3TCAA

Crystal structure of the ras-associating and pleckstrin-homology domains of riam
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
260
structure length
246
Chain Sequence
b'VKKLVVKVHMDDSSTKSLMVDERQLARDVLDNLFEKTHCDCNVDWCLYEIYPELQIERVFEDHENVVEVLSDWTRDTENKVLFLEKEERYAVFKNPQNFYLMNAKNKEYLLEESFCGTSIIVPELEGALYLKEDGKKSWKRRYFLLRASGIYYVPKGKTKTSRDLACFIQFENVNIYYGIQCKMKYKAPTDHCFVLKHPQIQKESQYIKYLCCDDARTLSQWVMGIRIAKYGKTLYDNYQRAVARA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Amyloid beta A4 precursor protein-binding family B member 1-
publication title Rap1-interacting adapter molecule (RIAM) associates with the plasma membrane via a proximity detector.
pubmed doi rcsb
source organism Mus musculus
molecule tags Signaling protein
total genus 76
structure length 246
sequence length 260
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-08-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00169 PH PH domain
A PF00788 RA Ras association (RalGDS/AF-6) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 3tcaA02
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 3tcaA01
4ZRIA 2IYDB 1ZW7A 2MSED 3VVWB 5JH5C 2N1WA 1OY2A 5KHOA 4CO7A 2C9WB 1JRUA 2CHXA 5DCNA 2ZVOA 1W1DA 4II2B 2LOXA 3IVFA 3PEGA 2ZCBA 3TO1A 1KZ7A 1MIXA 2M38A 4NJ7A 1WR6E 2R09A 2M17A 3VDZA 2YS1A 1I2HA 4KSKC 4AUQC 2NR2A 5C23A 3UZTA 4PS3A 2J59M 3B08A 4ANWA 3QQ8B 2L0TA 2ZPYA 3VH3B 3OLMD 4TQ1A 1U5EA 3PGEA 1XD3B 1U27A 2KX3A 2FIDA 2J0JA 3CIKA 1H8CA 4HB3B 4F7HA 5L81A 3SHQA 3C0RB 4BKSA 1CMXB 4W9FA 4C0AA 1G6JA 2LD9A 3W1SC 2GCLA 1GG3A 3GYPA 3BJIA 5CLLB 1KJTA 2YT0A 4F8CB 1WI0A 3DVGX 3A9KA 1MG8A 2NMBA 2JZZA 2LI5A 4DDGD 1P1AA 1E8XA 1MIZB 3HM3A 2LVOA 1WGYA 5EFXA 1UEFA 3AU4A 4TUUA 2I5CA 1X86A 2MBHA 3PREA 3AULA 4F1SA 2MWNB 4HHVA 3VUYA 2G35A 4I6LB 2GBNA 2EJ8A 2M4NA 3IHPC 1RAXA 2DKQA 3UINB 1YX6B 4WWNA 2J0KA 3I3TB 1U5GA 3G9WA 3Q3JA 2K2JA 1GC6A 1IP9A 2EMSA 2QKMA 3F0WA 1UZXB 3VXWA 4Z2MB 4YL8A 2CR5A 2KWUB 4HAVB 2PE6B 4NSWA 4DHZE 4FJYA 3HIZA 2P8VA 1AWEA 1FHWA 2COFA 2RUKB 1WF9A 1XKEA 3O96A 1NDDA 1D3ZA 5LXHA 2VRRB 1V81A 1TZ1A 4GN1A 3OJ3A 1FGZA 1FOEA 2XK5B 4DHJB 1H10A 3PVUA 2FAZA 2HE7A 2M14A 3TFMA 2NVUI 2RR9A 3BY4B 5DPTA 4XWXA 1A5RA 2G3QB 2MP2A 4NPNA 3A8PA 3V5WA 3DBSA 2WDTB 1WMHA 3W1SA 3ZDTA 3U30A 2RSGA 3LJUX 2D9WA 2D9VA 3PVLA 2BGFA 3H1UA 1R4NI 2DHZA 5GMVA 2Y8GA 1ISNA 1V80A 4LCDE 4NAWA 3KRWA 2KFKB 3A8QA 3VOQA 1K5GB 4JGHB 3QHTA 5AEKB 4K81A 5DHAB 4X57B 5JHBA 2ZZPB 1GNUA 1QQGA 2NS5A 3M1IB 2WYQA 3APFA 3PVWA 4HWIB 2D4QA 2DX5B 2Z0EB 3ZO5B 3UF8A 2NBWB 2O6VA 3AU5A 2M0XA 2AEHA 3PP2A 3DPDA 2EMTA 4IC7B 2IO1B 3NSUA 5FI1A 1FXTB 4TYZA 2A5UA 3RULA 3VIAA 1F9JA 3VTWA 3PRMB 3ODWA 2KWCA 4B6WA 5KCVA 3ZTDA 1WR1A 1ZSQA 2V76A 2DHJA 1KM7A 1P9DU 1EVHA 2HTHB 2PEAA 3ML9A 1BWNA 1L7YA 3ZNGC 4A5KA 5J18A 2KHWB 1Z5SB 4BKSD 4K2PA 4G11A 2RGNB 4KAXB 4B9KA 2KGXB 2EKEC 2UWQA 3SU8X 4HB4B 4BFRA 4GDKB 1C1YB 4H8SA 3B1LX 5HE1A 4BBNF 1U5DA 5D6JB 4Y94A 5LOPB 1UBQA 1IPGA 2MBQA 3RUIB 2MDXA 4W9GA 2N0YA 3PHWB 2KZRA 2DZMA 2C7NB 2L2IA 2G4SA 5D2MB 5FI0A 4ZYNA 5C16A 4DBBA 1K5DB 3RT3B 5DIFB 4WWOA 3RYTA 2D10A 3JYUA 2NPTB 2DX5A 3V6EB 4FA6A 4IM2A 2MFQA 2NCNA 2KN5A 2BYEA 1UBIA 3T8MA 3RCPA 2KFJA 3SUZA 2V1YA 2W9NA 3WA0A 3H7SA 4MELA 3L10B 2L76A 4KHOA 1TBEA 2Q13A 1Y8RC 3A4SC 4W9KA 2EC1A 4WAAA 2MCNB 3SNHA 3QCAA 4NQLB 1WX9A 1E7VA 1J19A 4HAXB 1FAOA 2KNBA 3O65B 1Z2MA 1XX0A 2GBRA 2M8SA 1BAKA 4HVBA 4NJ6A 4MJSA 1W1HA 4MM3A 1P3QU 2P0FA 2YT1A 1UD7A 1J8CA 2LYDA 2KDFB 5KHQA 1WVHA 3H7PB 4GDKA 3ECIA 1SE9A 1WXVA 2B3AA 3PV1A 2KCJA 2BWES 4HATB 3DBLI 1YD8U 3SYXA 4MT7A 2P0DA 1LXDA 4MEMA 3D32A 5HKHA 4HPMB 4TQ0A 3PZDA 3EECA 2NBUA 2PJHA 5D3WA 3D8EA 2CU1A 5C6RA 3GYOA 4GSWA 4A6FA 5D27A 1NBFC 2O6VD 3M63B 3A98B 4F7GA 4DHZB 4KV2A 4P7IA 2K8BA 1WGUA 2NPTA 2Z0OA 2IY0B 4ANVA 1PQSA 4HB0B 3ZNID 3SV1A 4A3PA 2ELBA 4EZLA 4GU2A 4TV3A 4A6HA 1OGWA 3PT2B 1J0WA 1SIFA 2R2QA 5GOWB 4FHJA 4F7UP 4DDID 4LDTD 4TKNA 1WX7A 3ODOA 2RVBB 2N9EB 1Q0WB 2KK8A 3ZDMC 5C1ZA 2MX2A 1AARA 2GBJA 3L0WB 4E74A 1UELA 2N1VA 1FB8A 5D3VA 1UNQA 2I1KA 1WGRA 2GOWA 3UQAA 4K7WA 3V62A 2KO3A 1EO6A 5AZGA 3FEHA 3VUXA 1U4AA 1V5MA 2YVCA 2FCNA 4PQ0A 1PFJA 4PS7A 3R7QA 2BYVE 4J6IA 4EOYA 3CSFA 3H7PA 2KDIA 4DBGA 3PLUA 2X18A 5AZHA 3L08A 4W9IA 3PLVA 1BTKA 2DFKA 2DYMA 3DQVA 3RCZA 2ZEQA 4GDLA 2E2XA 2K1FA 3WAPA 4HLEA 2R2OA 4MK0A 2RPQA 2BKRB 5EDSA 3KRXA 4CHJA 5CHWA 4EFOA 3NZUA 1DDMA 2MP2B 4A3OA 3OJ4B 4DK5A 5JHGA 2OQBA 4AJWA 2DAFA 4XX5A 1WMHB 3K9OB 1PMSA 2D2QA 2LGXA 2JRIB 2NBVB 3WYFB 1PLSA 3IBEA 4NAWB 3HK0A 2Y8FA 1YX5B 2LASA 1YIWA 3KZ1A 4IWPA 2PE9A 2ROZB 5JLJB 3CMMB 1WE6A 1ZC4B 4RM9A 3FSSA 5KQ4A 5E6PA 3VFKA 1WJMA 3NHEB 3KH0A 3QARA 3ZVVA 1WJ1A 4HCNB 4KDIC 3A4RA 1V6EA 2KTRA 2O6VB 3UIOB 3ZTCA 2MLBA 4FJVB 2KUPA 3R7RA 2QKLA 3KYDD 3PSEB 5LXIB 1GC7A 5AZFA 1UH6A 4WJQA 1LM8B 1EF5A 1K8RB 3M95A 1DDVA 4GGQA 1MK7B 4EJNA 3ALBA 4G3XB 4JIOU 1EUVB 4MSQB 3MJWA 2JP2A 3DBRI 2FJLA 4LDTB 5IA7A 2DN6A 4G0NB 1WJ4A 4GB9A 2CY4A 4FULA 1UNRA 2DYNA 3HM6X 2BPSA 5L95C 2L00B 2KTFA 2D9YA 1XT9B 2D07B 1W1GA 2L05A 3WALA 1TGZB 3ENEA 3AXCA 2ZVNA 4MGYE 4M8MA 5HE0A 1MAIA 2KDEB 3TBLD 2XEWA 4ANUA 3LDZE 3QWZB 3D8FA 4ICUA 1Q67A 4GPTB 1NI2A 2K6DB 5J17A 2GS0A 1NTVA 1NU2A 2WX0A 2IBIB 3VQIA 3WIMA 1IYFA 1VCBA 4AOFA 5LONB 1X1FA 2NZ8B 3ZRCA 3CXBB 2ZCCA 5HE3A 3DVNU 2PPHA 1WE7A 5LLIA 2IO0B 4IWQA 3ZLZA 4FHKA 4AP4C 2JUOA 3R66C 2P0HA 4BOZB 4PNKA 2MBBB 3EFUA 2UYZB 1B55A 5DH9B 4KHBB 1GUAB 3V61A 2JPHA 1MK9B 3RZFA 4WJPA 4WJNA 4B6HA 2JY6A 2IO2B 2C60A 3IG3A 3MHSD 1DROA 3BINA 1V2YA 2LVPA 3NOBA 4WVFB 2AYOB 4ZDVA 4KIKB 4DXAB 1KOTA 1UPQA 4IAPA 1YQBA 1WGGA 2D11A 3N7CA 2GBKA 2BCJA 4W9JA 4PYUA 4FN2A 2BKFA 1RLFA 3NS8A 2DYOA 5JZEB 1XD4A 4MJSB 2RLOA 2OOBB 1I35A 1XODA 1WZ3A 4HJKA 2KLCA 3ZKJC 1Y5OA 4CHKA 3JSVA 2CODA 2YF0A 3PHXB 1LB1A 3UGBB 5CHFA 4IFSA 2L1CA 2L8JA 1DYNA 4A20A 2HD5B 2KMCA 2XQNM 3A9JB 2K8CA 3AJ4A 2MBEA 1V5OA 2CAYA 1OQYA 4JL9A 1LW3A 1WRDB 3QA8A 2V3SA 3JVZX 1J0GA 3ONSA 1AQCA 3L17A 4A6FB 1KLVA 2C5LC 4JLCA 2ZJDA 1RJ2A 1V89A 3U8ZA 3A1QA 3T06A 4HPLB 2YLMA 5L83A 5J3TA 1VD2A 1QC6A 4K1RB 1WY8A 3M3JA 3LJ3A 5TR5A 4DX8A 4K7SA 2JT4B 4KVGB 2AL3A 4GIVA 3B0AA 3HHMA 2DHIA 2N9XA 3QWMA 1NTYA 1WIAA 1WZ0A 2QHOA 4KIKA 2K8HA 3T9LA 4D0NB 2LOZA 4IM0A 4OVUA 4XZ4A 4EZKA 1TXDA 1OEYA 5DHFB 4MGKE 5D7GA 3ML8A 2LGYA 2UZSA 2KOXA 2H7EA 4BVUC 2KXJA 3KY9A 2Y7BA 2MKRA 1V5UA 4I6NB 5C5BB 1WGQA 3DXDA 1UPRA 1QZEA 4GOCA 2I5FA 1V86A 1FHOA 4NY0A 2AL6A 4G50A 2KVRA 3DVNV 4MH0E 2MWSB 3K9PB 1GJZA 5HE2A 3L16A 4GDLB 3A9JA 4CYEA 4EEWA 1E5WA 1WXMA 4NNJB 3MPXA 4KZ0A 4XC2A 1E90A 3X23A 2LVQA 2MW5A 4W9LA 1WX8A 5E6NA 3M62B 2FCMA 2MRPA 4W9EA 1H4RA 3VH4B 5D3XA 5D3YA 4FADA 4LJPB 2REXA 2LJ5A 3TIXA 2ROVA 1WXAA 1E7UA 2RNRB 4GMXB 1Q1OA 2V4LA 1EGXA 2AWTA 1WI1A 1WYWB 2KJ6A 2YS3A 2OJRA 1YJ1A 4IG7B 4FJZA 2N7DA 5DPSA 3RD2A 3PG7A 2A4ZA 2D9XA 2WX1A 2ELAA 2MQJA 3VHTC 3ULBA 2FUHB 1U29A 3TW1A 2K25A 3EHVA 2KTRB 4WJ7A 1V88A 3ZW3A 1C3TA 2CS4A 2W2WA 2MBOA 2LXCA 1V5TA 2Z0DB 1EF1A 5DI9B 3QIJA 5C5BA 4HK2A 3MDBC 4E3CA 1WH3A 3DVGY 2ZNVC 3KVFB 2ZNVB 1R4MI 3ZVRA 2RD0A 1FGYA 1HE8A 4DX90 1P6SA 2Y5BB 5JHAA 2LG1A 3L13A 3L54A 1Q5WB 5KQ1A 3VUWA 2Z0QA 4MGZE 2KX0A 1X1MA 2OTXA 3WANA 2JF5A 2KMAA 4K7UA 4HAUB 1DDWA 1ZC3B 4IUMB 1ZM0A 2KC2A 2C7HA 1OQNA 4NQKE 3ZUNA 2YS5A 3TMPB 2IFSA 4KZCA 3V6CB 2DTCA 2UVMA 1ZGUB 4OVVA 4YONA 4PS8A 2W2XC 2I1JA 2Z0PA 2MA9B 2COAA 3HQCA 4IW0A 4EMOA 2ZPNA 2HJ8A 4KDLB 2G4DB 3WAMA 1OEYJ 1P5TA 2L7RA 3FM8C 3ODXA 2LUEA 1I42A 2O2VB 2LKOA 3KSYA 1X1GA 2YRYA 1OTRB 1T0YA 2GBMA 4WJOA 4I6PA 3D8DA 2FCSA 2XBBC 1KZGA 1X11A 2DX1A 3DBHI 3JW0X 5CX3A 3U7DA 4LJOB 2G45B 3APCA 2KLGA 4GMVA 3OANA 4M0WB 2N7EA 1P98A 3PTFC 3P2BA 1LFDA 3GOEA 4N9F4 1BTNA 4E71A 2KJHB 2LXAA 4IOYX 3PSCA 2KWVB 3KYCD 4HAZB 3OAWA 1WGDA 2DAJA 3JSVB 2DHKA 1WJ6A 4RM8A 3DCGA 3ZNHB 1M94A 2H7DA 1V49A 3Q3FA 3WAOA 2D3GA 3IFWB 4BKGA 2CRFA 2L3ZA 4FLHA 1P3RA 4W9CA 2BYFA 1WXSA 4ASWC 1S3SG 2K6QA 2JRHA 4JQWC 1XQQA 2ADZA 4M8NA 1V61A 2IYBA 3A33B 4MSMB 3A1QB 2N4FA 2IY1B 2O2VA 4BKTA 2K00A 1BT0A 2BF8B 1XCGA 2KDBA 1EAZA 2LWPA 1P0RA 5IAAC 4MGIE 1LQBA 5CTRC 3HW2B 2J0MA 2CHZA 4HXDA 4II3B 3TL5A 2DENB 3QBVB 1RRBA 3V60A 2DYBA 3MTNB 3QJZA 4AWJA 1WM3A 2COCA 1TJ6A 3S2AA 2DZIA 1SHCA 4FBJB 4WQOB 4HDQA 3AI5A 4F7ZA 3H9DA 3ZRFA 2BWFA 5J3QA 1UNPA 2IO3B 4BOSC 2C7MB 2DZKA 1N3HA 1MKEA 4ZRKA 1ZKHA 2KQ7A 3NY5A 4RMAA 2N9PC 2K39A 2FIFA 2XK5A 1X05A 3APDA 4AJYB 2JXXA 4URKA 2CY5A 2CHWA 2KANA 3N3KB 2K2UA 2YSZA 2L0FA 2J7QB 3KUZA 2VKIA 4K2OA 5FR6A 4Z2NA 1WM2A 2JZ3B 1M7EA 1RRPB 3SO6A 3F5RA 1WJNA 3PRPB 3UQBA 1KI1B 4IM3A 1WJUA 3PPAA 3DDCB 3PS6A 4W9HA 2RGFA 2DLWA 5CHVC 3DXCA 3TJPA 5D94A 2D9ZA 2KFKA 2PZ1A 4CHMA 4HCPB 4HB2B 4PYZA 4HDOA 3DXEA 2JWZA 3QAQA 3N30A 5C79A 4GXBA 3DOWA 4MY6A 5JP4A 2N23A 3CF6E 4EKUA 3QC8B 3RZWC 1S1QB 3KUCB 5J3YA 5JHHA 1WG7A 1DBHA 3VTVA 3VAWA 4WSFA 5J2RA 1U5FA 3NZSA 1Z87A 1RFAA 4WWPA 4BBKA 2LZ6A 1XR0B 3H6NA 1U2BA 1ZVRA 1OMWA 4L6EA 2HTHA 4IWOA 4KHAA 3QK0A 2DYQA 2KKCA 3EC8A 4K17A 2W2XD 3KW5B 3TVVA 3P7ZA 5BO4B 1TTNA 5DPRA 2LULA 1V9JA 3SD5A 1WGHA 2DZJA 1V5PA 4HAWB 2GMIC 3X0WA 4B95A 2KJRA 2KQSA 2VRWB 5DPWA 1E8ZA 3R3MA 4ICVA 5E6OA 4BBNC 2Z59B 2LGDA 2R0DA 2GCJA 1I7AA 4GZUA 3ML4A 1E8WA 5G2NA 4KSLC 2DA0A 4MDKE 2ASQA 3PRZA 2LRWA 3QX1A 1M7RA 3TCAA 4ZRJA 3ZNZB 3GZNI 2GJYA 2M1MA 3N32A 3KUDB 4DWFA 2FNJB 4ANXA 1WFYA 3P6AA 1MPHA 4HAYB 3VTUA 2KC1A 3UIPB 3W1YA 2RSUA 2CKHB 5G55A 1Y19B 4W9DA 3ZIMA 1SGHA 3A9KB 2IZVB 2LRUA 1L2NA 3SDLC 3CSTA 4EUTA 1UGMA 2VSZA 2WWZA 1FHXA 4A6KA 1IRSA 5CLQB 2FCQA 2JVCA 4DHJD 2KD0A 1TQZA 1E8YA 4EZJA 3ULCA 2UZRA 2DKPA
chains in the Genus database with same CATH superfamily
4ZRIA 2WDQB 1QOBA 1C4AA 2IYDB 2IGGA 1ZW7A 2MSED 3VVWB 1AYFA 5JH5C 4C7YA 1QQRA 2N1WA 2ZW0A 1OY2A 3ABVB 4RNAA 5KHOA 3CWIA 4CO7A 2C9WB 1JRUA 2CHXA 5DCNA 2ZVOA 1W1DA 4II2B 4N58A 2VZKD 4ZHOA 1VZ8A 1J7CA 2LOXA 3IVFA 3PEGA 2J53A 3C8YA 1XLPA 2ZCBA 3TO1A 1KZ7A 1QOAA 4WAFA 1V1PA 1MIXA 2M38A 4NJ7A 3GE3C 1WR6E 5D3IB 4PT5A 2R09A 2M17A 3VDZA 5BMIA 1I4QA 2YS1A 2EKIA 3Q3NC 1I2HA 4KSKC 4AUQC 2NR2A 1ZE3D 5C23A 2QDFA 3UZTA 4B0MA 2Z59A 2OJWA 2H88B 4PS3A 2J59M 3B08A 4ANWA 3QQ8B 2L0TA 2GRIA 1TKEA 2ZPYA 3VH3B 3OLMD 3Q14C 4TQ1A 5H8YE 1U5EA 3PGEA 1XD3B 2LGSA 1U27A 2KX3A 2FIDA 2WQYB 2WXNA 2J0JA 3CIKA 1H8CA 1ZYIA 4HB3B 3U12A 4F7HA 1UUPA 2LUMA 5L81A 3SHQA 3C0RB 4BKSA 1CMXB 4W9FA 4ZRQA 4C0AA 1G6JA 2LD9A 3W1SC 2GCLA 1GG3A 1ZXHA 3R8BA 3RN9C 3GYPA 3BJIA 3TEYA 5CLLB 1KJTA 2YT0A 4F8CB 1WI0A 1TYGB 3DVGX 3A9KA 5I4DA 1MG8A 2NMBA 2JZZA 2LI5A 4DDGD 1P1AA 1E8XA 1MIZB 3HM3A 2LVOA 1WGYA 5EFXA 3NVYA 1UEFA 3AU4A 3MJ5A 4TUUA 1IGDA 2I5CA 2N0SB 1X86A 2MBHA 3DWMA 3TSSA 1PGXA 4GNKB 3PREA 3AULA 4F1SA 1RFKA 2MWNB 3A58A 4HHVA 3VUYA 2G35A 4HEA1 4I6LB 3NVZA 2GBNA 2EJ8A 2M4NA 1TS5A 1HA5A 3Q2AC 3IHPC 4AQ7A 5BYQA 1EU3A 1RAXA 1ROEA 2J52A 2DKQA 3UINB 1YX6B 4WWNA 2J4XA 1FNVA 3RNFC 2J0KA 3I3TB 1U5GA 3G9WA 3Q3JA 2K2JA 1GC6A 1IP9A 5IN7A 2EMSA 2QKMA 3F0WA 1FRRA 1UZXB 1XEEA 4Z2MB 3VXWA 4YL8A 2CR5A 2KWUB 4HAVB 2PE6B 4NSWA 4DHZE 4FJYA 2JU6X 3HIZA 2P8VA 1AWEA 4HPPA 4FXCA 1FHWA 2COFA 4N6EB 2RUKB 3AE5B 2WDRB 4DQOC 1L4ZB 2RDBC 1WF9A 3IT6B 1XKEA 1CK1A 5FR3A 3O96A 2XNAC 1NDDA 1D3ZA 1SEBD 5LXHA 2VRRB 2PVOD 1V81A 3VRBB 4US9A 1TZ1A 4GN1A 3OJ3A 1FGZA 1FOEA 3ZJVA 4ZRPA 2XK5B 3VR8B 4DHJB 3AECB 4LNIA 1H10A 3PVUA 2RDHA 2FAZA 2WXLA 2HE7A 2M14A 3FKYA 3MP9A 3FC4A 1AN8A 3TFMA 2NVUI 1JRPA 2RR9A 3BY4B 4XYCA 5DPTA 4XWXA 3TEXA 2W3SA 1A5RA 2G3QB 1XCQL 2MP2A 4NPNA 2VZKB 3SR6A 4IOIE 3A8PA 2LGIA 1GPXA 2Z4DA 3V5WA 1C78A 3DBSA 2WDTB 4QJ3B 2MJDA 1WMHA 3W1SA 3ZDTA 4OSNA 4JWUC 3U30A 2RSGA 1D4BA 3B2GA 3LJUX 2D9WA 2D9VA 3PVLA 2BGFA 2NBVA 3H1UA 3Q8FA 1R4NI 2DHZA 5GMVA 2Y8GA 1QOFA 1ISNA 1V80A 3DHHC 2LHEA 4LCDE 4NAWA 3KRWA 2KFKB 3A8QA 3VOQA 1K5GB 3LB8C 4JGHB 3QHTA 2IDYA 5AEKB 4K81A 5DHAB 2JWUA 3BIID 4X57B 4C56C 5JHBA 2ZZPB 1GNUA 1QQGA 2NS5A 2V4IB 3M1IB 2WYQA 3APFA 3PVWA 2W55A 4HWIB 1VLBA 2D4QA 2DX5B 2Z0EB 3ZO5B 3UF8A 4US8A 2NBWB 2O6VA 3AU5A 3EUB2 2M0XA 1KFYB 2AEHA 4LNNA 3PP2A 3DPDA 2EMTA 2INDC 4IC7B 2IO1B 2KT7A 3NSUA 3H8HA 5FI1A 1FXTB 3GS2A 4S0RA 4TYZA 2A5UA 3RULA 3VIAA 1PFDA 4RCOA 1F9JA 1VDVA 3VTWA 1R7SA 3PRMB 2G9HD 3ODWA 3BYTB 2KWCA 1ZDXA 1F2RI 4B6WA 5KCVA 3ZTDA 1WR1A 3URYA 1ZSQA 2V76A 2DHJA 1KM7A 1P9DU 1EVHA 2HTHB 1YJIA 2PEAA 3AEEB 3ZXVA 4RGMA 3ML9A 1BWNA 1L7YA 1J7AA 3ZNGC 1NENB 2WXFA 4A5KA 5J18A 2KHWB 2PIAA 2CU3A 1Z5SB 4BKSD 4K2PA 4G11A 2RGNB 1JWBD 4KAXB 5EE3A 4B9KA 1V97A 2KGXB 2EKEC 2UWQA 3SU8X 4HB4B 3RNAC 2WHIA 4BFRA 4GDKB 2IGDA 3BK2A 1C1YB 4H8SA 3B1LX 5EE1A 5HE1A 1WGKA 1WSPA 2WU2B 2KVZA 4BBNF 1U5DA 5D6JB 4Y94A 1C77A 1L0XB 5LOPB 1UBQA 1V1OA 1IPGA 2MBQA 3DBHB 3RUIB 1YN5A 2MDXA 1N6ZA 4W9GA 2N0YA 1STEA 3PHWB 2KZRA 3N1ZC 3Q3OC 4HRSA 1MFWA 2DZMA 1TJEA 2C7NB 2L2IA 1BUIC 1PYWD 4C80A 4C7ZA 2G4SA 5D2MB 5FI0A 2WXIA 2L83A 1F1HA 2K49A 4ZYNA 5C16A 4DBBA 1K5DB 3RT3B 2AX5A 5DIFB 4WWOA 4H2AA 3RYTA 2D10A 1T3QA 3JYUA 1I4GA 2NPTB 2DX5A 3V6EB 1MI1A 4FA6A 4IM2A 2MFQA 2NCNA 2KN5A 2BYEA 1UBIA 3T8MA 3RCPA 1D5ZC 2KFJA 3SUZA 2V1YA 4KHBA 3BWUD 2W9NA 3WA0A 3H7SA 1YJJA 2H89B 4MELA 2IJ0A 3L10B 2L76A 1TZOA 3I63C 4KHOA 2K0PA 1TBEA 2YEPF 2Q13A 1Y8RC 3E9SA 3A4SC 1RYJA 2EC1A 4W9KA 2E6XA 3PO0A 4WAAA 4BZAA 1HEZE 2MCNB 3SNHA 3QCAA 4NQLB 4A9AA 1WX9A 5BYSA 1E7VA 4LNFA 1J19A 4HAXB 1FAOA 4HJGE 5IOIA 2KNBA 3VR9B 2NTTA 3O65B 2B76B 1Z2MA 3BVZA 1XX0A 2GBRA 2M8SA 1BAKA 4HVBA 1EWYC 4NJ6A 3HIEA 2LEKA 4MJSA 4C4VA 1W1HA 4MM3A 1P3QU 2P0FA 2YT1A 1ET9A 1UD7A 1J8CA 2LYDA 2QCZA 1M4VA 3C19A 2KDFB 5LNK1 5KHQA 1WVHA 3H7PB 4GDKA 3ECIA 1SE9A 1WXVA 3BVMA 2B3AA 3PV1A 2KCJA 2BWES 1C9FA 4HATB 3DBLI 1YD8U 3SYXA 4MT7A 2P0DA 1LXDA 4DXGA 4MEMA 4YWGG 3U4EG 3D32A 1I4RA 3L4PA 5HKHA 3B77A 1ACCA 4HPMB 4TQ0A 2DWQA 3PZDA 3EECA 2NBUA 2PJHA 4D2KA 5D3WA 3D8EA 4P16A 2CU1A 5C6RA 3BZDB 3GYOA 2OHFA 4GSWA 4OT1A 4A6FA 2K22A 5D27A 1F2RC 1NBFC 1Q10A 3A98B 4F7GA 1N60A 2O6VD 3M63B 4DHZB 4KV2A 4P7IA 1E9MA 2K8BA 3MC8A 1T6BX 1WGUA 2NPTA 1E6EB 2BVCA 4OVZA 1DOIA 3ZQ4A 2Z0OA 2IY0B 4ANVA 1PQSA 4HB0B 4UDUC 3Q6BA 3SV1A 3ZNID 2KMMA 4A3PA 2ELBA 3BVGA 3B2FA 3EA6A 4EZLA 4GU2A 4TV3A 4A6HA 1OGWA 3PT2B 3OWEB 1J0WA 1SIFA 2R2QA 2D3AA 1MJDA 4REZA 5GOWB 1JALA 2WS3B 4FHJA 4F7UP 4DDID 3NWFA 4K3CA 4LDTD 4TKNA 2YEPB 1C79A 1WX7A 3ODOA 1SE3A 2RVBB 4P6VF 2N9EB 1Q0WB 3RNGC 2KK8A 2WXOA 3ZDMC 5C1ZA 3OHMB 2MX2A 1AARA 2GBJA 3L0WB 2FBWB 4E74A 1UELA 2N1VA 1FB8A 5D3VA 3AH7A 1UNQA 2QJLA 3RI7C 2I1KA 2WNMA 1WGRA 2GOWA 2AQ2B 1E7PB 3UQAA 4K7WA 3V62A 1D6EC 2KO3A 4L2YA 1EO6A 4YTPB 3KLSX 4LTUA 5AZGA 3FEHA 4BAXA 3VUXA 1IBXA 4QJ4B 1U4AA 1V5MA 2YVCA 1ET6A 1RM6C 1OFFA 5EE0A 2FCNA 1CQVA 4PQ0A 2HTME 3MFGA 1PFJA 4PS7A 1FEHA 3R7QA 2BYVE 4J6IA 4EOYA 2BTEA 2HDEA 3CSFA 1I4XA 1EWCA 1L4DB 3H7PA 1MI0A 4M00A 2KDIA 4DBGA 3PLUA 2X18A 1TS3A 5AZHA 1YN3A 3L08A 1T0SC 1BXTA 4W9IA 3PLVA 1SE2A 1BTKA 2DFKA 2V0GA 2DYMA 3DQVA 3RCZA 5IP4D 2ZEQA 1OQRA 4GDLA 1WYGA 2E2XA 2K1FA 1GB1A 2WDVB 3MC9A 3WAPA 4HLEA 2R2OA 4EE2A 4MK0A 2RPQA 2HJ1A 2BKRB 4WH4A 1UWXA 3KRXA 5EDSA 1F0ZA 1QOGA 4CHJA 5CHWA 4EFOA 1KLUD 4XWWA 2X38A 1NYQA 3WCQA 3P4PB 3NZUA 1DDMA 1T0QC 1D5MC 2MP2B 4A3OA 3Q8BA 3HSAA 1PGAA 3OJ4B 4N59A 4DK5A 5JHGA 3RNCC 3AMZA 1VJKA 1YQ3B 2OQBA 4AJWA 2DAFA 4XX5A 1WMHB 2ZW1A 3FAHA 3K9OB 1PMSA 1PGBA 2D2QA 2KR0A 2LGXA 2JRIB 4OHJA 2NBVB 3RPFC 3WYFB 1PLSA 3IBEA 2WU5B 3AEGB 4NAWB 3HK0A 2Y8FA 1YX5B 2WXJA 2LASA 2WXMA 1YIWA 1XLQA 3KZ1A 4IWPA 2PE9A 2ROZB 5JLJB 3CMMB 2D5GA 1WE6A 1ZC4B 4RM9A 3DBLB 2JXTA 1D5XC 1GB4A 1XLNA 2LHDA 3FSSA 3DHIC 5KQ4A 3AV8A 4L1BA 4B0EA 5E6PA 3VFKA 1WJMA 3NHEB 3KH0A 3QARA 2Z14A 3ZVVA 1WJ1A 4HCNB 4KDIC 3A4RA 2LFIA 1V6EA 2KTRA 3W5VB 2O6VB 1TIFA 3UIOB 3ZTCA 2MLBA 4FJVB 4C00A 2KUPA 3R7RA 2QKLA 3KYDD 3PSEB 4OZBA 3TEZA 5LXIB 2BS2B 3I9V1 3RNEC 4GOUA 1GC7A 2V3NA 5AZFA 1UH6A 4WJQA 1AW7A 1BMLC 1LM8B 1EF5A 4XDDA 1K8RB 3M95A 1DDVA 2L32A 4GGQA 3GZNB 1MK7B 4EJNA 3ALBA 4G3XB 4JIOU 1EUVB 2IPKD 3DCXA 2WXKA 4MSQB 3MJWA 2JP2A 3DBRI 2FJLA 2M0AA 2I2YA 2WGSA 4LDTB 5D3DA 5IA7A 1VZ7A 3RFZB 2DN6A 4G0NB 2BBCA 1UGJA 2K8EA 1WJ4A 4GB9A 2CY4A 4FULA 1UNRA 1QT9A 2DYNA 3HM6X 2BPSA 5L95C 2X8XX 2L00B 2KTFA 2D9YA 1V8CA 2SEBD 1XT9B 2D07B 3Q69A 2AQ1B 1W1GA 2L05A 1SJED 1GOZA 1ENFA 3WALA 1N63A 1TGZB 3ENEA 3ZXRA 3GB1A 3AXCA 2ZVNA 4MGYE 4M8MA 1PDXA 5HE0A 1MAIA 4OW0A 2KDEB 3TBLD 2XEWA 4ANUA 3LDZE 3P4RB 3QWZB 3D8FA 4ICUA 1Q67A 4GPTB 4ACFA 3GP7A 1NI2A 2K6DB 5J17A 2GS0A 2KDMA 1NTVA 1NU2A 2WX0A 3GE8C 2IBIB 4LNOA 3VQIA 3WIMA 2INCC 1VCBA 1J7BA 4AOFA 1IYFA 4KKIA 5LONB 1X1FA 1VZ6A 2QSDA 2NZ8B 3ZRCA 1TS2A 3CXBB 1UF0A 3NW8A 2ZCCA 1N5XA 5HE3A 3DVNU 2PPHA 1WE7A 1KLGD 1SJHD 1TS4A 5LLIA 2GUMA 2IO0B 1ESFA 4IWQA 3ZLZA 4FHKA 2PMVA 4AP4C 2JUOA 2EELA 4WWMA 3R66C 1FFVA 1KH0A 2P0HA 1K51A 4BOZB 3EFCA 4PNKA 3N9YC 2MBBB 3EFUA 2UYZB 1B55A 5DH9B 2JYTA 1N5WA 4KHBB 1GUAB 3V61A 2JPHA 1LGRA 1WWTA 1CZPA 1MK9B 5I2MA 3RZFA 4WJPA 3KWLA 1JWSD 4WJNA 2FE8A 4B6HA 2JY6A 4O1NA 2IO2B 2C60A 3IG3A 3MHSD 1DROA 3BINA 1V2YA 2LVPA 3NOBA 1DOYA 4WVFB 1UNSA 2AYOB 4ZDVA 4KIKB 1QKZA 4DXAB 3NS1A 4S17A 1KOTA 4XWTA 4M01A 1UPQA 4IAPA 1YQBA 2J42A 1WGGA 4M0WA 2D11A 3Q8CA 3N7CA 2GBKA 2BCJA 4W9JA 4PYUA 4FN2A 2BKFA 1EM7A 1RLFA 3NS8A 1FM0D 1FNWA 3P1MA 1GAQB 1SB3C 2DYOA 5JZEB 1XD4A 3AE9B 4MJSB 2RLOA 4C4VB 4MM3B 2OOBB 1I35A 4ZOHC 1XODA 1WZ3A 4HJKA 2KLCA 2M19A 3ZGZA 3ZKJC 1Y5OA 4CHKA 2MJEA 4RGTA 3JSVA 2CODA 2YF0A 1FIQA 3PHXB 1LB1A 3UGBB 4LLGM 5CHFA 4IFSA 2L1CA 2L8JA 2RPVA 1DYNA 1L5PA 4A20A 2HD5B 2KMCA 3AE3B 4RF1A 2XQNM 2MEKA 3A9JB 2K8CA 5AUKA 5AUIA 1DOXA 3AJ4A 4A8XC 1TKYA 2MBEA 1V5OA 2CAYA 1AWDA 1OQYA 4JL9A 2KYWA 1LW3A 1WRDB 3QA8A 2V3SA 3JVZX 1J0GA 3R2TA 3ONSA 1AQCA 3L17A 4P1CC 3J9CA 4A6FB 4USAA 2WP9B 3IAS1 1KLVA 2C5LC 4JLCA 2ZJDA 1RJ2A 1V89A 3U8ZA 1HXYD 3A1QA 3T06A 1IUEA 4HPLB 2YLMA 5L83A 5J3TA 4IKGA 4JE3B 4RGNA 1VD2A 1QC6A 4K1RB 1WY8A 3M3JA 4Q2JA 1L0VB 3LJ3A 5TR5A 3NWAA 4DX8A 1TY0A 4HKQA 3NRZA 4K7SA 3Q8AA 4ARIA 4XDCA 4AS1A 2JT4B 4KVGB 2AL3A 4GIVA 3B0AA 5BYRA 3NVVA 3KWVA 3HHMA 2DHIA 1T77A 2BW2A 2N9XA 3QWMA 1NTYA 1CJEA 3P42A 1WIAA 1WZ0A 3LXFA 2QHOA 4KIKA 2KIGA 2K8HA 2PKOA 3HRDD 3T9LA 4D0NB 2LOZA 3AE2B 1FRDA 4IM0A 4OVUA 4XZ4A 5E6JA 4L1RA 4KGRA 4EZKA 1FXIA 5FK9C 1TXDA 1XCTL 1R4NB 3AE8B 1OEYA 4DXFA 5DHFB 4MGKE 4A55A 2WXHA 5D7GA 1P7FA 3ML8A 2LGYA 4K3BA 5BMGA 1IBXB 3FILA 2UZSA 1EU4A 2KOXA 2H7EA 4BVUC 2KXJA 1L6UA 3KY9A 2QIEB 2Y7BA 2MKRA 1V5UA 4I6NB 5C5BB 1WGQA 3DXDA 1UPRA 1QZEA 4GOCA 2I5FA 1V86A 4CSQA 1L6VA 3T3NA 1FHOA 4NY0A 2AL6A 4G50A 2KVRA 3DVNV 4WIPA 4MH0E 2MWSB 3K9PB 2E3TA 4ZYSA 4KGSA 2D3BA 1GJZA 5HE2A 3NZ3A 3L16A 3KQ4A 4GDLB 2KIEA 2K3UA 3A9JA 4CYEA 4EEWA 3AEBB 5T8IA 1E5WA 1WXMA 4NNJB 3MPXA 3SFDB 3RMKC 1JWMD 4KZ0A 3RNBC 3U52E 4XC2A 1E90A 3X23A 2N7JA 2LVQA 2MW5A 4W9LA 1WX8A 5E6NA 2OEDA 3M62B 2FCMA 2MRPA 4W9EA 1H4RA 3VH4B 5D3XA 5D3YA 4FADA 3NG0A 4LJPB 3AE6B 2REXA 2LJ5A 5EE9A 3TIXA 2ROVA 1WXAA 2VH2A 1E7UA 2RNRB 4NZLB 4GMXB 1Q1OA 3W5UB 4YXDB 2V4LA 2KAJA 1EGXA 2AWTA 1WI1A 3HUIA 1WYWB 2INNE 2KJ6A 1NI3A 2YS3A 1SSNA 2OJRA 4YTMB 1YJ1A 2L1AA 4IG7B 1WXQA 4FJZA 4A90A 2N7DA 5DPSA 3RD2A 1WRIA 1FPYA 3PG7A 2A4ZA 1DYQA 2D9XA 2WX1A 3PZ8A 1F77A 2ELAA 2MQJA 3VHTC 1NEKB 3IT4B 3ULBA 2FUHB 1U29A 2DLBA 3B9JA 1XF5L 2MJ3A 3TW1A 2K25A 3EHVA 2KTRB 4WJ7A 2WXQA 1V88A 2NMQA 1SIJA 1ZDVA 2BS3B 3ZW3A 1C3TA 4DIXA 3AB5A 2CS4A 2WXRA 2W2WA 2MBOA 2LXCA 1V5TA 2Z0DB 1EF1A 5DI9B 1JMLA 3QIJA 5C5BA 4HK2A 3MDBC 2MHJA 4E3CA 1WH3A 3DVGY 5LG4B 1QLBB 5GXGB 2ZNVC 3KVFB 2ZNVB 1R4MI 3ZVRA 2RD0A 1FGYA 1C4PA 2M56B 1HE8A 4DX90 1P6SA 2Y5BB 4RGOS 5JHAA 4M02A 2K5PA 2LG1A 2L52A 3L13A 2QMTA 3L54A 1C4CA 1Q5WB 5KQ1A 4R3DA 3VUWA 2Z0QA 1QILA 3NUHB 4MGZE 2KX0A 1X1MA 1N62A 1HZ6A 2OTXA 2SAKA 3WANA 2FJUB 3P4QB 2JF5A 2KMAA 3DWGC 2JSVX 4K7UA 2KACA 2WXPA 4KX6B 4HAUB 5TSSA 1DDWA 1ZC3B 4IUMB 1ZM0A 2KC2A 1B1ZA 2C7HA 1E10A 1OQNA 4NQKE 3ZUNA 2YS5A 3TMPB 2IFSA 4KZCA 3V6CB 3ZYYX 2DTCA 3N20C 2UVMA 4A6QA 1ZGUB 4OVVA 2ON8A 4YONA 4ARCA 5M4YB 4PS8A 2W2XC 4NJCA 3HVZA 2Z8LA 2I1JA 2Z0PA 1DGJA 2MA9B 2COAA 3HQCA 4IW0A 4EMOA 3ETRA 2ZPNA 2Y3AA 4MT5A 2HJ8A 4KDLB 1MG4A 2G4DB 3NVWA 2N9KA 1FMAD 4D6WA 1YQ4B 3WAMA 1HQRD 1OEYJ 2MH7A 3AE1B 1QF6A 1P5TA 2L7RA 3FM8C 3ODXA 2LUEA 1I42A 2O2VB 2LKOA 2V9HA 1HZ5A 1ZXIA 3KSYA 1X1GA 1KTKA 2NTSA 2ZKMX 1JW9D 4HKZE 3IAM1 2YRYA 3O13A 1OTRB 1T0YA 5HG2A 2Y5CA 2Y5PA 2GBMA 2BT6A 4WJOA 4I6PA 4IDIA 3ZJUA 2PVGC 1T5XD 4P1BC 3D8DA 3N1YC 2FCSA 2XBBC 1KZGA 3I5JC 3V05A 2IGHA 2BYTA 1X11A 2DX1A 3DBHI 2R61A 3JW0X 5CX3A 3U7DA 4LJOB 4JX1C 2DNFA 2G45B 3APCA 2KLGA 4GMVA 3OANA 4LNKA 2GLSA 2N7EA 1P98A 3PTFC 4M0WB 1E0ZA 3P2BA 1LFDA 3GOEA 4N9F4 1FXAA 2QC8A 1SXTA 1BTNA 1FFUA 5C2TB 4E71A 2KJHB 5JXVA 2LXAA 4IOYX 3PSCA 1IGCA 2PW9A 1I4HA 4XGAB 3T3OA 1JQ4A 2KWVB 3KYCD 4HAZB 1K52A 2D3CA 4J3OD 3OAWA 1WGDA 2ONQA 2DAJA 1B9RA 3U7ZA 3JSVB 2DHKA 1WJ6A 4RM8A 2GI9A 3UI3A 3BYYB 3DCGA 3NWDA 3ZNHB 1M94A 2H7DA 1V49A 3Q3FA 3WAOA 2D3GA 1UWMA 3IFWB 4L23A 1HTQA 4BKGA 2CRFA 1JWAD 1XXGA 3P63A 4MACA 2L3ZA 4FLHA 1P3RA 4W9CA 2BYFA 1WXSA 4ASWC 1S3SG 2K6QA 4YSZB 1ZOYB 2JRHA 4JQWC 4YSXB 3VRAB 1SE4A 3U2SC 2GB1A 1XQQA 2ADZA 4NAMA 4M8NA 4YT0B 1K53A 1V61A 1R4MB 3BK1A 3ZJTA 2IYBA 5HI1A 3A33B 4MSMB 3A1QB 2N4FA 2IY1B 2O2VA 4BKTA 2AQ3B 2K00A 1BT0A 2BF8B 3TUOA 3P4SB 1XCGA 2BB5A 1MVKA 2KDBA 2W82A 3MC0B 1EAZA 2LWPA 1P0RA 5IAAC 4MGIE 1LQBA 5CTRC 3HW2B 2J0MA 2CHZA 4HXDA 1JROA 4II3B 4YTNB 3TL5A 2DENB 3QBVB 1RRBA 3V60A 2DYBA 3MTNB 3QJZA 4AWJA 1WM3A 1XO3A 2COCA 1TJ6A 3S2AA 3IXSA 2DZIA 1SHCA 5IKCM 4FBJB 4WQOB 4PK1A 4HDQA 1SF0A 5G5HA 3AI5A 1N61A 4GLSC 2ACZB 4F7ZA 3H9DA 3ZRFA 2BWFA 4RF0A 3V3XA 3W9CB 1JWUD 2R2YA 5J3QA 4JWSC 1UNPA 1C76A 2IO3B 4BOSC 1KRHA 2C7MB 2DZKA 2XN9C 2CJOA 1N3HA 2K9XA 1I7HA 1MKEA 4ZRKA 1FD6A 4RFBA 1ZKHA 2KQ7A 3NY5A 1OQQA 4OZCA 3FILB 1ZPSA 4RMAA 2N9PC 2K39A 3I57A 2FIFA 1JCKB 2XK5A 1NYRA 1X05A 3APDA 2RDGA 4AJYB 2JXXA 4URKA 2CY5A 2CHWA 4TMAB 2KANA 3N3KB 2K2UA 2YSZA 2G1EA 2L0FA 2J7QB 3KUZA 2VKIA 4K2OA 5FR6A 1VRAB 4Z2NA 1WM2A 2JZ3B 1M7EA 1RRPB 2V3PA 5BMHA 3SO6A 3F5RA 4QXAB 5C3JB 2LMCA 4WURA 1WJNA 2KN4A 2TSSA 3PRPB 3UQBA 5H92C 4YSYB 1KI1B 4IM3A 2WXGA 1TY2A 1WJUA 3LYYA 3PPAA 3AM9A 1NVID 3DDCB 1SBBB 4OZAA 3PS6A 5HFYA 3EGRA 1K50A 4WQMA 4W9HA 2RGFA 2DLWA 3DBRB 5CHVC 3DXCA 2QEJC 3TJPA 5D94A 2JQRB 2D9ZA 2LJIA 3HVDA 5HHDG 2KUQA 2KFKA 2PZ1A 1FCCC 4CHMA 1FO4A 4HCPB 4HB2B 4QAYA 4RH6A 2INPE 4PYZA 4HDOA 3DXEA 2JWZA 3N1XC 2N9LA 1YN4A 3MHZA 3QAQA 3W2DA 3N30A 4KGTA 1TT5B 3E56A 1FCLA 1F52A 5C79A 2I38A 4GXBA 2VH1A 2WLBA 2JZPA 3DOWA 1TKGA 1MHHE 4MY6A 5JP4A 2N23A 3CF6E 4EKUA 3QC8B 3RZWC 1S1QB 2DBYA 3KUCB 3Q3MC 2W3RA 1L0YB 5I2SA 5IRSA 5J3YA 2W54A 5JHHA 1PUTA 1VR9A 1WG7A 1DBHA 4HROA 3VTVA 3VAWA 2KWDA 4WSFA 2JYEA 3SEBA 5J2RA 1U5FA 3NZSA 3AEFB 2KQ4X 1Z87A 1RFAA 4WWPA 4BBKA 1T0RC 3FVCA 2LZ6A 1XR0B 2PTLA 3AEAB 3H6NA 1U2BA 1A70A 4XE0A 5G5GA 1ZUD2 1MPEA 2QILA 1XLOA 1ZVRA 1OMWA 4L6EA 2HTHA 3OG5A 4IWOA 3TEWA 2Z13A 4KHAA 3QK0A 2DYQA 2KKCA 2YT2A 3EC8A 4K17A 2W2XD 3KW5B 4QJ5B 1V1PB 3TVVA 2JX5A 3P7ZA 5BO4B 1TTNA 5DPRA 2LULA 1Y56A 4CQNA 1V9JA 3SD5A 1WGHA 2DZJA 4KKJA 1V5PA 4HAWB 2GMIC 4LK0M 3X0WA 2CJNA 3CIRB 3NJTA 4B95A 2KJRA 2KQSA 2VRWB 5DPWA 1E8ZA 3R3MA 3PZ7A 4ICVA 5E6OA 2Z59B 4BBNC 2LGDA 3Q8EA 4HSIA 2R0DA 1YOVB 2GCJA 3AE4B 3DHGC 2BQQA 1I7AA 3SFEB 4GZUA 3ML4A 1E8WA 4TSSA 1MHXA 5G2NA 4KSLC 2DA0A 3AEDB 4MDKE 2ASQA 3R2IA 1RWSA 3PRZA 2RRFA 5FKAC 2LRWA 3QX1A 1M7RA 3TCAA 4ITKA 4ZRJA 2BS4B 3ZNZB 5MPOA 3GZNI 2GJYA 2M1MA 3N32A 3KUDB 4DWFA 2FNJB 4ANXA 1WFYA 3P6AA 1MPHA 4HAYB 4JPSA 3VTUA 2KC1A 3UIPB 3W1YA 1YMHE 2RSUA 2CKHB 5G55A 1HTOA 1LO5D 1P7EA 1Y19B 1KF6B 4W9DA 3ZIMA 5IO9A 1SGHA 2FUG1 3A9KB 1ZP0B 2IZVB 2LRUA 2Q5WD 1L2NA 3SDLC 3CSTA 2BB6A 1I4PA 4EUTA 1UGMA 3AE7B 2VSZA 1YNTE 2WWZA 1FHXA 2UU7A 4A6KA 2ICIA 4MH8A 1IRSA 5CLQB 3AN1A 4ZHPA 2FCQA 2PLPA 2JVCA 4DHJD 2KD0A 1TQZA 1E8YA 1FNUA 4EZJA 3ULCA 2RMMA 2UZRA 2DKPA
chains in the Genus database with same CATH topology
4ZRIA 2IYDB 1ZW7A 2MSED 3VVWB 5JH5C 2N1WA 1OY2A 5KHOA 4CO7A 2C9WB 1JRUA 2CHXA 5DCNA 2ZVOA 1W1DA 4II2B 2LOXA 3IVFA 3PEGA 2ZCBA 3TO1A 1KZ7A 1MIXA 2M38A 4NJ7A 1WR6E 2R09A 2M17A 3VDZA 2YS1A 1I2HA 4KSKC 4AUQC 2NR2A 5C23A 3UZTA 4PS3A 2J59M 3B08A 4ANWA 3QQ8B 2L0TA 2ZPYA 3VH3B 3OLMD 4TQ1A 1U5EA 3PGEA 1XD3B 1U27A 2KX3A 2FIDA 2J0JA 3CIKA 1H8CA 4HB3B 4F7HA 5L81A 3SHQA 3C0RB 4BKSA 1CMXB 4W9FA 4C0AA 1G6JA 2LD9A 3W1SC 2GCLA 1GG3A 3GYPA 3BJIA 5CLLB 1KJTA 2YT0A 4F8CB 1WI0A 3DVGX 3A9KA 1MG8A 2NMBA 2JZZA 2LI5A 4DDGD 1P1AA 1E8XA 1MIZB 3HM3A 2LVOA 1WGYA 5EFXA 1UEFA 3AU4A 4TUUA 2I5CA 1X86A 2MBHA 3PREA 3AULA 4F1SA 2MWNB 4HHVA 3VUYA 2G35A 4I6LB 2GBNA 2EJ8A 2M4NA 3IHPC 1RAXA 2DKQA 3UINB 1YX6B 4WWNA 2J0KA 3I3TB 1U5GA 3G9WA 3Q3JA 2K2JA 1GC6A 1IP9A 2EMSA 2QKMA 3F0WA 1UZXB 3VXWA 4Z2MB 4YL8A 2CR5A 2KWUB 4HAVB 2PE6B 4NSWA 4DHZE 4FJYA 3HIZA 2P8VA 1AWEA 1FHWA 2COFA 2RUKB 1WF9A 1XKEA 3O96A 1NDDA 1D3ZA 5LXHA 2VRRB 1V81A 1TZ1A 4GN1A 3OJ3A 1FGZA 1FOEA 2XK5B 4DHJB 1H10A 3PVUA 2FAZA 2HE7A 2M14A 3TFMA 2NVUI 2RR9A 3BY4B 5DPTA 4XWXA 1A5RA 2G3QB 2MP2A 4NPNA 3A8PA 3V5WA 3DBSA 2WDTB 1WMHA 3W1SA 3ZDTA 3U30A 2RSGA 3LJUX 2D9WA 2D9VA 3PVLA 2BGFA 3H1UA 1R4NI 2DHZA 5GMVA 2Y8GA 1ISNA 1V80A 4LCDE 4NAWA 3KRWA 2KFKB 3A8QA 3VOQA 1K5GB 4JGHB 3QHTA 5AEKB 4K81A 5DHAB 4X57B 5JHBA 2ZZPB 1GNUA 1QQGA 2NS5A 3M1IB 2WYQA 3APFA 3PVWA 4HWIB 2D4QA 2DX5B 2Z0EB 3ZO5B 3UF8A 2NBWB 2O6VA 3AU5A 2M0XA 2AEHA 3PP2A 3DPDA 2EMTA 4IC7B 2IO1B 3NSUA 5FI1A 1FXTB 4TYZA 2A5UA 3RULA 3VIAA 1F9JA 3VTWA 3PRMB 3ODWA 2KWCA 4B6WA 5KCVA 3ZTDA 1WR1A 1ZSQA 2V76A 2DHJA 1KM7A 1P9DU 1EVHA 2HTHB 2PEAA 3ML9A 1BWNA 1L7YA 3ZNGC 4A5KA 5J18A 2KHWB 1Z5SB 4BKSD 4K2PA 4G11A 2RGNB 4KAXB 4B9KA 2KGXB 2EKEC 2UWQA 3SU8X 4HB4B 4BFRA 4GDKB 1C1YB 4H8SA 3B1LX 5HE1A 4BBNF 1U5DA 5D6JB 4Y94A 5LOPB 1UBQA 1IPGA 2MBQA 3RUIB 2MDXA 4W9GA 2N0YA 3PHWB 2KZRA 2DZMA 2C7NB 2L2IA 2G4SA 5D2MB 5FI0A 4ZYNA 5C16A 4DBBA 1K5DB 3RT3B 5DIFB 4WWOA 3RYTA 2D10A 3JYUA 2NPTB 2DX5A 3V6EB 4FA6A 4IM2A 2MFQA 2NCNA 2KN5A 2BYEA 1UBIA 3T8MA 3RCPA 2KFJA 3SUZA 2V1YA 2W9NA 3WA0A 3H7SA 4MELA 3L10B 2L76A 4KHOA 1TBEA 2Q13A 1Y8RC 3A4SC 4W9KA 2EC1A 4WAAA 2MCNB 3SNHA 3QCAA 4NQLB 1WX9A 1E7VA 1J19A 4HAXB 1FAOA 2KNBA 3O65B 1Z2MA 1XX0A 2GBRA 2M8SA 1BAKA 4HVBA 4NJ6A 4MJSA 1W1HA 4MM3A 1P3QU 2P0FA 2YT1A 1UD7A 1J8CA 2LYDA 2KDFB 5KHQA 1WVHA 3H7PB 4GDKA 3ECIA 1SE9A 1WXVA 2B3AA 3PV1A 2KCJA 2BWES 4HATB 3DBLI 1YD8U 3SYXA 4MT7A 2P0DA 1LXDA 4MEMA 3D32A 5HKHA 4HPMB 4TQ0A 3PZDA 3EECA 2NBUA 2PJHA 5D3WA 3D8EA 2CU1A 5C6RA 3GYOA 4GSWA 4A6FA 5D27A 1NBFC 2O6VD 3M63B 3A98B 4F7GA 4DHZB 4KV2A 4P7IA 2K8BA 1WGUA 2NPTA 2Z0OA 2IY0B 4ANVA 1PQSA 4HB0B 3ZNID 3SV1A 4A3PA 2ELBA 4EZLA 4GU2A 4TV3A 4A6HA 1OGWA 3PT2B 1J0WA 1SIFA 2R2QA 5GOWB 4FHJA 4F7UP 4DDID 4LDTD 4TKNA 1WX7A 3ODOA 2RVBB 2N9EB 1Q0WB 2KK8A 3ZDMC 5C1ZA 2MX2A 1AARA 2GBJA 3L0WB 4E74A 1UELA 2N1VA 1FB8A 5D3VA 1UNQA 2I1KA 1WGRA 2GOWA 3UQAA 4K7WA 3V62A 2KO3A 1EO6A 5AZGA 3FEHA 3VUXA 1U4AA 1V5MA 2YVCA 2FCNA 4PQ0A 1PFJA 4PS7A 3R7QA 2BYVE 4J6IA 4EOYA 3CSFA 3H7PA 2KDIA 4DBGA 3PLUA 2X18A 5AZHA 3L08A 4W9IA 3PLVA 1BTKA 2DFKA 2DYMA 3DQVA 3RCZA 2ZEQA 4GDLA 2E2XA 2K1FA 3WAPA 4HLEA 2R2OA 4MK0A 2RPQA 2BKRB 5EDSA 3KRXA 4CHJA 5CHWA 4EFOA 3NZUA 1DDMA 2MP2B 4A3OA 3OJ4B 4DK5A 5JHGA 2OQBA 4AJWA 2DAFA 4XX5A 1WMHB 3K9OB 1PMSA 2D2QA 2LGXA 2JRIB 2NBVB 3WYFB 1PLSA 3IBEA 4NAWB 3HK0A 2Y8FA 1YX5B 2LASA 1YIWA 3KZ1A 4IWPA 2PE9A 2ROZB 5JLJB 3CMMB 1WE6A 1ZC4B 4RM9A 3FSSA 5KQ4A 5E6PA 3VFKA 1WJMA 3NHEB 3KH0A 3QARA 3ZVVA 1WJ1A 4HCNB 4KDIC 3A4RA 1V6EA 2KTRA 2O6VB 3UIOB 3ZTCA 2MLBA 4FJVB 2KUPA 3R7RA 2QKLA 3KYDD 3PSEB 5LXIB 1GC7A 5AZFA 1UH6A 4WJQA 1LM8B 1EF5A 1K8RB 3M95A 1DDVA 4GGQA 1MK7B 4EJNA 3ALBA 4G3XB 4JIOU 1EUVB 4MSQB 3MJWA 2JP2A 3DBRI 2FJLA 4LDTB 5IA7A 2DN6A 4G0NB 1WJ4A 4GB9A 2CY4A 4FULA 1UNRA 2DYNA 3HM6X 2BPSA 5L95C 2L00B 2KTFA 2D9YA 1XT9B 2D07B 1W1GA 2L05A 3WALA 1TGZB 3ENEA 3AXCA 2ZVNA 4MGYE 4M8MA 5HE0A 1MAIA 2KDEB 3TBLD 2XEWA 4ANUA 3LDZE 3QWZB 3D8FA 4ICUA 1Q67A 4GPTB 1NI2A 2K6DB 5J17A 2GS0A 1NTVA 1NU2A 2WX0A 2IBIB 3VQIA 3WIMA 1IYFA 1VCBA 4AOFA 5LONB 1X1FA 2NZ8B 3ZRCA 3CXBB 2ZCCA 5HE3A 3DVNU 2PPHA 1WE7A 5LLIA 2IO0B 4IWQA 3ZLZA 4FHKA 4AP4C 2JUOA 3R66C 2P0HA 4BOZB 4PNKA 2MBBB 3EFUA 2UYZB 1B55A 5DH9B 4KHBB 1GUAB 3V61A 2JPHA 1MK9B 3RZFA 4WJPA 4WJNA 4B6HA 2JY6A 2IO2B 2C60A 3IG3A 3MHSD 1DROA 3BINA 1V2YA 2LVPA 3NOBA 4WVFB 2AYOB 4ZDVA 4KIKB 4DXAB 1KOTA 1UPQA 4IAPA 1YQBA 1WGGA 2D11A 3N7CA 2GBKA 2BCJA 4W9JA 4PYUA 4FN2A 2BKFA 1RLFA 3NS8A 2DYOA 5JZEB 1XD4A 4MJSB 2RLOA 2OOBB 1I35A 1XODA 1WZ3A 4HJKA 2KLCA 3ZKJC 1Y5OA 4CHKA 3JSVA 2CODA 2YF0A 3PHXB 1LB1A 3UGBB 5CHFA 4IFSA 2L1CA 2L8JA 1DYNA 4A20A 2HD5B 2KMCA 2XQNM 3A9JB 2K8CA 3AJ4A 2MBEA 1V5OA 2CAYA 1OQYA 4JL9A 1LW3A 1WRDB 3QA8A 2V3SA 3JVZX 1J0GA 3ONSA 1AQCA 3L17A 4A6FB 1KLVA 2C5LC 4JLCA 2ZJDA 1RJ2A 1V89A 3U8ZA 3A1QA 3T06A 4HPLB 2YLMA 5L83A 5J3TA 1VD2A 1QC6A 4K1RB 1WY8A 3M3JA 3LJ3A 5TR5A 4DX8A 4K7SA 2JT4B 4KVGB 2AL3A 4GIVA 3B0AA 3HHMA 2DHIA 2N9XA 3QWMA 1NTYA 1WIAA 1WZ0A 2QHOA 4KIKA 2K8HA 3T9LA 4D0NB 2LOZA 4IM0A 4OVUA 4XZ4A 4EZKA 1TXDA 1OEYA 5DHFB 4MGKE 5D7GA 3ML8A 2LGYA 2UZSA 2KOXA 2H7EA 4BVUC 2KXJA 3KY9A 2Y7BA 2MKRA 1V5UA 4I6NB 5C5BB 1WGQA 3DXDA 1UPRA 1QZEA 4GOCA 2I5FA 1V86A 1FHOA 4NY0A 2AL6A 4G50A 2KVRA 3DVNV 4MH0E 2MWSB 3K9PB 1GJZA 5HE2A 3L16A 4GDLB 3A9JA 4CYEA 4EEWA 1E5WA 1WXMA 4NNJB 3MPXA 4KZ0A 4XC2A 1E90A 3X23A 2LVQA 2MW5A 4W9LA 1WX8A 5E6NA 3M62B 2FCMA 2MRPA 4W9EA 1H4RA 3VH4B 5D3XA 5D3YA 4FADA 4LJPB 2REXA 2LJ5A 3TIXA 2ROVA 1WXAA 1E7UA 2RNRB 4GMXB 1Q1OA 2V4LA 1EGXA 2AWTA 1WI1A 1WYWB 2KJ6A 2YS3A 2OJRA 1YJ1A 4IG7B 4FJZA 2N7DA 5DPSA 3RD2A 3PG7A 2A4ZA 2D9XA 2WX1A 2ELAA 2MQJA 3VHTC 3ULBA 2FUHB 1U29A 3TW1A 2K25A 3EHVA 2KTRB 4WJ7A 1V88A 3ZW3A 1C3TA 2CS4A 2W2WA 2MBOA 2LXCA 1V5TA 2Z0DB 1EF1A 5DI9B 3QIJA 5C5BA 4HK2A 3MDBC 4E3CA 1WH3A 3DVGY 2ZNVC 3KVFB 2ZNVB 1R4MI 3ZVRA 2RD0A 1FGYA 1HE8A 4DX90 1P6SA 2Y5BB 5JHAA 2LG1A 3L13A 3L54A 1Q5WB 5KQ1A 3VUWA 2Z0QA 4MGZE 2KX0A 1X1MA 2OTXA 3WANA 2JF5A 2KMAA 4K7UA 4HAUB 1DDWA 1ZC3B 4IUMB 1ZM0A 2KC2A 2C7HA 1OQNA 4NQKE 3ZUNA 2YS5A 3TMPB 2IFSA 4KZCA 3V6CB 2DTCA 2UVMA 1ZGUB 4OVVA 4YONA 4PS8A 2W2XC 2I1JA 2Z0PA 2MA9B 2COAA 3HQCA 4IW0A 4EMOA 2ZPNA 2HJ8A 4KDLB 2G4DB 3WAMA 1OEYJ 1P5TA 2L7RA 3FM8C 3ODXA 2LUEA 1I42A 2O2VB 2LKOA 3KSYA 1X1GA 2YRYA 1OTRB 1T0YA 2GBMA 4WJOA 4I6PA 3D8DA 2FCSA 2XBBC 1KZGA 1X11A 2DX1A 3DBHI 3JW0X 5CX3A 3U7DA 4LJOB 2G45B 3APCA 2KLGA 4GMVA 3OANA 4M0WB 2N7EA 1P98A 3PTFC 3P2BA 1LFDA 3GOEA 4N9F4 1BTNA 4E71A 2KJHB 2LXAA 4IOYX 3PSCA 2KWVB 3KYCD 4HAZB 3OAWA 1WGDA 2DAJA 3JSVB 2DHKA 1WJ6A 4RM8A 3DCGA 3ZNHB 1M94A 2H7DA 1V49A 3Q3FA 3WAOA 2D3GA 3IFWB 4BKGA 2CRFA 2L3ZA 4FLHA 1P3RA 4W9CA 2BYFA 1WXSA 4ASWC 1S3SG 2K6QA 2JRHA 4JQWC 1XQQA 2ADZA 4M8NA 1V61A 2IYBA 3A33B 4MSMB 3A1QB 2N4FA 2IY1B 2O2VA 4BKTA 2K00A 1BT0A 2BF8B 1XCGA 2KDBA 1EAZA 2LWPA 1P0RA 5IAAC 4MGIE 1LQBA 5CTRC 3HW2B 2J0MA 2CHZA 4HXDA 4II3B 3TL5A 2DENB 3QBVB 1RRBA 3V60A 2DYBA 3MTNB 3QJZA 4AWJA 1WM3A 2COCA 1TJ6A 3S2AA 2DZIA 1SHCA 4FBJB 4WQOB 4HDQA 3AI5A 4F7ZA 3H9DA 3ZRFA 2BWFA 5J3QA 1UNPA 2IO3B 4BOSC 2C7MB 2DZKA 1N3HA 1MKEA 4ZRKA 1ZKHA 2KQ7A 3NY5A 4RMAA 2N9PC 2K39A 2FIFA 2XK5A 1X05A 3APDA 4AJYB 2JXXA 4URKA 2CY5A 2CHWA 2KANA 3N3KB 2K2UA 2YSZA 2L0FA 2J7QB 3KUZA 2VKIA 4K2OA 5FR6A 4Z2NA 1WM2A 2JZ3B 1M7EA 1RRPB 3SO6A 3F5RA 1WJNA 3PRPB 3UQBA 1KI1B 4IM3A 1WJUA 3PPAA 3DDCB 3PS6A 4W9HA 2RGFA 2DLWA 5CHVC 3DXCA 3TJPA 5D94A 2D9ZA 2KFKA 2PZ1A 4CHMA 4HCPB 4HB2B 4PYZA 4HDOA 3DXEA 2JWZA 3QAQA 3N30A 5C79A 4GXBA 3DOWA 4MY6A 5JP4A 2N23A 3CF6E 4EKUA 3QC8B 3RZWC 1S1QB 3KUCB 5J3YA 5JHHA 1WG7A 1DBHA 3VTVA 3VAWA 4WSFA 5J2RA 1U5FA 3NZSA 1Z87A 1RFAA 4WWPA 4BBKA 2LZ6A 1XR0B 3H6NA 1U2BA 1ZVRA 1OMWA 4L6EA 2HTHA 4IWOA 4KHAA 3QK0A 2DYQA 2KKCA 3EC8A 4K17A 2W2XD 3KW5B 3TVVA 3P7ZA 5BO4B 1TTNA 5DPRA 2LULA 1V9JA 3SD5A 1WGHA 2DZJA 1V5PA 4HAWB 2GMIC 3X0WA 4B95A 2KJRA 2KQSA 2VRWB 5DPWA 1E8ZA 3R3MA 4ICVA 5E6OA 4BBNC 2Z59B 2LGDA 2R0DA 2GCJA 1I7AA 4GZUA 3ML4A 1E8WA 5G2NA 4KSLC 2DA0A 4MDKE 2ASQA 3PRZA 2LRWA 3QX1A 1M7RA 3TCAA 4ZRJA 3ZNZB 3GZNI 2GJYA 2M1MA 3N32A 3KUDB 4DWFA 2FNJB 4ANXA 1WFYA 3P6AA 1MPHA 4HAYB 3VTUA 2KC1A 3UIPB 3W1YA 2RSUA 2CKHB 5G55A 1Y19B 4W9DA 3ZIMA 1SGHA 3A9KB 2IZVB 2LRUA 1L2NA 3SDLC 3CSTA 4EUTA 1UGMA 2VSZA 2WWZA 1FHXA 4A6KA 1IRSA 5CLQB 2FCQA 2JVCA 4DHJD 2KD0A 1TQZA 1E8YA 4EZJA 3ULCA 2UZRA 2DKPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ZRI A;  2IYD B;  1ZW7 A;  2MSE D;  3VVW B;  5JH5 C;  2N1W A;  1OY2 A;  5KHO A;  4CO7 A;  2C9W B;  1JRU A;  2CHX A;  5DCN A;  2ZVO A;  1W1D A;  4II2 B;  2LOX A;  3IVF A;  3PEG A;  2ZCB A;  3TO1 A;  1KZ7 A;  1MIX A;  2M38 A;  4NJ7 A;  1WR6 E;  2R09 A;  2M17 A;  3VDZ A;  2YS1 A;  1I2H A;  4KSK C;  4AUQ C;  2NR2 A;  5C23 A;  3UZT A;  4PS3 A;  2J59 M;  3B08 A;  4ANW A;  3QQ8 B;  2L0T A;  2ZPY A;  3VH3 B;  3OLM D;  4TQ1 A;  1U5E A;  3PGE A;  1XD3 B;  1U27 A;  2KX3 A;  2FID A;  2J0J A;  3CIK A;  1H8C A;  4HB3 B;  4F7H A;  5L81 A;  3SHQ A;  3C0R B;  4BKS A;  1CMX B;  4W9F A;  4C0A A;  1G6J A;  2LD9 A;  3W1S C;  2GCL A;  1GG3 A;  3GYP A;  3BJI A;  5CLL B;  1KJT A;  2YT0 A;  4F8C B;  1WI0 A;  3DVG X;  3A9K A;  1MG8 A;  2NMB A;  2JZZ A;  2LI5 A;  4DDG D;  1P1A A;  1E8X A;  1MIZ B;  3HM3 A;  2LVO A;  1WGY A;  5EFX A;  1UEF A;  3AU4 A;  4TUU A;  2I5C A;  1X86 A;  2MBH A;  3PRE A;  3AUL A;  4F1S A;  2MWN B;  4HHV A;  3VUY A;  2G35 A;  4I6L B;  2GBN A;  2EJ8 A;  2M4N A;  3IHP C;  1RAX A;  2DKQ A;  3UIN B;  1YX6 B;  4WWN A;  2J0K A;  3I3T B;  1U5G A;  3G9W A;  3Q3J A;  2K2J A;  1GC6 A;  1IP9 A;  2EMS A;  2QKM A;  3F0W A;  1UZX B;  3VXW A;  4Z2M B;  4YL8 A;  2CR5 A;  2KWU B;  4HAV B;  2PE6 B;  4NSW A;  4DHZ E;  4FJY A;  3HIZ A;  2P8V A;  1AWE A;  1FHW A;  2COF A;  2RUK B;  1WF9 A;  1XKE A;  3O96 A;  1NDD A;  1D3Z A;  5LXH A;  2VRR B;  1V81 A;  1TZ1 A;  4GN1 A;  3OJ3 A;  1FGZ A;  1FOE A;  2XK5 B;  4DHJ B;  1H10 A;  3PVU A;  2FAZ A;  2HE7 A;  2M14 A;  3TFM A;  2NVU I;  2RR9 A;  3BY4 B;  5DPT A;  4XWX A;  1A5R A;  2G3Q B;  2MP2 A;  4NPN A;  3A8P A;  3V5W A;  3DBS A;  2WDT B;  1WMH A;  3W1S A;  3ZDT A;  3U30 A;  2RSG A;  3LJU X;  2D9W A;  2D9V A;  3PVL A;  2BGF A;  3H1U A;  1R4N I;  2DHZ A;  5GMV A;  2Y8G A;  1ISN A;  1V80 A;  4LCD E;  4NAW A;  3KRW A;  2KFK B;  3A8Q A;  3VOQ A;  1K5G B;  4JGH B;  3QHT A;  5AEK B;  4K81 A;  5DHA B;  4X57 B;  5JHB A;  2ZZP B;  1GNU A;  1QQG A;  2NS5 A;  3M1I B;  2WYQ A;  3APF A;  3PVW A;  4HWI B;  2D4Q A;  2DX5 B;  2Z0E B;  3ZO5 B;  3UF8 A;  2NBW B;  2O6V A;  3AU5 A;  2M0X A;  2AEH A;  3PP2 A;  3DPD A;  2EMT A;  4IC7 B;  2IO1 B;  3NSU A;  5FI1 A;  1FXT B;  4TYZ A;  2A5U A;  3RUL A;  3VIA A;  1F9J A;  3VTW A;  3PRM B;  3ODW A;  2KWC A;  4B6W A;  5KCV A;  3ZTD A;  1WR1 A;  1ZSQ A;  2V76 A;  2DHJ A;  1KM7 A;  1P9D U;  1EVH A;  2HTH B;  2PEA A;  3ML9 A;  1BWN A;  1L7Y A;  3ZNG C;  4A5K A;  5J18 A;  2KHW B;  1Z5S B;  4BKS D;  4K2P A;  4G11 A;  2RGN B;  4KAX B;  4B9K A;  2KGX B;  2EKE C;  2UWQ A;  3SU8 X;  4HB4 B;  4BFR A;  4GDK B;  1C1Y B;  4H8S A;  3B1L X;  5HE1 A;  4BBN F;  1U5D A;  5D6J B;  4Y94 A;  5LOP B;  1UBQ A;  1IPG A;  2MBQ A;  3RUI B;  2MDX A;  4W9G A;  2N0Y A;  3PHW B;  2KZR A;  2DZM A;  2C7N B;  2L2I A;  2G4S A;  5D2M B;  5FI0 A;  4ZYN A;  5C16 A;  4DBB A;  1K5D B;  3RT3 B;  5DIF B;  4WWO A;  3RYT A;  2D10 A;  3JYU A;  2NPT B;  2DX5 A;  3V6E B;  4FA6 A;  4IM2 A;  2MFQ A;  2NCN A;  2KN5 A;  2BYE A;  1UBI A;  3T8M A;  3RCP A;  2KFJ A;  3SUZ A;  2V1Y A;  2W9N A;  3WA0 A;  3H7S A;  4MEL A;  3L10 B;  2L76 A;  4KHO A;  1TBE A;  2Q13 A;  1Y8R C;  3A4S C;  4W9K A;  2EC1 A;  4WAA A;  2MCN B;  3SNH A;  3QCA A;  4NQL B;  1WX9 A;  1E7V A;  1J19 A;  4HAX B;  1FAO A;  2KNB A;  3O65 B;  1Z2M A;  1XX0 A;  2GBR A;  2M8S A;  1BAK A;  4HVB A;  4NJ6 A;  4MJS A;  1W1H A;  4MM3 A;  1P3Q U;  2P0F A;  2YT1 A;  1UD7 A;  1J8C A;  2LYD A;  2KDF B;  5KHQ A;  1WVH A;  3H7P B;  4GDK A;  3ECI A;  1SE9 A;  1WXV A;  2B3A A;  3PV1 A;  2KCJ A;  2BWE S;  4HAT B;  3DBL I;  1YD8 U;  3SYX A;  4MT7 A;  2P0D A;  1LXD A;  4MEM A;  3D32 A;  5HKH A;  4HPM B;  4TQ0 A;  3PZD A;  3EEC A;  2NBU A;  2PJH A;  5D3W A;  3D8E A;  2CU1 A;  5C6R A;  3GYO A;  4GSW A;  4A6F A;  5D27 A;  1NBF C;  2O6V D;  3M63 B;  3A98 B;  4F7G A;  4DHZ B;  4KV2 A;  4P7I A;  2K8B A;  1WGU A;  2NPT A;  2Z0O A;  2IY0 B;  4ANV A;  1PQS A;  4HB0 B;  3ZNI D;  3SV1 A;  4A3P A;  2ELB A;  4EZL A;  4GU2 A;  4TV3 A;  4A6H A;  1OGW A;  3PT2 B;  1J0W A;  1SIF A;  2R2Q A;  5GOW B;  4FHJ A;  4F7U P;  4DDI D;  4LDT D;  4TKN A;  1WX7 A;  3ODO A;  2RVB B;  2N9E B;  1Q0W B;  2KK8 A;  3ZDM C;  5C1Z A;  2MX2 A;  1AAR A;  2GBJ A;  3L0W B;  4E74 A;  1UEL A;  2N1V A;  1FB8 A;  5D3V A;  1UNQ A;  2I1K A;  1WGR A;  2GOW A;  3UQA A;  4K7W A;  3V62 A;  2KO3 A;  1EO6 A;  5AZG A;  3FEH A;  3VUX A;  1U4A A;  1V5M A;  2YVC A;  2FCN A;  4PQ0 A;  1PFJ A;  4PS7 A;  3R7Q A;  2BYV E;  4J6I A;  4EOY A;  3CSF A;  3H7P A;  2KDI A;  4DBG A;  3PLU A;  2X18 A;  5AZH A;  3L08 A;  4W9I A;  3PLV A;  1BTK A;  2DFK A;  2DYM A;  3DQV A;  3RCZ A;  2ZEQ A;  4GDL A;  2E2X A;  2K1F A;  3WAP A;  4HLE A;  2R2O A;  4MK0 A;  2RPQ A;  2BKR B;  5EDS A;  3KRX A;  4CHJ A;  5CHW A;  4EFO A;  3NZU A;  1DDM A;  2MP2 B;  4A3O A;  3OJ4 B;  4DK5 A;  5JHG A;  2OQB A;  4AJW A;  2DAF A;  4XX5 A;  1WMH B;  3K9O B;  1PMS A;  2D2Q A;  2LGX A;  2JRI B;  2NBV B;  3WYF B;  1PLS A;  3IBE A;  4NAW B;  3HK0 A;  2Y8F A;  1YX5 B;  2LAS A;  1YIW A;  3KZ1 A;  4IWP A;  2PE9 A;  2ROZ B;  5JLJ B;  3CMM B;  1WE6 A;  1ZC4 B;  4RM9 A;  3FSS A;  5KQ4 A;  5E6P A;  3VFK A;  1WJM A;  3NHE B;  3KH0 A;  3QAR A;  3ZVV A;  1WJ1 A;  4HCN B;  4KDI C;  3A4R A;  1V6E A;  2KTR A;  2O6V B;  3UIO B;  3ZTC A;  2MLB A;  4FJV B;  2KUP A;  3R7R A;  2QKL A;  3KYD D;  3PSE B;  5LXI B;  1GC7 A;  5AZF A;  1UH6 A;  4WJQ A;  1LM8 B;  1EF5 A;  1K8R B;  3M95 A;  1DDV A;  4GGQ A;  1MK7 B;  4EJN A;  3ALB A;  4G3X B;  4JIO U;  1EUV B;  4MSQ B;  3MJW A;  2JP2 A;  3DBR I;  2FJL A;  4LDT B;  5IA7 A;  2DN6 A;  4G0N B;  1WJ4 A;  4GB9 A;  2CY4 A;  4FUL A;  1UNR A;  2DYN A;  3HM6 X;  2BPS A;  5L95 C;  2L00 B;  2KTF A;  2D9Y A;  1XT9 B;  2D07 B;  1W1G A;  2L05 A;  3WAL A;  1TGZ B;  3ENE A;  3AXC A;  2ZVN A;  4MGY E;  4M8M A;  5HE0 A;  1MAI A;  2KDE B;  3TBL D;  2XEW A;  4ANU A;  3LDZ E;  3QWZ B;  3D8F A;  4ICU A;  1Q67 A;  4GPT B;  1NI2 A;  2K6D B;  5J17 A;  2GS0 A;  1NTV A;  1NU2 A;  2WX0 A;  2IBI B;  3VQI A;  3WIM A;  1IYF A;  1VCB A;  4AOF A;  5LON B;  1X1F A;  2NZ8 B;  3ZRC A;  3CXB B;  2ZCC A;  5HE3 A;  3DVN U;  2PPH A;  1WE7 A;  5LLI A;  2IO0 B;  4IWQ A;  3ZLZ A;  4FHK A;  4AP4 C;  2JUO A;  3R66 C;  2P0H A;  4BOZ B;  4PNK A;  2MBB B;  3EFU A;  2UYZ B;  1B55 A;  5DH9 B;  4KHB B;  1GUA B;  3V61 A;  2JPH A;  1MK9 B;  3RZF A;  4WJP A;  4WJN A;  4B6H A;  2JY6 A;  2IO2 B;  2C60 A;  3IG3 A;  3MHS D;  1DRO A;  3BIN A;  1V2Y A;  2LVP A;  3NOB A;  4WVF B;  2AYO B;  4ZDV A;  4KIK B;  4DXA B;  1KOT A;  1UPQ A;  4IAP A;  1YQB A;  1WGG A;  2D11 A;  3N7C A;  2GBK A;  2BCJ A;  4W9J A;  4PYU A;  4FN2 A;  2BKF A;  1RLF A;  3NS8 A;  2DYO A;  5JZE B;  1XD4 A;  4MJS B;  2RLO A;  2OOB B;  1I35 A;  1XOD A;  1WZ3 A;  4HJK A;  2KLC A;  3ZKJ C;  1Y5O A;  4CHK A;  3JSV A;  2COD A;  2YF0 A;  3PHX B;  1LB1 A;  3UGB B;  5CHF A;  4IFS A;  2L1C A;  2L8J A;  1DYN A;  4A20 A;  2HD5 B;  2KMC A;  2XQN M;  3A9J B;  2K8C A;  3AJ4 A;  2MBE A;  1V5O A;  2CAY A;  1OQY A;  4JL9 A;  1LW3 A;  1WRD B;  3QA8 A;  2V3S A;  3JVZ X;  1J0G A;  3ONS A;  1AQC A;  3L17 A;  4A6F B;  1KLV A;  2C5L C;  4JLC A;  2ZJD A;  1RJ2 A;  1V89 A;  3U8Z A;  3A1Q A;  3T06 A;  4HPL B;  2YLM A;  5L83 A;  5J3T A;  1VD2 A;  1QC6 A;  4K1R B;  1WY8 A;  3M3J A;  3LJ3 A;  5TR5 A;  4DX8 A;  4K7S A;  2JT4 B;  4KVG B;  2AL3 A;  4GIV A;  3B0A A;  3HHM A;  2DHI A;  2N9X A;  3QWM A;  1NTY A;  1WIA A;  1WZ0 A;  2QHO A;  4KIK A;  2K8H A;  3T9L A;  4D0N B;  2LOZ A;  4IM0 A;  4OVU A;  4XZ4 A;  4EZK A;  1TXD A;  1OEY A;  5DHF B;  4MGK E;  5D7G A;  3ML8 A;  2LGY A;  2UZS A;  2KOX A;  2H7E A;  4BVU C;  2KXJ A;  3KY9 A;  2Y7B A;  2MKR A;  1V5U A;  4I6N B;  5C5B B;  1WGQ A;  3DXD A;  1UPR A;  1QZE A;  4GOC A;  2I5F A;  1V86 A;  1FHO A;  4NY0 A;  2AL6 A;  4G50 A;  2KVR A;  3DVN V;  4MH0 E;  2MWS B;  3K9P B;  1GJZ A;  5HE2 A;  3L16 A;  4GDL B;  3A9J A;  4CYE A;  4EEW A;  1E5W A;  1WXM A;  4NNJ B;  3MPX A;  4KZ0 A;  4XC2 A;  1E90 A;  3X23 A;  2LVQ A;  2MW5 A;  4W9L A;  1WX8 A;  5E6N A;  3M62 B;  2FCM A;  2MRP A;  4W9E A;  1H4R A;  3VH4 B;  5D3X A;  5D3Y A;  4FAD A;  4LJP B;  2REX A;  2LJ5 A;  3TIX A;  2ROV A;  1WXA A;  1E7U A;  2RNR B;  4GMX B;  1Q1O A;  2V4L A;  1EGX A;  2AWT A;  1WI1 A;  1WYW B;  2KJ6 A;  2YS3 A;  2OJR A;  1YJ1 A;  4IG7 B;  4FJZ A;  2N7D A;  5DPS A;  3RD2 A;  3PG7 A;  2A4Z A;  2D9X A;  2WX1 A;  2ELA A;  2MQJ A;  3VHT C;  3ULB A;  2FUH B;  1U29 A;  3TW1 A;  2K25 A;  3EHV A;  2KTR B;  4WJ7 A;  1V88 A;  3ZW3 A;  1C3T A;  2CS4 A;  2W2W A;  2MBO A;  2LXC A;  1V5T A;  2Z0D B;  1EF1 A;  5DI9 B;  3QIJ A;  5C5B A;  4HK2 A;  3MDB C;  4E3C A;  1WH3 A;  3DVG Y;  2ZNV C;  3KVF B;  2ZNV B;  1R4M I;  3ZVR A;  2RD0 A;  1FGY A;  1HE8 A;  4DX9 0;  1P6S A;  2Y5B B;  5JHA A;  2LG1 A;  3L13 A;  3L54 A;  1Q5W B;  5KQ1 A;  3VUW A;  2Z0Q A;  4MGZ E;  2KX0 A;  1X1M A;  2OTX A;  3WAN A;  2JF5 A;  2KMA A;  4K7U A;  4HAU B;  1DDW A;  1ZC3 B;  4IUM B;  1ZM0 A;  2KC2 A;  2C7H A;  1OQN A;  4NQK E;  3ZUN A;  2YS5 A;  3TMP B;  2IFS A;  4KZC A;  3V6C B;  2DTC A;  2UVM A;  1ZGU B;  4OVV A;  4YON A;  4PS8 A;  2W2X C;  2I1J A;  2Z0P A;  2MA9 B;  2COA A;  3HQC A;  4IW0 A;  4EMO A;  2ZPN A;  2HJ8 A;  4KDL B;  2G4D B;  3WAM A;  1OEY J;  1P5T A;  2L7R A;  3FM8 C;  3ODX A;  2LUE A;  1I42 A;  2O2V B;  2LKO A;  3KSY A;  1X1G A;  2YRY A;  1OTR B;  1T0Y A;  2GBM A;  4WJO A;  4I6P A;  3D8D A;  2FCS A;  2XBB C;  1KZG A;  1X11 A;  2DX1 A;  3DBH I;  3JW0 X;  5CX3 A;  3U7D A;  4LJO B;  2G45 B;  3APC A;  2KLG A;  4GMV A;  3OAN A;  4M0W B;  2N7E A;  1P98 A;  3PTF C;  3P2B A;  1LFD A;  3GOE A;  4N9F 4;  1BTN A;  4E71 A;  2KJH B;  2LXA A;  4IOY X;  3PSC A;  2KWV B;  3KYC D;  4HAZ B;  3OAW A;  1WGD A;  2DAJ A;  3JSV B;  2DHK A;  1WJ6 A;  4RM8 A;  3DCG A;  3ZNH B;  1M94 A;  2H7D A;  1V49 A;  3Q3F A;  3WAO A;  2D3G A;  3IFW B;  4BKG A;  2CRF A;  2L3Z A;  4FLH A;  1P3R A;  4W9C A;  2BYF A;  1WXS A;  4ASW C;  1S3S G;  2K6Q A;  2JRH A;  4JQW C;  1XQQ A;  2ADZ A;  4M8N A;  1V61 A;  2IYB A;  3A33 B;  4MSM B;  3A1Q B;  2N4F A;  2IY1 B;  2O2V A;  4BKT A;  2K00 A;  1BT0 A;  2BF8 B;  1XCG A;  2KDB A;  1EAZ A;  2LWP A;  1P0R A;  5IAA C;  4MGI E;  1LQB A;  5CTR C;  3HW2 B;  2J0M A;  2CHZ A;  4HXD A;  4II3 B;  3TL5 A;  2DEN B;  3QBV B;  1RRB A;  3V60 A;  2DYB A;  3MTN B;  3QJZ A;  4AWJ A;  1WM3 A;  2COC A;  1TJ6 A;  3S2A A;  2DZI A;  1SHC A;  4FBJ B;  4WQO B;  4HDQ A;  3AI5 A;  4F7Z A;  3H9D A;  3ZRF A;  2BWF A;  5J3Q A;  1UNP A;  2IO3 B;  4BOS C;  2C7M B;  2DZK A;  1N3H A;  1MKE A;  4ZRK A;  1ZKH A;  2KQ7 A;  3NY5 A;  4RMA A;  2N9P C;  2K39 A;  2FIF A;  2XK5 A;  1X05 A;  3APD A;  4AJY B;  2JXX A;  4URK A;  2CY5 A;  2CHW A;  2KAN A;  3N3K B;  2K2U A;  2YSZ A;  2L0F A;  2J7Q B;  3KUZ A;  2VKI A;  4K2O A;  5FR6 A;  4Z2N A;  1WM2 A;  2JZ3 B;  1M7E A;  1RRP B;  3SO6 A;  3F5R A;  1WJN A;  3PRP B;  3UQB A;  1KI1 B;  4IM3 A;  1WJU A;  3PPA A;  3DDC B;  3PS6 A;  4W9H A;  2RGF A;  2DLW A;  5CHV C;  3DXC A;  3TJP A;  5D94 A;  2D9Z A;  2KFK A;  2PZ1 A;  4CHM A;  4HCP B;  4HB2 B;  4PYZ A;  4HDO A;  3DXE A;  2JWZ A;  3QAQ A;  3N30 A;  5C79 A;  4GXB A;  3DOW A;  4MY6 A;  5JP4 A;  2N23 A;  3CF6 E;  4EKU A;  3QC8 B;  3RZW C;  1S1Q B;  3KUC B;  5J3Y A;  5JHH A;  1WG7 A;  1DBH A;  3VTV A;  3VAW A;  4WSF A;  5J2R A;  1U5F A;  3NZS A;  1Z87 A;  1RFA A;  4WWP A;  4BBK A;  2LZ6 A;  1XR0 B;  3H6N A;  1U2B A;  1ZVR A;  1OMW A;  4L6E A;  2HTH A;  4IWO A;  4KHA A;  3QK0 A;  2DYQ A;  2KKC A;  3EC8 A;  4K17 A;  2W2X D;  3KW5 B;  3TVV A;  3P7Z A;  5BO4 B;  1TTN A;  5DPR A;  2LUL A;  1V9J A;  3SD5 A;  1WGH A;  2DZJ A;  1V5P A;  4HAW B;  2GMI C;  3X0W A;  4B95 A;  2KJR A;  2KQS A;  2VRW B;  5DPW A;  1E8Z A;  3R3M A;  4ICV A;  5E6O A;  4BBN C;  2Z59 B;  2LGD A;  2R0D A;  2GCJ A;  1I7A A;  4GZU A;  3ML4 A;  1E8W A;  5G2N A;  4KSL C;  2DA0 A;  4MDK E;  2ASQ A;  3PRZ A;  2LRW A;  3QX1 A;  1M7R A;  3TCA A;  4ZRJ A;  3ZNZ B;  3GZN I;  2GJY A;  2M1M A;  3N32 A;  3KUD B;  4DWF A;  2FNJ B;  4ANX A;  1WFY A;  3P6A A;  1MPH A;  4HAY B;  3VTU A;  2KC1 A;  3UIP B;  3W1Y A;  2RSU A;  2CKH B;  5G55 A;  1Y19 B;  4W9D A;  3ZIM A;  1SGH A;  3A9K B;  2IZV B;  2LRU A;  1L2N A;  3SDL C;  3CST A;  4EUT A;  1UGM A;  2VSZ A;  2WWZ A;  1FHX A;  4A6K A;  1IRS A;  5CLQ B;  2FCQ A;  2JVC A;  4DHJ D;  2KD0 A;  1TQZ A;  1E8Y A;  4EZJ A;  3ULC A;  2UZR A;  2DKP A; 
#chains in the Genus database with same CATH topology
 4ZRI A;  2WDQ B;  1QOB A;  1C4A A;  2IYD B;  2IGG A;  1ZW7 A;  2MSE D;  3VVW B;  1AYF A;  5JH5 C;  4C7Y A;  1QQR A;  2N1W A;  2ZW0 A;  1OY2 A;  3ABV B;  4RNA A;  5KHO A;  3CWI A;  4CO7 A;  2C9W B;  1JRU A;  2CHX A;  5DCN A;  2ZVO A;  1W1D A;  4II2 B;  4N58 A;  2VZK D;  4ZHO A;  1VZ8 A;  1J7C A;  2LOX A;  3IVF A;  3PEG A;  2J53 A;  3C8Y A;  1XLP A;  2ZCB A;  3TO1 A;  1KZ7 A;  1QOA A;  4WAF A;  1V1P A;  1MIX A;  2M38 A;  4NJ7 A;  3GE3 C;  1WR6 E;  5D3I B;  4PT5 A;  2R09 A;  2M17 A;  3VDZ A;  5BMI A;  1I4Q A;  2YS1 A;  2EKI A;  3Q3N C;  1I2H A;  4KSK C;  4AUQ C;  2NR2 A;  1ZE3 D;  5C23 A;  2QDF A;  3UZT A;  4B0M A;  2Z59 A;  2OJW A;  2H88 B;  4PS3 A;  2J59 M;  3B08 A;  4ANW A;  3QQ8 B;  2L0T A;  2GRI A;  1TKE A;  2ZPY A;  3VH3 B;  3OLM D;  3Q14 C;  4TQ1 A;  5H8Y E;  1U5E A;  3PGE A;  1XD3 B;  2LGS A;  1U27 A;  2KX3 A;  2FID A;  2WQY B;  2WXN A;  2J0J A;  3CIK A;  1H8C A;  1ZYI A;  4HB3 B;  3U12 A;  4F7H A;  1UUP A;  2LUM A;  5L81 A;  3SHQ A;  3C0R B;  4BKS A;  1CMX B;  4W9F A;  4ZRQ A;  4C0A A;  1G6J A;  2LD9 A;  3W1S C;  2GCL A;  1GG3 A;  1ZXH A;  3R8B A;  3RN9 C;  3GYP A;  3BJI A;  3TEY A;  5CLL B;  1KJT A;  2YT0 A;  4F8C B;  1WI0 A;  1TYG B;  3DVG X;  3A9K A;  5I4D A;  1MG8 A;  2NMB A;  2JZZ A;  2LI5 A;  4DDG D;  1P1A A;  1E8X A;  1MIZ B;  3HM3 A;  2LVO A;  1WGY A;  5EFX A;  3NVY A;  1UEF A;  3AU4 A;  3MJ5 A;  4TUU A;  1IGD A;  2I5C A;  2N0S B;  1X86 A;  2MBH A;  3DWM A;  3TSS A;  1PGX A;  4GNK B;  3PRE A;  3AUL A;  4F1S A;  1RFK A;  2MWN B;  3A58 A;  4HHV A;  3VUY A;  2G35 A;  4HEA 1;  4I6L B;  3NVZ A;  2GBN A;  2EJ8 A;  2M4N A;  1TS5 A;  1HA5 A;  3Q2A C;  3IHP C;  4AQ7 A;  5BYQ A;  1EU3 A;  1RAX A;  1ROE A;  2J52 A;  2DKQ A;  3UIN B;  1YX6 B;  4WWN A;  2J4X A;  1FNV A;  3RNF C;  2J0K A;  3I3T B;  1U5G A;  3G9W A;  3Q3J A;  2K2J A;  1GC6 A;  1IP9 A;  5IN7 A;  2EMS A;  2QKM A;  3F0W A;  1FRR A;  1UZX B;  1XEE A;  4Z2M B;  3VXW A;  4YL8 A;  2CR5 A;  2KWU B;  4HAV B;  2PE6 B;  4NSW A;  4DHZ E;  4FJY A;  2JU6 X;  3HIZ A;  2P8V A;  1AWE A;  4HPP A;  4FXC A;  1FHW A;  2COF A;  4N6E B;  2RUK B;  3AE5 B;  2WDR B;  4DQO C;  1L4Z B;  2RDB C;  1WF9 A;  3IT6 B;  1XKE A;  1CK1 A;  5FR3 A;  3O96 A;  2XNA C;  1NDD A;  1D3Z A;  1SEB D;  5LXH A;  2VRR B;  2PVO D;  1V81 A;  3VRB B;  4US9 A;  1TZ1 A;  4GN1 A;  3OJ3 A;  1FGZ A;  1FOE A;  3ZJV A;  4ZRP A;  2XK5 B;  3VR8 B;  4DHJ B;  3AEC B;  4LNI A;  1H10 A;  3PVU A;  2RDH A;  2FAZ A;  2WXL A;  2HE7 A;  2M14 A;  3FKY A;  3MP9 A;  3FC4 A;  1AN8 A;  3TFM A;  2NVU I;  1JRP A;  2RR9 A;  3BY4 B;  4XYC A;  5DPT A;  4XWX A;  3TEX A;  2W3S A;  1A5R A;  2G3Q B;  1XCQ L;  2MP2 A;  4NPN A;  2VZK B;  3SR6 A;  4IOI E;  3A8P A;  2LGI A;  1GPX A;  2Z4D A;  3V5W A;  1C78 A;  3DBS A;  2WDT B;  4QJ3 B;  2MJD A;  1WMH A;  3W1S A;  3ZDT A;  4OSN A;  4JWU C;  3U30 A;  2RSG A;  1D4B A;  3B2G A;  3LJU X;  2D9W A;  2D9V A;  3PVL A;  2BGF A;  2NBV A;  3H1U A;  3Q8F A;  1R4N I;  2DHZ A;  5GMV A;  2Y8G A;  1QOF A;  1ISN A;  1V80 A;  3DHH C;  2LHE A;  4LCD E;  4NAW A;  3KRW A;  2KFK B;  3A8Q A;  3VOQ A;  1K5G B;  3LB8 C;  4JGH B;  3QHT A;  2IDY A;  5AEK B;  4K81 A;  5DHA B;  2JWU A;  3BII D;  4X57 B;  4C56 C;  5JHB A;  2ZZP B;  1GNU A;  1QQG A;  2NS5 A;  2V4I B;  3M1I B;  2WYQ A;  3APF A;  3PVW A;  2W55 A;  4HWI B;  1VLB A;  2D4Q A;  2DX5 B;  2Z0E B;  3ZO5 B;  3UF8 A;  4US8 A;  2NBW B;  2O6V A;  3AU5 A;  3EUB 2;  2M0X A;  1KFY B;  2AEH A;  4LNN A;  3PP2 A;  3DPD A;  2EMT A;  2IND C;  4IC7 B;  2IO1 B;  2KT7 A;  3NSU A;  3H8H A;  5FI1 A;  1FXT B;  3GS2 A;  4S0R A;  4TYZ A;  2A5U A;  3RUL A;  3VIA A;  1PFD A;  4RCO A;  1F9J A;  1VDV A;  3VTW A;  1R7S A;  3PRM B;  2G9H D;  3ODW A;  3BYT B;  2KWC A;  1ZDX A;  1F2R I;  4B6W A;  5KCV A;  3ZTD A;  1WR1 A;  3URY A;  1ZSQ A;  2V76 A;  2DHJ A;  1KM7 A;  1P9D U;  1EVH A;  2HTH B;  1YJI A;  2PEA A;  3AEE B;  3ZXV A;  4RGM A;  3ML9 A;  1BWN A;  1L7Y A;  1J7A A;  3ZNG C;  1NEN B;  2WXF A;  4A5K A;  5J18 A;  2KHW B;  2PIA A;  2CU3 A;  1Z5S B;  4BKS D;  4K2P A;  4G11 A;  2RGN B;  1JWB D;  4KAX B;  5EE3 A;  4B9K A;  1V97 A;  2KGX B;  2EKE C;  2UWQ A;  3SU8 X;  4HB4 B;  3RNA C;  2WHI A;  4BFR A;  4GDK B;  2IGD A;  3BK2 A;  1C1Y B;  4H8S A;  3B1L X;  5EE1 A;  5HE1 A;  1WGK A;  1WSP A;  2WU2 B;  2KVZ A;  4BBN F;  1U5D A;  5D6J B;  4Y94 A;  1C77 A;  1L0X B;  5LOP B;  1UBQ A;  1V1O A;  1IPG A;  2MBQ A;  3DBH B;  3RUI B;  1YN5 A;  2MDX A;  1N6Z A;  4W9G A;  2N0Y A;  1STE A;  3PHW B;  2KZR A;  3N1Z C;  3Q3O C;  4HRS A;  1MFW A;  2DZM A;  1TJE A;  2C7N B;  2L2I A;  1BUI C;  1PYW D;  4C80 A;  4C7Z A;  2G4S A;  5D2M B;  5FI0 A;  2WXI A;  2L83 A;  1F1H A;  2K49 A;  4ZYN A;  5C16 A;  4DBB A;  1K5D B;  3RT3 B;  2AX5 A;  5DIF B;  4WWO A;  4H2A A;  3RYT A;  2D10 A;  1T3Q A;  3JYU A;  1I4G A;  2NPT B;  2DX5 A;  3V6E B;  1MI1 A;  4FA6 A;  4IM2 A;  2MFQ A;  2NCN A;  2KN5 A;  2BYE A;  1UBI A;  3T8M A;  3RCP A;  1D5Z C;  2KFJ A;  3SUZ A;  2V1Y A;  4KHB A;  3BWU D;  2W9N A;  3WA0 A;  3H7S A;  1YJJ A;  2H89 B;  4MEL A;  2IJ0 A;  3L10 B;  2L76 A;  1TZO A;  3I63 C;  4KHO A;  2K0P A;  1TBE A;  2YEP F;  2Q13 A;  1Y8R C;  3E9S A;  3A4S C;  1RYJ A;  2EC1 A;  4W9K A;  2E6X A;  3PO0 A;  4WAA A;  4BZA A;  1HEZ E;  2MCN B;  3SNH A;  3QCA A;  4NQL B;  4A9A A;  1WX9 A;  5BYS A;  1E7V A;  4LNF A;  1J19 A;  4HAX B;  1FAO A;  4HJG E;  5IOI A;  2KNB A;  3VR9 B;  2NTT A;  3O65 B;  2B76 B;  1Z2M A;  3BVZ A;  1XX0 A;  2GBR A;  2M8S A;  1BAK A;  4HVB A;  1EWY C;  4NJ6 A;  3HIE A;  2LEK A;  4MJS A;  4C4V A;  1W1H A;  4MM3 A;  1P3Q U;  2P0F A;  2YT1 A;  1ET9 A;  1UD7 A;  1J8C A;  2LYD A;  2QCZ A;  1M4V A;  3C19 A;  2KDF B;  5LNK 1;  5KHQ A;  1WVH A;  3H7P B;  4GDK A;  3ECI A;  1SE9 A;  1WXV A;  3BVM A;  2B3A A;  3PV1 A;  2KCJ A;  2BWE S;  1C9F A;  4HAT B;  3DBL I;  1YD8 U;  3SYX A;  4MT7 A;  2P0D A;  1LXD A;  4DXG A;  4MEM A;  4YWG G;  3U4E G;  3D32 A;  1I4R A;  3L4P A;  5HKH A;  3B77 A;  1ACC A;  4HPM B;  4TQ0 A;  2DWQ A;  3PZD A;  3EEC A;  2NBU A;  2PJH A;  4D2K A;  5D3W A;  3D8E A;  4P16 A;  2CU1 A;  5C6R A;  3BZD B;  3GYO A;  2OHF A;  4GSW A;  4OT1 A;  4A6F A;  2K22 A;  5D27 A;  1F2R C;  1NBF C;  1Q10 A;  3A98 B;  4F7G A;  1N60 A;  2O6V D;  3M63 B;  4DHZ B;  4KV2 A;  4P7I A;  1E9M A;  2K8B A;  3MC8 A;  1T6B X;  1WGU A;  2NPT A;  1E6E B;  2BVC A;  4OVZ A;  1DOI A;  3ZQ4 A;  2Z0O A;  2IY0 B;  4ANV A;  1PQS A;  4HB0 B;  4UDU C;  3Q6B A;  3SV1 A;  3ZNI D;  2KMM A;  4A3P A;  2ELB A;  3BVG A;  3B2F A;  3EA6 A;  4EZL A;  4GU2 A;  4TV3 A;  4A6H A;  1OGW A;  3PT2 B;  3OWE B;  1J0W A;  1SIF A;  2R2Q A;  2D3A A;  1MJD A;  4REZ A;  5GOW B;  1JAL A;  2WS3 B;  4FHJ A;  4F7U P;  4DDI D;  3NWF A;  4K3C A;  4LDT D;  4TKN A;  2YEP B;  1C79 A;  1WX7 A;  3ODO A;  1SE3 A;  2RVB B;  4P6V F;  2N9E B;  1Q0W B;  3RNG C;  2KK8 A;  2WXO A;  3ZDM C;  5C1Z A;  3OHM B;  2MX2 A;  1AAR A;  2GBJ A;  3L0W B;  2FBW B;  4E74 A;  1UEL A;  2N1V A;  1FB8 A;  5D3V A;  3AH7 A;  1UNQ A;  2QJL A;  3RI7 C;  2I1K A;  2WNM A;  1WGR A;  2GOW A;  2AQ2 B;  1E7P B;  3UQA A;  4K7W A;  3V62 A;  1D6E C;  2KO3 A;  4L2Y A;  1EO6 A;  4YTP B;  3KLS X;  4LTU A;  5AZG A;  3FEH A;  4BAX A;  3VUX A;  1IBX A;  4QJ4 B;  1U4A A;  1V5M A;  2YVC A;  1ET6 A;  1RM6 C;  1OFF A;  5EE0 A;  2FCN A;  1CQV A;  4PQ0 A;  2HTM E;  3MFG A;  1PFJ A;  4PS7 A;  1FEH A;  3R7Q A;  2BYV E;  4J6I A;  4EOY A;  2BTE A;  2HDE A;  3CSF A;  1I4X A;  1EWC A;  1L4D B;  3H7P A;  1MI0 A;  4M00 A;  2KDI A;  4DBG A;  3PLU A;  2X18 A;  1TS3 A;  5AZH A;  1YN3 A;  3L08 A;  1T0S C;  1BXT A;  4W9I A;  3PLV A;  1SE2 A;  1BTK A;  2DFK A;  2V0G A;  2DYM A;  3DQV A;  3RCZ A;  5IP4 D;  2ZEQ A;  1OQR A;  4GDL A;  1WYG A;  2E2X A;  2K1F A;  1GB1 A;  2WDV B;  3MC9 A;  3WAP A;  4HLE A;  2R2O A;  4EE2 A;  4MK0 A;  2RPQ A;  2HJ1 A;  2BKR B;  4WH4 A;  1UWX A;  3KRX A;  5EDS A;  1F0Z A;  1QOG A;  4CHJ A;  5CHW A;  4EFO A;  1KLU D;  4XWW A;  2X38 A;  1NYQ A;  3WCQ A;  3P4P B;  3NZU A;  1DDM A;  1T0Q C;  1D5M C;  2MP2 B;  4A3O A;  3Q8B A;  3HSA A;  1PGA A;  3OJ4 B;  4N59 A;  4DK5 A;  5JHG A;  3RNC C;  3AMZ A;  1VJK A;  1YQ3 B;  2OQB A;  4AJW A;  2DAF A;  4XX5 A;  1WMH B;  2ZW1 A;  3FAH A;  3K9O B;  1PMS A;  1PGB A;  2D2Q A;  2KR0 A;  2LGX A;  2JRI B;  4OHJ A;  2NBV B;  3RPF C;  3WYF B;  1PLS A;  3IBE A;  2WU5 B;  3AEG B;  4NAW B;  3HK0 A;  2Y8F A;  1YX5 B;  2WXJ A;  2LAS A;  2WXM A;  1YIW A;  1XLQ A;  3KZ1 A;  4IWP A;  2PE9 A;  2ROZ B;  5JLJ B;  3CMM B;  2D5G A;  1WE6 A;  1ZC4 B;  4RM9 A;  3DBL B;  2JXT A;  1D5X C;  1GB4 A;  1XLN A;  2LHD A;  3FSS A;  3DHI C;  5KQ4 A;  3AV8 A;  4L1B A;  4B0E A;  5E6P A;  3VFK A;  1WJM A;  3NHE B;  3KH0 A;  3QAR A;  2Z14 A;  3ZVV A;  1WJ1 A;  4HCN B;  4KDI C;  3A4R A;  2LFI A;  1V6E A;  2KTR A;  3W5V B;  2O6V B;  1TIF A;  3UIO B;  3ZTC A;  2MLB A;  4FJV B;  4C00 A;  2KUP A;  3R7R A;  2QKL A;  3KYD D;  3PSE B;  4OZB A;  3TEZ A;  5LXI B;  2BS2 B;  3I9V 1;  3RNE C;  4GOU A;  1GC7 A;  2V3N A;  5AZF A;  1UH6 A;  4WJQ A;  1AW7 A;  1BML C;  1LM8 B;  1EF5 A;  4XDD A;  1K8R B;  3M95 A;  1DDV A;  2L32 A;  4GGQ A;  3GZN B;  1MK7 B;  4EJN A;  3ALB A;  4G3X B;  4JIO U;  1EUV B;  2IPK D;  3DCX A;  2WXK A;  4MSQ B;  3MJW A;  2JP2 A;  3DBR I;  2FJL A;  2M0A A;  2I2Y A;  2WGS A;  4LDT B;  5D3D A;  5IA7 A;  1VZ7 A;  3RFZ B;  2DN6 A;  4G0N B;  2BBC A;  1UGJ A;  2K8E A;  1WJ4 A;  4GB9 A;  2CY4 A;  4FUL A;  1UNR A;  1QT9 A;  2DYN A;  3HM6 X;  2BPS A;  5L95 C;  2X8X X;  2L00 B;  2KTF A;  2D9Y A;  1V8C A;  2SEB D;  1XT9 B;  2D07 B;  3Q69 A;  2AQ1 B;  1W1G A;  2L05 A;  1SJE D;  1GOZ A;  1ENF A;  3WAL A;  1N63 A;  1TGZ B;  3ENE A;  3ZXR A;  3GB1 A;  3AXC A;  2ZVN A;  4MGY E;  4M8M A;  1PDX A;  5HE0 A;  1MAI A;  4OW0 A;  2KDE B;  3TBL D;  2XEW A;  4ANU A;  3LDZ E;  3P4R B;  3QWZ B;  3D8F A;  4ICU A;  1Q67 A;  4GPT B;  4ACF A;  3GP7 A;  1NI2 A;  2K6D B;  5J17 A;  2GS0 A;  2KDM A;  1NTV A;  1NU2 A;  2WX0 A;  3GE8 C;  2IBI B;  4LNO A;  3VQI A;  3WIM A;  2INC C;  1VCB A;  1J7B A;  4AOF A;  1IYF A;  4KKI A;  5LON B;  1X1F A;  1VZ6 A;  2QSD A;  2NZ8 B;  3ZRC A;  1TS2 A;  3CXB B;  1UF0 A;  3NW8 A;  2ZCC A;  1N5X A;  5HE3 A;  3DVN U;  2PPH A;  1WE7 A;  1KLG D;  1SJH D;  1TS4 A;  5LLI A;  2GUM A;  2IO0 B;  1ESF A;  4IWQ A;  3ZLZ A;  4FHK A;  2PMV A;  4AP4 C;  2JUO A;  2EEL A;  4WWM A;  3R66 C;  1FFV A;  1KH0 A;  2P0H A;  1K51 A;  4BOZ B;  3EFC A;  4PNK A;  3N9Y C;  2MBB B;  3EFU A;  2UYZ B;  1B55 A;  5DH9 B;  2JYT A;  1N5W A;  4KHB B;  1GUA B;  3V61 A;  2JPH A;  1LGR A;  1WWT A;  1CZP A;  1MK9 B;  5I2M A;  3RZF A;  4WJP A;  3KWL A;  1JWS D;  4WJN A;  2FE8 A;  4B6H A;  2JY6 A;  4O1N A;  2IO2 B;  2C60 A;  3IG3 A;  3MHS D;  1DRO A;  3BIN A;  1V2Y A;  2LVP A;  3NOB A;  1DOY A;  4WVF B;  1UNS A;  2AYO B;  4ZDV A;  4KIK B;  1QKZ A;  4DXA B;  3NS1 A;  4S17 A;  1KOT A;  4XWT A;  4M01 A;  1UPQ A;  4IAP A;  1YQB A;  2J42 A;  1WGG A;  4M0W A;  2D11 A;  3Q8C A;  3N7C A;  2GBK A;  2BCJ A;  4W9J A;  4PYU A;  4FN2 A;  2BKF A;  1EM7 A;  1RLF A;  3NS8 A;  1FM0 D;  1FNW A;  3P1M A;  1GAQ B;  1SB3 C;  2DYO A;  5JZE B;  1XD4 A;  3AE9 B;  4MJS B;  2RLO A;  4C4V B;  4MM3 B;  2OOB B;  1I35 A;  4ZOH C;  1XOD A;  1WZ3 A;  4HJK A;  2KLC A;  2M19 A;  3ZGZ A;  3ZKJ C;  1Y5O A;  4CHK A;  2MJE A;  4RGT A;  3JSV A;  2COD A;  2YF0 A;  1FIQ A;  3PHX B;  1LB1 A;  3UGB B;  4LLG M;  5CHF A;  4IFS A;  2L1C A;  2L8J A;  2RPV A;  1DYN A;  1L5P A;  4A20 A;  2HD5 B;  2KMC A;  3AE3 B;  4RF1 A;  2XQN M;  2MEK A;  3A9J B;  2K8C A;  5AUK A;  5AUI A;  1DOX A;  3AJ4 A;  4A8X C;  1TKY A;  2MBE A;  1V5O A;  2CAY A;  1AWD A;  1OQY A;  4JL9 A;  2KYW A;  1LW3 A;  1WRD B;  3QA8 A;  2V3S A;  3JVZ X;  1J0G A;  3R2T A;  3ONS A;  1AQC A;  3L17 A;  4P1C C;  3J9C A;  4A6F B;  4USA A;  2WP9 B;  3IAS 1;  1KLV A;  2C5L C;  4JLC A;  2ZJD A;  1RJ2 A;  1V89 A;  3U8Z A;  1HXY D;  3A1Q A;  3T06 A;  1IUE A;  4HPL B;  2YLM A;  5L83 A;  5J3T A;  4IKG A;  4JE3 B;  4RGN A;  1VD2 A;  1QC6 A;  4K1R B;  1WY8 A;  3M3J A;  4Q2J A;  1L0V B;  3LJ3 A;  5TR5 A;  3NWA A;  4DX8 A;  1TY0 A;  4HKQ A;  3NRZ A;  4K7S A;  3Q8A A;  4ARI A;  4XDC A;  4AS1 A;  2JT4 B;  4KVG B;  2AL3 A;  4GIV A;  3B0A A;  5BYR A;  3NVV A;  3KWV A;  3HHM A;  2DHI A;  1T77 A;  2BW2 A;  2N9X A;  3QWM A;  1NTY A;  1CJE A;  3P42 A;  1WIA A;  1WZ0 A;  3LXF A;  2QHO A;  4KIK A;  2KIG A;  2K8H A;  2PKO A;  3HRD D;  3T9L A;  4D0N B;  2LOZ A;  3AE2 B;  1FRD A;  4IM0 A;  4OVU A;  4XZ4 A;  5E6J A;  4L1R A;  4KGR A;  4EZK A;  1FXI A;  5FK9 C;  1TXD A;  1XCT L;  1R4N B;  3AE8 B;  1OEY A;  4DXF A;  5DHF B;  4MGK E;  4A55 A;  2WXH A;  5D7G A;  1P7F A;  3ML8 A;  2LGY A;  4K3B A;  5BMG A;  1IBX B;  3FIL A;  2UZS A;  1EU4 A;  2KOX A;  2H7E A;  4BVU C;  2KXJ A;  1L6U A;  3KY9 A;  2QIE B;  2Y7B A;  2MKR A;  1V5U A;  4I6N B;  5C5B B;  1WGQ A;  3DXD A;  1UPR A;  1QZE A;  4GOC A;  2I5F A;  1V86 A;  4CSQ A;  1L6V A;  3T3N A;  1FHO A;  4NY0 A;  2AL6 A;  4G50 A;  2KVR A;  3DVN V;  4WIP A;  4MH0 E;  2MWS B;  3K9P B;  2E3T A;  4ZYS A;  4KGS A;  2D3B A;  1GJZ A;  5HE2 A;  3NZ3 A;  3L16 A;  3KQ4 A;  4GDL B;  2KIE A;  2K3U A;  3A9J A;  4CYE A;  4EEW A;  3AEB B;  5T8I A;  1E5W A;  1WXM A;  4NNJ B;  3MPX A;  3SFD B;  3RMK C;  1JWM D;  4KZ0 A;  3RNB C;  3U52 E;  4XC2 A;  1E90 A;  3X23 A;  2N7J A;  2LVQ A;  2MW5 A;  4W9L A;  1WX8 A;  5E6N A;  2OED A;  3M62 B;  2FCM A;  2MRP A;  4W9E A;  1H4R A;  3VH4 B;  5D3X A;  5D3Y A;  4FAD A;  3NG0 A;  4LJP B;  3AE6 B;  2REX A;  2LJ5 A;  5EE9 A;  3TIX A;  2ROV A;  1WXA A;  2VH2 A;  1E7U A;  2RNR B;  4NZL B;  4GMX B;  1Q1O A;  3W5U B;  4YXD B;  2V4L A;  2KAJ A;  1EGX A;  2AWT A;  1WI1 A;  3HUI A;  1WYW B;  2INN E;  2KJ6 A;  1NI3 A;  2YS3 A;  1SSN A;  2OJR A;  4YTM B;  1YJ1 A;  2L1A A;  4IG7 B;  1WXQ A;  4FJZ A;  4A90 A;  2N7D A;  5DPS A;  3RD2 A;  1WRI A;  1FPY A;  3PG7 A;  2A4Z A;  1DYQ A;  2D9X A;  2WX1 A;  3PZ8 A;  1F77 A;  2ELA A;  2MQJ A;  3VHT C;  1NEK B;  3IT4 B;  3ULB A;  2FUH B;  1U29 A;  2DLB A;  3B9J A;  1XF5 L;  2MJ3 A;  3TW1 A;  2K25 A;  3EHV A;  2KTR B;  4WJ7 A;  2WXQ A;  1V88 A;  2NMQ A;  1SIJ A;  1ZDV A;  2BS3 B;  3ZW3 A;  1C3T A;  4DIX A;  3AB5 A;  2CS4 A;  2WXR A;  2W2W A;  2MBO A;  2LXC A;  1V5T A;  2Z0D B;  1EF1 A;  5DI9 B;  1JML A;  3QIJ A;  5C5B A;  4HK2 A;  3MDB C;  2MHJ A;  4E3C A;  1WH3 A;  3DVG Y;  5LG4 B;  1QLB B;  5GXG B;  2ZNV C;  3KVF B;  2ZNV B;  1R4M I;  3ZVR A;  2RD0 A;  1FGY A;  1C4P A;  2M56 B;  1HE8 A;  4DX9 0;  1P6S A;  2Y5B B;  4RGO S;  5JHA A;  4M02 A;  2K5P A;  2LG1 A;  2L52 A;  3L13 A;  2QMT A;  3L54 A;  1C4C A;  1Q5W B;  5KQ1 A;  4R3D A;  3VUW A;  2Z0Q A;  1QIL A;  3NUH B;  4MGZ E;  2KX0 A;  1X1M A;  1N62 A;  1HZ6 A;  2OTX A;  2SAK A;  3WAN A;  2FJU B;  3P4Q B;  2JF5 A;  2KMA A;  3DWG C;  2JSV X;  4K7U A;  2KAC A;  2WXP A;  4KX6 B;  4HAU B;  5TSS A;  1DDW A;  1ZC3 B;  4IUM B;  1ZM0 A;  2KC2 A;  1B1Z A;  2C7H A;  1E10 A;  1OQN A;  4NQK E;  3ZUN A;  2YS5 A;  3TMP B;  2IFS A;  4KZC A;  3V6C B;  3ZYY X;  2DTC A;  3N20 C;  2UVM A;  4A6Q A;  1ZGU B;  4OVV A;  2ON8 A;  4YON A;  4ARC A;  5M4Y B;  4PS8 A;  2W2X C;  4NJC A;  3HVZ A;  2Z8L A;  2I1J A;  2Z0P A;  1DGJ A;  2MA9 B;  2COA A;  3HQC A;  4IW0 A;  4EMO A;  3ETR A;  2ZPN A;  2Y3A A;  4MT5 A;  2HJ8 A;  4KDL B;  1MG4 A;  2G4D B;  3NVW A;  2N9K A;  1FMA D;  4D6W A;  1YQ4 B;  3WAM A;  1HQR D;  1OEY J;  2MH7 A;  3AE1 B;  1QF6 A;  1P5T A;  2L7R A;  3FM8 C;  3ODX A;  2LUE A;  1I42 A;  2O2V B;  2LKO A;  2V9H A;  1HZ5 A;  1ZXI A;  3KSY A;  1X1G A;  1KTK A;  2NTS A;  2ZKM X;  1JW9 D;  4HKZ E;  3IAM 1;  2YRY A;  3O13 A;  1OTR B;  1T0Y A;  5HG2 A;  2Y5C A;  2Y5P A;  2GBM A;  2BT6 A;  4WJO A;  4I6P A;  4IDI A;  3ZJU A;  2PVG C;  1T5X D;  4P1B C;  3D8D A;  3N1Y C;  2FCS A;  2XBB C;  1KZG A;  3I5J C;  3V05 A;  2IGH A;  2BYT A;  1X11 A;  2DX1 A;  3DBH I;  2R61 A;  3JW0 X;  5CX3 A;  3U7D A;  4LJO B;  4JX1 C;  2DNF A;  2G45 B;  3APC A;  2KLG A;  4GMV A;  3OAN A;  4LNK A;  2GLS A;  2N7E A;  1P98 A;  3PTF C;  4M0W B;  1E0Z A;  3P2B A;  1LFD A;  3GOE A;  4N9F 4;  1FXA A;  2QC8 A;  1SXT A;  1BTN A;  1FFU A;  5C2T B;  4E71 A;  2KJH B;  5JXV A;  2LXA A;  4IOY X;  3PSC A;  1IGC A;  2PW9 A;  1I4H A;  4XGA B;  3T3O A;  1JQ4 A;  2KWV B;  3KYC D;  4HAZ B;  1K52 A;  2D3C A;  4J3O D;  3OAW A;  1WGD A;  2ONQ A;  2DAJ A;  1B9R A;  3U7Z A;  3JSV B;  2DHK A;  1WJ6 A;  4RM8 A;  2GI9 A;  3UI3 A;  3BYY B;  3DCG A;  3NWD A;  3ZNH B;  1M94 A;  2H7D A;  1V49 A;  3Q3F A;  3WAO A;  2D3G A;  1UWM A;  3IFW B;  4L23 A;  1HTQ A;  4BKG A;  2CRF A;  1JWA D;  1XXG A;  3P63 A;  4MAC A;  2L3Z A;  4FLH A;  1P3R A;  4W9C A;  2BYF A;  1WXS A;  4ASW C;  1S3S G;  2K6Q A;  4YSZ B;  1ZOY B;  2JRH A;  4JQW C;  4YSX B;  3VRA B;  1SE4 A;  3U2S C;  2GB1 A;  1XQQ A;  2ADZ A;  4NAM A;  4M8N A;  4YT0 B;  1K53 A;  1V61 A;  1R4M B;  3BK1 A;  3ZJT A;  2IYB A;  5HI1 A;  3A33 B;  4MSM B;  3A1Q B;  2N4F A;  2IY1 B;  2O2V A;  4BKT A;  2AQ3 B;  2K00 A;  1BT0 A;  2BF8 B;  3TUO A;  3P4S B;  1XCG A;  2BB5 A;  1MVK A;  2KDB A;  2W82 A;  3MC0 B;  1EAZ A;  2LWP A;  1P0R A;  5IAA C;  4MGI E;  1LQB A;  5CTR C;  3HW2 B;  2J0M A;  2CHZ A;  4HXD A;  1JRO A;  4II3 B;  4YTN B;  3TL5 A;  2DEN B;  3QBV B;  1RRB A;  3V60 A;  2DYB A;  3MTN B;  3QJZ A;  4AWJ A;  1WM3 A;  1XO3 A;  2COC A;  1TJ6 A;  3S2A A;  3IXS A;  2DZI A;  1SHC A;  5IKC M;  4FBJ B;  4WQO B;  4PK1 A;  4HDQ A;  1SF0 A;  5G5H A;  3AI5 A;  1N61 A;  4GLS C;  2ACZ B;  4F7Z A;  3H9D A;  3ZRF A;  2BWF A;  4RF0 A;  3V3X A;  3W9C B;  1JWU D;  2R2Y A;  5J3Q A;  4JWS C;  1UNP A;  1C76 A;  2IO3 B;  4BOS C;  1KRH A;  2C7M B;  2DZK A;  2XN9 C;  2CJO A;  1N3H A;  2K9X A;  1I7H A;  1MKE A;  4ZRK A;  1FD6 A;  4RFB A;  1ZKH A;  2KQ7 A;  3NY5 A;  1OQQ A;  4OZC A;  3FIL B;  1ZPS A;  4RMA A;  2N9P C;  2K39 A;  3I57 A;  2FIF A;  1JCK B;  2XK5 A;  1NYR A;  1X05 A;  3APD A;  2RDG A;  4AJY B;  2JXX A;  4URK A;  2CY5 A;  2CHW A;  4TMA B;  2KAN A;  3N3K B;  2K2U A;  2YSZ A;  2G1E A;  2L0F A;  2J7Q B;  3KUZ A;  2VKI A;  4K2O A;  5FR6 A;  1VRA B;  4Z2N A;  1WM2 A;  2JZ3 B;  1M7E A;  1RRP B;  2V3P A;  5BMH A;  3SO6 A;  3F5R A;  4QXA B;  5C3J B;  2LMC A;  4WUR A;  1WJN A;  2KN4 A;  2TSS A;  3PRP B;  3UQB A;  5H92 C;  4YSY B;  1KI1 B;  4IM3 A;  2WXG A;  1TY2 A;  1WJU A;  3LYY A;  3PPA A;  3AM9 A;  1NVI D;  3DDC B;  1SBB B;  4OZA A;  3PS6 A;  5HFY A;  3EGR A;  1K50 A;  4WQM A;  4W9H A;  2RGF A;  2DLW A;  3DBR B;  5CHV C;  3DXC A;  2QEJ C;  3TJP A;  5D94 A;  2JQR B;  2D9Z A;  2LJI A;  3HVD A;  5HHD G;  2KUQ A;  2KFK A;  2PZ1 A;  1FCC C;  4CHM A;  1FO4 A;  4HCP B;  4HB2 B;  4QAY A;  4RH6 A;  2INP E;  4PYZ A;  4HDO A;  3DXE A;  2JWZ A;  3N1X C;  2N9L A;  1YN4 A;  3MHZ A;  3QAQ A;  3W2D A;  3N30 A;  4KGT A;  1TT5 B;  3E56 A;  1FCL A;  1F52 A;  5C79 A;  2I38 A;  4GXB A;  2VH1 A;  2WLB A;  2JZP A;  3DOW A;  1TKG A;  1MHH E;  4MY6 A;  5JP4 A;  2N23 A;  3CF6 E;  4EKU A;  3QC8 B;  3RZW C;  1S1Q B;  2DBY A;  3KUC B;  3Q3M C;  2W3R A;  1L0Y B;  5I2S A;  5IRS A;  5J3Y A;  2W54 A;  5JHH A;  1PUT A;  1VR9 A;  1WG7 A;  1DBH A;  4HRO A;  3VTV A;  3VAW A;  2KWD A;  4WSF A;  2JYE A;  3SEB A;  5J2R A;  1U5F A;  3NZS A;  3AEF B;  2KQ4 X;  1Z87 A;  1RFA A;  4WWP A;  4BBK A;  1T0R C;  3FVC A;  2LZ6 A;  1XR0 B;  2PTL A;  3AEA B;  3H6N A;  1U2B A;  1A70 A;  4XE0 A;  5G5G A;  1ZUD 2;  1MPE A;  2QIL A;  1XLO A;  1ZVR A;  1OMW A;  4L6E A;  2HTH A;  3OG5 A;  4IWO A;  3TEW A;  2Z13 A;  4KHA A;  3QK0 A;  2DYQ A;  2KKC A;  2YT2 A;  3EC8 A;  4K17 A;  2W2X D;  3KW5 B;  4QJ5 B;  1V1P B;  3TVV A;  2JX5 A;  3P7Z A;  5BO4 B;  1TTN A;  5DPR A;  2LUL A;  1Y56 A;  4CQN A;  1V9J A;  3SD5 A;  1WGH A;  2DZJ A;  4KKJ A;  1V5P A;  4HAW B;  2GMI C;  4LK0 M;  3X0W A;  2CJN A;  3CIR B;  3NJT A;  4B95 A;  2KJR A;  2KQS A;  2VRW B;  5DPW A;  1E8Z A;  3R3M A;  3PZ7 A;  4ICV A;  5E6O A;  2Z59 B;  4BBN C;  2LGD A;  3Q8E A;  4HSI A;  2R0D A;  1YOV B;  2GCJ A;  3AE4 B;  3DHG C;  2BQQ A;  1I7A A;  3SFE B;  4GZU A;  3ML4 A;  1E8W A;  4TSS A;  1MHX A;  5G2N A;  4KSL C;  2DA0 A;  3AED B;  4MDK E;  2ASQ A;  3R2I A;  1RWS A;  3PRZ A;  2RRF A;  5FKA C;  2LRW A;  3QX1 A;  1M7R A;  3TCA A;  4ITK A;  4ZRJ A;  2BS4 B;  3ZNZ B;  5MPO A;  3GZN I;  2GJY A;  2M1M A;  3N32 A;  3KUD B;  4DWF A;  2FNJ B;  4ANX A;  1WFY A;  3P6A A;  1MPH A;  4HAY B;  4JPS A;  3VTU A;  2KC1 A;  3UIP B;  3W1Y A;  1YMH E;  2RSU A;  2CKH B;  5G55 A;  1HTO A;  1LO5 D;  1P7E A;  1Y19 B;  1KF6 B;  4W9D A;  3ZIM A;  5IO9 A;  1SGH A;  2FUG 1;  3A9K B;  1ZP0 B;  2IZV B;  2LRU A;  2Q5W D;  1L2N A;  3SDL C;  3CST A;  2BB6 A;  1I4P A;  4EUT A;  1UGM A;  3AE7 B;  2VSZ A;  1YNT E;  2WWZ A;  1FHX A;  2UU7 A;  4A6K A;  2ICI A;  4MH8 A;  1IRS A;  5CLQ B;  3AN1 A;  4ZHP A;  2FCQ A;  2PLP A;  2JVC A;  4DHJ D;  2KD0 A;  1TQZ A;  1E8Y A;  1FNU A;  4EZJ A;  3ULC A;  2RMM A;  2UZR A;  2DKP A; 
#chains in the Genus database with same CATH homology
 4ZRI A;  2IYD B;  1ZW7 A;  2MSE D;  3VVW B;  5JH5 C;  2N1W A;  1OY2 A;  5KHO A;  4CO7 A;  2C9W B;  1JRU A;  2CHX A;  5DCN A;  2ZVO A;  1W1D A;  4II2 B;  2LOX A;  3IVF A;  3PEG A;  2ZCB A;  3TO1 A;  1KZ7 A;  1MIX A;  2M38 A;  4NJ7 A;  1WR6 E;  2R09 A;  2M17 A;  3VDZ A;  2YS1 A;  1I2H A;  4KSK C;  4AUQ C;  2NR2 A;  5C23 A;  3UZT A;  4PS3 A;  2J59 M;  3B08 A;  4ANW A;  3QQ8 B;  2L0T A;  2ZPY A;  3VH3 B;  3OLM D;  4TQ1 A;  1U5E A;  3PGE A;  1XD3 B;  1U27 A;  2KX3 A;  2FID A;  2J0J A;  3CIK A;  1H8C A;  4HB3 B;  4F7H A;  5L81 A;  3SHQ A;  3C0R B;  4BKS A;  1CMX B;  4W9F A;  4C0A A;  1G6J A;  2LD9 A;  3W1S C;  2GCL A;  1GG3 A;  3GYP A;  3BJI A;  5CLL B;  1KJT A;  2YT0 A;  4F8C B;  1WI0 A;  3DVG X;  3A9K A;  1MG8 A;  2NMB A;  2JZZ A;  2LI5 A;  4DDG D;  1P1A A;  1E8X A;  1MIZ B;  3HM3 A;  2LVO A;  1WGY A;  5EFX A;  1UEF A;  3AU4 A;  4TUU A;  2I5C A;  1X86 A;  2MBH A;  3PRE A;  3AUL A;  4F1S A;  2MWN B;  4HHV A;  3VUY A;  2G35 A;  4I6L B;  2GBN A;  2EJ8 A;  2M4N A;  3IHP C;  1RAX A;  2DKQ A;  3UIN B;  1YX6 B;  4WWN A;  2J0K A;  3I3T B;  1U5G A;  3G9W A;  3Q3J A;  2K2J A;  1GC6 A;  1IP9 A;  2EMS A;  2QKM A;  3F0W A;  1UZX B;  3VXW A;  4Z2M B;  4YL8 A;  2CR5 A;  2KWU B;  4HAV B;  2PE6 B;  4NSW A;  4DHZ E;  4FJY A;  3HIZ A;  2P8V A;  1AWE A;  1FHW A;  2COF A;  2RUK B;  1WF9 A;  1XKE A;  3O96 A;  1NDD A;  1D3Z A;  5LXH A;  2VRR B;  1V81 A;  1TZ1 A;  4GN1 A;  3OJ3 A;  1FGZ A;  1FOE A;  2XK5 B;  4DHJ B;  1H10 A;  3PVU A;  2FAZ A;  2HE7 A;  2M14 A;  3TFM A;  2NVU I;  2RR9 A;  3BY4 B;  5DPT A;  4XWX A;  1A5R A;  2G3Q B;  2MP2 A;  4NPN A;  3A8P A;  3V5W A;  3DBS A;  2WDT B;  1WMH A;  3W1S A;  3ZDT A;  3U30 A;  2RSG A;  3LJU X;  2D9W A;  2D9V A;  3PVL A;  2BGF A;  3H1U A;  1R4N I;  2DHZ A;  5GMV A;  2Y8G A;  1ISN A;  1V80 A;  4LCD E;  4NAW A;  3KRW A;  2KFK B;  3A8Q A;  3VOQ A;  1K5G B;  4JGH B;  3QHT A;  5AEK B;  4K81 A;  5DHA B;  4X57 B;  5JHB A;  2ZZP B;  1GNU A;  1QQG A;  2NS5 A;  3M1I B;  2WYQ A;  3APF A;  3PVW A;  4HWI B;  2D4Q A;  2DX5 B;  2Z0E B;  3ZO5 B;  3UF8 A;  2NBW B;  2O6V A;  3AU5 A;  2M0X A;  2AEH A;  3PP2 A;  3DPD A;  2EMT A;  4IC7 B;  2IO1 B;  3NSU A;  5FI1 A;  1FXT B;  4TYZ A;  2A5U A;  3RUL A;  3VIA A;  1F9J A;  3VTW A;  3PRM B;  3ODW A;  2KWC A;  4B6W A;  5KCV A;  3ZTD A;  1WR1 A;  1ZSQ A;  2V76 A;  2DHJ A;  1KM7 A;  1P9D U;  1EVH A;  2HTH B;  2PEA A;  3ML9 A;  1BWN A;  1L7Y A;  3ZNG C;  4A5K A;  5J18 A;  2KHW B;  1Z5S B;  4BKS D;  4K2P A;  4G11 A;  2RGN B;  4KAX B;  4B9K A;  2KGX B;  2EKE C;  2UWQ A;  3SU8 X;  4HB4 B;  4BFR A;  4GDK B;  1C1Y B;  4H8S A;  3B1L X;  5HE1 A;  4BBN F;  1U5D A;  5D6J B;  4Y94 A;  5LOP B;  1UBQ A;  1IPG A;  2MBQ A;  3RUI B;  2MDX A;  4W9G A;  2N0Y A;  3PHW B;  2KZR A;  2DZM A;  2C7N B;  2L2I A;  2G4S A;  5D2M B;  5FI0 A;  4ZYN A;  5C16 A;  4DBB A;  1K5D B;  3RT3 B;  5DIF B;  4WWO A;  3RYT A;  2D10 A;  3JYU A;  2NPT B;  2DX5 A;  3V6E B;  4FA6 A;  4IM2 A;  2MFQ A;  2NCN A;  2KN5 A;  2BYE A;  1UBI A;  3T8M A;  3RCP A;  2KFJ A;  3SUZ A;  2V1Y A;  2W9N A;  3WA0 A;  3H7S A;  4MEL A;  3L10 B;  2L76 A;  4KHO A;  1TBE A;  2Q13 A;  1Y8R C;  3A4S C;  4W9K A;  2EC1 A;  4WAA A;  2MCN B;  3SNH A;  3QCA A;  4NQL B;  1WX9 A;  1E7V A;  1J19 A;  4HAX B;  1FAO A;  2KNB A;  3O65 B;  1Z2M A;  1XX0 A;  2GBR A;  2M8S A;  1BAK A;  4HVB A;  4NJ6 A;  4MJS A;  1W1H A;  4MM3 A;  1P3Q U;  2P0F A;  2YT1 A;  1UD7 A;  1J8C A;  2LYD A;  2KDF B;  5KHQ A;  1WVH A;  3H7P B;  4GDK A;  3ECI A;  1SE9 A;  1WXV A;  2B3A A;  3PV1 A;  2KCJ A;  2BWE S;  4HAT B;  3DBL I;  1YD8 U;  3SYX A;  4MT7 A;  2P0D A;  1LXD A;  4MEM A;  3D32 A;  5HKH A;  4HPM B;  4TQ0 A;  3PZD A;  3EEC A;  2NBU A;  2PJH A;  5D3W A;  3D8E A;  2CU1 A;  5C6R A;  3GYO A;  4GSW A;  4A6F A;  5D27 A;  1NBF C;  2O6V D;  3M63 B;  3A98 B;  4F7G A;  4DHZ B;  4KV2 A;  4P7I A;  2K8B A;  1WGU A;  2NPT A;  2Z0O A;  2IY0 B;  4ANV A;  1PQS A;  4HB0 B;  3ZNI D;  3SV1 A;  4A3P A;  2ELB A;  4EZL A;  4GU2 A;  4TV3 A;  4A6H A;  1OGW A;  3PT2 B;  1J0W A;  1SIF A;  2R2Q A;  5GOW B;  4FHJ A;  4F7U P;  4DDI D;  4LDT D;  4TKN A;  1WX7 A;  3ODO A;  2RVB B;  2N9E B;  1Q0W B;  2KK8 A;  3ZDM C;  5C1Z A;  2MX2 A;  1AAR A;  2GBJ A;  3L0W B;  4E74 A;  1UEL A;  2N1V A;  1FB8 A;  5D3V A;  1UNQ A;  2I1K A;  1WGR A;  2GOW A;  3UQA A;  4K7W A;  3V62 A;  2KO3 A;  1EO6 A;  5AZG A;  3FEH A;  3VUX A;  1U4A A;  1V5M A;  2YVC A;  2FCN A;  4PQ0 A;  1PFJ A;  4PS7 A;  3R7Q A;  2BYV E;  4J6I A;  4EOY A;  3CSF A;  3H7P A;  2KDI A;  4DBG A;  3PLU A;  2X18 A;  5AZH A;  3L08 A;  4W9I A;  3PLV A;  1BTK A;  2DFK A;  2DYM A;  3DQV A;  3RCZ A;  2ZEQ A;  4GDL A;  2E2X A;  2K1F A;  3WAP A;  4HLE A;  2R2O A;  4MK0 A;  2RPQ A;  2BKR B;  5EDS A;  3KRX A;  4CHJ A;  5CHW A;  4EFO A;  3NZU A;  1DDM A;  2MP2 B;  4A3O A;  3OJ4 B;  4DK5 A;  5JHG A;  2OQB A;  4AJW A;  2DAF A;  4XX5 A;  1WMH B;  3K9O B;  1PMS A;  2D2Q A;  2LGX A;  2JRI B;  2NBV B;  3WYF B;  1PLS A;  3IBE A;  4NAW B;  3HK0 A;  2Y8F A;  1YX5 B;  2LAS A;  1YIW A;  3KZ1 A;  4IWP A;  2PE9 A;  2ROZ B;  5JLJ B;  3CMM B;  1WE6 A;  1ZC4 B;  4RM9 A;  3FSS A;  5KQ4 A;  5E6P A;  3VFK A;  1WJM A;  3NHE B;  3KH0 A;  3QAR A;  3ZVV A;  1WJ1 A;  4HCN B;  4KDI C;  3A4R A;  1V6E A;  2KTR A;  2O6V B;  3UIO B;  3ZTC A;  2MLB A;  4FJV B;  2KUP A;  3R7R A;  2QKL A;  3KYD D;  3PSE B;  5LXI B;  1GC7 A;  5AZF A;  1UH6 A;  4WJQ A;  1LM8 B;  1EF5 A;  1K8R B;  3M95 A;  1DDV A;  4GGQ A;  1MK7 B;  4EJN A;  3ALB A;  4G3X B;  4JIO U;  1EUV B;  4MSQ B;  3MJW A;  2JP2 A;  3DBR I;  2FJL A;  4LDT B;  5IA7 A;  2DN6 A;  4G0N B;  1WJ4 A;  4GB9 A;  2CY4 A;  4FUL A;  1UNR A;  2DYN A;  3HM6 X;  2BPS A;  5L95 C;  2L00 B;  2KTF A;  2D9Y A;  1XT9 B;  2D07 B;  1W1G A;  2L05 A;  3WAL A;  1TGZ B;  3ENE A;  3AXC A;  2ZVN A;  4MGY E;  4M8M A;  5HE0 A;  1MAI A;  2KDE B;  3TBL D;  2XEW A;  4ANU A;  3LDZ E;  3QWZ B;  3D8F A;  4ICU A;  1Q67 A;  4GPT B;  1NI2 A;  2K6D B;  5J17 A;  2GS0 A;  1NTV A;  1NU2 A;  2WX0 A;  2IBI B;  3VQI A;  3WIM A;  1IYF A;  1VCB A;  4AOF A;  5LON B;  1X1F A;  2NZ8 B;  3ZRC A;  3CXB B;  2ZCC A;  5HE3 A;  3DVN U;  2PPH A;  1WE7 A;  5LLI A;  2IO0 B;  4IWQ A;  3ZLZ A;  4FHK A;  4AP4 C;  2JUO A;  3R66 C;  2P0H A;  4BOZ B;  4PNK A;  2MBB B;  3EFU A;  2UYZ B;  1B55 A;  5DH9 B;  4KHB B;  1GUA B;  3V61 A;  2JPH A;  1MK9 B;  3RZF A;  4WJP A;  4WJN A;  4B6H A;  2JY6 A;  2IO2 B;  2C60 A;  3IG3 A;  3MHS D;  1DRO A;  3BIN A;  1V2Y A;  2LVP A;  3NOB A;  4WVF B;  2AYO B;  4ZDV A;  4KIK B;  4DXA B;  1KOT A;  1UPQ A;  4IAP A;  1YQB A;  1WGG A;  2D11 A;  3N7C A;  2GBK A;  2BCJ A;  4W9J A;  4PYU A;  4FN2 A;  2BKF A;  1RLF A;  3NS8 A;  2DYO A;  5JZE B;  1XD4 A;  4MJS B;  2RLO A;  2OOB B;  1I35 A;  1XOD A;  1WZ3 A;  4HJK A;  2KLC A;  3ZKJ C;  1Y5O A;  4CHK A;  3JSV A;  2COD A;  2YF0 A;  3PHX B;  1LB1 A;  3UGB B;  5CHF A;  4IFS A;  2L1C A;  2L8J A;  1DYN A;  4A20 A;  2HD5 B;  2KMC A;  2XQN M;  3A9J B;  2K8C A;  3AJ4 A;  2MBE A;  1V5O A;  2CAY A;  1OQY A;  4JL9 A;  1LW3 A;  1WRD B;  3QA8 A;  2V3S A;  3JVZ X;  1J0G A;  3ONS A;  1AQC A;  3L17 A;  4A6F B;  1KLV A;  2C5L C;  4JLC A;  2ZJD A;  1RJ2 A;  1V89 A;  3U8Z A;  3A1Q A;  3T06 A;  4HPL B;  2YLM A;  5L83 A;  5J3T A;  1VD2 A;  1QC6 A;  4K1R B;  1WY8 A;  3M3J A;  3LJ3 A;  5TR5 A;  4DX8 A;  4K7S A;  2JT4 B;  4KVG B;  2AL3 A;  4GIV A;  3B0A A;  3HHM A;  2DHI A;  2N9X A;  3QWM A;  1NTY A;  1WIA A;  1WZ0 A;  2QHO A;  4KIK A;  2K8H A;  3T9L A;  4D0N B;  2LOZ A;  4IM0 A;  4OVU A;  4XZ4 A;  4EZK A;  1TXD A;  1OEY A;  5DHF B;  4MGK E;  5D7G A;  3ML8 A;  2LGY A;  2UZS A;  2KOX A;  2H7E A;  4BVU C;  2KXJ A;  3KY9 A;  2Y7B A;  2MKR A;  1V5U A;  4I6N B;  5C5B B;  1WGQ A;  3DXD A;  1UPR A;  1QZE A;  4GOC A;  2I5F A;  1V86 A;  1FHO A;  4NY0 A;  2AL6 A;  4G50 A;  2KVR A;  3DVN V;  4MH0 E;  2MWS B;  3K9P B;  1GJZ A;  5HE2 A;  3L16 A;  4GDL B;  3A9J A;  4CYE A;  4EEW A;  1E5W A;  1WXM A;  4NNJ B;  3MPX A;  4KZ0 A;  4XC2 A;  1E90 A;  3X23 A;  2LVQ A;  2MW5 A;  4W9L A;  1WX8 A;  5E6N A;  3M62 B;  2FCM A;  2MRP A;  4W9E A;  1H4R A;  3VH4 B;  5D3X A;  5D3Y A;  4FAD A;  4LJP B;  2REX A;  2LJ5 A;  3TIX A;  2ROV A;  1WXA A;  1E7U A;  2RNR B;  4GMX B;  1Q1O A;  2V4L A;  1EGX A;  2AWT A;  1WI1 A;  1WYW B;  2KJ6 A;  2YS3 A;  2OJR A;  1YJ1 A;  4IG7 B;  4FJZ A;  2N7D A;  5DPS A;  3RD2 A;  3PG7 A;  2A4Z A;  2D9X A;  2WX1 A;  2ELA A;  2MQJ A;  3VHT C;  3ULB A;  2FUH B;  1U29 A;  3TW1 A;  2K25 A;  3EHV A;  2KTR B;  4WJ7 A;  1V88 A;  3ZW3 A;  1C3T A;  2CS4 A;  2W2W A;  2MBO A;  2LXC A;  1V5T A;  2Z0D B;  1EF1 A;  5DI9 B;  3QIJ A;  5C5B A;  4HK2 A;  3MDB C;  4E3C A;  1WH3 A;  3DVG Y;  2ZNV C;  3KVF B;  2ZNV B;  1R4M I;  3ZVR A;  2RD0 A;  1FGY A;  1HE8 A;  4DX9 0;  1P6S A;  2Y5B B;  5JHA A;  2LG1 A;  3L13 A;  3L54 A;  1Q5W B;  5KQ1 A;  3VUW A;  2Z0Q A;  4MGZ E;  2KX0 A;  1X1M A;  2OTX A;  3WAN A;  2JF5 A;  2KMA A;  4K7U A;  4HAU B;  1DDW A;  1ZC3 B;  4IUM B;  1ZM0 A;  2KC2 A;  2C7H A;  1OQN A;  4NQK E;  3ZUN A;  2YS5 A;  3TMP B;  2IFS A;  4KZC A;  3V6C B;  2DTC A;  2UVM A;  1ZGU B;  4OVV A;  4YON A;  4PS8 A;  2W2X C;  2I1J A;  2Z0P A;  2MA9 B;  2COA A;  3HQC A;  4IW0 A;  4EMO A;  2ZPN A;  2HJ8 A;  4KDL B;  2G4D B;  3WAM A;  1OEY J;  1P5T A;  2L7R A;  3FM8 C;  3ODX A;  2LUE A;  1I42 A;  2O2V B;  2LKO A;  3KSY A;  1X1G A;  2YRY A;  1OTR B;  1T0Y A;  2GBM A;  4WJO A;  4I6P A;  3D8D A;  2FCS A;  2XBB C;  1KZG A;  1X11 A;  2DX1 A;  3DBH I;  3JW0 X;  5CX3 A;  3U7D A;  4LJO B;  2G45 B;  3APC A;  2KLG A;  4GMV A;  3OAN A;  4M0W B;  2N7E A;  1P98 A;  3PTF C;  3P2B A;  1LFD A;  3GOE A;  4N9F 4;  1BTN A;  4E71 A;  2KJH B;  2LXA A;  4IOY X;  3PSC A;  2KWV B;  3KYC D;  4HAZ B;  3OAW A;  1WGD A;  2DAJ A;  3JSV B;  2DHK A;  1WJ6 A;  4RM8 A;  3DCG A;  3ZNH B;  1M94 A;  2H7D A;  1V49 A;  3Q3F A;  3WAO A;  2D3G A;  3IFW B;  4BKG A;  2CRF A;  2L3Z A;  4FLH A;  1P3R A;  4W9C A;  2BYF A;  1WXS A;  4ASW C;  1S3S G;  2K6Q A;  2JRH A;  4JQW C;  1XQQ A;  2ADZ A;  4M8N A;  1V61 A;  2IYB A;  3A33 B;  4MSM B;  3A1Q B;  2N4F A;  2IY1 B;  2O2V A;  4BKT A;  2K00 A;  1BT0 A;  2BF8 B;  1XCG A;  2KDB A;  1EAZ A;  2LWP A;  1P0R A;  5IAA C;  4MGI E;  1LQB A;  5CTR C;  3HW2 B;  2J0M A;  2CHZ A;  4HXD A;  4II3 B;  3TL5 A;  2DEN B;  3QBV B;  1RRB A;  3V60 A;  2DYB A;  3MTN B;  3QJZ A;  4AWJ A;  1WM3 A;  2COC A;  1TJ6 A;  3S2A A;  2DZI A;  1SHC A;  4FBJ B;  4WQO B;  4HDQ A;  3AI5 A;  4F7Z A;  3H9D A;  3ZRF A;  2BWF A;  5J3Q A;  1UNP A;  2IO3 B;  4BOS C;  2C7M B;  2DZK A;  1N3H A;  1MKE A;  4ZRK A;  1ZKH A;  2KQ7 A;  3NY5 A;  4RMA A;  2N9P C;  2K39 A;  2FIF A;  2XK5 A;  1X05 A;  3APD A;  4AJY B;  2JXX A;  4URK A;  2CY5 A;  2CHW A;  2KAN A;  3N3K B;  2K2U A;  2YSZ A;  2L0F A;  2J7Q B;  3KUZ A;  2VKI A;  4K2O A;  5FR6 A;  4Z2N A;  1WM2 A;  2JZ3 B;  1M7E A;  1RRP B;  3SO6 A;  3F5R A;  1WJN A;  3PRP B;  3UQB A;  1KI1 B;  4IM3 A;  1WJU A;  3PPA A;  3DDC B;  3PS6 A;  4W9H A;  2RGF A;  2DLW A;  5CHV C;  3DXC A;  3TJP A;  5D94 A;  2D9Z A;  2KFK A;  2PZ1 A;  4CHM A;  4HCP B;  4HB2 B;  4PYZ A;  4HDO A;  3DXE A;  2JWZ A;  3QAQ A;  3N30 A;  5C79 A;  4GXB A;  3DOW A;  4MY6 A;  5JP4 A;  2N23 A;  3CF6 E;  4EKU A;  3QC8 B;  3RZW C;  1S1Q B;  3KUC B;  5J3Y A;  5JHH A;  1WG7 A;  1DBH A;  3VTV A;  3VAW A;  4WSF A;  5J2R A;  1U5F A;  3NZS A;  1Z87 A;  1RFA A;  4WWP A;  4BBK A;  2LZ6 A;  1XR0 B;  3H6N A;  1U2B A;  1ZVR A;  1OMW A;  4L6E A;  2HTH A;  4IWO A;  4KHA A;  3QK0 A;  2DYQ A;  2KKC A;  3EC8 A;  4K17 A;  2W2X D;  3KW5 B;  3TVV A;  3P7Z A;  5BO4 B;  1TTN A;  5DPR A;  2LUL A;  1V9J A;  3SD5 A;  1WGH A;  2DZJ A;  1V5P A;  4HAW B;  2GMI C;  3X0W A;  4B95 A;  2KJR A;  2KQS A;  2VRW B;  5DPW A;  1E8Z A;  3R3M A;  4ICV A;  5E6O A;  4BBN C;  2Z59 B;  2LGD A;  2R0D A;  2GCJ A;  1I7A A;  4GZU A;  3ML4 A;  1E8W A;  5G2N A;  4KSL C;  2DA0 A;  4MDK E;  2ASQ A;  3PRZ A;  2LRW A;  3QX1 A;  1M7R A;  3TCA A;  4ZRJ A;  3ZNZ B;  3GZN I;  2GJY A;  2M1M A;  3N32 A;  3KUD B;  4DWF A;  2FNJ B;  4ANX A;  1WFY A;  3P6A A;  1MPH A;  4HAY B;  3VTU A;  2KC1 A;  3UIP B;  3W1Y A;  2RSU A;  2CKH B;  5G55 A;  1Y19 B;  4W9D A;  3ZIM A;  1SGH A;  3A9K B;  2IZV B;  2LRU A;  1L2N A;  3SDL C;  3CST A;  4EUT A;  1UGM A;  2VSZ A;  2WWZ A;  1FHX A;  4A6K A;  1IRS A;  5CLQ B;  2FCQ A;  2JVC A;  4DHJ D;  2KD0 A;  1TQZ A;  1E8Y A;  4EZJ A;  3ULC A;  2UZR A;  2DKP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...