V6EA 2FIDA 3SO6A 1RJ2A 4WWNA 3V6CB 3VFKA 3WAOA 3SNHA 3K9PB 4HB2B 3I3TB 2DA0A 4X57B 1RRBA 4J6IA 4WWOA 3VTVA 4JQWC 1WXSA 1BWNA 5C1ZA 2NVUI 4K17A 1V49A 2XK5A 2ZVOA 2KWCA 3WALA 4WJPA 2ZPNA 3PZDA 1WGGA 3MJWA 1UEFA 2A4ZA 2IFSA 4K2OA 2NBWB 4RMAA 1E7VA 4DHZE 3PTFC 2JZZA 4RM8A 5TR5A 3A9JA 3VVWB 3KZ1A 1V5MA 1WZ0A 2OQBA 2KO3A 3FSSA 4A6FB 3KRXA 3F0WA 3PRPB 3A9KA 1WFYA 3R66C 1UPQA 2I5CA 2A5UA 2LASA 2KJ6A 2DYNA 5JLJB 2GCJA 3QJZA 4PYUA 3ZLZA 2IO1B 1UBIA 2WDTB 2PJHA 2Z59B 2JRHA 5KCVA 3ZKJC 3A8QA 4K2PA 2KDBA 2NCNA 4IC7B 2KX3A 4MM3A 4GZUA 3ZVVA 3TFMA 2KHWB 2Z0OA 4MSQB 3KY9A 1R4NI 2MA9B 2DZMA 3HM3A 3VTWA 3AXCA 3ZNGC 4A20A 1I35A 2GCLA 1OEYJ 3A1QB 1TXDA 3ZTCA 1V2YA 4WAAA 1MK7B 4MJSB 3VDZA 4MDKE 1DDMA 5E6NA 5C79A 3QHTA 4RM9A 5L95C 1BTKA 5LXHA 4PS3A 2YS3A 2R09A 2N9XA 2FJLA 1Y19B 2XBBC 4Z2MB 3VOQA 2N9PC 4HAXB 2WYQA 1M94A 1FXTB 2GBRA 4BBNC 3VHTC 3V60A 3UQAA 2N7DA 5D94A 2O6VA 5KHOA 1KZ7A 1Q1OA 2EKEC 2LVQA 2KXJA 2V4LA 3TIXA 4DK5A 2P8VA 2D3GA 3ODXA 2DZJA 3KVFB 1F9JA 4GDLB 1ZSQA 4K7WA 1K5DB 3N32A 3DOWA 3A9JB 2Y8GA 4AJWA 1I2HA 5HE2A 3L0WB 2BWES 1I7AA 3W1SA 1WMHB 2CU1A 3AU4A 2J59M 3HIZA 2UZSA 1FAOA 4WJQA 2G35A 3WAPA 4Z2NA 2L76A 1NU2A 2KKCA 1KOTA 1YX6B 2NBUA 3ZRFA 1BTNA 2GJYA 1KJTA 4G50A 3T8MA 2MLBA 1SHCA 1K5GB 3PVUA 3L17A 1TJ6A 1IP9A 3ALBA 3UIPB 2DYQA 5DHFB 4PNKA 2LWPA 3CSFA 2HJ8A 1WI1A 2DHZA 1ZW7A 1MPHA 3GOEA 1WZ3A 4MT7A 1WX8A 2RD0A 3WAMA 1IRSA 5LOPB 2N9EB 1ZC4B 4HAYB 2RSUA 3A33B 3TVVA 1TGZB 2DKPA 4MJSA 4F8CB 4YONA 2MW5A 1MG8A 4GB9A 3EECA 4JGHB 2W2XC 5L81A 4G11A 5CLLB 3DPDA 1UZXB 5D3XA 3W1YA 2CR5A 4FBJB 3S2AA 2DLWA 4DX8A 2KTRA 2C7NB 1GNUA 3DBHI 5HE1A 4HDOA 2YS1A 3PVWA
chains in the Genus database with same CATH superfamily
4HAZB 2AL3A 4HJKA 4ANVA 1GB1A 2WXQA 1ZVRA 4GDLA 1X86A 3JVZX 4K1RB 2KVRA 4IM0A 2KOXA 1DROA 3SUZA 1S1QB 2DYBA 1OQQA 2RPQA 3M95A 3BJIA 2BYFA 2FUG1 2BS4B 1XO3A 4HWIB 2KMAA 1E8XA 2JZ3B 5DHAB 2NBVA 4NJ7A 5DPWA 4P7IA 1E8WA 2K0PA 2K6QA 3Q8AA 1KZGA 3BYTB 4EUTA 1HQRD 3LYYA 3TMPB 1VZ6A 3KYCD 1F0ZA 1K50A 3DBSA 4FLHA 3RNCC 2Q5WD 4QJ3B 2EMTA 1J8CA 4FHJA 1WGQA 1WSPA 3BVMA 1LM8B 3L10B 2RLOA 2K39A 5G2NA 2C7HA 3V5WA 2PW9A 2HE7A 1FFVA 1IBXB 5G55A 2K8EA 1VRAB 3V6EB 2DX5B 2N1WA 4A5KA 1UD7A 1A70A 4B6HA 1OTRB 3ZRCA 4KKJA 1MK9B 1W1DA 1V5PA 1XQQA 3CF6E 1SF0A 2IO0B 3Q6BA 4M8NA 2LZ6A 4BOZB 2I1JA 2KC2A 1WJ1A 4Q2JA 5BYSA 1X1GA 4HKZE 1E8ZA 3H7SA 2NR2A 1M7RA 3N1YC 1T0SC 4HJGE 3ML9A 1WXQA 5BYRA 1T3QA 5J3TA 2LVPA 2QKMA 2INNE 2JPHA 1S3SG 1MHHE 4XYCA 3SFEB 4YTMB 5D3DA 2PKOA 4FJYA 2GOWA 4I6NB 4MGYE 3E9SA 4RCOA 1TKGA 2KLGA 1C78A 4TSSA 2L32A 3ZYYX 2L0FA 3NWAA 3AE2B 2IGGA 2NMQA 3NVVA 1RYJA 4XX5A 3D32A 4C00A 2CJOA 2K9XA 2M4NA 2RR9A 4NY0A 4WQMA 2RDGA 2IGHA 1YQ3B 3VIAA 5GMVA 1F1HA 5BMHA 1WYGA 4E3CA 1XCQL 4DQOC 1MKEA 1C77A 2KAJA 4JLCA 5KQ4A 4W9FA 3ZVRA 4F7ZA 3PRMB 3RPFC 1OMWA 3ZUNA 3U7DA 3UI3A 3OHMB 2Y8FA 2Y5PA 2BF8B 1UNQA 1E90A 3NUHB 1MVKA 5H92C 1WJMA 4US9A 4LDTD 2UWQA 4ITKA 3QAQA 2MHJA 2ZJDA 2DZKA 2OOBB 1W1HA 1WRIA 1TJEA 3RN9C 3W1SC 4NQKE 3BYYB 1EVHA 1PUTA 1FEHA 3J9CA 2Z8LA 2UZRA 2E6XA 4CO7A 3MP9A 2BGFA 2RNRB 2PE6B 3D8EA 2JRIB 3BWUD 2MJ3A 1ZE3D 2OEDA 2V3SA 1EM7A 3DWMA 5DH9B 2GMIC 3PHWB 3BZDB 1AN8A 1PYWD 2DENB 2MKRA 5JHAA 2X8XX 2GS0A 2DHIA 1HXYD 1U29A 2KQ7A 3EGRA 2JXXA 1WGRA 1WXAA 4KDLB 5D6JB 2I5FA 5H8YE 2K8CA 1GPXA 2LD9A 1EO6A 2LHDA 4N6EB 2H88B 2D07B 4HK2A 1ZDXA 3FILA 2WLBA 1V88A 3Q8BA 4AJYB 4M0WB 1L5PA 3NWDA 4IOYX 2JP2A 4GNKB 3NSUA 2FE8A 4BVUC 2LOZA 1I4GA 1YQBA 1ISNA 1KLGD 1XT9B 4K7SA 2EC1A 1FRDA 2BS2B 2LI5A 2ZCBA 1JALA 2N7EA 2J0KA 2Z0PA 1JRUA 2ASQA 4ZRQA 2UYZB 3LXFA 2NPTB 4ZRIA 1J7BA 2KFKB 3IBEA 2RUKB 1WGDA 1XXGA 2ICIA 3I5JC 5HFYA 3RD2A 1VD2A 5IOIA 4GDKA 4IM2A 5C6RA 1PGBA 2QJLA 3PV1A 3FILB 2BKRB 2BS3B 4OW0A 1UF0A 2KMCA 1VDVA 1ZXIA 1ZOYB 4NNJB 2EJ8A 2YRYA 1GC7A 2M17A 1E8YA 1JWUD 5I4DA 1TZ1A 2D9YA 1M7EA 4W9GA 3SU8X 5EE9A 3DHGC 2MBEA 3VUYA 4FN2A 2KFKA 2OHFA 4ZYSA 1T0QC 3KQ4A 4TYZA 2LHEA 3KH0A 5G5HA 4HPPA 5BO4B 4HAVB 3PO0A 1TKYA 3LDZE 3C0RB 1SB3C 4KX6B 3V62A 4GDKB 2IPKD 2DX1A 3EUB2 2Q13A 1A5RA 1L4DB 4UDUC 1QOBA 1FNWA 3AI5A 3WANA 4II2B 1UNPA 4W9JA 4MT5A 4JPSA 3AE7B 3NVWA 1I7HA 4HB4B 1NBFC 2ELAA 3DBRI 2UU7A 3CSTA 2I1KA 1ZXHA 2J0MA 1WI0A 2WU2B 2PZ1A 2M14A 1SE4A 3R8BA 2KGXB 4YWGG 2QHOA 4KSLC 1YOVB 2L2IA 4P6VF 2KR0A 5DIFB 4XZ4A 1B9RA 2CY5A 3F5RA 4KDIC 1QOGA 3P1MA 3N1ZC 3OWEB 1BMLC 4A3OA 4EJNA 2H7DA 2INPE 1F77A 1KTKA 3MHSD 5GXGB 3U7ZA 4XWTA 1E0ZA 2PVOD 4OSNA 2DFKA 1V6EA 1RJ2A 4XE0A 3V6CB 1E9MA 4HB2B 4X57B 1L0XB 1WGKA 4YTNB 2ZVOA 4P1CC 4WJPA 2ZPNA 2VH2A 4RMAA 2IFSA 4K2OA 3I9V1 2WXIA 3VVWB 3IAS1 3R66C 1UPQA 1PFDA 2A5UA 2LASA 5JLJB 3NRZA 4HEA1 2WDTB 3A8QA 4K2PA 4GZUA 4RF0A 4A20A 2N9LA 2MEKA 3A1QB 3U12A 4WAAA 1MK7B 4MJSB 3QHTA 5L95C 2KN4A 2N9XA 4PS3A 2J42A 4LNIA 1B1ZA 2XBBC 3VOQA 1M94A 2M19A 1FXTB 3VHTC 2O6VA 3TIXA 2P8VA 3ODXA 3KVFB 1XEEA 3AN1A 4JWUC 4K7WA 1K5DB 5AUKA 2Y8GA 2K22A 4AJWA 2BWES 3AEGB 1I7AA 3IXSA 2J59M 2UZSA 3WAPA 4Z2NA 2JX5A 1NU2A 2L76A 1KJTA 2JWUA 2MLBA 1SHCA 3PVUA 3L17A 3ALBA 3URYA 2DYQA 3GOEA 2BB6A 2LFIA 1I4PA 2RD0A 3WAMA 4MJSA 2DKPA 2PLPA 4KGTA 5L81A 3FC4A 3T3OA 4FBJB 1N6ZA 3EA6A 3S2AA 4DX8A 2C7NB 1GNUA 3PVWA 1HZ6A 3TJPA 1QILA 5IKCM 2O6VB 1QT9A 3ZW3A 3TO1A 2NS5A 4A3PA 4DDGD 3IHPC 1WJ4A 4EFOA 2K5PA 2W2XD 3HM6X 4DIXA 2D10A 2C7MB 1U2BA 2K8BA 4I6PA 3TEWA 3AV8A 2D3AA 2VSZA 1C79A 3ZXRA 4FULA 3Q3FA 2GI9A 2J52A 3DVNU 4NQLB 3ZQ4A 2EMSA 1Y8RC 4IKGA 4ANXA 4GIVA 4MELA 3WYFB 2CODA 4WJNA 2BB5A 1L4ZB 4B95A 1NYQA 1DOIA 4W9HA 1GC6A 2G45B 2VH1A 2P0FA 3LJUX 2ZEQA 3RNEC 4JIOU 2H89B 2MSED 2JSVX 2KNBA 1RFAA 1V5UA 2WWZA 5J18A 4WJ7A 4RGOS 4KHBB 2LGDA 4TKNA 4KKIA 1K51A 2D9VA 2INCC 3R7RA 2IYBA 4OZCA 2BYTA 5AZHA 2ADZA 4TUUA 4E71A 1IPGA 4C7ZA 2LXCA 2LJ5A 4AS1A 2H7EA 1TYGB 2WXKA 1UGMA 1NI2A 4L1BA 4OVUA 1KLVA 1CMXB 1YJ1A 3KUZA 1JCKB 1KI1B 5TSSA 1UH6A 1OQNA 4USAA 2WGSA 2JF5A 3HQCA 3L16A 2KZRA 2ZKMX 4JX1C 1WXVA 1I4QA 3PHXB 3UF8A 3RUIB 3DHIC 1DYQA 1JWSD 3P4RB 2Z13A 1P1AA 1T0RC 4FJZA 4KHBA 1Q5WB 3QIJA 5JZEB 4M00A 3SDLC 4MACA 4RGTA 4FHKA 5AZGA 1V89A 4ZRJA 2LGIA 2KMMA 5EDSA 2Y3AA 1FB8A 2WP9B 2K6DB 3PZ8A 4P1BC 3H8HA 5FK9C 2Y7BA 5DCNA 2L00B 3PT2B 1FIQA 3GZNI 5HHDG 1YN3A 3AE6B 4AUQC 2K8HA 4ANWA 3MHZA 2WX0A 2REXA 3SR6A 3RFZB 1BT0A 2R61A 4HROA 3BIID 1P3RA 2AQ1B 2NMBA 3W5UB 2JQRB 1P7EA 5DI9B 2LRUA 3Q3NC 3ZDTA 1I42A 4RGMA 4HDQA 2HTHA 2COAA 3NWFA 5MPOA 2MBHA 1TQZA 4NAMA 5C5BA 3JSVA 4M02A 3NZUA 1D4BA 5FI1A 3Q3JA 5D2MB 4IUMB 5C3JB 4GXBA 3P2BA 2KVZA 3K9OB 4MK0A 1TIFA 2PPHA 2KK8A 4IAPA 3AULA 3GYOA 4G3XB 1WJUA 1YMHE 1GUAB 2BWFA 4A6QA 1WGUA 2WXOA 1GOZA 3FM8C 5HE0A 2FIFA 3WIMA 5D3WA 3Q2AC 2Z14A 2WXGA 4BKSD 2ZCCA 3RZWC 1WR6E 2O2VB 2ROZB 1TY0A 1XD3B 2K25A 3SFDB 2IDYA 3P4PB 2Z0QA 4BKSA 3GS2A 3VRAB 2LGYA 4LNOA 2B76B 1BUIC 1V9JA 3ODWA 4NAWA 2RPVA 3DXCA 4W9IA 1UNRA 3CXBB 1MIXA 4WH4A 1SE2A 4TQ1A 4D0NB 3ZO5B 2OJRA 4HCPB 4NPNA 4LK0M 2ACZB 2LVOA 2P0HA 4BZAA 2OTXA 1Y56A 2K2UA 2MH7A 1JWBD 1P6SA 3DCXA 1FFUA 1R7SA 2O2VA 2Y5BB 4KIKB 1LB1A 4LCDE 1TS3A 1ZPSA 3O13A 2N1VA 4C80A 4ZOHC 2YS5A 2N9KA 1V1PA 4WWPA 4OVZA 3VTUA 1RAXA 1UPRA 2I38A 5G5GA 1XODA 2MQJA 2D9ZA 1EAZA 3PEGA 2V3NA 1TTNA 3KW5B 2KWUB 4RM8A 4MGKE 3KWLA 1ZYIA 3H6NA 4N9F4 4B0MA 3AE8B 4NAWB 4QJ5B 2ZNVB 1ZDVA 1CJEA 2DZIA 3B2FA 4IOIE 2KFJA 1U27A 2Y5CA 3UIOB 1W1GA 4F7GA 1T77A 2INDC 1LQBA 5I2SA 3OJ4B 3Q3MC 3PLUA 2KANA 3SV1A 5C23A 2PE9A 1ZP0B 3TSSA 1FGYA 4KIKA 1DDVA 3APFA 5DPSA 3VUWA 1T0YA 2BKFA 3FAHA 3FEHA 5EE1A 3BINA 4G0NB 3IT4B 3R3MA 3A8PA 1NVID 1MPEA 4MH0E 3U30A 5CHVC 3DCGA 4MSMB 1TY2A 3L54A 1J7AA 2N4FA 3M63B 2L7RA 2PVGC 2NTTA 1EU4A 2L3ZA 2M0AA 3RNFC 4CHKA 3OAWA 2VRRB 1QLBB 1UWXA 3ZDMC 1X1FA 5D3VA 4KZCA 4S17A 1JW9D 1K52A 4A55A 1ZKHA 4IW0A 5BYQA 1FOEA 1AARA 3MFGA 1TKEA 5J3YA 3KUCB 1FHOA 5CHFA 2R0DA 1WRDB 1DOYA 1EWYC 2HTME 3AJ4A 2KJRA 2VKIA 1RWSA 4WVFB 1CK1A 3B0AA 3HHMA 1SEBD 1ZUD2 2RVBB 4MM3B 5FR3A 3OJ3A 2JY6A 4F7HA 5T8IA 4HSIA 4OVVA 1PLSA 1HTQA 1FHWA 2FCMA 4WAFA 1AWDA 1F2RC 1QOFA 4JL9A 1P98A 3AECB 3APDA 2EKIA 4WWNA 3SNHA 1D5XC 1YJIA 3VR8B 1RRBA 3VTVA 5C1ZA 4JQWC 1BWNA 4OT1A 4K17A 2XK5A 3MJWA 1UEFA 3PTFC 2JZZA 1ET9A 5TR5A 1FNUA 3BK2A 2OQBA 3PZ7A 3F0WA 3PRPB 4O1NA 1WFYA 3UGBB 2I5CA 5E6OA 1C4CA 2Z59B 2GLSA 3ZVVA 2KHWB 2K3UA 2MA9B 3HM3A 2GCLA 3P42A 4QJ4B 1DDMA 4RM9A 1BTKA 2FJLA 2NTSA 4Z2MB 2N9PC 2WYQA 4DXGA 2GBRA 4BBNC 2Z4DA 3V60A 2N7DA 2VZKB 1T6BX 1Q1OA 1ROEA 2EKEC 2LVQA 2KXJA 1MHXA 2ZW0A 4DK5A 2DZJA 1F9JA 2QDFA 1I2HA 1N63A 1MFWA 2CU1A 3AU4A 1OFFA 3HIZA 4WJQA 3N1XC 1YX6B 1BTNA 2AQ2B 5LNK1 2Z59A 4G50A 3V3XA 1TT5B 1IP9A 2GUMA 1RFKA 5DHFB 2PTLA 4PNKA 1YNTE 2LWPA 3CSFA 2HJ8A 1WI1A 2WXRA 4HAYB 4WIPA 4A90A 1TGZB 2DLBA 2MW5A 1MG8A 2D3BA 1MI0A 2E3TA 2KTRA 5IP4D 3DBHI 2J53A 4HDOA 2YS1A 1TS2A 2DNFA 3B77A 3KWVA 4D6WA 1V86A 4BOSC 3QWMA 4YL8A 2M56B 3ENEA 2KWDA 1QF6A 3WAOA 1SGHA 2DKQA 3QBVB 3UIPB 4EZLA 3SD5A 2FCQA 4KGSA 2GBMA 3KRWA 1FNVA 4PQ0A 2YEPB 3WA0A 4IWQA 3VXWA 4HAWB 2W55A 3DHHC 3PS6A 1FCLA 5FI0A 1UBQA 1UUPA 2BYEA 4MEMA 4EE2A 2WX1A 1WE6A 3VH4B 4D2KA 3Q8CA 2FAZA 2KQSA 2LG1A 1PDXA 5HI1A 2Z0DB 3KLSX 4BBNF 2KTRB 2KDMA 3Q8EA 4PT5A 1PGAA 3T8MA 3TBLD 2DWQA 3PPAA 2HD5B 4EKUA 1OGWA 1WWTA 4FJVB 1D5ZC 2DYMA 4K3BA 2W82A 4A6KA 3U8ZA 3V05A 1KH0A 1I4HA 5JP4A 3OANA 2JVCA 1UELA 2ZW1A 2LJIA 4CSQA 2WDRB 3VAWA 3CIRB 1YX5B 2NBVB 3B1LX 2AEHA 2P0DA 1E10A 4W9LA 5D3YA 4HCNB 3MTNB 2L52A 2FCNA 1D5MC 2LEKA 1XX0A 4WJOA 3JYUA 4NJ6A 5BMGA 3P4SB 1VLBA 2CU3A 1ZM0A 5LONB 1M4VA 1IBXA 2KWVB 2DX5A 3ETRA 3QQ8B 2KACA 2LULA 2IZVB 4LNNA 4XGAB 4C7YA 3Q14C 4GGQA 2CHXA 1QOAA 4A8XC 2QIEB 4GMVA 1RRPB 3NHEB 2KT7A 3RZFA 4LJPB 2DAJA 1P7FA 1FGZA 4HLEA 4HB3B 2MJEA 3T3NA 2C60A 1HTOA 2LMCA 1LW3A 3EC8A 1XLNA 5AEKB 2DBYA 2CS4A 2DTCA 1WM3A 1WR1A 1WGHA 2MCNB 4A6HA 3GE3C 1LO5D 1GG3A 3P7ZA 1I4XA 2LOXA 2IBIB 3BVGA 1FMAD 4RH6A 1WY8A 2XN9C 2GB1A 2R2OA 1AQCA 5KQ1A 3QX1A 4NZLB 2YVCA 2G1EA 4CHJA 1CQVA 2V3PA 1B55A 1SSNA 1Q10A 4YT0B 3O96A 4LNFA 1V1OA 2ELBA 3RCPA 3TEXA 4WURA 1U5FA 1WXMA 1IYFA 2C5LC 3QC8B 3NZ3A 3NW8A 3M62B 1WJNA 3TL5A 3DBLB 1R4MB 3ZNZB 2KIEA 2M8SA 1WX7A 2RGNB 4A9AA 3MPXA 3L13A 2YF0A 1P5TA 3ZTDA 4US8A 2M38A 2JZPA 3WCQA 1NDDA 4HPLB 4M0WA 1DYNA 3NY5A 3IVFA 5FR6A 4N58A 1XR0B 2X38A 3B2GA 1IGDA 1SJHD 5IAAC 1WG7A 2GBNA 3BK1A 1ACCA 4L1RA 4ICUA 3R7QA 2KD0A 4PS7A 4YTPB 2N0YA 2W3RA 2MBBB 3AE4B 1V5TA 3AE1B 1C4PA 2NPTA 3C8YA 3PSCA 4WQOB 1U4AA 2E2XA 4W9EA 4KZ0A 3UZTA 3ULBA 2J4XA 1XD4A 3QARA 4H2AA 3Q69A 1Q67A 2VZKD 2QEJC 3M1IB 5HKHA 4AQ7A 3ML8A 4HAUB 1DGJA 3QA8A 1R4MI 2BPSA 2COFA 3PREA 4GPTB 1FD6A 2MBOA 5IN7A 4IM3A 3L4PA 5AUIA 2N7JA 1XF5L 2V1YA 1QC6A 4OZBA 2DHJA 3EFCA 1H4RA 2K49A 3PVLA 2SAKA 2TSSA 3TUOA 1VZ8A 2W3SA 3TEYA 3HSAA 1AYFA 3EFUA 3AEEB 3DWGC 3H9DA 1NYRA 2GBJA 3HUIA 5M4YB 3ZJUA 5HE3A 1L6VA 1LXDA 4EMOA 5EE0A 2MJDA 3RNBC 1SXTA 1RLFA 4B9KA 1ESFA 4DHZB 1L2NA 1IUEA 3PP2A 2D9XA 2XQNM 1SBBB 2YEPF 2DYOA 2R2QA 3P63A 3ZNID 3NZSA 1DDWA 1WF9A 2JYTA 2V76A 1NEKB 4W9KA 4HPMB 3KSYA 2D3CA 2L0TA 1FRRA 4DXAB 4PYZA 3DDCB 2ROVA 1WJ6A 4DHJD 4EOYA 4ZHPA 4W9CA 3TW1A 1EF5A 3H7PB 1N3HA 2MX2A 3TCAA 2JUOA 3NVZA 4KV2A 3IAM1 4KVGB 5CTRC 2Z0EB 1FPYA 1E5WA 1FM0D 1T5XD 2PIAA 4LJOB 4AOFA 3P6AA 1FO4A 2YLMA 5KHQA 4I6LB 1YD8U 1SIJA 2LRWA 2RSGA 3BVZA 3JW0X 2CHZA 2FNJB 3ODOA 1TS4A 4K7UA 1WVHA 4CYEA 3NOBA 4IWOA 4S0RA 1YN5A 4JE3B 1KM7A 1U5DA 2KCJA 3I57A 5J3QA 1G6JA 3H7PA 2LGXA 3IG3A 1N61A 1PGXA 4MGIE 1L7YA 1STEA 4F7UP 4AWJA 1V5OA 4FA6A 2YT2A 5D7GA 1H10A 4RGNA 2L8JA 4ACFA 4KSKC 1Z2MA 1C1YB 1X11A 3EHVA 1SE9A 2QKLA 4PK1A 2RGFA 2RMMA 5LLIA 4GN1A 3VRBB 5J17A 2RDHA 1XKEA 3RULA 2FCSA 4IG7B 3ML4A 2IO3B 1QQGA 3A1QA 3NJTA 3ULCA 2K1FA 1EWCA 3NVYA 1J0WA 3QWZB 2FIDA 3VR9B 3K9PB 3I3TB 2WXHA 4ZHOA 1WXSA 1C76A 2NVUI 3U2SC 1V49A 3AEDB 3WALA 4IDIA 2KYWA 2WQYB 2A4ZA 3GE8C 1E7VA 2KQ4X 4DHZE 3A9JA 3KZ1A 5IO9A 3KRXA 1JMLA 3AEBB 2KJ6A 2DYNA 4PYUA 3MC9A 1UBIA 3AE5B 2JRHA 3ZKJC 1L6UA 4IC7B 2KX3A 2Z0OA 1R4NI 3ZNGC 3FVCA 2DZMA 4HRSA 1TXDA 1V2YA 3VDZA 1ENFA 4L23A 2FJUB 1SJED 5C79A 2KUQA 2R09A 1RM6C 4HAXB 1YJJA 5LG4B 5D3IB 4KGRA 2V4IB 1KZ7A 2V4LA 1XCTL 3AEFB 3DOWA 3A9JB 1OQRA 2LUMA 5HE2A 1N5XA 3W1SA 1WMHB 3LB8C 1E6EB 3A58A 1TZOA 1FAOA 4LNKA 2G35A 3ZJVA 2KKCA 1KOTA 2NBUA 3ZRFA 2GJYA 3Q8FA 3E56A 3ZJTA 1K5GB 1TJ6A 5I2MA 2AQ3B 2WDQB 4REZA 1ZW7A 1MPHA 4MT7A 1WX8A 1IRSA 2N9EB 1XLOA 1ZC4B 2RSUA 3TVVA 3EECA 4JGHB 2W2XC 5CLLB 3W1YA 2CR5A 4RF1A 4L6EA 4YSZB 4NSWA 1R4NB 1SIFA 2K00A 1FCCC 1NTVA 1K8RB 2LGSA 2WDVB 3T9LA 5C2TB 2G9HD 3N7CA 3QCAA 4ZYNA 1WMHA 1FXIA 1P3QU 3MDBC 1GB4A 4TMAB 3W9CB 1IGCA 1WM2A 2QC8A 1TBEA 2MP2B 4DBBA 3PGEA 1NTYA 2AYOB 1GJZA 2KC1A 3FKYA 2LYDA 1BAKA 4BKGA 3SHQA 3H1UA 2KDFB 2BVCA 1WYWB 2V0GA 4ANUA 2BW2A 2PEAA 1KFYB 3BY4B 4GU2A 2MWNB 2MDXA 2JU6X 2FBWB 2CAYA 1OY2A 1OEYA 4F8CB 3HW2B 3UINB 1LGRA 4XWWA 4HVBA 2OJWA 4ARIA 1XCGA 1EUVB 3V61A 3IFWB 3HVZA 3N9YC 4DWFA 2FUHB 4ZRKA 2MP2A 1JWMD 4ZDVA 4KHOA 4MGZE 2IGDA 3MC8A 1E7UA 1N62A 2MBQA 1C9FA 3ZIMA 2CRFA 2IY1B 1H8CA 3W5VB 1JQ4A 5IRSA 4DX90 2KUPA 2WXFA 5E6JA 4IFSA 2L1AA 3GP7A 1V61A 2LKOA 3DVNV 4EZKA 3D8DA 2KX0A 4M8MA 1VCBA 1AWEA 2ZPYA 2G4DB 3N30A 4DHJB 1YIWA 4DDID 1JROA 3VUXA 4BAXA 4N59A 1Q0WB 5CLQB 3DVGY 1V80A 4XC2A 4YSYB 3GB1A 1V81A 2PMVA 4BBKA 5JHGA 3A4SC 2IY0B 4PS8A 5D27A 2JT4B 2YSZA 3DQVA 4H8SA 2D5GA 1J0GA 4XDCA 4E74A 1NI3A 4FADA 4Y94A 1Y5OA 2SEBD 2BYVE 1C3TA 4HXDA 1J19A 2HTHB 2JYEA 4TQ0A 2L05A 3X0WA 2W2WA 4NJCA 4URKA 1N5WA 1MIZB 4J3OD 5J2RA 4ASWC 1PFJA 4B0EA 1XLPA 5EE3A 2AWTA 3ONSA 2K2JA 2KTFA 1D3ZA 3DVGX 2WXMA 1K53A 4LTUA 3B08A 2N23A 2W54A 3N20C 2CY4A 2BTEA 3AB5A 2KN5A 2BT6A 2QMTA 3B9JA 2B3AA 4XWXA 4HATB 1X05A 1P9DU 1HZ5A 5CX3A 2W9NA 2WXPA 1WIAA 3DBRB 3AU5A 3GYPA 2JWZA 2XNAC 3DBHB 5EFXA 4DBGA 2D9WA 4C4VB 3IT6B 2GBKA 3U4EG 2QILA 3CIKA 5C16A 3ECIA 1V8CA 2JXTA 5CHWA 1QZEA 3PRZA 1P0RA 2BBCA 4AP4C 3Q3OC 3KYDD 3PSEB 2MFQA 4F1SA 2IO2B 1MJDA 3RCZA 3UQBA 4GLSC 1LFDA 2O6VD 2IYDB 2DAFA 2MRPA 3ZXVA 2ZVNA 1CZPA 3HVDA 2G3QB 2RDBC 4GSWA 5IA7A 2MWSB 2DHKA 2WU5B 4MH8A 2BCJA 1HE8A 4C56C 4WSFA 4C4VA 2LXAA 1ET6A 4K3CA 5C5BB 1YQ4B 3SEBA 3JSVB 1V1PB 2CKHB 2C9WB 4LDTB 1EU3A 1KF6B 2ON8A 2DN6A 1AW7A 5JH5C 2J7QB 3RT3B 4YSXB 2ZNVC 5E6PA 1FHXA 3DXEA 4EZJA 1F2RI 2L1CA 1NENB 2D11A 2D2QA 4HKQA 5DPRA 4IWPA 4XDDA 3AE9B 2N0SB 3KUDB 3AM9A 5JXVA 3CMMB 5LXIB 4YXDB 4ZRPA 3O65B 4ICVA 4P16A 5HG2A 4II3B 5GOWB 4GOCA 2I2YA 1U5GA 4QXAB 3NG0A 1C4AA 3VH3B 2WS3B 3NS1A 1EGXA 4K81A 3AEAB 3N3KB 1SE3A 2KLCA 4RFBA 1UGJA 2L83A 3OLMD 1X1MA 2G4SA 4L2YA 2ZZPB 3QK0A 3PLVA 1Z87A 1ZC3B 3D8FA 3AH7A 4HB0B 4HHVA 1BXTA 2M0XA 3G9WA 1MAIA 4EEWA 3RI7C 2EELA 4W9DA 5FKAC 3T06A 2J0JA 2LUEA 1WH3A 2KJHB 2X18A 5BMIA 3ZGZA 5L83A 1JWAD 1VJKA 1Z5SB 2QSDA 1YN4A 1MI1A 3A98B 1DBHA 5JHBA 3W2DA 4CQNA 1HEZE 2AL6A 2VRWB 4TV3A 3PG7A 1N60A 2CJNA 4DXFA 3TEZA 1QQRA 2WXLA 1PQSA 3HRDD 3R2TA 3NS8A 3DXDA 2WHIA 1WGYA 1MG4A 1J7CA 1EF1A 3SYXA 2XEWA 1WX9A 5DPTA 1KLUD 3VQIA 2KDIA 4LLGM 2YT0A 3M3JA 1ZGUB 4BFRA 4KAXB 2NZ8B 1FXAA 3CWIA 3LJ3A 3HIEA 1HA5A 1VZ7A 2M1MA 2UVMA 4JWSC 1WE7A 2HJ1A 3RYTA 2XK5B 4FXCA 4OHJA 1GAQB 3DBLI 3X23A 3HK0A 2V9HA 1E7PB 4A6FA 5JHHA 3A9KB 2D4QA 1L0YB 1QKZA 3L08A 3RNAC 2R2YA 4GMXB 4CHMA 2WXNA 3ZNHB 4B6WA 4KHAA 4BKTA 1XLQA 2BQQA 3APCA 2YT1A 1PMSA 1U5EA 4C0AA 3A4RA 2KDEB 2CHWA 5AZFA 4MY6A 1OQYA 2COCA 1I4RA 3VFKA 3SO6A 2DA0A 4WWOA 4J6IA 3AMZA 2KWCA 3RNGC 3PZDA 1WGGA 2NBWB 1TS5A 3C19A 4OZAA 1V5MA 1WZ0A 2AX5A 2KO3A 2KIGA 3FSSA 4A6FB 1V97A 3A9KA 1D6EC 3I63C 2QCZA 2GCJA 3QJZA 3ZLZA 2IO1B 3R2IA 5KCVA 4GOUA 2KDBA 2NCNA 4MM3A 3TFMA 4MSQB 4WWMA 3VTWA 3KY9A 1I35A 3AXCA 1OEYJ 2WNMA 3ZTCA 4MDKE 5E6NA 2WXJA 3MJ5A 5LXHA 2YS3A 1Y19B 1VR9A 1UWMA 3UQAA 1KRHA 5D94A 5KHOA 3RMKC 3MC0B 4ARCA 3GZNB 1UNSA 2D3GA 4GDLB 1ZSQA 3N32A 2ONQA 3L0WB 3U52E 1DOXA 2HDEA 4RNAA 3AE3B 4QAYA 1F52A 1L0VB 4R3DA 3P4QB 2DHZA 1WZ3A 2RRFA 3A33B 5LOPB 1JRPA 4M01A 2IJ0A 4YONA 4GB9A 2GRIA 3ABVB 4G11A 3DPDA 1UZXB 5D3XA 2DLWA 3OG5A 5HE1A 2PJHA
chains in the Genus database with same CATH topology
4HAZB 2AL3A 4HJKA 3TJPA 4ANVA 4NSWA 1SIFA 2O6VB 2K00A 3ZW3A 3TO1A 2NS5A 1V86A 4BOSC 1NTVA 1ZVRA 1K8RB 3QWMA 4GDLA 3T9LA 4A3PA 1X86A 4YL8A 3JVZX 4DDGD 3ENEA 3IHPC 1WJ4A 4K1RB 2KVRA 4EFOA 2W2XD 3N7CA 4IM0A 1SGHA 2KOXA 3HM6X 3QCAA 4ZYNA 2D10A 1DROA 2DKQA 1U2BA 3MDBC 3QBVB 3SUZA 1P3QU 1S1QB 1WMHA 2DYBA 2FCQA 2K8BA 4I6PA 2RPQA 3SD5A 4EZLA 3M95A 1WM2A 3KRWA 2GBMA 3BJIA 4PQ0A 1TBEA 2BYFA 2C7MB 4DBBA 2MP2B 3WA0A 4HWIB 2KMAA 1NTYA 2AYOB 1E8XA 3PGEA 4IWQA 2VSZA 2JZ3B 2KC1A 4HAWB 3VXWA 1GJZA 3PS6A 2LYDA 5DHAB 5FI0A 1BAKA 1UBQA 4FULA 4NJ7A 4BKGA 4P7IA 1E8WA 2K6QA 3Q3FA 5DPWA 1KZGA 3H1UA 3SHQA 4MEMA 2BYEA 4EUTA 3DVNU 2WX1A 2KDFB 1WE6A 3VH4B 2FAZA 3TMPB 4NQLB 2KQSA 4ANXA 2EMSA 2LG1A 1Y8RC 3KYCD 1WYWB 4GIVA 2Z0DB 3DBSA 4FLHA 4MELA 4BBNF 3WYFB 2KTRB 2CODA 4ANUA 2EMTA 1J8CA 4FHJA 1WGQA 4WJNA 4B95A 2PEAA 3BY4B 1LM8B 2MWNB 2MDXA 4GU2A 3PPAA 3L10B 4W9HA 1GC6A 2HD5B 3TBLD 2RLOA 2CAYA 1OY2A 4EKUA 1OEYA 3HW2B 2C7HA 2G45B 2K39A 3V5WA 2P0FA 5G2NA 3UINB 3LJUX 2ZEQA 1OGWA 4HVBA 2HE7A 4FJVB 4JIOU 2MSED 2DYMA 5G55A 2KNBA 1XCGA 4A6KA 1EUVB 1RFAA 1V5UA 2DX5B 3IFWB 3V61A 3U8ZA 2N1WA 2FUHB 2WWZA 4ZRKA 4DWFA 5J18A 4WJ7A 4A5KA 5JP4A 3OANA 1UD7A 2JVCA 1UELA 4B6HA 2MP2A 4KHBB 2LGDA 4TKNA 4ZDVA 2D9VA 1OTRB 3ZRCA 4KHOA 3R7RA 3VAWA 2IYBA 1YX5B 2NBVB 4MGZE 1MK9B 1W1DA 3B1LX 1V5PA 2AEHA 5AZHA 2ADZA 4TUUA 4E71A 1E7UA 1IPGA 1XQQA 2MBQA 2P0DA 2LXCA 3CF6E 3ZIMA 2CRFA 2IY1B 1H8CA 2LJ5A 2H7EA 4DX90 2IO0B 1UGMA 2KUPA 4W9LA 1NI2A 5D3YA 4M8NA 2LZ6A 4HCNB 3MTNB 4OVUA 4BOZB 2I1JA 2KC2A 4IFSA 2FCNA 1WJ1A 1CMXB 1KLVA 1XX0A 1YJ1A 3KUZA 1V61A 1X1GA 2LKOA 3DVNV 4WJOA 1E8ZA 3JYUA 4EZKA 3D8DA 2KX0A 3H7SA 4M8MA 1VCBA 1AWEA 1KI1B 2NR2A 1M7RA 1UH6A 1OQNA 2ZPYA 4NJ6A 2G4DB 2JF5A 1ZM0A 5LONB 3N30A 1YIWA 3HQCA 3ML9A 4DDID 4DHJB 3L16A 5J3TA 2KZRA 2LVPA 3VUXA 2KWVB 2QKMA 1Q0WB 5CLQB 2DX5A 1WXVA 3DVGY 1V80A 3PHXB 3QQ8B 2JPHA 3RUIB 3UF8A 1S3SG 4XC2A 2LULA 1V81A 2IZVB 4FJZA 1P1AA 4FJYA 4GGQA 2GOWA 2CHXA 4BBKA 5JHGA 3A4SC 4I6NB 4MGYE 2KLGA 4GMVA 1RRPB 3QIJA 1Q5WB 2IY0B 3NHEB 4PS8A 3RZFA 3SDLC 5JZEB 2L0FA 3ZDMC 5D27A 2JT4B 2YSZA 4LJPB 3DQVA 4FHKA 4H8SA 2DAJA 4XX5A 3D32A 1J0GA 2RR9A 2M4NA 5AZGA 1FGZA 4NY0A 1V89A 4ZRJA 4E74A 4HLEA 4FADA 4HB3B 1Y5OA 4Y94A 2BYVE 5EDSA 3VIAA 1C3TA 5GMVA 4HXDA 2C60A 1FB8A 1J19A 2HTHB 4TQ0A 4BVUC 2K6DB 2L05A 1LW3A 3EC8A 3X0WA 2W2WA 4E3CA 5AEKB 2Y7BA 4URKA 1MIZB 5DCNA 2CS4A 2L00B 5J2RA 1MKEA 2DTCA 3PT2B 3GZNI 4AUQC 4ASWC 1PFJA 2K8HA 1WM3A 4JLCA 5KQ4A 4ANWA 1WR1A 1WGHA 2MCNB 4A6HA 2AWTA 2K2JA 3ZVRA 2KTFA 2REXA 2WX0A 3ONSA 3PRMB 4W9FA 3DVGX 4EOYA 4F7ZA 1D3ZA 1OMWA 1GG3A 3ZUNA 3U7DA 3P7ZA 2LOXA 1BT0A 2IBIB 3B08A 2N23A 2CY4A 1WY8A 2KN5A 1P3RA 2Y8FA 2R2OA 1AQCA 5KQ1A 2B3AA 1UNQA 2BF8B 4XWXA 1E90A 2NMBA 4HATB 1X05A 3QX1A 2YVCA 1P9DU 4CHJA 1WJMA 5CX3A 2W9NA 1B55A 4LDTD 1WIAA 2LRUA 3O96A 5DI9B 2UWQA 3AU5A 3OAWA 2ELBA 3RCPA 3GYPA 3ZDTA 1I42A 1U5FA 2JWZA 1WXMA 1IYFA 2C5LC 5EFXA 4HDQA 3QC8B 3QAQA 2HTHA 2COAA 4DBGA 2D9WA 2MBHA 2ZJDA 3M62B 1WJNA 2DZKA 3TL5A 1TQZA 2GBKA 5LXIB 2OOBB 1W1HA 5C5BA 3CIKA 2M8SA 5C16A 1WX7A 2RGNB 3JSVA 3ZNZB 3NZUA 5FI1A 3ECIA 3Q3JA 3W1SC 3MPXA 4NQKE 5CHWA 1QZEA 3UGBB 3PRZA 3L13A 2YF0A 5D2MB 1P0RA 1EVHA 4IUMB 4GXBA 3P2BA 1P5TA 2UZRA 4MK0A 3K9OB 2PPHA 2M38A 2KK8A 5E6OA 3ZTDA 4AP4C 4CO7A 4IAPA 3AULA 2BGFA 3GYOA 1NDDA 3KYDD 2RNRB 2PE6B 3PSEB 4HPLB 2MFQA 4F1SA 3D8EA 2IO2B 4G3XB 3RCZA 2JRIB 1WJUA 1DYNA 3NY5A 3IVFA 3UQBA 2V3SA 5FR6A 1GUAB 1LFDA 2O6VD 1XR0B 2IYDB 2BWFA 1WGUA 5DH9B 2DAFA 2MRPA 2GMIC 3FM8C 5HE0A 2ZVNA 2FIFA 2G3QB 5D3WA 3PHWB 1WG7A 2GBNA 4GSWA 3WIMA 5IA7A 2DENB 4ICUA 3R7QA 2MWSB 4BKSD 2KD0A 2MKRA 2DHKA 5JHAA 4PS7A 2GS0A 2ZCCA 2N0YA 1WR6E 2BCJA 3RZWC 2DHIA 1HE8A 2MBBB 2ROZB 1V5TA 1U29A 2O2VB 4WSFA 1XD3B 2NPTA 2K25A 2KQ7A 2LXAA 2JXXA 3PSCA 5C5BB 1WGRA 1WXAA 4KDLB 3JSVB 5D6JB 2I5FA 2K8CA 4WQOB 1U4AA 2E2XA 2Z0QA 4W9EA 2CKHB 2C9WB 4LDTB 4BKSA 2LD9A 1EO6A 4KZ0A 2DN6A 3UZTA 3ULBA 2LGYA 1XD4A 3QARA 5JH5C 2J7QB 3RT3B 1Q67A 2ZNVC 1V9JA 2D07B 3ODWA 5E6PA 1FHXA 3M1IB 4HK2A 4NAWA 3DXEA 5HKHA 1V88A 4AJYB 4EZJA 3ML8A 2L1CA 4HAUB 4M0WB 3DXCA 3QA8A 1R4MI 2D11A 4W9IA 1UNRA 2D2QA 2COFA 1MIXA 3CXBB 4GPTB 2BPSA 2MBOA 3PREA 4IOYX 2JP2A 5DPRA 4IWPA 4IM3A 4TQ1A 4D0NB 3KUDB 3ZO5B 3NSUA 2OJRA 2V1YA 1QC6A 4HCPB 2LOZA 2DHJA 3CMMB 1H4RA 1YQBA 1ISNA 1XT9B 2LVOA 4K7SA 4NPNA 5AZFA 2P0HA 3PVLA 2OTXA 3O65B 2EC1A 4ICVA 2K2UA 2LI5A 2ZCBA 2N7EA 4II3B 2J0KA 2Z0PA 5GOWB 3LJ3A 1JRUA 2ASQA 1P6SA 3EFUA 4GOCA 1U5GA 3H9DA 2O2VA 2UYZB 2GBJA 2Y5BB 4KIKB 1LB1A 4ZRIA 2KFKB 2NPTB 4LCDE 3IBEA 2RUKB 1WGDA 2N1VA 5HE3A 3VH3B 2YS5A 1EGXA 4K81A 4WWPA 3VTUA 1RAXA 1UPRA 3N3KB 1LXDA 1XODA 4EMOA 2KLCA 2MQJA 2D9ZA 1EAZA 3PEGA 1RLFA 1TTNA 1VD2A 3KW5B 3RD2A 3OLMD 1X1MA 2G4SA 4B9KA 4DHZB 1L2NA 2ZZPB 3PP2A 2KWUB 4GDKA 3QK0A 4IM2A 3PLVA 1Z87A 5C6RA 4MGKE 1ZC3B 3H6NA 2D9XA 4N9F4 2XQNM 3D8FA 3PV1A 4NAWB 4HB0B 2DYOA 4HHVA 2R2QA 2M0XA 2BKRB 3G9WA 1MAIA 3NZSA 3ZNID 4EEWA 2ZNVB 1DDWA 1WF9A 2V76A 4W9KA 4W9DA 4HPMB 3KSYA 5IAAC 3T06A 2DZIA 2J0JA 2KMCA 2L0TA 2LUEA 2KFJA 4DXAB 1U27A 1WH3A 4PYZA 2KJHB 2X18A 4NNJB 3DDCB 1W1GA 2EJ8A 2ROVA 2YRYA 4F7GA 1WJ6A 4W9CA 1GC7A 3UIOB 4DHJD 3TW1A 1EF5A 1LQBA 2M17A 3H7PB 1E8YA 1N3HA 3OJ4B 5L83A 1TZ1A 2D9YA 2MX2A 3PLUA 1M7EA 3TCAA 2JUOA 2KANA 4W9GA 3SU8X 4KV2A 4KVGB 3SV1A 1Z5SB 2Z0EB 5CTRC 2MBEA 5C23A 2PE9A 3VUYA 1E5WA 1FGYA 4FN2A 4KIKA 2KFKA 3A98B 1DBHA 1DDVA 3APFA 4LJOB 3P6AA 5DPSA 4AOFA 2AL6A 5JHBA 2YLMA 2VRWB 4I6LB 5KHQA 4TYZA 3VUWA 1T0YA 4TV3A 3PG7A 1YD8U 3KH0A 2BKFA 1G6JA 2LRWA 5BO4B 3FEHA 3BINA 4HAVB 3R3MA 2RSGA 3A8PA 4G0NB 3JW0X 3LDZE 3C0RB 3V62A 2CHZA 1PQSA 2FNJB 4GDKB 4MH0E 3U30A 5CHVC 3DCGA 3NS8A 3DXDA 4MSMB 3L54A 3M63B 2N4FA 1WGYA 2DX1A 2L7RA 2Q13A 1EF1A 3SYXA 2XEWA 1A5RA 3ODOA 4K7UA 1WVHA 4CYEA 3NOBA 1WX9A 4IWOA 3AI5A 5DPTA 3WANA 2L3ZA 1UNPA 4II2B 4L6EA 4W9JA 3VQIA 2KDIA 2YT0A 3M3JA 1KM7A 1ZGUB 4BFRA 4CHKA 1U5DA 4HB4B 4KAXB 2KCJA 2NZ8B 2ELAA 1NBFC 2VRRB 1X1FA 3CSTA 2I1KA 5D3VA 5J3QA 3DBRI 3H7PA 2LGXA 3V6EB 2M1MA 2UVMA 4KZCA 1WE7A 2J0MA 3IG3A 1WI0A 3RYTA 2XK5B 4MGIE 2PZ1A 1ZKHA 1L7YA 4IW0A 1FOEA 1AARA 4F7UP 4AWJA 1V5OA 4FA6A 2M14A 3DBLI 5D7GA 1H10A 5J3YA 3HK0A 2KGXB 3X23A 1FHOA 3KUCB 2L8JA 5CHFA 2QHOA 4KSLC 4KSKC 2R0DA 4A6FA 5JHHA 2L2IA 1Z2MA 1WRDB 3A9KB 2D4QA 1C1YB 1X11A 5DIFB 3EHVA 4XZ4A 1SE9A 3L08A 3AJ4A 2KJRA 2QKLA 2VKIA 4GMXB 4CHMA 4WVFB 2CY5A 3ZNHB 3B0AA 2RGFA 3HHMA 4KHAA 3F5RA 5LLIA 4KDIC 4GN1A 4B6WA 4BKTA 2RVBB 5J17A 1XKEA 2JY6A 4F7HA 3OJ3A 3RULA 3APCA 4OVVA 2FCSA 4IG7B 1PLSA 1PMSA 2YT1A 3ML4A 2IO3B 1FHWA 1QQGA 1U5EA 3A1QA 4A3OA 4C0AA 4EJNA 2H7DA 3ULCA 2CHWA 2FCMA 2K1FA 2KDEB 3A4RA 4MY6A 1OQYA 2COCA 4JL9A 3MHSD 1P98A 3APDA 1J0WA 2DFKA 3QWZB 1V6EA 2FIDA 3SO6A 1RJ2A 4WWNA 3V6CB 3VFKA 3WAOA 3SNHA 3K9PB 4HB2B 3I3TB 2DA0A 4X57B 1RRBA 4J6IA 4WWOA 3VTVA 4JQWC 1WXSA 1BWNA 5C1ZA 2NVUI 4K17A 1V49A 2XK5A 2ZVOA 2KWCA 3WALA 4WJPA 2ZPNA 3PZDA 1WGGA 3MJWA 1UEFA 2A4ZA 2IFSA 4K2OA 2NBWB 4RMAA 1E7VA 4DHZE 3PTFC 2JZZA 4RM8A 5TR5A 3A9JA 3VVWB 3KZ1A 1V5MA 1WZ0A 2OQBA 2KO3A 3FSSA 4A6FB 3KRXA 3F0WA 3PRPB 3A9KA 1WFYA 3R66C 1UPQA 2I5CA 2A5UA 2LASA 2KJ6A 2DYNA 5JLJB 2GCJA 3QJZA 4PYUA 3ZLZA 2IO1B 1UBIA 2WDTB 2PJHA 2Z59B 2JRHA 5KCVA 3ZKJC 3A8QA 4K2PA 2KDBA 2NCNA 4IC7B 2KX3A 4MM3A 4GZUA 3ZVVA 3TFMA 2KHWB 2Z0OA 4MSQB 3KY9A 1R4NI 2MA9B 2DZMA 3HM3A 3VTWA 3AXCA 3ZNGC 4A20A 1I35A 2GCLA 1OEYJ 3A1QB 1TXDA 3ZTCA 1V2YA 4WAAA 1MK7B 4MJSB 3VDZA 4MDKE 1DDMA 5E6NA 5C79A 3QHTA 4RM9A 5L95C 1BTKA 5LXHA 4PS3A 2YS3A 2R09A 2N9XA 2FJLA 1Y19B 2XBBC 4Z2MB 3VOQA 2N9PC 4HAXB 2WYQA 1M94A 1FXTB 2GBRA 4BBNC 3VHTC 3V60A 3UQAA 2N7DA 5D94A 2O6VA 5KHOA 1KZ7A 1Q1OA 2EKEC 2LVQA 2KXJA 2V4LA 3TIXA 4DK5A 2P8VA 2D3GA 3ODXA 2DZJA 3KVFB 1F9JA 4GDLB 1ZSQA 4K7WA 1K5DB 3N32A 3DOWA 3A9JB 2Y8GA 4AJWA 1I2HA 5HE2A 3L0WB 2BWES 1I7AA 3W1SA 1WMHB 2CU1A 3AU4A 2J59M 3HIZA 2UZSA 1FAOA 4WJQA 2G35A 3WAPA 4Z2NA 2L76A 1NU2A 2KKCA 1KOTA 1YX6B 2NBUA 3ZRFA 1BTNA 2GJYA 1KJTA 4G50A 3T8MA 2MLBA 1SHCA 1K5GB 3PVUA 3L17A 1TJ6A 1IP9A 3ALBA 3UIPB 2DYQA 5DHFB 4PNKA 2LWPA 3CSFA 2HJ8A 1WI1A 2DHZA 1ZW7A 1MPHA 3GOEA 1WZ3A 4MT7A 1WX8A 2RD0A 3WAMA 1IRSA 5LOPB 2N9EB 1ZC4B 4HAYB 2RSUA 3A33B 3TVVA 1TGZB 2DKPA 4MJSA 4F8CB 4YONA 2MW5A 1MG8A 4GB9A 3EECA 4JGHB 2W2XC 5L81A 4G11A 5CLLB 3DPDA 1UZXB 5D3XA 3W1YA 2CR5A 4FBJB 3S2AA 2DLWA 4DX8A 2KTRA 2C7NB 1GNUA 3DBHI 5HE1A 4HDOA 2YS1A 3PVWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HAZ B;  2AL3 A;  4HJK A;  3TJP A;  4ANV A;  4NSW A;  1SIF A;  2O6V B;  2K00 A;  3ZW3 A;  3TO1 A;  2NS5 A;  1V86 A;  4BOS C;  1NTV A;  1ZVR A;  1K8R B;  3QWM A;  4GDL A;  3T9L A;  4A3P A;  1X86 A;  4YL8 A;  3JVZ X;  4DDG D;  3ENE A;  3IHP C;  1WJ4 A;  4K1R B;  2KVR A;  4EFO A;  2W2X D;  3N7C A;  4IM0 A;  1SGH A;  2KOX A;  3HM6 X;  3QCA A;  4ZYN A;  2D10 A;  1DRO A;  2DKQ A;  1U2B A;  3MDB C;  3QBV B;  3SUZ A;  1P3Q U;  1S1Q B;  1WMH A;  2DYB A;  2FCQ A;  2K8B A;  4I6P A;  2RPQ A;  3SD5 A;  4EZL A;  3M95 A;  1WM2 A;  3KRW A;  2GBM A;  3BJI A;  4PQ0 A;  1TBE A;  2BYF A;  2C7M B;  4DBB A;  2MP2 B;  3WA0 A;  4HWI B;  2KMA A;  1NTY A;  2AYO B;  1E8X A;  3PGE A;  4IWQ A;  2VSZ A;  2JZ3 B;  2KC1 A;  4HAW B;  3VXW A;  1GJZ A;  3PS6 A;  2LYD A;  5DHA B;  5FI0 A;  1BAK A;  1UBQ A;  4FUL A;  4NJ7 A;  4BKG A;  4P7I A;  1E8W A;  2K6Q A;  3Q3F A;  5DPW A;  1KZG A;  3H1U A;  3SHQ A;  4MEM A;  2BYE A;  4EUT A;  3DVN U;  2WX1 A;  2KDF B;  1WE6 A;  3VH4 B;  2FAZ A;  3TMP B;  4NQL B;  2KQS A;  4ANX A;  2EMS A;  2LG1 A;  1Y8R C;  3KYC D;  1WYW B;  4GIV A;  2Z0D B;  3DBS A;  4FLH A;  4MEL A;  4BBN F;  3WYF B;  2KTR B;  2COD A;  4ANU A;  2EMT A;  1J8C A;  4FHJ A;  1WGQ A;  4WJN A;  4B95 A;  2PEA A;  3BY4 B;  1LM8 B;  2MWN B;  2MDX A;  4GU2 A;  3PPA A;  3L10 B;  4W9H A;  1GC6 A;  2HD5 B;  3TBL D;  2RLO A;  2CAY A;  1OY2 A;  4EKU A;  1OEY A;  3HW2 B;  2C7H A;  2G45 B;  2K39 A;  3V5W A;  2P0F A;  5G2N A;  3UIN B;  3LJU X;  2ZEQ A;  1OGW A;  4HVB A;  2HE7 A;  4FJV B;  4JIO U;  2MSE D;  2DYM A;  5G55 A;  2KNB A;  1XCG A;  4A6K A;  1EUV B;  1RFA A;  1V5U A;  2DX5 B;  3IFW B;  3V61 A;  3U8Z A;  2N1W A;  2FUH B;  2WWZ A;  4ZRK A;  4DWF A;  5J18 A;  4WJ7 A;  4A5K A;  5JP4 A;  3OAN A;  1UD7 A;  2JVC A;  1UEL A;  4B6H A;  2MP2 A;  4KHB B;  2LGD A;  4TKN A;  4ZDV A;  2D9V A;  1OTR B;  3ZRC A;  4KHO A;  3R7R A;  3VAW A;  2IYB A;  1YX5 B;  2NBV B;  4MGZ E;  1MK9 B;  1W1D A;  3B1L X;  1V5P A;  2AEH A;  5AZH A;  2ADZ A;  4TUU A;  4E71 A;  1E7U A;  1IPG A;  1XQQ A;  2MBQ A;  2P0D A;  2LXC A;  3CF6 E;  3ZIM A;  2CRF A;  2IY1 B;  1H8C A;  2LJ5 A;  2H7E A;  4DX9 0;  2IO0 B;  1UGM A;  2KUP A;  4W9L A;  1NI2 A;  5D3Y A;  4M8N A;  2LZ6 A;  4HCN B;  3MTN B;  4OVU A;  4BOZ B;  2I1J A;  2KC2 A;  4IFS A;  2FCN A;  1WJ1 A;  1CMX B;  1KLV A;  1XX0 A;  1YJ1 A;  3KUZ A;  1V61 A;  1X1G A;  2LKO A;  3DVN V;  4WJO A;  1E8Z A;  3JYU A;  4EZK A;  3D8D A;  2KX0 A;  3H7S A;  4M8M A;  1VCB A;  1AWE A;  1KI1 B;  2NR2 A;  1M7R A;  1UH6 A;  1OQN A;  2ZPY A;  4NJ6 A;  2G4D B;  2JF5 A;  1ZM0 A;  5LON B;  3N30 A;  1YIW A;  3HQC A;  3ML9 A;  4DDI D;  4DHJ B;  3L16 A;  5J3T A;  2KZR A;  2LVP A;  3VUX A;  2KWV B;  2QKM A;  1Q0W B;  5CLQ B;  2DX5 A;  1WXV A;  3DVG Y;  1V80 A;  3PHX B;  3QQ8 B;  2JPH A;  3RUI B;  3UF8 A;  1S3S G;  4XC2 A;  2LUL A;  1V81 A;  2IZV B;  4FJZ A;  1P1A A;  4FJY A;  4GGQ A;  2GOW A;  2CHX A;  4BBK A;  5JHG A;  3A4S C;  4I6N B;  4MGY E;  2KLG A;  4GMV A;  1RRP B;  3QIJ A;  1Q5W B;  2IY0 B;  3NHE B;  4PS8 A;  3RZF A;  3SDL C;  5JZE B;  2L0F A;  3ZDM C;  5D27 A;  2JT4 B;  2YSZ A;  4LJP B;  3DQV A;  4FHK A;  4H8S A;  2DAJ A;  4XX5 A;  3D32 A;  1J0G A;  2RR9 A;  2M4N A;  5AZG A;  1FGZ A;  4NY0 A;  1V89 A;  4ZRJ A;  4E74 A;  4HLE A;  4FAD A;  4HB3 B;  1Y5O A;  4Y94 A;  2BYV E;  5EDS A;  3VIA A;  1C3T A;  5GMV A;  4HXD A;  2C60 A;  1FB8 A;  1J19 A;  2HTH B;  4TQ0 A;  4BVU C;  2K6D B;  2L05 A;  1LW3 A;  3EC8 A;  3X0W A;  2W2W A;  4E3C A;  5AEK B;  2Y7B A;  4URK A;  1MIZ B;  5DCN A;  2CS4 A;  2L00 B;  5J2R A;  1MKE A;  2DTC A;  3PT2 B;  3GZN I;  4AUQ C;  4ASW C;  1PFJ A;  2K8H A;  1WM3 A;  4JLC A;  5KQ4 A;  4ANW A;  1WR1 A;  1WGH A;  2MCN B;  4A6H A;  2AWT A;  2K2J A;  3ZVR A;  2KTF A;  2REX A;  2WX0 A;  3ONS A;  3PRM B;  4W9F A;  3DVG X;  4EOY A;  4F7Z A;  1D3Z A;  1OMW A;  1GG3 A;  3ZUN A;  3U7D A;  3P7Z A;  2LOX A;  1BT0 A;  2IBI B;  3B08 A;  2N23 A;  2CY4 A;  1WY8 A;  2KN5 A;  1P3R A;  2Y8F A;  2R2O A;  1AQC A;  5KQ1 A;  2B3A A;  1UNQ A;  2BF8 B;  4XWX A;  1E90 A;  2NMB A;  4HAT B;  1X05 A;  3QX1 A;  2YVC A;  1P9D U;  4CHJ A;  1WJM A;  5CX3 A;  2W9N A;  1B55 A;  4LDT D;  1WIA A;  2LRU A;  3O96 A;  5DI9 B;  2UWQ A;  3AU5 A;  3OAW A;  2ELB A;  3RCP A;  3GYP A;  3ZDT A;  1I42 A;  1U5F A;  2JWZ A;  1WXM A;  1IYF A;  2C5L C;  5EFX A;  4HDQ A;  3QC8 B;  3QAQ A;  2HTH A;  2COA A;  4DBG A;  2D9W A;  2MBH A;  2ZJD A;  3M62 B;  1WJN A;  2DZK A;  3TL5 A;  1TQZ A;  2GBK A;  5LXI B;  2OOB B;  1W1H A;  5C5B A;  3CIK A;  2M8S A;  5C16 A;  1WX7 A;  2RGN B;  3JSV A;  3ZNZ B;  3NZU A;  5FI1 A;  3ECI A;  3Q3J A;  3W1S C;  3MPX A;  4NQK E;  5CHW A;  1QZE A;  3UGB B;  3PRZ A;  3L13 A;  2YF0 A;  5D2M B;  1P0R A;  1EVH A;  4IUM B;  4GXB A;  3P2B A;  1P5T A;  2UZR A;  4MK0 A;  3K9O B;  2PPH A;  2M38 A;  2KK8 A;  5E6O A;  3ZTD A;  4AP4 C;  4CO7 A;  4IAP A;  3AUL A;  2BGF A;  3GYO A;  1NDD A;  3KYD D;  2RNR B;  2PE6 B;  3PSE B;  4HPL B;  2MFQ A;  4F1S A;  3D8E A;  2IO2 B;  4G3X B;  3RCZ A;  2JRI B;  1WJU A;  1DYN A;  3NY5 A;  3IVF A;  3UQB A;  2V3S A;  5FR6 A;  1GUA B;  1LFD A;  2O6V D;  1XR0 B;  2IYD B;  2BWF A;  1WGU A;  5DH9 B;  2DAF A;  2MRP A;  2GMI C;  3FM8 C;  5HE0 A;  2ZVN A;  2FIF A;  2G3Q B;  5D3W A;  3PHW B;  1WG7 A;  2GBN A;  4GSW A;  3WIM A;  5IA7 A;  2DEN B;  4ICU A;  3R7Q A;  2MWS B;  4BKS D;  2KD0 A;  2MKR A;  2DHK A;  5JHA A;  4PS7 A;  2GS0 A;  2ZCC A;  2N0Y A;  1WR6 E;  2BCJ A;  3RZW C;  2DHI A;  1HE8 A;  2MBB B;  2ROZ B;  1V5T A;  1U29 A;  2O2V B;  4WSF A;  1XD3 B;  2NPT A;  2K25 A;  2KQ7 A;  2LXA A;  2JXX A;  3PSC A;  5C5B B;  1WGR A;  1WXA A;  4KDL B;  3JSV B;  5D6J B;  2I5F A;  2K8C A;  4WQO B;  1U4A A;  2E2X A;  2Z0Q A;  4W9E A;  2CKH B;  2C9W B;  4LDT B;  4BKS A;  2LD9 A;  1EO6 A;  4KZ0 A;  2DN6 A;  3UZT A;  3ULB A;  2LGY A;  1XD4 A;  3QAR A;  5JH5 C;  2J7Q B;  3RT3 B;  1Q67 A;  2ZNV C;  1V9J A;  2D07 B;  3ODW A;  5E6P A;  1FHX A;  3M1I B;  4HK2 A;  4NAW A;  3DXE A;  5HKH A;  1V88 A;  4AJY B;  4EZJ A;  3ML8 A;  2L1C A;  4HAU B;  4M0W B;  3DXC A;  3QA8 A;  1R4M I;  2D11 A;  4W9I A;  1UNR A;  2D2Q A;  2COF A;  1MIX A;  3CXB B;  4GPT B;  2BPS A;  2MBO A;  3PRE A;  4IOY X;  2JP2 A;  5DPR A;  4IWP A;  4IM3 A;  4TQ1 A;  4D0N B;  3KUD B;  3ZO5 B;  3NSU A;  2OJR A;  2V1Y A;  1QC6 A;  4HCP B;  2LOZ A;  2DHJ A;  3CMM B;  1H4R A;  1YQB A;  1ISN A;  1XT9 B;  2LVO A;  4K7S A;  4NPN A;  5AZF A;  2P0H A;  3PVL A;  2OTX A;  3O65 B;  2EC1 A;  4ICV A;  2K2U A;  2LI5 A;  2ZCB A;  2N7E A;  4II3 B;  2J0K A;  2Z0P A;  5GOW B;  3LJ3 A;  1JRU A;  2ASQ A;  1P6S A;  3EFU A;  4GOC A;  1U5G A;  3H9D A;  2O2V A;  2UYZ B;  2GBJ A;  2Y5B B;  4KIK B;  1LB1 A;  4ZRI A;  2KFK B;  2NPT B;  4LCD E;  3IBE A;  2RUK B;  1WGD A;  2N1V A;  5HE3 A;  3VH3 B;  2YS5 A;  1EGX A;  4K81 A;  4WWP A;  3VTU A;  1RAX A;  1UPR A;  3N3K B;  1LXD A;  1XOD A;  4EMO A;  2KLC A;  2MQJ A;  2D9Z A;  1EAZ A;  3PEG A;  1RLF A;  1TTN A;  1VD2 A;  3KW5 B;  3RD2 A;  3OLM D;  1X1M A;  2G4S A;  4B9K A;  4DHZ B;  1L2N A;  2ZZP B;  3PP2 A;  2KWU B;  4GDK A;  3QK0 A;  4IM2 A;  3PLV A;  1Z87 A;  5C6R A;  4MGK E;  1ZC3 B;  3H6N A;  2D9X A;  4N9F 4;  2XQN M;  3D8F A;  3PV1 A;  4NAW B;  4HB0 B;  2DYO A;  4HHV A;  2R2Q A;  2M0X A;  2BKR B;  3G9W A;  1MAI A;  3NZS A;  3ZNI D;  4EEW A;  2ZNV B;  1DDW A;  1WF9 A;  2V76 A;  4W9K A;  4W9D A;  4HPM B;  3KSY A;  5IAA C;  3T06 A;  2DZI A;  2J0J A;  2KMC A;  2L0T A;  2LUE A;  2KFJ A;  4DXA B;  1U27 A;  1WH3 A;  4PYZ A;  2KJH B;  2X18 A;  4NNJ B;  3DDC B;  1W1G A;  2EJ8 A;  2ROV A;  2YRY A;  4F7G A;  1WJ6 A;  4W9C A;  1GC7 A;  3UIO B;  4DHJ D;  3TW1 A;  1EF5 A;  1LQB A;  2M17 A;  3H7P B;  1E8Y A;  1N3H A;  3OJ4 B;  5L83 A;  1TZ1 A;  2D9Y A;  2MX2 A;  3PLU A;  1M7E A;  3TCA A;  2JUO A;  2KAN A;  4W9G A;  3SU8 X;  4KV2 A;  4KVG B;  3SV1 A;  1Z5S B;  2Z0E B;  5CTR C;  2MBE A;  5C23 A;  2PE9 A;  3VUY A;  1E5W A;  1FGY A;  4FN2 A;  4KIK A;  2KFK A;  3A98 B;  1DBH A;  1DDV A;  3APF A;  4LJO B;  3P6A A;  5DPS A;  4AOF A;  2AL6 A;  5JHB A;  2YLM A;  2VRW B;  4I6L B;  5KHQ A;  4TYZ A;  3VUW A;  1T0Y A;  4TV3 A;  3PG7 A;  1YD8 U;  3KH0 A;  2BKF A;  1G6J A;  2LRW A;  5BO4 B;  3FEH A;  3BIN A;  4HAV B;  3R3M A;  2RSG A;  3A8P A;  4G0N B;  3JW0 X;  3LDZ E;  3C0R B;  3V62 A;  2CHZ A;  1PQS A;  2FNJ B;  4GDK B;  4MH0 E;  3U30 A;  5CHV C;  3DCG A;  3NS8 A;  3DXD A;  4MSM B;  3L54 A;  3M63 B;  2N4F A;  1WGY A;  2DX1 A;  2L7R A;  2Q13 A;  1EF1 A;  3SYX A;  2XEW A;  1A5R A;  3ODO A;  4K7U A;  1WVH A;  4CYE A;  3NOB A;  1WX9 A;  4IWO A;  3AI5 A;  5DPT A;  3WAN A;  2L3Z A;  1UNP A;  4II2 B;  4L6E A;  4W9J A;  3VQI A;  2KDI A;  2YT0 A;  3M3J A;  1KM7 A;  1ZGU B;  4BFR A;  4CHK A;  1U5D A;  4HB4 B;  4KAX B;  2KCJ A;  2NZ8 B;  2ELA A;  1NBF C;  2VRR B;  1X1F A;  3CST A;  2I1K A;  5D3V A;  5J3Q A;  3DBR I;  3H7P A;  2LGX A;  3V6E B;  2M1M A;  2UVM A;  4KZC A;  1WE7 A;  2J0M A;  3IG3 A;  1WI0 A;  3RYT A;  2XK5 B;  4MGI E;  2PZ1 A;  1ZKH A;  1L7Y A;  4IW0 A;  1FOE A;  1AAR A;  4F7U P;  4AWJ A;  1V5O A;  4FA6 A;  2M14 A;  3DBL I;  5D7G A;  1H10 A;  5J3Y A;  3HK0 A;  2KGX B;  3X23 A;  1FHO A;  3KUC B;  2L8J A;  5CHF A;  2QHO A;  4KSL C;  4KSK C;  2R0D A;  4A6F A;  5JHH A;  2L2I A;  1Z2M A;  1WRD B;  3A9K B;  2D4Q A;  1C1Y B;  1X11 A;  5DIF B;  3EHV A;  4XZ4 A;  1SE9 A;  3L08 A;  3AJ4 A;  2KJR A;  2QKL A;  2VKI A;  4GMX B;  4CHM A;  4WVF B;  2CY5 A;  3ZNH B;  3B0A A;  2RGF A;  3HHM A;  4KHA A;  3F5R A;  5LLI A;  4KDI C;  4GN1 A;  4B6W A;  4BKT A;  2RVB B;  5J17 A;  1XKE A;  2JY6 A;  4F7H A;  3OJ3 A;  3RUL A;  3APC A;  4OVV A;  2FCS A;  4IG7 B;  1PLS A;  1PMS A;  2YT1 A;  3ML4 A;  2IO3 B;  1FHW A;  1QQG A;  1U5E A;  3A1Q A;  4A3O A;  4C0A A;  4EJN A;  2H7D A;  3ULC A;  2CHW A;  2FCM A;  2K1F A;  2KDE B;  3A4R A;  4MY6 A;  1OQY A;  2COC A;  4JL9 A;  3MHS D;  1P98 A;  3APD A;  1J0W A;  2DFK A;  3QWZ B;  1V6E A;  2FID A;  3SO6 A;  1RJ2 A;  4WWN A;  3V6C B;  3VFK A;  3WAO A;  3SNH A;  3K9P B;  4HB2 B;  3I3T B;  2DA0 A;  4X57 B;  1RRB A;  4J6I A;  4WWO A;  3VTV A;  4JQW C;  1WXS A;  1BWN A;  5C1Z A;  2NVU I;  4K17 A;  1V49 A;  2XK5 A;  2ZVO A;  2KWC A;  3WAL A;  4WJP A;  2ZPN A;  3PZD A;  1WGG A;  3MJW A;  1UEF A;  2A4Z A;  2IFS A;  4K2O A;  2NBW B;  4RMA A;  1E7V A;  4DHZ E;  3PTF C;  2JZZ A;  4RM8 A;  5TR5 A;  3A9J A;  3VVW B;  3KZ1 A;  1V5M A;  1WZ0 A;  2OQB A;  2KO3 A;  3FSS A;  4A6F B;  3KRX A;  3F0W A;  3PRP B;  3A9K A;  1WFY A;  3R66 C;  1UPQ A;  2I5C A;  2A5U A;  2LAS A;  2KJ6 A;  2DYN A;  5JLJ B;  2GCJ A;  3QJZ A;  4PYU A;  3ZLZ A;  2IO1 B;  1UBI A;  2WDT B;  2PJH A;  2Z59 B;  2JRH A;  5KCV A;  3ZKJ C;  3A8Q A;  4K2P A;  2KDB A;  2NCN A;  4IC7 B;  2KX3 A;  4MM3 A;  4GZU A;  3ZVV A;  3TFM A;  2KHW B;  2Z0O A;  4MSQ B;  3KY9 A;  1R4N I;  2MA9 B;  2DZM A;  3HM3 A;  3VTW A;  3AXC A;  3ZNG C;  4A20 A;  1I35 A;  2GCL A;  1OEY J;  3A1Q B;  1TXD A;  3ZTC A;  1V2Y A;  4WAA A;  1MK7 B;  4MJS B;  3VDZ A;  4MDK E;  1DDM A;  5E6N A;  5C79 A;  3QHT A;  4RM9 A;  5L95 C;  1BTK A;  5LXH A;  4PS3 A;  2YS3 A;  2R09 A;  2N9X A;  2FJL A;  1Y19 B;  2XBB C;  4Z2M B;  3VOQ A;  2N9P C;  4HAX B;  2WYQ A;  1M94 A;  1FXT B;  2GBR A;  4BBN C;  3VHT C;  3V60 A;  3UQA A;  2N7D A;  5D94 A;  2O6V A;  5KHO A;  1KZ7 A;  1Q1O A;  2EKE C;  2LVQ A;  2KXJ A;  2V4L A;  3TIX A;  4DK5 A;  2P8V A;  2D3G A;  3ODX A;  2DZJ A;  3KVF B;  1F9J A;  4GDL B;  1ZSQ A;  4K7W A;  1K5D B;  3N32 A;  3DOW A;  3A9J B;  2Y8G A;  4AJW A;  1I2H A;  5HE2 A;  3L0W B;  2BWE S;  1I7A A;  3W1S A;  1WMH B;  2CU1 A;  3AU4 A;  2J59 M;  3HIZ A;  2UZS A;  1FAO A;  4WJQ A;  2G35 A;  3WAP A;  4Z2N A;  2L76 A;  1NU2 A;  2KKC A;  1KOT A;  1YX6 B;  2NBU A;  3ZRF A;  1BTN A;  2GJY A;  1KJT A;  4G50 A;  3T8M A;  2MLB A;  1SHC A;  1K5G B;  3PVU A;  3L17 A;  1TJ6 A;  1IP9 A;  3ALB A;  3UIP B;  2DYQ A;  5DHF B;  4PNK A;  2LWP A;  3CSF A;  2HJ8 A;  1WI1 A;  2DHZ A;  1ZW7 A;  1MPH A;  3GOE A;  1WZ3 A;  4MT7 A;  1WX8 A;  2RD0 A;  3WAM A;  1IRS A;  5LOP B;  2N9E B;  1ZC4 B;  4HAY B;  2RSU A;  3A33 B;  3TVV A;  1TGZ B;  2DKP A;  4MJS A;  4F8C B;  4YON A;  2MW5 A;  1MG8 A;  4GB9 A;  3EEC A;  4JGH B;  2W2X C;  5L81 A;  4G11 A;  5CLL B;  3DPD A;  1UZX B;  5D3X A;  3W1Y A;  2CR5 A;  4FBJ B;  3S2A A;  2DLW A;  4DX8 A;  2KTR A;  2C7N B;  1GNU A;  3DBH I;  5HE1 A;  4HDO A;  2YS1 A;  3PVW A; 
#chains in the Genus database with same CATH topology
 4HAZ B;  2AL3 A;  4HJK A;  4ANV A;  1GB1 A;  2WXQ A;  1ZVR A;  4GDL A;  1X86 A;  3JVZ X;  4K1R B;  2KVR A;  4IM0 A;  2KOX A;  1DRO A;  3SUZ A;  1S1Q B;  2DYB A;  1OQQ A;  2RPQ A;  3M95 A;  3BJI A;  2BYF A;  2FUG 1;  2BS4 B;  1XO3 A;  4HWI B;  2KMA A;  1E8X A;  2JZ3 B;  5DHA B;  2NBV A;  4NJ7 A;  5DPW A;  4P7I A;  1E8W A;  2K0P A;  2K6Q A;  3Q8A A;  1KZG A;  3BYT B;  4EUT A;  1HQR D;  3LYY A;  3TMP B;  1VZ6 A;  3KYC D;  1F0Z A;  1K50 A;  3DBS A;  4FLH A;  3RNC C;  2Q5W D;  4QJ3 B;  2EMT A;  1J8C A;  4FHJ A;  1WGQ A;  1WSP A;  3BVM A;  1LM8 B;  3L10 B;  2RLO A;  2K39 A;  5G2N A;  2C7H A;  3V5W A;  2PW9 A;  2HE7 A;  1FFV A;  1IBX B;  5G55 A;  2K8E A;  1VRA B;  3V6E B;  2DX5 B;  2N1W A;  4A5K A;  1UD7 A;  1A70 A;  4B6H A;  1OTR B;  3ZRC A;  4KKJ A;  1MK9 B;  1W1D A;  1V5P A;  1XQQ A;  3CF6 E;  1SF0 A;  2IO0 B;  3Q6B A;  4M8N A;  2LZ6 A;  4BOZ B;  2I1J A;  2KC2 A;  1WJ1 A;  4Q2J A;  5BYS A;  1X1G A;  4HKZ E;  1E8Z A;  3H7S A;  2NR2 A;  1M7R A;  3N1Y C;  1T0S C;  4HJG E;  3ML9 A;  1WXQ A;  5BYR A;  1T3Q A;  5J3T A;  2LVP A;  2QKM A;  2INN E;  2JPH A;  1S3S G;  1MHH E;  4XYC A;  3SFE B;  4YTM B;  5D3D A;  2PKO A;  4FJY A;  2GOW A;  4I6N B;  4MGY E;  3E9S A;  4RCO A;  1TKG A;  2KLG A;  1C78 A;  4TSS A;  2L32 A;  3ZYY X;  2L0F A;  3NWA A;  3AE2 B;  2IGG A;  2NMQ A;  3NVV A;  1RYJ A;  4XX5 A;  3D32 A;  4C00 A;  2CJO A;  2K9X A;  2M4N A;  2RR9 A;  4NY0 A;  4WQM A;  2RDG A;  2IGH A;  1YQ3 B;  3VIA A;  5GMV A;  1F1H A;  5BMH A;  1WYG A;  4E3C A;  1XCQ L;  4DQO C;  1MKE A;  1C77 A;  2KAJ A;  4JLC A;  5KQ4 A;  4W9F A;  3ZVR A;  4F7Z A;  3PRM B;  3RPF C;  1OMW A;  3ZUN A;  3U7D A;  3UI3 A;  3OHM B;  2Y8F A;  2Y5P A;  2BF8 B;  1UNQ A;  1E90 A;  3NUH B;  1MVK A;  5H92 C;  1WJM A;  4US9 A;  4LDT D;  2UWQ A;  4ITK A;  3QAQ A;  2MHJ A;  2ZJD A;  2DZK A;  2OOB B;  1W1H A;  1WRI A;  1TJE A;  3RN9 C;  3W1S C;  4NQK E;  3BYY B;  1EVH A;  1PUT A;  1FEH A;  3J9C A;  2Z8L A;  2UZR A;  2E6X A;  4CO7 A;  3MP9 A;  2BGF A;  2RNR B;  2PE6 B;  3D8E A;  2JRI B;  3BWU D;  2MJ3 A;  1ZE3 D;  2OED A;  2V3S A;  1EM7 A;  3DWM A;  5DH9 B;  2GMI C;  3PHW B;  3BZD B;  1AN8 A;  1PYW D;  2DEN B;  2MKR A;  5JHA A;  2X8X X;  2GS0 A;  2DHI A;  1HXY D;  1U29 A;  2KQ7 A;  3EGR A;  2JXX A;  1WGR A;  1WXA A;  4KDL B;  5D6J B;  2I5F A;  5H8Y E;  2K8C A;  1GPX A;  2LD9 A;  1EO6 A;  2LHD A;  4N6E B;  2H88 B;  2D07 B;  4HK2 A;  1ZDX A;  3FIL A;  2WLB A;  1V88 A;  3Q8B A;  4AJY B;  4M0W B;  1L5P A;  3NWD A;  4IOY X;  2JP2 A;  4GNK B;  3NSU A;  2FE8 A;  4BVU C;  2LOZ A;  1I4G A;  1YQB A;  1ISN A;  1KLG D;  1XT9 B;  4K7S A;  2EC1 A;  1FRD A;  2BS2 B;  2LI5 A;  2ZCB A;  1JAL A;  2N7E A;  2J0K A;  2Z0P A;  1JRU A;  2ASQ A;  4ZRQ A;  2UYZ B;  3LXF A;  2NPT B;  4ZRI A;  1J7B A;  2KFK B;  3IBE A;  2RUK B;  1WGD A;  1XXG A;  2ICI A;  3I5J C;  5HFY A;  3RD2 A;  1VD2 A;  5IOI A;  4GDK A;  4IM2 A;  5C6R A;  1PGB A;  2QJL A;  3PV1 A;  3FIL B;  2BKR B;  2BS3 B;  4OW0 A;  1UF0 A;  2KMC A;  1VDV A;  1ZXI A;  1ZOY B;  4NNJ B;  2EJ8 A;  2YRY A;  1GC7 A;  2M17 A;  1E8Y A;  1JWU D;  5I4D A;  1TZ1 A;  2D9Y A;  1M7E A;  4W9G A;  3SU8 X;  5EE9 A;  3DHG C;  2MBE A;  3VUY A;  4FN2 A;  2KFK A;  2OHF A;  4ZYS A;  1T0Q C;  3KQ4 A;  4TYZ A;  2LHE A;  3KH0 A;  5G5H A;  4HPP A;  5BO4 B;  4HAV B;  3PO0 A;  1TKY A;  3LDZ E;  3C0R B;  1SB3 C;  4KX6 B;  3V62 A;  4GDK B;  2IPK D;  2DX1 A;  3EUB 2;  2Q13 A;  1A5R A;  1L4D B;  4UDU C;  1QOB A;  1FNW A;  3AI5 A;  3WAN A;  4II2 B;  1UNP A;  4W9J A;  4MT5 A;  4JPS A;  3AE7 B;  3NVW A;  1I7H A;  4HB4 B;  1NBF C;  2ELA A;  3DBR I;  2UU7 A;  3CST A;  2I1K A;  1ZXH A;  2J0M A;  1WI0 A;  2WU2 B;  2PZ1 A;  2M14 A;  1SE4 A;  3R8B A;  2KGX B;  4YWG G;  2QHO A;  4KSL C;  1YOV B;  2L2I A;  4P6V F;  2KR0 A;  5DIF B;  4XZ4 A;  1B9R A;  2CY5 A;  3F5R A;  4KDI C;  1QOG A;  3P1M A;  3N1Z C;  3OWE B;  1BML C;  4A3O A;  4EJN A;  2H7D A;  2INP E;  1F77 A;  1KTK A;  3MHS D;  5GXG B;  3U7Z A;  4XWT A;  1E0Z A;  2PVO D;  4OSN A;  2DFK A;  1V6E A;  1RJ2 A;  4XE0 A;  3V6C B;  1E9M A;  4HB2 B;  4X57 B;  1L0X B;  1WGK A;  4YTN B;  2ZVO A;  4P1C C;  4WJP A;  2ZPN A;  2VH2 A;  4RMA A;  2IFS A;  4K2O A;  3I9V 1;  2WXI A;  3VVW B;  3IAS 1;  3R66 C;  1UPQ A;  1PFD A;  2A5U A;  2LAS A;  5JLJ B;  3NRZ A;  4HEA 1;  2WDT B;  3A8Q A;  4K2P A;  4GZU A;  4RF0 A;  4A20 A;  2N9L A;  2MEK A;  3A1Q B;  3U12 A;  4WAA A;  1MK7 B;  4MJS B;  3QHT A;  5L95 C;  2KN4 A;  2N9X A;  4PS3 A;  2J42 A;  4LNI A;  1B1Z A;  2XBB C;  3VOQ A;  1M94 A;  2M19 A;  1FXT B;  3VHT C;  2O6V A;  3TIX A;  2P8V A;  3ODX A;  3KVF B;  1XEE A;  3AN1 A;  4JWU C;  4K7W A;  1K5D B;  5AUK A;  2Y8G A;  2K22 A;  4AJW A;  2BWE S;  3AEG B;  1I7A A;  3IXS A;  2J59 M;  2UZS A;  3WAP A;  4Z2N A;  2JX5 A;  1NU2 A;  2L76 A;  1KJT A;  2JWU A;  2MLB A;  1SHC A;  3PVU A;  3L17 A;  3ALB A;  3URY A;  2DYQ A;  3GOE A;  2BB6 A;  2LFI A;  1I4P A;  2RD0 A;  3WAM A;  4MJS A;  2DKP A;  2PLP A;  4KGT A;  5L81 A;  3FC4 A;  3T3O A;  4FBJ B;  1N6Z A;  3EA6 A;  3S2A A;  4DX8 A;  2C7N B;  1GNU A;  3PVW A;  1HZ6 A;  3TJP A;  1QIL A;  5IKC M;  2O6V B;  1QT9 A;  3ZW3 A;  3TO1 A;  2NS5 A;  4A3P A;  4DDG D;  3IHP C;  1WJ4 A;  4EFO A;  2K5P A;  2W2X D;  3HM6 X;  4DIX A;  2D10 A;  2C7M B;  1U2B A;  2K8B A;  4I6P A;  3TEW A;  3AV8 A;  2D3A A;  2VSZ A;  1C79 A;  3ZXR A;  4FUL A;  3Q3F A;  2GI9 A;  2J52 A;  3DVN U;  4NQL B;  3ZQ4 A;  2EMS A;  1Y8R C;  4IKG A;  4ANX A;  4GIV A;  4MEL A;  3WYF B;  2COD A;  4WJN A;  2BB5 A;  1L4Z B;  4B95 A;  1NYQ A;  1DOI A;  4W9H A;  1GC6 A;  2G45 B;  2VH1 A;  2P0F A;  3LJU X;  2ZEQ A;  3RNE C;  4JIO U;  2H89 B;  2MSE D;  2JSV X;  2KNB A;  1RFA A;  1V5U A;  2WWZ A;  5J18 A;  4WJ7 A;  4RGO S;  4KHB B;  2LGD A;  4TKN A;  4KKI A;  1K51 A;  2D9V A;  2INC C;  3R7R A;  2IYB A;  4OZC A;  2BYT A;  5AZH A;  2ADZ A;  4TUU A;  4E71 A;  1IPG A;  4C7Z A;  2LXC A;  2LJ5 A;  4AS1 A;  2H7E A;  1TYG B;  2WXK A;  1UGM A;  1NI2 A;  4L1B A;  4OVU A;  1KLV A;  1CMX B;  1YJ1 A;  3KUZ A;  1JCK B;  1KI1 B;  5TSS A;  1UH6 A;  1OQN A;  4USA A;  2WGS A;  2JF5 A;  3HQC A;  3L16 A;  2KZR A;  2ZKM X;  4JX1 C;  1WXV A;  1I4Q A;  3PHX B;  3UF8 A;  3RUI B;  3DHI C;  1DYQ A;  1JWS D;  3P4R B;  2Z13 A;  1P1A A;  1T0R C;  4FJZ A;  4KHB A;  1Q5W B;  3QIJ A;  5JZE B;  4M00 A;  3SDL C;  4MAC A;  4RGT A;  4FHK A;  5AZG A;  1V89 A;  4ZRJ A;  2LGI A;  2KMM A;  5EDS A;  2Y3A A;  1FB8 A;  2WP9 B;  2K6D B;  3PZ8 A;  4P1B C;  3H8H A;  5FK9 C;  2Y7B A;  5DCN A;  2L00 B;  3PT2 B;  1FIQ A;  3GZN I;  5HHD G;  1YN3 A;  3AE6 B;  4AUQ C;  2K8H A;  4ANW A;  3MHZ A;  2WX0 A;  2REX A;  3SR6 A;  3RFZ B;  1BT0 A;  2R61 A;  4HRO A;  3BII D;  1P3R A;  2AQ1 B;  2NMB A;  3W5U B;  2JQR B;  1P7E A;  5DI9 B;  2LRU A;  3Q3N C;  3ZDT A;  1I42 A;  4RGM A;  4HDQ A;  2HTH A;  2COA A;  3NWF A;  5MPO A;  2MBH A;  1TQZ A;  4NAM A;  5C5B A;  3JSV A;  4M02 A;  3NZU A;  1D4B A;  5FI1 A;  3Q3J A;  5D2M B;  4IUM B;  5C3J B;  4GXB A;  3P2B A;  2KVZ A;  3K9O B;  4MK0 A;  1TIF A;  2PPH A;  2KK8 A;  4IAP A;  3AUL A;  3GYO A;  4G3X B;  1WJU A;  1YMH E;  1GUA B;  2BWF A;  4A6Q A;  1WGU A;  2WXO A;  1GOZ A;  3FM8 C;  5HE0 A;  2FIF A;  3WIM A;  5D3W A;  3Q2A C;  2Z14 A;  2WXG A;  4BKS D;  2ZCC A;  3RZW C;  1WR6 E;  2O2V B;  2ROZ B;  1TY0 A;  1XD3 B;  2K25 A;  3SFD B;  2IDY A;  3P4P B;  2Z0Q A;  4BKS A;  3GS2 A;  3VRA B;  2LGY A;  4LNO A;  2B76 B;  1BUI C;  1V9J A;  3ODW A;  4NAW A;  2RPV A;  3DXC A;  4W9I A;  1UNR A;  3CXB B;  1MIX A;  4WH4 A;  1SE2 A;  4TQ1 A;  4D0N B;  3ZO5 B;  2OJR A;  4HCP B;  4NPN A;  4LK0 M;  2ACZ B;  2LVO A;  2P0H A;  4BZA A;  2OTX A;  1Y56 A;  2K2U A;  2MH7 A;  1JWB D;  1P6S A;  3DCX A;  1FFU A;  1R7S A;  2O2V A;  2Y5B B;  4KIK B;  1LB1 A;  4LCD E;  1TS3 A;  1ZPS A;  3O13 A;  2N1V A;  4C80 A;  4ZOH C;  2YS5 A;  2N9K A;  1V1P A;  4WWP A;  4OVZ A;  3VTU A;  1RAX A;  1UPR A;  2I38 A;  5G5G A;  1XOD A;  2MQJ A;  2D9Z A;  1EAZ A;  3PEG A;  2V3N A;  1TTN A;  3KW5 B;  2KWU B;  4RM8 A;  4MGK E;  3KWL A;  1ZYI A;  3H6N A;  4N9F 4;  4B0M A;  3AE8 B;  4NAW B;  4QJ5 B;  2ZNV B;  1ZDV A;  1CJE A;  2DZI A;  3B2F A;  4IOI E;  2KFJ A;  1U27 A;  2Y5C A;  3UIO B;  1W1G A;  4F7G A;  1T77 A;  2IND C;  1LQB A;  5I2S A;  3OJ4 B;  3Q3M C;  3PLU A;  2KAN A;  3SV1 A;  5C23 A;  2PE9 A;  1ZP0 B;  3TSS A;  1FGY A;  4KIK A;  1DDV A;  3APF A;  5DPS A;  3VUW A;  1T0Y A;  2BKF A;  3FAH A;  3FEH A;  5EE1 A;  3BIN A;  4G0N B;  3IT4 B;  3R3M A;  3A8P A;  1NVI D;  1MPE A;  4MH0 E;  3U30 A;  5CHV C;  3DCG A;  4MSM B;  1TY2 A;  3L54 A;  1J7A A;  2N4F A;  3M63 B;  2L7R A;  2PVG C;  2NTT A;  1EU4 A;  2L3Z A;  2M0A A;  3RNF C;  4CHK A;  3OAW A;  2VRR B;  1QLB B;  1UWX A;  3ZDM C;  1X1F A;  5D3V A;  4KZC A;  4S17 A;  1JW9 D;  1K52 A;  4A55 A;  1ZKH A;  4IW0 A;  5BYQ A;  1FOE A;  1AAR A;  3MFG A;  1TKE A;  5J3Y A;  3KUC B;  1FHO A;  5CHF A;  2R0D A;  1WRD B;  1DOY A;  1EWY C;  2HTM E;  3AJ4 A;  2KJR A;  2VKI A;  1RWS A;  4WVF B;  1CK1 A;  3B0A A;  3HHM A;  1SEB D;  1ZUD 2;  2RVB B;  4MM3 B;  5FR3 A;  3OJ3 A;  2JY6 A;  4F7H A;  5T8I A;  4HSI A;  4OVV A;  1PLS A;  1HTQ A;  1FHW A;  2FCM A;  4WAF A;  1AWD A;  1F2R C;  1QOF A;  4JL9 A;  1P98 A;  3AEC B;  3APD A;  2EKI A;  4WWN A;  3SNH A;  1D5X C;  1YJI A;  3VR8 B;  1RRB A;  3VTV A;  5C1Z A;  4JQW C;  1BWN A;  4OT1 A;  4K17 A;  2XK5 A;  3MJW A;  1UEF A;  3PTF C;  2JZZ A;  1ET9 A;  5TR5 A;  1FNU A;  3BK2 A;  2OQB A;  3PZ7 A;  3F0W A;  3PRP B;  4O1N A;  1WFY A;  3UGB B;  2I5C A;  5E6O A;  1C4C A;  2Z59 B;  2GLS A;  3ZVV A;  2KHW B;  2K3U A;  2MA9 B;  3HM3 A;  2GCL A;  3P42 A;  4QJ4 B;  1DDM A;  4RM9 A;  1BTK A;  2FJL A;  2NTS A;  4Z2M B;  2N9P C;  2WYQ A;  4DXG A;  2GBR A;  4BBN C;  2Z4D A;  3V60 A;  2N7D A;  2VZK B;  1T6B X;  1Q1O A;  1ROE A;  2EKE C;  2LVQ A;  2KXJ A;  1MHX A;  2ZW0 A;  4DK5 A;  2DZJ A;  1F9J A;  2QDF A;  1I2H A;  1N63 A;  1MFW A;  2CU1 A;  3AU4 A;  1OFF A;  3HIZ A;  4WJQ A;  3N1X C;  1YX6 B;  1BTN A;  2AQ2 B;  5LNK 1;  2Z59 A;  4G50 A;  3V3X A;  1TT5 B;  1IP9 A;  2GUM A;  1RFK A;  5DHF B;  2PTL A;  4PNK A;  1YNT E;  2LWP A;  3CSF A;  2HJ8 A;  1WI1 A;  2WXR A;  4HAY B;  4WIP A;  4A90 A;  1TGZ B;  2DLB A;  2MW5 A;  1MG8 A;  2D3B A;  1MI0 A;  2E3T A;  2KTR A;  5IP4 D;  3DBH I;  2J53 A;  4HDO A;  2YS1 A;  1TS2 A;  2DNF A;  3B77 A;  3KWV A;  4D6W A;  1V86 A;  4BOS C;  3QWM A;  4YL8 A;  2M56 B;  3ENE A;  2KWD A;  1QF6 A;  3WAO A;  1SGH A;  2DKQ A;  3QBV B;  3UIP B;  4EZL A;  3SD5 A;  2FCQ A;  4KGS A;  2GBM A;  3KRW A;  1FNV A;  4PQ0 A;  2YEP B;  3WA0 A;  4IWQ A;  3VXW A;  4HAW B;  2W55 A;  3DHH C;  3PS6 A;  1FCL A;  5FI0 A;  1UBQ A;  1UUP A;  2BYE A;  4MEM A;  4EE2 A;  2WX1 A;  1WE6 A;  3VH4 B;  4D2K A;  3Q8C A;  2FAZ A;  2KQS A;  2LG1 A;  1PDX A;  5HI1 A;  2Z0D B;  3KLS X;  4BBN F;  2KTR B;  2KDM A;  3Q8E A;  4PT5 A;  1PGA A;  3T8M A;  3TBL D;  2DWQ A;  3PPA A;  2HD5 B;  4EKU A;  1OGW A;  1WWT A;  4FJV B;  1D5Z C;  2DYM A;  4K3B A;  2W82 A;  4A6K A;  3U8Z A;  3V05 A;  1KH0 A;  1I4H A;  5JP4 A;  3OAN A;  2JVC A;  1UEL A;  2ZW1 A;  2LJI A;  4CSQ A;  2WDR B;  3VAW A;  3CIR B;  1YX5 B;  2NBV B;  3B1L X;  2AEH A;  2P0D A;  1E10 A;  4W9L A;  5D3Y A;  4HCN B;  3MTN B;  2L52 A;  2FCN A;  1D5M C;  2LEK A;  1XX0 A;  4WJO A;  3JYU A;  4NJ6 A;  5BMG A;  3P4S B;  1VLB A;  2CU3 A;  1ZM0 A;  5LON B;  1M4V A;  1IBX A;  2KWV B;  2DX5 A;  3ETR A;  3QQ8 B;  2KAC A;  2LUL A;  2IZV B;  4LNN A;  4XGA B;  4C7Y A;  3Q14 C;  4GGQ A;  2CHX A;  1QOA A;  4A8X C;  2QIE B;  4GMV A;  1RRP B;  3NHE B;  2KT7 A;  3RZF A;  4LJP B;  2DAJ A;  1P7F A;  1FGZ A;  4HLE A;  4HB3 B;  2MJE A;  3T3N A;  2C60 A;  1HTO A;  2LMC A;  1LW3 A;  3EC8 A;  1XLN A;  5AEK B;  2DBY A;  2CS4 A;  2DTC A;  1WM3 A;  1WR1 A;  1WGH A;  2MCN B;  4A6H A;  3GE3 C;  1LO5 D;  1GG3 A;  3P7Z A;  1I4X A;  2LOX A;  2IBI B;  3BVG A;  1FMA D;  4RH6 A;  1WY8 A;  2XN9 C;  2GB1 A;  2R2O A;  1AQC A;  5KQ1 A;  3QX1 A;  4NZL B;  2YVC A;  2G1E A;  4CHJ A;  1CQV A;  2V3P A;  1B55 A;  1SSN A;  1Q10 A;  4YT0 B;  3O96 A;  4LNF A;  1V1O A;  2ELB A;  3RCP A;  3TEX A;  4WUR A;  1U5F A;  1WXM A;  1IYF A;  2C5L C;  3QC8 B;  3NZ3 A;  3NW8 A;  3M62 B;  1WJN A;  3TL5 A;  3DBL B;  1R4M B;  3ZNZ B;  2KIE A;  2M8S A;  1WX7 A;  2RGN B;  4A9A A;  3MPX A;  3L13 A;  2YF0 A;  1P5T A;  3ZTD A;  4US8 A;  2M38 A;  2JZP A;  3WCQ A;  1NDD A;  4HPL B;  4M0W A;  1DYN A;  3NY5 A;  3IVF A;  5FR6 A;  4N58 A;  1XR0 B;  2X38 A;  3B2G A;  1IGD A;  1SJH D;  5IAA C;  1WG7 A;  2GBN A;  3BK1 A;  1ACC A;  4L1R A;  4ICU A;  3R7Q A;  2KD0 A;  4PS7 A;  4YTP B;  2N0Y A;  2W3R A;  2MBB B;  3AE4 B;  1V5T A;  3AE1 B;  1C4P A;  2NPT A;  3C8Y A;  3PSC A;  4WQO B;  1U4A A;  2E2X A;  4W9E A;  4KZ0 A;  3UZT A;  3ULB A;  2J4X A;  1XD4 A;  3QAR A;  4H2A A;  3Q69 A;  1Q67 A;  2VZK D;  2QEJ C;  3M1I B;  5HKH A;  4AQ7 A;  3ML8 A;  4HAU B;  1DGJ A;  3QA8 A;  1R4M I;  2BPS A;  2COF A;  3PRE A;  4GPT B;  1FD6 A;  2MBO A;  5IN7 A;  4IM3 A;  3L4P A;  5AUI A;  2N7J A;  1XF5 L;  2V1Y A;  1QC6 A;  4OZB A;  2DHJ A;  3EFC A;  1H4R A;  2K49 A;  3PVL A;  2SAK A;  2TSS A;  3TUO A;  1VZ8 A;  2W3S A;  3TEY A;  3HSA A;  1AYF A;  3EFU A;  3AEE B;  3DWG C;  3H9D A;  1NYR A;  2GBJ A;  3HUI A;  5M4Y B;  3ZJU A;  5HE3 A;  1L6V A;  1LXD A;  4EMO A;  5EE0 A;  2MJD A;  3RNB C;  1SXT A;  1RLF A;  4B9K A;  1ESF A;  4DHZ B;  1L2N A;  1IUE A;  3PP2 A;  2D9X A;  2XQN M;  1SBB B;  2YEP F;  2DYO A;  2R2Q A;  3P63 A;  3ZNI D;  3NZS A;  1DDW A;  1WF9 A;  2JYT A;  2V76 A;  1NEK B;  4W9K A;  4HPM B;  3KSY A;  2D3C A;  2L0T A;  1FRR A;  4DXA B;  4PYZ A;  3DDC B;  2ROV A;  1WJ6 A;  4DHJ D;  4EOY A;  4ZHP A;  4W9C A;  3TW1 A;  1EF5 A;  3H7P B;  1N3H A;  2MX2 A;  3TCA A;  2JUO A;  3NVZ A;  4KV2 A;  3IAM 1;  4KVG B;  5CTR C;  2Z0E B;  1FPY A;  1E5W A;  1FM0 D;  1T5X D;  2PIA A;  4LJO B;  4AOF A;  3P6A A;  1FO4 A;  2YLM A;  5KHQ A;  4I6L B;  1YD8 U;  1SIJ A;  2LRW A;  2RSG A;  3BVZ A;  3JW0 X;  2CHZ A;  2FNJ B;  3ODO A;  1TS4 A;  4K7U A;  1WVH A;  4CYE A;  3NOB A;  4IWO A;  4S0R A;  1YN5 A;  4JE3 B;  1KM7 A;  1U5D A;  2KCJ A;  3I57 A;  5J3Q A;  1G6J A;  3H7P A;  2LGX A;  3IG3 A;  1N61 A;  1PGX A;  4MGI E;  1L7Y A;  1STE A;  4F7U P;  4AWJ A;  1V5O A;  4FA6 A;  2YT2 A;  5D7G A;  1H10 A;  4RGN A;  2L8J A;  4ACF A;  4KSK C;  1Z2M A;  1C1Y B;  1X11 A;  3EHV A;  1SE9 A;  2QKL A;  4PK1 A;  2RGF A;  2RMM A;  5LLI A;  4GN1 A;  3VRB B;  5J17 A;  2RDH A;  1XKE A;  3RUL A;  2FCS A;  4IG7 B;  3ML4 A;  2IO3 B;  1QQG A;  3A1Q A;  3NJT A;  3ULC A;  2K1F A;  1EWC A;  3NVY A;  1J0W A;  3QWZ B;  2FID A;  3VR9 B;  3K9P B;  3I3T B;  2WXH A;  4ZHO A;  1WXS A;  1C76 A;  2NVU I;  3U2S C;  1V49 A;  3AED B;  3WAL A;  4IDI A;  2KYW A;  2WQY B;  2A4Z A;  3GE8 C;  1E7V A;  2KQ4 X;  4DHZ E;  3A9J A;  3KZ1 A;  5IO9 A;  3KRX A;  1JML A;  3AEB B;  2KJ6 A;  2DYN A;  4PYU A;  3MC9 A;  1UBI A;  3AE5 B;  2JRH A;  3ZKJ C;  1L6U A;  4IC7 B;  2KX3 A;  2Z0O A;  1R4N I;  3ZNG C;  3FVC A;  2DZM A;  4HRS A;  1TXD A;  1V2Y A;  3VDZ A;  1ENF A;  4L23 A;  2FJU B;  1SJE D;  5C79 A;  2KUQ A;  2R09 A;  1RM6 C;  4HAX B;  1YJJ A;  5LG4 B;  5D3I B;  4KGR A;  2V4I B;  1KZ7 A;  2V4L A;  1XCT L;  3AEF B;  3DOW A;  3A9J B;  1OQR A;  2LUM A;  5HE2 A;  1N5X A;  3W1S A;  1WMH B;  3LB8 C;  1E6E B;  3A58 A;  1TZO A;  1FAO A;  4LNK A;  2G35 A;  3ZJV A;  2KKC A;  1KOT A;  2NBU A;  3ZRF A;  2GJY A;  3Q8F A;  3E56 A;  3ZJT A;  1K5G B;  1TJ6 A;  5I2M A;  2AQ3 B;  2WDQ B;  4REZ A;  1ZW7 A;  1MPH A;  4MT7 A;  1WX8 A;  1IRS A;  2N9E B;  1XLO A;  1ZC4 B;  2RSU A;  3TVV A;  3EEC A;  4JGH B;  2W2X C;  5CLL B;  3W1Y A;  2CR5 A;  4RF1 A;  4L6E A;  4YSZ B;  4NSW A;  1R4N B;  1SIF A;  2K00 A;  1FCC C;  1NTV A;  1K8R B;  2LGS A;  2WDV B;  3T9L A;  5C2T B;  2G9H D;  3N7C A;  3QCA A;  4ZYN A;  1WMH A;  1FXI A;  1P3Q U;  3MDB C;  1GB4 A;  4TMA B;  3W9C B;  1IGC A;  1WM2 A;  2QC8 A;  1TBE A;  2MP2 B;  4DBB A;  3PGE A;  1NTY A;  2AYO B;  1GJZ A;  2KC1 A;  3FKY A;  2LYD A;  1BAK A;  4BKG A;  3SHQ A;  3H1U A;  2KDF B;  2BVC A;  1WYW B;  2V0G A;  4ANU A;  2BW2 A;  2PEA A;  1KFY B;  3BY4 B;  4GU2 A;  2MWN B;  2MDX A;  2JU6 X;  2FBW B;  2CAY A;  1OY2 A;  1OEY A;  4F8C B;  3HW2 B;  3UIN B;  1LGR A;  4XWW A;  4HVB A;  2OJW A;  4ARI A;  1XCG A;  1EUV B;  3V61 A;  3IFW B;  3HVZ A;  3N9Y C;  4DWF A;  2FUH B;  4ZRK A;  2MP2 A;  1JWM D;  4ZDV A;  4KHO A;  4MGZ E;  2IGD A;  3MC8 A;  1E7U A;  1N62 A;  2MBQ A;  1C9F A;  3ZIM A;  2CRF A;  2IY1 B;  1H8C A;  3W5V B;  1JQ4 A;  5IRS A;  4DX9 0;  2KUP A;  2WXF A;  5E6J A;  4IFS A;  2L1A A;  3GP7 A;  1V61 A;  2LKO A;  3DVN V;  4EZK A;  3D8D A;  2KX0 A;  4M8M A;  1VCB A;  1AWE A;  2ZPY A;  2G4D B;  3N30 A;  4DHJ B;  1YIW A;  4DDI D;  1JRO A;  3VUX A;  4BAX A;  4N59 A;  1Q0W B;  5CLQ B;  3DVG Y;  1V80 A;  4XC2 A;  4YSY B;  3GB1 A;  1V81 A;  2PMV A;  4BBK A;  5JHG A;  3A4S C;  2IY0 B;  4PS8 A;  5D27 A;  2JT4 B;  2YSZ A;  3DQV A;  4H8S A;  2D5G A;  1J0G A;  4XDC A;  4E74 A;  1NI3 A;  4FAD A;  4Y94 A;  1Y5O A;  2SEB D;  2BYV E;  1C3T A;  4HXD A;  1J19 A;  2HTH B;  2JYE A;  4TQ0 A;  2L05 A;  3X0W A;  2W2W A;  4NJC A;  4URK A;  1N5W A;  1MIZ B;  4J3O D;  5J2R A;  4ASW C;  1PFJ A;  4B0E A;  1XLP A;  5EE3 A;  2AWT A;  3ONS A;  2K2J A;  2KTF A;  1D3Z A;  3DVG X;  2WXM A;  1K53 A;  4LTU A;  3B08 A;  2N23 A;  2W54 A;  3N20 C;  2CY4 A;  2BTE A;  3AB5 A;  2KN5 A;  2BT6 A;  2QMT A;  3B9J A;  2B3A A;  4XWX A;  4HAT B;  1X05 A;  1P9D U;  1HZ5 A;  5CX3 A;  2W9N A;  2WXP A;  1WIA A;  3DBR B;  3AU5 A;  3GYP A;  2JWZ A;  2XNA C;  3DBH B;  5EFX A;  4DBG A;  2D9W A;  4C4V B;  3IT6 B;  2GBK A;  3U4E G;  2QIL A;  3CIK A;  5C16 A;  3ECI A;  1V8C A;  2JXT A;  5CHW A;  1QZE A;  3PRZ A;  1P0R A;  2BBC A;  4AP4 C;  3Q3O C;  3KYD D;  3PSE B;  2MFQ A;  4F1S A;  2IO2 B;  1MJD A;  3RCZ A;  3UQB A;  4GLS C;  1LFD A;  2O6V D;  2IYD B;  2DAF A;  2MRP A;  3ZXV A;  2ZVN A;  1CZP A;  3HVD A;  2G3Q B;  2RDB C;  4GSW A;  5IA7 A;  2MWS B;  2DHK A;  2WU5 B;  4MH8 A;  2BCJ A;  1HE8 A;  4C56 C;  4WSF A;  4C4V A;  2LXA A;  1ET6 A;  4K3C A;  5C5B B;  1YQ4 B;  3SEB A;  3JSV B;  1V1P B;  2CKH B;  2C9W B;  4LDT B;  1EU3 A;  1KF6 B;  2ON8 A;  2DN6 A;  1AW7 A;  5JH5 C;  2J7Q B;  3RT3 B;  4YSX B;  2ZNV C;  5E6P A;  1FHX A;  3DXE A;  4EZJ A;  1F2R I;  2L1C A;  1NEN B;  2D11 A;  2D2Q A;  4HKQ A;  5DPR A;  4IWP A;  4XDD A;  3AE9 B;  2N0S B;  3KUD B;  3AM9 A;  5JXV A;  3CMM B;  5LXI B;  4YXD B;  4ZRP A;  3O65 B;  4ICV A;  4P16 A;  5HG2 A;  4II3 B;  5GOW B;  4GOC A;  2I2Y A;  1U5G A;  4QXA B;  3NG0 A;  1C4A A;  3VH3 B;  2WS3 B;  3NS1 A;  1EGX A;  4K81 A;  3AEA B;  3N3K B;  1SE3 A;  2KLC A;  4RFB A;  1UGJ A;  2L83 A;  3OLM D;  1X1M A;  2G4S A;  4L2Y A;  2ZZP B;  3QK0 A;  3PLV A;  1Z87 A;  1ZC3 B;  3D8F A;  3AH7 A;  4HB0 B;  4HHV A;  1BXT A;  2M0X A;  3G9W A;  1MAI A;  4EEW A;  3RI7 C;  2EEL A;  4W9D A;  5FKA C;  3T06 A;  2J0J A;  2LUE A;  1WH3 A;  2KJH B;  2X18 A;  5BMI A;  3ZGZ A;  5L83 A;  1JWA D;  1VJK A;  1Z5S B;  2QSD A;  1YN4 A;  1MI1 A;  3A98 B;  1DBH A;  5JHB A;  3W2D A;  4CQN A;  1HEZ E;  2AL6 A;  2VRW B;  4TV3 A;  3PG7 A;  1N60 A;  2CJN A;  4DXF A;  3TEZ A;  1QQR A;  2WXL A;  1PQS A;  3HRD D;  3R2T A;  3NS8 A;  3DXD A;  2WHI A;  1WGY A;  1MG4 A;  1J7C A;  1EF1 A;  3SYX A;  2XEW A;  1WX9 A;  5DPT A;  1KLU D;  3VQI A;  2KDI A;  4LLG M;  2YT0 A;  3M3J A;  1ZGU B;  4BFR A;  4KAX B;  2NZ8 B;  1FXA A;  3CWI A;  3LJ3 A;  3HIE A;  1HA5 A;  1VZ7 A;  2M1M A;  2UVM A;  4JWS C;  1WE7 A;  2HJ1 A;  3RYT A;  2XK5 B;  4FXC A;  4OHJ A;  1GAQ B;  3DBL I;  3X23 A;  3HK0 A;  2V9H A;  1E7P B;  4A6F A;  5JHH A;  3A9K B;  2D4Q A;  1L0Y B;  1QKZ A;  3L08 A;  3RNA C;  2R2Y A;  4GMX B;  4CHM A;  2WXN A;  3ZNH B;  4B6W A;  4KHA A;  4BKT A;  1XLQ A;  2BQQ A;  3APC A;  2YT1 A;  1PMS A;  1U5E A;  4C0A A;  3A4R A;  2KDE B;  2CHW A;  5AZF A;  4MY6 A;  1OQY A;  2COC A;  1I4R A;  3VFK A;  3SO6 A;  2DA0 A;  4WWO A;  4J6I A;  3AMZ A;  2KWC A;  3RNG C;  3PZD A;  1WGG A;  2NBW B;  1TS5 A;  3C19 A;  4OZA A;  1V5M A;  1WZ0 A;  2AX5 A;  2KO3 A;  2KIG A;  3FSS A;  4A6F B;  1V97 A;  3A9K A;  1D6E C;  3I63 C;  2QCZ A;  2GCJ A;  3QJZ A;  3ZLZ A;  2IO1 B;  3R2I A;  5KCV A;  4GOU A;  2KDB A;  2NCN A;  4MM3 A;  3TFM A;  4MSQ B;  4WWM A;  3VTW A;  3KY9 A;  1I35 A;  3AXC A;  1OEY J;  2WNM A;  3ZTC A;  4MDK E;  5E6N A;  2WXJ A;  3MJ5 A;  5LXH A;  2YS3 A;  1Y19 B;  1VR9 A;  1UWM A;  3UQA A;  1KRH A;  5D94 A;  5KHO A;  3RMK C;  3MC0 B;  4ARC A;  3GZN B;  1UNS A;  2D3G A;  4GDL B;  1ZSQ A;  3N32 A;  2ONQ A;  3L0W B;  3U52 E;  1DOX A;  2HDE A;  4RNA A;  3AE3 B;  4QAY A;  1F52 A;  1L0V B;  4R3D A;  3P4Q B;  2DHZ A;  1WZ3 A;  2RRF A;  3A33 B;  5LOP B;  1JRP A;  4M01 A;  2IJ0 A;  4YON A;  4GB9 A;  2GRI A;  3ABV B;  4G11 A;  3DPD A;  1UZX B;  5D3X A;  2DLW A;  3OG5 A;  5HE1 A;  2PJH A; 
#chains in the Genus database with same CATH homology
 4HAZ B;  2AL3 A;  4HJK A;  3TJP A;  4ANV A;  4NSW A;  1SIF A;  2O6V B;  2K00 A;  3ZW3 A;  3TO1 A;  2NS5 A;  1V86 A;  4BOS C;  1NTV A;  1ZVR A;  1K8R B;  3QWM A;  4GDL A;  3T9L A;  4A3P A;  1X86 A;  4YL8 A;  3JVZ X;  4DDG D;  3ENE A;  3IHP C;  1WJ4 A;  4K1R B;  2KVR A;  4EFO A;  2W2X D;  3N7C A;  4IM0 A;  1SGH A;  2KOX A;  3HM6 X;  3QCA A;  4ZYN A;  2D10 A;  1DRO A;  2DKQ A;  1U2B A;  3MDB C;  3QBV B;  3SUZ A;  1P3Q U;  1S1Q B;  1WMH A;  2DYB A;  2FCQ A;  2K8B A;  4I6P A;  2RPQ A;  3SD5 A;  4EZL A;  3M95 A;  1WM2 A;  3KRW A;  2GBM A;  3BJI A;  4PQ0 A;  1TBE A;  2BYF A;  2C7M B;  4DBB A;  2MP2 B;  3WA0 A;  4HWI B;  2KMA A;  1NTY A;  2AYO B;  1E8X A;  3PGE A;  4IWQ A;  2VSZ A;  2JZ3 B;  2KC1 A;  4HAW B;  3VXW A;  1GJZ A;  3PS6 A;  2LYD A;  5DHA B;  5FI0 A;  1BAK A;  1UBQ A;  4FUL A;  4NJ7 A;  4BKG A;  4P7I A;  1E8W A;  2K6Q A;  3Q3F A;  5DPW A;  1KZG A;  3H1U A;  3SHQ A;  4MEM A;  2BYE A;  4EUT A;  3DVN U;  2WX1 A;  2KDF B;  1WE6 A;  3VH4 B;  2FAZ A;  3TMP B;  4NQL B;  2KQS A;  4ANX A;  2EMS A;  2LG1 A;  1Y8R C;  3KYC D;  1WYW B;  4GIV A;  2Z0D B;  3DBS A;  4FLH A;  4MEL A;  4BBN F;  3WYF B;  2KTR B;  2COD A;  4ANU A;  2EMT A;  1J8C A;  4FHJ A;  1WGQ A;  4WJN A;  4B95 A;  2PEA A;  3BY4 B;  1LM8 B;  2MWN B;  2MDX A;  4GU2 A;  3PPA A;  3L10 B;  4W9H A;  1GC6 A;  2HD5 B;  3TBL D;  2RLO A;  2CAY A;  1OY2 A;  4EKU A;  1OEY A;  3HW2 B;  2C7H A;  2G45 B;  2K39 A;  3V5W A;  2P0F A;  5G2N A;  3UIN B;  3LJU X;  2ZEQ A;  1OGW A;  4HVB A;  2HE7 A;  4FJV B;  4JIO U;  2MSE D;  2DYM A;  5G55 A;  2KNB A;  1XCG A;  4A6K A;  1EUV B;  1RFA A;  1V5U A;  2DX5 B;  3IFW B;  3V61 A;  3U8Z A;  2N1W A;  2FUH B;  2WWZ A;  4ZRK A;  4DWF A;  5J18 A;  4WJ7 A;  4A5K A;  5JP4 A;  3OAN A;  1UD7 A;  2JVC A;  1UEL A;  4B6H A;  2MP2 A;  4KHB B;  2LGD A;  4TKN A;  4ZDV A;  2D9V A;  1OTR B;  3ZRC A;  4KHO A;  3R7R A;  3VAW A;  2IYB A;  1YX5 B;  2NBV B;  4MGZ E;  1MK9 B;  1W1D A;  3B1L X;  1V5P A;  2AEH A;  5AZH A;  2ADZ A;  4TUU A;  4E71 A;  1E7U A;  1IPG A;  1XQQ A;  2MBQ A;  2P0D A;  2LXC A;  3CF6 E;  3ZIM A;  2CRF A;  2IY1 B;  1H8C A;  2LJ5 A;  2H7E A;  4DX9 0;  2IO0 B;  1UGM A;  2KUP A;  4W9L A;  1NI2 A;  5D3Y A;  4M8N A;  2LZ6 A;  4HCN B;  3MTN B;  4OVU A;  4BOZ B;  2I1J A;  2KC2 A;  4IFS A;  2FCN A;  1WJ1 A;  1CMX B;  1KLV A;  1XX0 A;  1YJ1 A;  3KUZ A;  1V61 A;  1X1G A;  2LKO A;  3DVN V;  4WJO A;  1E8Z A;  3JYU A;  4EZK A;  3D8D A;  2KX0 A;  3H7S A;  4M8M A;  1VCB A;  1AWE A;  1KI1 B;  2NR2 A;  1M7R A;  1UH6 A;  1OQN A;  2ZPY A;  4NJ6 A;  2G4D B;  2JF5 A;  1ZM0 A;  5LON B;  3N30 A;  1YIW A;  3HQC A;  3ML9 A;  4DDI D;  4DHJ B;  3L16 A;  5J3T A;  2KZR A;  2LVP A;  3VUX A;  2KWV B;  2QKM A;  1Q0W B;  5CLQ B;  2DX5 A;  1WXV A;  3DVG Y;  1V80 A;  3PHX B;  3QQ8 B;  2JPH A;  3RUI B;  3UF8 A;  1S3S G;  4XC2 A;  2LUL A;  1V81 A;  2IZV B;  4FJZ A;  1P1A A;  4FJY A;  4GGQ A;  2GOW A;  2CHX A;  4BBK A;  5JHG A;  3A4S C;  4I6N B;  4MGY E;  2KLG A;  4GMV A;  1RRP B;  3QIJ A;  1Q5W B;  2IY0 B;  3NHE B;  4PS8 A;  3RZF A;  3SDL C;  5JZE B;  2L0F A;  3ZDM C;  5D27 A;  2JT4 B;  2YSZ A;  4LJP B;  3DQV A;  4FHK A;  4H8S A;  2DAJ A;  4XX5 A;  3D32 A;  1J0G A;  2RR9 A;  2M4N A;  5AZG A;  1FGZ A;  4NY0 A;  1V89 A;  4ZRJ A;  4E74 A;  4HLE A;  4FAD A;  4HB3 B;  1Y5O A;  4Y94 A;  2BYV E;  5EDS A;  3VIA A;  1C3T A;  5GMV A;  4HXD A;  2C60 A;  1FB8 A;  1J19 A;  2HTH B;  4TQ0 A;  4BVU C;  2K6D B;  2L05 A;  1LW3 A;  3EC8 A;  3X0W A;  2W2W A;  4E3C A;  5AEK B;  2Y7B A;  4URK A;  1MIZ B;  5DCN A;  2CS4 A;  2L00 B;  5J2R A;  1MKE A;  2DTC A;  3PT2 B;  3GZN I;  4AUQ C;  4ASW C;  1PFJ A;  2K8H A;  1WM3 A;  4JLC A;  5KQ4 A;  4ANW A;  1WR1 A;  1WGH A;  2MCN B;  4A6H A;  2AWT A;  2K2J A;  3ZVR A;  2KTF A;  2REX A;  2WX0 A;  3ONS A;  3PRM B;  4W9F A;  3DVG X;  4EOY A;  4F7Z A;  1D3Z A;  1OMW A;  1GG3 A;  3ZUN A;  3U7D A;  3P7Z A;  2LOX A;  1BT0 A;  2IBI B;  3B08 A;  2N23 A;  2CY4 A;  1WY8 A;  2KN5 A;  1P3R A;  2Y8F A;  2R2O A;  1AQC A;  5KQ1 A;  2B3A A;  1UNQ A;  2BF8 B;  4XWX A;  1E90 A;  2NMB A;  4HAT B;  1X05 A;  3QX1 A;  2YVC A;  1P9D U;  4CHJ A;  1WJM A;  5CX3 A;  2W9N A;  1B55 A;  4LDT D;  1WIA A;  2LRU A;  3O96 A;  5DI9 B;  2UWQ A;  3AU5 A;  3OAW A;  2ELB A;  3RCP A;  3GYP A;  3ZDT A;  1I42 A;  1U5F A;  2JWZ A;  1WXM A;  1IYF A;  2C5L C;  5EFX A;  4HDQ A;  3QC8 B;  3QAQ A;  2HTH A;  2COA A;  4DBG A;  2D9W A;  2MBH A;  2ZJD A;  3M62 B;  1WJN A;  2DZK A;  3TL5 A;  1TQZ A;  2GBK A;  5LXI B;  2OOB B;  1W1H A;  5C5B A;  3CIK A;  2M8S A;  5C16 A;  1WX7 A;  2RGN B;  3JSV A;  3ZNZ B;  3NZU A;  5FI1 A;  3ECI A;  3Q3J A;  3W1S C;  3MPX A;  4NQK E;  5CHW A;  1QZE A;  3UGB B;  3PRZ A;  3L13 A;  2YF0 A;  5D2M B;  1P0R A;  1EVH A;  4IUM B;  4GXB A;  3P2B A;  1P5T A;  2UZR A;  4MK0 A;  3K9O B;  2PPH A;  2M38 A;  2KK8 A;  5E6O A;  3ZTD A;  4AP4 C;  4CO7 A;  4IAP A;  3AUL A;  2BGF A;  3GYO A;  1NDD A;  3KYD D;  2RNR B;  2PE6 B;  3PSE B;  4HPL B;  2MFQ A;  4F1S A;  3D8E A;  2IO2 B;  4G3X B;  3RCZ A;  2JRI B;  1WJU A;  1DYN A;  3NY5 A;  3IVF A;  3UQB A;  2V3S A;  5FR6 A;  1GUA B;  1LFD A;  2O6V D;  1XR0 B;  2IYD B;  2BWF A;  1WGU A;  5DH9 B;  2DAF A;  2MRP A;  2GMI C;  3FM8 C;  5HE0 A;  2ZVN A;  2FIF A;  2G3Q B;  5D3W A;  3PHW B;  1WG7 A;  2GBN A;  4GSW A;  3WIM A;  5IA7 A;  2DEN B;  4ICU A;  3R7Q A;  2MWS B;  4BKS D;  2KD0 A;  2MKR A;  2DHK A;  5JHA A;  4PS7 A;  2GS0 A;  2ZCC A;  2N0Y A;  1WR6 E;  2BCJ A;  3RZW C;  2DHI A;  1HE8 A;  2MBB B;  2ROZ B;  1V5T A;  1U29 A;  2O2V B;  4WSF A;  1XD3 B;  2NPT A;  2K25 A;  2KQ7 A;  2LXA A;  2JXX A;  3PSC A;  5C5B B;  1WGR A;  1WXA A;  4KDL B;  3JSV B;  5D6J B;  2I5F A;  2K8C A;  4WQO B;  1U4A A;  2E2X A;  2Z0Q A;  4W9E A;  2CKH B;  2C9W B;  4LDT B;  4BKS A;  2LD9 A;  1EO6 A;  4KZ0 A;  2DN6 A;  3UZT A;  3ULB A;  2LGY A;  1XD4 A;  3QAR A;  5JH5 C;  2J7Q B;  3RT3 B;  1Q67 A;  2ZNV C;  1V9J A;  2D07 B;  3ODW A;  5E6P A;  1FHX A;  3M1I B;  4HK2 A;  4NAW A;  3DXE A;  5HKH A;  1V88 A;  4AJY B;  4EZJ A;  3ML8 A;  2L1C A;  4HAU B;  4M0W B;  3DXC A;  3QA8 A;  1R4M I;  2D11 A;  4W9I A;  1UNR A;  2D2Q A;  2COF A;  1MIX A;  3CXB B;  4GPT B;  2BPS A;  2MBO A;  3PRE A;  4IOY X;  2JP2 A;  5DPR A;  4IWP A;  4IM3 A;  4TQ1 A;  4D0N B;  3KUD B;  3ZO5 B;  3NSU A;  2OJR A;  2V1Y A;  1QC6 A;  4HCP B;  2LOZ A;  2DHJ A;  3CMM B;  1H4R A;  1YQB A;  1ISN A;  1XT9 B;  2LVO A;  4K7S A;  4NPN A;  5AZF A;  2P0H A;  3PVL A;  2OTX A;  3O65 B;  2EC1 A;  4ICV A;  2K2U A;  2LI5 A;  2ZCB A;  2N7E A;  4II3 B;  2J0K A;  2Z0P A;  5GOW B;  3LJ3 A;  1JRU A;  2ASQ A;  1P6S A;  3EFU A;  4GOC A;  1U5G A;  3H9D A;  2O2V A;  2UYZ B;  2GBJ A;  2Y5B B;  4KIK B;  1LB1 A;  4ZRI A;  2KFK B;  2NPT B;  4LCD E;  3IBE A;  2RUK B;  1WGD A;  2N1V A;  5HE3 A;  3VH3 B;  2YS5 A;  1EGX A;  4K81 A;  4WWP A;  3VTU A;  1RAX A;  1UPR A;  3N3K B;  1LXD A;  1XOD A;  4EMO A;  2KLC A;  2MQJ A;  2D9Z A;  1EAZ A;  3PEG A;  1RLF A;  1TTN A;  1VD2 A;  3KW5 B;  3RD2 A;  3OLM D;  1X1M A;  2G4S A;  4B9K A;  4DHZ B;  1L2N A;  2ZZP B;  3PP2 A;  2KWU B;  4GDK A;  3QK0 A;  4IM2 A;  3PLV A;  1Z87 A;  5C6R A;  4MGK E;  1ZC3 B;  3H6N A;  2D9X A;  4N9F 4;  2XQN M;  3D8F A;  3PV1 A;  4NAW B;  4HB0 B;  2DYO A;  4HHV A;  2R2Q A;  2M0X A;  2BKR B;  3G9W A;  1MAI A;  3NZS A;  3ZNI D;  4EEW A;  2ZNV B;  1DDW A;  1WF9 A;  2V76 A;  4W9K A;  4W9D A;  4HPM B;  3KSY A;  5IAA C;  3T06 A;  2DZI A;  2J0J A;  2KMC A;  2L0T A;  2LUE A;  2KFJ A;  4DXA B;  1U27 A;  1WH3 A;  4PYZ A;  2KJH B;  2X18 A;  4NNJ B;  3DDC B;  1W1G A;  2EJ8 A;  2ROV A;  2YRY A;  4F7G A;  1WJ6 A;  4W9C A;  1GC7 A;  3UIO B;  4DHJ D;  3TW1 A;  1EF5 A;  1LQB A;  2M17 A;  3H7P B;  1E8Y A;  1N3H A;  3OJ4 B;  5L83 A;  1TZ1 A;  2D9Y A;  2MX2 A;  3PLU A;  1M7E A;  3TCA A;  2JUO A;  2KAN A;  4W9G A;  3SU8 X;  4KV2 A;  4KVG B;  3SV1 A;  1Z5S B;  2Z0E B;  5CTR C;  2MBE A;  5C23 A;  2PE9 A;  3VUY A;  1E5W A;  1FGY A;  4FN2 A;  4KIK A;  2KFK A;  3A98 B;  1DBH A;  1DDV A;  3APF A;  4LJO B;  3P6A A;  5DPS A;  4AOF A;  2AL6 A;  5JHB A;  2YLM A;  2VRW B;  4I6L B;  5KHQ A;  4TYZ A;  3VUW A;  1T0Y A;  4TV3 A;  3PG7 A;  1YD8 U;  3KH0 A;  2BKF A;  1G6J A;  2LRW A;  5BO4 B;  3FEH A;  3BIN A;  4HAV B;  3R3M A;  2RSG A;  3A8P A;  4G0N B;  3JW0 X;  3LDZ E;  3C0R B;  3V62 A;  2CHZ A;  1PQS A;  2FNJ B;  4GDK B;  4MH0 E;  3U30 A;  5CHV C;  3DCG A;  3NS8 A;  3DXD A;  4MSM B;  3L54 A;  3M63 B;  2N4F A;  1WGY A;  2DX1 A;  2L7R A;  2Q13 A;  1EF1 A;  3SYX A;  2XEW A;  1A5R A;  3ODO A;  4K7U A;  1WVH A;  4CYE A;  3NOB A;  1WX9 A;  4IWO A;  3AI5 A;  5DPT A;  3WAN A;  2L3Z A;  1UNP A;  4II2 B;  4L6E A;  4W9J A;  3VQI A;  2KDI A;  2YT0 A;  3M3J A;  1KM7 A;  1ZGU B;  4BFR A;  4CHK A;  1U5D A;  4HB4 B;  4KAX B;  2KCJ A;  2NZ8 B;  2ELA A;  1NBF C;  2VRR B;  1X1F A;  3CST A;  2I1K A;  5D3V A;  5J3Q A;  3DBR I;  3H7P A;  2LGX A;  3V6E B;  2M1M A;  2UVM A;  4KZC A;  1WE7 A;  2J0M A;  3IG3 A;  1WI0 A;  3RYT A;  2XK5 B;  4MGI E;  2PZ1 A;  1ZKH A;  1L7Y A;  4IW0 A;  1FOE A;  1AAR A;  4F7U P;  4AWJ A;  1V5O A;  4FA6 A;  2M14 A;  3DBL I;  5D7G A;  1H10 A;  5J3Y A;  3HK0 A;  2KGX B;  3X23 A;  1FHO A;  3KUC B;  2L8J A;  5CHF A;  2QHO A;  4KSL C;  4KSK C;  2R0D A;  4A6F A;  5JHH A;  2L2I A;  1Z2M A;  1WRD B;  3A9K B;  2D4Q A;  1C1Y B;  1X11 A;  5DIF B;  3EHV A;  4XZ4 A;  1SE9 A;  3L08 A;  3AJ4 A;  2KJR A;  2QKL A;  2VKI A;  4GMX B;  4CHM A;  4WVF B;  2CY5 A;  3ZNH B;  3B0A A;  2RGF A;  3HHM A;  4KHA A;  3F5R A;  5LLI A;  4KDI C;  4GN1 A;  4B6W A;  4BKT A;  2RVB B;  5J17 A;  1XKE A;  2JY6 A;  4F7H A;  3OJ3 A;  3RUL A;  3APC A;  4OVV A;  2FCS A;  4IG7 B;  1PLS A;  1PMS A;  2YT1 A;  3ML4 A;  2IO3 B;  1FHW A;  1QQG A;  1U5E A;  3A1Q A;  4A3O A;  4C0A A;  4EJN A;  2H7D A;  3ULC A;  2CHW A;  2FCM A;  2K1F A;  2KDE B;  3A4R A;  4MY6 A;  1OQY A;  2COC A;  4JL9 A;  3MHS D;  1P98 A;  3APD A;  1J0W A;  2DFK A;  3QWZ B;  1V6E A;  2FID A;  3SO6 A;  1RJ2 A;  4WWN A;  3V6C B;  3VFK A;  3WAO A;  3SNH A;  3K9P B;  4HB2 B;  3I3T B;  2DA0 A;  4X57 B;  1RRB A;  4J6I A;  4WWO A;  3VTV A;  4JQW C;  1WXS A;  1BWN A;  5C1Z A;  2NVU I;  4K17 A;  1V49 A;  2XK5 A;  2ZVO A;  2KWC A;  3WAL A;  4WJP A;  2ZPN A;  3PZD A;  1WGG A;  3MJW A;  1UEF A;  2A4Z A;  2IFS A;  4K2O A;  2NBW B;  4RMA A;  1E7V A;  4DHZ E;  3PTF C;  2JZZ A;  4RM8 A;  5TR5 A;  3A9J A;  3VVW B;  3KZ1 A;  1V5M A;  1WZ0 A;  2OQB A;  2KO3 A;  3FSS A;  4A6F B;  3KRX A;  3F0W A;  3PRP B;  3A9K A;  1WFY A;  3R66 C;  1UPQ A;  2I5C A;  2A5U A;  2LAS A;  2KJ6 A;  2DYN A;  5JLJ B;  2GCJ A;  3QJZ A;  4PYU A;  3ZLZ A;  2IO1 B;  1UBI A;  2WDT B;  2PJH A;  2Z59 B;  2JRH A;  5KCV A;  3ZKJ C;  3A8Q A;  4K2P A;  2KDB A;  2NCN A;  4IC7 B;  2KX3 A;  4MM3 A;  4GZU A;  3ZVV A;  3TFM A;  2KHW B;  2Z0O A;  4MSQ B;  3KY9 A;  1R4N I;  2MA9 B;  2DZM A;  3HM3 A;  3VTW A;  3AXC A;  3ZNG C;  4A20 A;  1I35 A;  2GCL A;  1OEY J;  3A1Q B;  1TXD A;  3ZTC A;  1V2Y A;  4WAA A;  1MK7 B;  4MJS B;  3VDZ A;  4MDK E;  1DDM A;  5E6N A;  5C79 A;  3QHT A;  4RM9 A;  5L95 C;  1BTK A;  5LXH A;  4PS3 A;  2YS3 A;  2R09 A;  2N9X A;  2FJL A;  1Y19 B;  2XBB C;  4Z2M B;  3VOQ A;  2N9P C;  4HAX B;  2WYQ A;  1M94 A;  1FXT B;  2GBR A;  4BBN C;  3VHT C;  3V60 A;  3UQA A;  2N7D A;  5D94 A;  2O6V A;  5KHO A;  1KZ7 A;  1Q1O A;  2EKE C;  2LVQ A;  2KXJ A;  2V4L A;  3TIX A;  4DK5 A;  2P8V A;  2D3G A;  3ODX A;  2DZJ A;  3KVF B;  1F9J A;  4GDL B;  1ZSQ A;  4K7W A;  1K5D B;  3N32 A;  3DOW A;  3A9J B;  2Y8G A;  4AJW A;  1I2H A;  5HE2 A;  3L0W B;  2BWE S;  1I7A A;  3W1S A;  1WMH B;  2CU1 A;  3AU4 A;  2J59 M;  3HIZ A;  2UZS A;  1FAO A;  4WJQ A;  2G35 A;  3WAP A;  4Z2N A;  2L76 A;  1NU2 A;  2KKC A;  1KOT A;  1YX6 B;  2NBU A;  3ZRF A;  1BTN A;  2GJY A;  1KJT A;  4G50 A;  3T8M A;  2MLB A;  1SHC A;  1K5G B;  3PVU A;  3L17 A;  1TJ6 A;  1IP9 A;  3ALB A;  3UIP B;  2DYQ A;  5DHF B;  4PNK A;  2LWP A;  3CSF A;  2HJ8 A;  1WI1 A;  2DHZ A;  1ZW7 A;  1MPH A;  3GOE A;  1WZ3 A;  4MT7 A;  1WX8 A;  2RD0 A;  3WAM A;  1IRS A;  5LOP B;  2N9E B;  1ZC4 B;  4HAY B;  2RSU A;  3A33 B;  3TVV A;  1TGZ B;  2DKP A;  4MJS A;  4F8C B;  4YON A;  2MW5 A;  1MG8 A;  4GB9 A;  3EEC A;  4JGH B;  2W2X C;  5L81 A;  4G11 A;  5CLL B;  3DPD A;  1UZX B;  5D3X A;  3W1Y A;  2CR5 A;  4FBJ B;  3S2A A;  2DLW A;  4DX8 A;  2KTR A;  2C7N B;  1GNU A;  3DBH I;  5HE1 A;  4HDO A;  2YS1 A;  3PVW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...