3TCAA

Crystal structure of the ras-associating and pleckstrin-homology domains of riam
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
260
structure length
246
Chain Sequence
VKKLVVKVHMDDSSTKSLMVDERQLARDVLDNLFEKTHCDCNVDWCLYEIYPELQIERVFEDHENVVEVLSDWTRDTENKVLFLEKEERYAVFKNPQNFYLMNAKNKEYLLEESFCGTSIIVPELEGALYLKEDGKKSWKRRYFLLRASGIYYVPKGKTKTSRDLACFIQFENVNIYYGIQCKMKYKAPTDHCFVLKHPQIQKESQYIKYLCCDDARTLSQWVMGIRIAKYGKTLYDNYQRAVARA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords Amyloid beta A4 precursor protein-binding family B member 1-
publication title Rap1-interacting adapter molecule (RIAM) associates with the plasma membrane via a proximity detector.
pubmed doi rcsb
source organism Mus musculus
total genus 76
structure length 246
sequence length 260
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-08-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00169 PH PH domain
A PF00788 RA Ras association (RalGDS/AF-6) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 3tcaA02
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 3tcaA01
2V3SA 3ZNZB 3ZUNA 3KUCB 4JIOU 2KLCA 2Z0DB 5KQ1A 2AWTA 3PRPB 2MRPA 5HE2A 2FIDA 4CHKA 1Z2MA 1YIWA 4DHJB 3KW5B 3TMPB 3WANA 2KTRA 1X86A 1F9JA 4DK5A 2KWCA 3KYCD 4NJ7A 4BVUC 3JSVA 1G6JA 2MDXA 1I2HA 1UNRA 3P2BA 4LJOB 3UQAA 1C3TA 3ZDMC 4IC7B 4P7IA 4AWJA 1NDDA 2K6DB 2RSGA 2NS5A 5C23A 2I1JA 3EC8A 2UZRA 2L05A 3RUIB 2WX1A 4H8SA 4GDLA 4KZ0A 3DOWA 5AZGA 5J18A 2OTXA 2FCNA 2MW5A 1V86A 2GBJA 4GIVA 3ZNHB 1LXDA 2RLOA 5D2MB 3VFKA 4I6LB 4HJKA 4ZYNA 3UGBB 4IUMB 2V4LA 4DXAB 4NY0A 4F1SA 3WAPA 2AYOB 3A33B 1FXTB 2R09A 2LULA 4D0NB 3VAWA 1WYWB 1KI1B 2H7DA 4FLHA 3H6NA 1FHOA 3ML9A 2ZCCA 4KHAA 3NHEB 2YSZA 5CHVC 2MSED 2IO2B 3MTNB 5E6OA 1KJTA 3VTUA 2VSZA 4DHZB 4A20A 3ULBA 3R3MA 2DHKA 2KWUB 2D9YA 1WI0A 2NPTB 2WX0A 4FADA 4DDGD 2ELBA 3AULA 2KHWB 1P3QU 5C5BB 1Q67A 1IPGA 2K1FA 3QIJA 4GDKB 3CF6E 1WZ3A 2CAYA 2JWZA 3CSTA 2B3AA 2J0MA 3TW1A 1V5OA 2FNJB 4TKNA 3H9DA 2GMIC 2O6VA 4TQ0A 5D6JB 1XR0B 3DXCA 3CIKA 3KUDB 2BPSA 4W9KA 2JPHA 1WMHA 3ZRFA 3PLUA 1TGZB 1FGZA 2W2XC 1LB1A 3KVFB 5CX3A 2LUEA 5C6RA 2KTFA 1BT0A 3TVVA 1V6EA 3W1SA 3RULA 1GC7A 4HDOA 1WXAA 2ZJDA 3SHQA 2NVUI 4BOZB 1MKEA 3UF8A 3QK0A 3ZTDA 4M8MA 3ZW3A 3B08A 2D2QA 4MK0A 4MJSA 4K2PA 1R4NI 3QWZB 4GZUA 3A9KB 1P1AA 2DFKA 2KX0A 5E6NA 4M8NA 1V2YA 2KO3A 2PE6B 3N7CA 1TZ1A 4MDKE 1RRPB 2EJ8A 3QJZA 2NR2A 1WM3A 2NZ8B 2DHJA 1I42A 3K9OB 4TUUA 4WJOA 2DYQA 2FIFA 4PS8A 2ROZB 1TXDA 2QHOA 1OY2A 5HE3A 1KOTA 3N32A 3MDBC 1S1QB 1TTNA 1Y5OA 5CLQB 2KFKB 3H7PB 4W9FA 2MLBA 4DX90 3APFA 1J0WA 2YT0A 2GJYA 4KDLB 2QKLA 2C7NB 1WX8A 2BCJA 2WYQA 4HB4B 4DBBA 2KQ7A 3UIOB 2PPHA 3D8EA 2PE9A 4WJQA 1WXMA 2K8HA 4EUTA 3VVWB 3PZDA 1OEYJ 4AJWA 4GB9A 2CU1A 3N30A 2Y8GA 2AL3A 2G45B 1WF9A 4ICUA 2RGNB 3A8QA 4PS7A 1MG8A 4HAVB 1BAKA 1PQSA 2OQBA 4B95A 5EDSA 1OQYA 2KX3A 4MSQB 1OMWA 1GC6A 4IW0A 4FBJB 4MEMA 2N9XA 3VXWA 3B1LX 4EKUA 1WVHA 1VD2A 4DHJD 1Q5WB 2RD0A 1U27A 2D07B 1Z87A 1XQQA 3PRZA 1U5GA 5C79A 5JHAA 2PJHA 2V1YA 3DCGA 5J3TA 3QC8B 1AQCA 2RPQA 5KHOA 2DZIA 2KJRA 1EO6A 2FUHB 5D27A 4CYEA 5KCVA 4BKSA 1NBFC 3M95A 3VUWA 2AL6A 1WGQA 1X11A 4HAXB 3HM3A 5J3QA 2LJ5A 4IAPA 1UH6A 1EGXA 1Z5SB 3MJWA 2FJLA 5GMVA 3QQ8B 2Y8FA 5FR6A 5JHHA 1U5EA 1Y19B 4WQOB 2A4ZA 2K39A 4KZCA 4FA6A 4ICVA 1XD3B 2DLWA 4HATB 2W2WA 1K5GB 4B9KA 4B6HA 1V80A 2LGXA 3OLMD 4FN2A 4W9EA 3NS8A 3F0WA 4GGQA 2CS4A 4MM3A 2KJ6A 5GOWB 4J6IA 4WAAA 5DPSA 3KH0A 5AEKB 5L81A 4NSWA 1DDMA 3W1SC 1E8YA 3WYFB 1LFDA 2JT4B 2KFJA 2FCSA 4LDTB 2YS1A 1M7EA 4ZRKA 1WJUA 2NMBA 3DVGX 4II3B 4L6EA 3H7SA 2HTHB 2EMTA 4Y94A 3SYXA 1OGWA 1OQNA 2JXXA 5DI9B 4MGKE 2K8CA 3B0AA 3PREA 4MT7A 1SGHA 3V62A 2LASA 3PEGA 3UIPB 3DDCB 1L7YA 2XBBC 5E6PA 3ZKJC 1QZEA 4A6KA 2DYMA 3DBSA 2DX1A 1IYFA 3D32A 2KVRA 2MBQA 2J0KA 2CODA 2IBIB 3MHSD 2VRRB 2LOZA 2ZPYA 3DVNV 5JLJB 1KM7A 5C16A 3G9WA 1WG7A 2GS0A 4GSWA 2CRFA 5D3VA 2ZZPB 3IFWB 1U2BA 4MGIE 2RVBB 4HB2B 1K5DB 3D8FA 3EFUA 2X18A 4EZJA 2CHXA 3KUZA 1E8WA 5J17A 5C5BA 3DBHI 1KLVA 1WJNA 3A1QB 1VCBA 2LGDA 3RZWC 3A4RA 1W1GA 1KZ7A 1Q0WB 1V49A 2VRWB 2BGFA 5G2NA 2UWQA 2LVQA 2ZVOA 2KD0A 3PHWB 3PGEA 4K7WA 4FJZA 3NZUA 2MBEA 2J0JA 3W1YA 1UPRA 1ZM0A 3KRXA 4DBGA 2BYEA 4RMAA 2DZMA 4OVVA 2DAJA 4YONA 3OJ3A 4RM9A 1RFAA 3PLVA 2EMSA 1EUVB 1IRSA 2Y7BA 3QA8A 4PQ0A 3M62B 1UNQA 1WR1A 1M7RA 2KDEB 3DXEA 1ZKHA 1WGGA 3ZNID 2IY0B 4TQ1A 1FGYA 2N7EA 1WY8A 1WX7A 4GPTB 4GOCA 4MSMB 2PZ1A 1WRDB 4F7ZA 4K17A 4FHKA 2DTCA 3X23A 2KTRB 2PEAA 4NAWA 3A9KA 3ODWA 3APDA 1X1FA 1MPHA 3SU8X 2KANA 4CHJA 4WVFB 3ZRCA 4AUQC 2J7QB 5CHWA 4C0AA 5AZHA 1D3ZA 4EZLA 4FHJA 3U8ZA 2GCLA 2BWES 5D3XA 5FI0A 2LG1A 2NBWB 2BYVE 1LQBA 3PP2A 2OOBB 1WJ1A 2N1VA 2BKFA 3ZVVA 1DROA 4KDIC 5BO4B 2KQSA 4ANVA 1PLSA 2Y5BB 3H7PA 4HAWB 1UEFA 4N9F4 2I5FA 3PV1A 2H7EA 2D11A 1I7AA 3FM8C 5D7GA 2M1MA 1V5UA 3RZFA 4BBNC 1V81A 2ROVA 4GMVA 1RLFA 5C1ZA 1X1GA 1P0RA 2Z0QA 4IOYX 2CHWA 2MCNB 3WA0A 4OVUA 1WE6A 2JY6A 1YX6B 1U4AA 2M8SA 2K2JA 2QKMA 3HHMA 3DQVA 2RNRB 4GXBA 4K1RB 4NNJB 5D3YA 3UINB 2IYBA 4BKGA 3PS6A 2OJRA 1H4RA 3V60A 2YS3A 1ISNA 3QWMA 2L2IA 4B6WA 1H8CA 2CY5A 2IO1B 3PVLA 3GYPA 4TYZA 2YS5A 1RRBA 2G4SA 4F7GA 4BKTA 2M38A 4IG7B 2K00A 3V6CB 1WGUA 4KAXB 2Z0PA 4HLEA 4ANUA 3BY4B 3I3TB 1V88A 1GNUA 2CHZA 2MP2B 2N4FA 1HE8A 2J59M 2O2VA 2P0DA 4PS3A 3ZTCA 4ASWC 3PVUA 4EZKA 2DENB 3QHTA 2BYFA 2COAA 3V6EB 1U29A 2COFA 1P9DU 3PPAA 5FI1A 1MK9B 1YD8U 2UYZB 2JZ3B 3ZNGC 3ML8A 3RD2A 3PVWA 2LVOA 2O6VB 1EAZA 3OJ4B 1TQZA 4KIKA 1SIFA 3ALBA 3QBVB 5JP4A 1EF1A 3HW2B 3LDZE 3QAQA 4AOFA 3DXDA 4MELA 2REXA 2ASQA 4HVBA 4MGZE 3DBLI 1H10A 3VDZA 1UBQA 3AJ4A 2BWFA 2DZKA 4HB3B 4IM0A 2M14A 3WALA 2IFSA 2FCQA 4WWOA 3KSYA 1CMXB 2BKRB 2JZZA 2M0XA 4JQWC 2RR9A 4HDQA 2R2OA 2XK5B 1ZW7A 4HAZB 1P6SA 3JVZX 1K8RB 3A9JB 2L76A 1BWNA 3FSSA 2G35A 4II2B 1C1YB 2DKQA 2N23A 1KZGA 1XKEA 2DHIA 1WGDA 1ZC3B 4A3PA 4PNKA 1AARA 3V61A 3VTVA 1V89A 4PYUA 2Z0OA 5D94A 2KDFB 3KRWA 1Y8RC 3TBLD 2DYNA 4KSLC 1E7UA 3EECA 1X05A 2RUKB 4HHVA 2HTHA 1FAOA 3L08A 3HK0A 4G50A 3FEHA 5J2RA 2W9NA 4X57B 4MY6A 2I5CA 3K9PB 1EVHA 2L00B 3SUZA 5DPWA 2D9WA 1IP9A 2FAZA 1WX9A 1UD7A 2LXCA 5DPRA 2LYDA 5JHBA 5LXHA 1E8ZA 2JP2A 2UZSA 3ODXA 3VTWA 4W9HA 2R2QA 4WJPA 3RYTA 1PFJA 1DDWA 3H1UA 4TV3A 4A6FB 4G3XB 3WAMA 1XX0A 3DVGY 2DAFA 1BTNA 4KVGB 3CSFA 4YL8A 5G55A 2COCA 2L7RA 1E7VA 4XX5A 4PYZA 3NZSA 3KZ1A 1OTRB 4A6HA 2Z0EB 4K7SA 2YLMA 3RT3B 1V9JA 2KLGA 4K81A 3A8PA 2JUOA 4GU2A 2M4NA 3KY9A 1P3RA 4E3CA 3JYUA 2ZVNA 4IFSA 4BFRA 1NU2A 3ZDTA 2JRIB 5JHGA 4BOSC 4NJ6A 4WJNA 4W9GA 3VUXA 2K25A 2E2XA 2VKIA 2CY4A 4BBKA 3VIAA 4GMXB 2WWZA 2N9PC 4XWXA 2DX5B 3BINA 1V5TA 3CMMB 3O65B 1QC6A 4IM3A 3F5RA 3VUYA 2ZCBA 1L2NA 4KHBB 2K6QA 1XD4A 3ZVRA 4CO7A 5CTRC 3IG3A 4KV2A 5DCNA 3BJIA 2YF0A 1MK7B 3L10B 5CLLB 4JLCA 4WSFA 2LKOA 3X0WA 4KHOA 3KYDD 2GBKA 3LJUX 4IWPA 1YQBA 2ZNVC 3SV1A 3SD5A 2N7DA 1WE7A 2MBBB 1JRUA 3U7DA 5JZEB 2MKRA 2KZRA 2N1WA 1WM2A 2BF8B 1N3HA 4W9LA 3R7QA 4LCDE 1T0YA 2V76A 2LRWA 2NPTA 3VQIA 4EJNA 2G3QB 2IYDB 4RM8A 4Z2MB 2A5UA 4W9DA 2KNBA 2KJHB 5HE1A 4WJ7A 4GDKA 3R7RA 4A3OA 1WGRA 5LONB 2MX2A 1UNPA 2LOXA 4FJVB 3PT2B 2C5LC 3RCZA 3M1IB 4WWNA 3D8DA 3L54A 1SE9A 1ZC4B 4ZDVA 3MPXA 3VH3B 1ZGUB 1XCGA 1DYNA 4ZRJA 5TR5A 3U30A 2KCJA 1YX5B 3VH4B 1UZXB 4EMOA 4W9JA 3UQBA 3HQCA 2CR5A 1P5TA 2KK8A 3NOBA 4DDID 3JW0X 2MQJA 3TO1A 3P7ZA 1I35A 2IO3B 5KHQA 2KGXB 2P0FA 1E90A 2LGYA 2C60A 3TJPA 4WWPA 2GBRA 3Q3JA 2DKPA 3GYOA 4E71A 5DPTA 2DHZA 2N0YA 4MGYE 3SO6A 1DBHA 3AI5A 2IY1B 1J19A 1NTVA 2DYBA 1WGYA 2WDTB 3DVNU 1RAXA 3JSVB 2MWSB 2KOXA 2KKCA 1RJ2A 2MBHA 2D9VA 1WJ4A 3PTFC 4EFOA 4EOYA 1NI2A 3WAOA 2D9XA 2O6VD 2KMCA 1FOEA 2MP2A 4JGHB 3HM6X 5DIFB 2Q13A 1WR6E 2D3GA 1E5WA 1X1MA 3OANA 1B55A 1V61A 4HWIB 1WJ6A 1A5RA 1XODA 2UVMA 4EEWA 3ZO5B 1U5DA 3C0RB 2KFKA 4GDLB 3SNHA 2MFQA 3Q3FA 2LVPA 2GCJA 5LOPB 1QQGA 3O96A 2XEWA 2I1KA 2L1CA 1FB8A 3ONSA 3L17A 3GZNI 1BTKA 2GOWA 2D9ZA 2LI5A 4JL9A 5LLIA 3ECIA 4ANWA 4MH0E 4NPNA 3AU4A 2HE7A 3ODOA 3DBRI 4HK2A 2C7HA 3UZTA 3OAWA 2LXAA 3LJ3A 2KWVB 2KC1A 4HB0B 3QCAA 2FCMA 3TCAA 3S2AA 4XC2A 1GJZA 1J8CA 2GBMA 3APCA 2DN6A 3L0WB 4HAYB 3V5WA 4KSKC 2D4QA 2R0DA 2KXJA 2NBVB 3M3JA 4HPMB 1Q1OA 2ZEQA 1W1HA 1WI1A 1UGMA 3ZLZA 2XK5A 3QARA 3A9JA 2M17A 3TIXA 1OEYA 4HCPB 3QX1A 4NAWB 1YJ1A 1AWEA 2LWPA 4HXDA 1V5PA 2HD5B 4W9CA 1ZSQA 3N3KB 5EFXA 2NBUA 2MWNB 3PG7A 4ZRIA 1WJMA 1E8XA 5LXIB 1FHWA 1W1DA 4DX8A 3IHPC 2NCNA 4AP4C 4I6PA 4K2OA 2EC1A 5L83A 4ANXA 5IAAC 5L95C 2K2UA 1MIXA 1WZ0A 4G11A 2IO0B 1LM8B 5D3WA 3T9LA 3P6AA 1WMHB 4URKA 3GOEA 1M94A 4F7UP 4HAUB 2GBNA 1XT9B 4CHMA 4F7HA 3TFMA 2RGFA 2ADZA 2G4DB 5JH5C 3HIZA 2AEHA 4LDTD 4K7UA 4A6FA 3PSEB 2P0HA 1WH3A 2ZPNA 3PSCA 5DH9B 3A98B 1GUAB 3DPDA 3WIMA 3AU5A 5AZFA 4I6NB 3L13A 2JRHA 4BBNF 3AXCA 2LRUA 4E74A 4MJSB 4DWFA 2HJ8A 1PMSA 3EHVA 2YVCA 1MAIA 2C9WB 1WXSA 4GN1A 1UPQA 4A5KA 2N9EB 1DDVA 3IBEA 5DHFB 4FULA 4IWOA 3RCPA 2DA0A 2L0FA 4NQLB 4BKSD 4DHZE 2C7MB 2DX5A 1U5FA 1TBEA 2YRYA 1EF5A 1GG3A 2KC2A 2ZNVB 1R4MI 2O2VB 1LW3A 2P8VA 1TJ6A 5HE0A 4AJYB 4LJPB 3PHXB 3ZIMA 2IZVB 5DHAB 1MIZB 2YT1A 2L0TA 5KQ4A 3ULCA 4HPLB 3NY5A 4FJYA 1WGHA 1S3SG 1SHCA 3PRMB 2KDIA 4KIKB 1WXVA 3IVFA 2W2XD 2MA9B 2KN5A 4W9IA 1ZVRA 2JF5A 2L3ZA 3VHTC 2D10A 3A4SC 2Z59B 4M0WB 1J0GA 3R66C 3ENEA 3T06A 3TL5A 5IA7A 3T8MA 5J3YA 3VOQA 2ELAA 2KUPA 2K8BA 1UBIA 1FHXA 2CKHB 4IM2A 4XZ4A 2RSUA 4F8CB 1WIAA 3A1QA 2JVCA 1P98A 2L8JA 4Z2NA 2MBOA 2LZ6A 3L16A 1V5MA 2KDBA 2DZJA 1UELA 4G0NB 2EKEC 3CXBB 3NSUA 4NQKE 5HKHA 1WFYA 2XQNM 4HCNB 2DYOA 2LD9A 4IWQA 2KMAA 5CHFA 3ML4A 3SDLC 3M63B 1NTYA
chains in the Genus database with same CATH superfamily
2V3SA 3ZNZB 3ZUNA 3KUCB 1RM6C 4JIOU 3IXSA 2KLCA 4XWWA 2KIEA 2Z0DB 5KQ1A 4YSYB 3P63A 2AWTA 3PRPB 2MRPA 3NVWA 5HE2A 2FIDA 4CHKA 1N61A 4LNNA 1VRAB 1Z2MA 1YIWA 1LGRA 1FMAD 3NRZA 4DHJB 3KW5B 1UWXA 3ZGZA 4B0MA 5FR3A 2QCZA 3NVZA 3TMPB 3WANA 2KTRA 1X86A 1F9JA 4DK5A 2KWCA 3KYCD 4NJ7A 4LLGM 3T3NA 4BVUC 3JSVA 1G6JA 2MDXA 2NTSA 1I2HA 1UNRA 3P2BA 4LJOB 1XLPA 3UQAA 1C3TA 3ZDMC 1V1OA 4IC7B 4JPSA 1PYWD 4P7IA 4AWJA 4US8A 1NDDA 2W3RA 1TYGB 2EELA 2K6DB 3FKYA 2RSGA 4RGTA 2NS5A 3T3OA 4S17A 5C23A 1ROEA 1FRRA 1RYJA 2GI9A 2I1JA 3EC8A 4MM3B 2LEKA 4USAA 2M0AA 1YQ4B 2UZRA 2X8XX 2L05A 3RUIB 2WX1A 4H8SA 1FFUA 1PGXA 4JWSC 3N20C 2G1EA 4GDLA 4KZ0A 3Q6BA 1F2RI 3DOWA 4DXGA 1MVKA 5AZGA 5J18A 1L0VB 2OTXA 3TEZA 2WXQA 2FCNA 4NAMA 2V4IB 1FM0D 2JXTA 2MW5A 1V86A 2GBJA 2WU5B 4GIVA 1EU4A 5AUKA 3ZNHB 1LXDA 2RLOA 5D2MB 3VFKA 4I6LB 4HJKA 1ENFA 4ZYNA 3UGBB 4OW0A 4IUMB 2KN4A 2BW2A 2V4LA 4AS1A 3DCXA 4DXAB 4NY0A 4F1SA 3MC9A 3WAPA 1Q10A 2WXHA 2KQ4X 2INDC 2AYOB 3A33B 1FXTB 2XN9C 2R09A 2LULA 4D0NB 3VAWA 1WYWB 1KI1B 1V1PB 2H7DA 4FLHA 4B0EA 3H6NA 1FHOA 3ML9A 2ZCCA 4KHAA 3NHEB 2YSZA 1T3QA 5CHVC 2MSED 2IO2B 3MTNB 5E6OA 3RNGC 1ZDXA 1KJTA 3VTUA 2LHEA 2VSZA 2FUG1 4ZHOA 1SXTA 4DHZB 4A20A 3ULBA 3R3MA 1E10A 2DHKA 1JWBD 2QEJC 2KWUB 2D9YA 1WI0A 2NPTB 2WX0A 2INPE 4FADA 4OHJA 4DDGD 2ELBA 3AULA 3AMZA 3HSAA 4A90A 3EUB2 2KHWB 1SEBD 2KT7A 1P3QU 5C5BB 1Q67A 1IPGA 4QJ5B 2K1FA 4FXCA 3QIJA 4GDKB 3CF6E 2HJ1A 1WZ3A 2CAYA 2JWZA 4HSIA 4JWUC 3CSTA 2B3AA 2J0MA 3TW1A 1V5OA 1XCTL 2FNJB 4TKNA 3H9DA 2GMIC 2O6VA 1BXTA 4RGMA 4TQ0A 2OJWA 2PTLA 1XR0B 5D6JB 3DXCA 5AUIA 1B1ZA 3CIKA 3KUDB 4RH6A 2BPSA 4W9KA 4JE3B 4WAFA 2JPHA 1WMHA 1SE4A 3ZRFA 2KIGA 3PLUA 1TGZB 3TUOA 3C19A 1FGZA 2Y5PA 2W2XC 1LB1A 3KVFB 4HJGE 1N62A 1R7SA 1M4VA 5CX3A 2LUEA 5C6RA 4C80A 2KTFA 1BT0A 5IOIA 3TVVA 1V6EA 3W1SA 3RULA 4C00A 1GC7A 2Z4DA 4HDOA 1DOIA 1MI0A 1WXAA 2PKOA 4YSZB 2BBCA 2ZJDA 4PK1A 1WYGA 3SHQA 2NVUI 4BOZB 1MKEA 3UF8A 1QILA 3QK0A 2N0SB 1WXQA 3ZTDA 5BMHA 3RNBC 1UWMA 4M8MA 2VZKD 3ZW3A 3B08A 2D2QA 3AE8B 4OZCA 4MK0A 3TEYA 2K3UA 1V8CA 4MJSA 4K2PA 1R4NI 3QWZB 4GZUA 3KWLA 3A9KB 1P1AA 2DFKA 2KX0A 4QAYA 2K0PA 2XNAC 3DBLB 2KWDA 5E6NA 4M8NA 1V2YA 1FEHA 3P4PB 2KO3A 2PE6B 3N7CA 1TZ1A 4MDKE 2ONQA 1RRPB 2EJ8A 3QJZA 2QJLA 2NR2A 2WXIA 2BQQA 1WM3A 1HQRD 2NZ8B 1XCQL 1QKZA 2DHJA 1I42A 1ZP0B 1MHXA 3K9OB 4IDIA 2INCC 4TUUA 2AX5A 3AH7A 4WJOA 2DYQA 4DXFA 2FIFA 2NMQA 5LG4B 4PS8A 4TSSA 1IBXA 2ROZB 1TXDA 2QHOA 1JWAD 1OY2A 5HE3A 1KOTA 3BK2A 3N32A 3MDBC 1S1QB 1TTNA 2ACZB 2MEKA 2W82A 1Y5OA 5CLQB 2KFKB 3H7PB 4W9FA 2MLBA 4DX90 3APFA 1J0WA 2J53A 4YSXB 2WHIA 2YT0A 2GJYA 1SJED 1ZPSA 4KDLB 3VR8B 2QKLA 2C7NB 1GAQB 2IPKD 5D3IB 1WX8A 2BCJA 3BVGA 1EU3A 2WYQA 4HB4B 4DBBA 1YN5A 2KQ7A 3BIID 4OVZA 3UIOB 2PPHA 3D8EA 4YWGG 1ET6A 2PE9A 4WJQA 1WXMA 2K8HA 4EUTA 3VVWB 3PZDA 1OEYJ 4US9A 5BMIA 4XE0A 2PVOD 2RDBC 4GB9A 2CU1A 4AJWA 3Q8CA 1BUIC 3ZJVA 2WU2B 3N30A 1D6EC 2Y8GA 4HRSA 2AL3A 1XLOA 2G45B 3KLSX 1WF9A 4ICUA 2RGNB 3A8QA 2IGDA 4PS7A 3AB5A 3MFGA 1K50A 1MG8A 2JWUA 2MJ3A 4HAVB 2E6XA 1VZ8A 4HPPA 1BAKA 1PQSA 2OQBA 4B95A 3U4EG 5EDSA 1FNUA 1OQYA 2KX3A 1FO4A 4MSQB 1OMWA 4HKQA 1GC6A 4IW0A 4FBJB 2I2YA 4MEMA 2N9XA 3DHGC 3Q3OC 3VXWA 1D5XC 3B1LX 4EKUA 1WVHA 2W55A 1VD2A 4DHJD 1Q5WB 2RD0A 1SE2A 1U27A 2D07B 2WNMA 2WDVB 1Z87A 1CZPA 2VH1A 2WXOA 2ZW1A 1QOGA 1YOVB 4XWTA 1XQQA 3PRZA 1VZ6A 2V9HA 1U5GA 5C79A 5JHAA 2PJHA 2V1YA 3DCGA 5J3TA 3FC4A 3QC8B 2J4XA 1AQCA 2RPQA 3KWVA 5KHOA 4HROA 2DZIA 2KJRA 1EO6A 2LJIA 2FUHB 5D27A 4CYEA 1JALA 5KCVA 4LNKA 1T0QC 4BKSA 1NBFC 2J52A 5T8IA 3M95A 3VUWA 2AL6A 5TSSA 1WGQA 1X11A 4HAXB 3HM3A 4BAXA 5J3QA 2LJ5A 4IAPA 1UH6A 1EGXA 3OG5A 1SSNA 1Z5SB 3MJWA 2FJLA 5GMVA 3AE2B 3QQ8B 2Y8FA 5FR6A 5JHHA 1U5EA 1Y19B 4WQOB 2A4ZA 2K39A 4KZCA 4FA6A 1ZXIA 4ICVA 1XD3B 2LGSA 1BMLC 1FXIA 2DLWA 4HATB 2W2WA 1K5GB 3UI3A 4B9KA 2D3CA 4B6HA 1V80A 2LGXA 1ZXHA 3OLMD 4FN2A 3A58A 4W9EA 3NS8A 3F0WA 4GGQA 2CS4A 4MM3A 2KJ6A 3AEAB 5GOWB 4J6IA 4WAAA 5DPSA 3KH0A 5AEKB 5M4YB 1AW7A 5L81A 4NSWA 3BWUD 3TEWA 1DDMA 3W1SC 1GB4A 4JX1C 1E8YA 3WYFB 4LNFA 1LFDA 3SFEB 2JT4B 2QIEB 4MACA 2KR0A 2KFJA 2FCSA 2N9LA 4LDTB 2YS1A 4HKZE 3AV8A 1M7EA 4ZRKA 1WJUA 4XYCA 1QLBB 2WXKA 3CWIA 3HRDD 2NMBA 3DVGX 4II3B 4L6EA 3H7SA 5HI1A 4L1RA 4ARIA 2HTHB 2EMTA 4Y94A 3SYXA 1OGWA 4K3CA 1KLUD 1OQNA 4GOUA 3HVZA 2JXXA 1L4ZB 2V0GA 5DI9B 4MGKE 4A6QA 4OZBA 4WIPA 4YTNB 4S0RA 3VR9B 2K8CA 4LK0M 1WWTA 3B0AA 3PREA 4MT7A 1SGHA 3V62A 2LASA 3PEGA 3URYA 2EKIA 2WXMA 3UIPB 3DDCB 1L7YA 3KQ4A 2XBBC 3RNAC 5E6PA 3ZKJC 2WS3B 1RFKA 2DNFA 1QZEA 4A6KA 2DYMA 2D3AA 3VRBB 3DBSA 3DWGC 2DX1A 1IYFA 3D32A 2KVRA 3Q3MC 5I2MA 3W5UB 2MBQA 1ET9A 2J0KA 2CODA 2IBIB 3MHSD 2VRRB 2LOZA 2ZPYA 3DVNV 5JLJB 3P4RB 1KM7A 2JYTA 5C16A 1MJDA 3G9WA 5G5GA 1WG7A 2GS0A 4GSWA 3TSSA 2CRFA 5D3VA 2ZZPB 3IFWB 1F52A 1U2BA 4XGAB 1C9FA 3B77A 3MC8A 1YJIA 4MGIE 2RVBB 3SR6A 3AEBB 4HB2B 1K5DB 3D8FA 3EFUA 2X18A 3AEFB 4ARCA 4EZJA 2CHXA 1HTQA 2QDFA 3KUZA 1E8WA 5J17A 5C5BA 3DBHI 2GUMA 1F1HA 1KLVA 1WJNA 1AWDA 3P4QB 3A1QB 1VCBA 2J42A 2LGDA 2BTEA 3RZWC 2BS4B 3A4RA 1W1GA 1KZ7A 1Q0WB 1V49A 4MH8A 3LXFA 2VRWB 1ACCA 2BGFA 5G2NA 2UWQA 3N9YC 1MPEA 4C4VB 2WQYB 2LVQA 1QOAA 2ZVOA 2BT6A 2RMMA 2KD0A 3PHWB 3PGEA 1FXAA 3N1ZC 4FJZA 1Y56A 4K7WA 1ZDVA 3NZUA 1J7AA 2MBEA 4OZAA 2J0JA 3W1YA 1UPRA 1ZM0A 3KRXA 4DBGA 2BYEA 1FNVA 1I4GA 3NWAA 4RMAA 1FCCC 2DZMA 1LO5D 4OVVA 2D3BA 2DAJA 4YONA 3LB8C 3OJ3A 3I5JC 2AQ1B 4RM9A 1FNWA 1RFAA 3PLVA 2EMSA 1EUVB 1IRSA 3AN1A 2Y7BA 3QA8A 1VJKA 4PQ0A 3M62B 1EWYC 1UNQA 2IDYA 3J9CA 1WR1A 4LNIA 1M7RA 2KDEB 2NBVA 3DXEA 1ZKHA 1WGGA 3ZNID 2IY0B 4TQ1A 3MP9A 4OT1A 1FGYA 1VZ7A 2N7EA 1WY8A 1YNTE 1FCLA 1SIJA 3GZNB 1WX7A 4GPTB 4GOCA 3IT4B 4MSMB 2PZ1A 1WRDB 4F7ZA 1VDVA 4K17A 4FHKA 5IRSA 1F77A 2DTCA 3X23A 2KTRB 2PEAA 4NAWA 3A9KA 3DBRB 3ODWA 3APDA 4H2AA 1X1FA 1F2RC 1MPHA 3SU8X 2KANA 2L83A 4CHJA 4WVFB 3ZRCA 4AUQC 2J7QB 1TY2A 1JCKB 2QSDA 1T5XD 1TS2A 1IGDA 5CHWA 4YTMB 4C0AA 5AZHA 1D3ZA 4EZLA 4FHJA 4ZRPA 1YMHE 3FILA 2FE8A 3IAM1 3U8ZA 3ZJTA 2GCLA 2BWES 5D3XA 4HEA1 5BYRA 5FI0A 2NBWB 2LG1A 1QOBA 2BYVE 1LQBA 1D4BA 2JX5A 3PP2A 3B9JA 4GLSC 2OOBB 1WJ1A 4C7YA 2N1VA 2BKFA 3ZVVA 1DROA 1ZOYB 3BYTB 4KDIC 5BO4B 1I7HA 2KQSA 4ANVA 1PLSA 2Y5BB 2MJEA 1WRIA 3H7PA 4HAWB 1TKYA 1UEFA 4M01A 4N9F4 2I5FA 1SJHD 3PV1A 3Q2AC 2H7EA 2D11A 1I7AA 1E9MA 3GE3C 3FM8C 2SAKA 5D7GA 2M1MA 1V5UA 3RZFA 4BBNC 2L32A 1V81A 2ROVA 4GMVA 1RLFA 2M19A 5C1ZA 1X1GA 1P0RA 1NEKB 2Z0QA 4NJCA 4IOYX 2CHWA 2MCNB 3WA0A 4OVUA 5H92C 1CK1A 2KUQA 1WE6A 2JY6A 1YX6B 2WDRB 1U4AA 2M8SA 1N63A 2K2JA 2QKMA 3HHMA 3DQVA 2RNRB 1KF6B 2Z13A 5BMGA 1SE3A 4GXBA 2KMMA 1TT5B 2JYEA 4K1RB 4NNJB 5D3YA 3UINB 5EE1A 5IP4D 2IYBA 5H8YE 4BKGA 3PS6A 2OJRA 1H4RA 3MC0B 3V60A 2L52A 3AE9B 1ZYIA 1T0RC 2YS3A 1ISNA 3QWMA 2L2IA 4B6WA 2PVGC 1H8CA 2CY5A 2IO1B 3PVLA 1TZOA 2IJ0A 3GYPA 4TYZA 3ZQ4A 2YS5A 1RRBA 2G4SA 4F7GA 4BKTA 2M38A 2K49A 4IG7B 2K00A 2BB5A 3V6CB 1WGUA 4KAXB 2Z0PA 5FK9C 4HLEA 3W2DA 4ANUA 1MHHE 3BY4B 3I3TB 1V88A 1TKEA 2WDQB 1GNUA 1E0ZA 2CHZA 2ZKMX 1D5MC 1TKGA 2MP2B 3N1XC 2CU3A 1C4AA 1T6BX 3BVMA 3R8BA 2N4FA 1HE8A 3EGRA 4MT5A 5FKAC 3Q14C 2J59M 2H89B 2O2VA 2P0DA 4PS3A 3ZTCA 1FIQA 4ASWC 3PVUA 4EZKA 1CJEA 2DENB 3QHTA 3NS1A 2ZW0A 2BYFA 3ETRA 2COAA 3V6EB 1U29A 3DWMA 2COFA 1P9DU 3Q8AA 3PPAA 4RGOS 5FI1A 1MK9B 1YD8U 2UYZB 3ZXVA 2JZ3B 4P1BC 3DHHC 3W5VB 3ZNGC 3ML8A 3RD2A 3AM9A 1F0ZA 3PVWA 2D5GA 2LVOA 2O6VB 1QOFA 1EAZA 3OJ4B 1TQZA 4KIKA 2W54A 2Q5WD 4D6WA 4LNOA 2WXJA 3PZ8A 1SIFA 5LNK1 3V05A 3ALBA 3QBVB 5JP4A 2Z59A 4M0WA 1EF1A 3HW2B 3LDZE 1R4MB 3QAQA 4AOFA 3DXDA 2LGIA 1P7EA 4MELA 2REXA 2ASQA 3Q8FA 4HVBA 5IN7A 5I2SA 4MGZE 3DBLI 1H10A 2WXPA 3VDZA 1UBQA 3AJ4A 4QXAB 2BWFA 2DZKA 4O1NA 4HB3B 2R61A 4IM0A 2M14A 1RWSA 1A70A 3U2SC 1JRPA 3WALA 2IFSA 2FCQA 2K22A 1QT9A 4WWOA 3KSYA 1CMXB 5MPOA 2BKRB 2JZZA 2M0XA 4JQWC 2JZPA 2RR9A 4HDQA 2KVZA 4YTPB 1HXYD 2R2OA 2WXFA 2XK5B 1ZW7A 3NWDA 4HAZB 1P6SA 3JVZX 1K8RB 3A9JB 2L76A 2WXGA 1BWNA 4ZOHC 3FSSA 2G35A 4II2B 1C1YB 2DKQA 2N23A 1K53A 1OQQA 1KZGA 4A9AA 4P16A 1AN8A 1XKEA 2DHIA 1WGDA 1ZC3B 4A3PA 3RNCC 3OWEB 4N6EB 4PNKA 3VRAB 1AARA 3V61A 1KLGD 3VTVA 1V89A 3GS2A 4PYUA 2Z0OA 4RGNA 5D94A 2KDFB 3KRWA 1Y8RC 1C78A 3TBLD 2M56B 2DYNA 4KSLC 1E7UA 2JSVX 4ITKA 3EECA 1X05A 2RUKB 4HHVA 1TS3A 2HTHA 3W9CB 1FAOA 1WGKA 3L08A 3HK0A 4L2YA 1XF5L 1UUPA 3FEHA 4G50A 1J7BA 5J2RA 2V3NA 5C3JB 2W9NA 4YXDB 4X57B 4DQOC 1SBBB 1P7FA 1IBXB 4MY6A 2N9KA 2I5CA 2BS3B 3K9PB 2BVCA 1EVHA 3P4SB 2L00B 3SUZA 3IT6B 5DPWA 2D9WA 1TS5A 1IP9A 3EFCA 2FAZA 1DOXA 1WX9A 1UD7A 2LXCA 5DPRA 2KYWA 2LYDA 5JHBA 1JROA 1HEZE 5LXHA 1E8ZA 1L5PA 3ZJUA 1N60A 2JP2A 2UZSA 4KKJA 3ODXA 3VTWA 4A8XC 1FD6A 4W9HA 2R2QA 4WJPA 3RYTA 1PFJA 1DDWA 4ZRQA 3H1UA 4CSQA 4D2KA 4TV3A 3Q8BA 4A6FB 4G3XB 3WAMA 1XX0A 1T0SC 1PFDA 3DVGY 2DAFA 2UU7A 1BTNA 2GLSA 3RPFC 4KVGB 3CSFA 4YL8A 3I63C 5G55A 2COCA 2L7RA 1E7VA 1HTOA 4N59A 2B76B 2LMCA 4XX5A 4PYZA 3NZSA 1NVID 3NUHB 3KZ1A 1OTRB 4A6HA 2Z0EB 4K7SA 3AE5B 5I4DA 2YLMA 3RT3B 1V9JA 3Q3NC 2KLGA 3ZYYX 4K81A 3A8PA 2JUOA 4GU2A 2M4NA 3KY9A 5D3DA 1P3RA 5C2TB 4E3CA 3JYUA 2ZVNA 3NW8A 4IFSA 4BFRA 4C4VA 2YEPF 1SF0A 1NU2A 3ZDTA 2JRIB 5JHGA 4BOSC 2FJUB 4NJ6A 4WJNA 4W9GA 3VUXA 2K25A 2E2XA 2VKIA 2CJOA 2CY4A 4BBKA 3VIAA 4GMXB 2Z14A 3B2FA 3EA6A 2WWZA 2N9PC 4XWXA 2DX5B 3CIRB 4WH4A 2DWQA 2QC8A 3BINA 2INNE 3SFDB 1E7PB 1V5TA 3N1YC 2WGSA 3CMMB 3O65B 3SEBA 2KACA 1TY0A 3WCQA 1QC6A 4IM3A 3F5RA 3VUYA 1PUTA 2ZCBA 1L2NA 4KHBB 2K6QA 5GXGB 1XD4A 3ZVRA 4CO7A 3FVCA 2DLBA 5CTRC 1L0XB 3IG3A 4KV2A 5DCNA 5HHDG 1V1PA 3BJIA 2YF0A 1MK7B 3L10B 5CLLB 4JLCA 3GB1A 4WSFA 2LKOA 3BYYB 3AE7B 3X0WA 4KHOA 3KYDD 2GBKA 4RFBA 3LJUX 1YN3A 4IWPA 1YQBA 2ZNVC 3SV1A 3P42A 5EE0A 3SD5A 4M02A 2N7DA 1WE7A 3PO0A 2OHFA 2MBBB 1JRUA 3U7DA 3NWFA 4M00A 5JZEB 2MKRA 2HDEA 2KZRA 1IUEA 2N1WA 1WM2A 1WSPA 2X38A 2BF8B 1N3HA 4W9LA 2GRIA 3R7QA 4LCDE 2PIAA 3R2IA 1T0YA 1IGCA 2LRWA 2V76A 2NPTA 3VQIA 4EJNA 2G3QB 2IYDB 4R3DA 3Q69A 2BYTA 1TS4A 4RM8A 4Z2MB 2A5UA 4W9DA 2KNBA 2LHDA 2KJHB 5HE1A 4WJ7A 4GDKA 3R7RA 4A3OA 4EE2A 1I4HA 1WGRA 5LONB 2MX2A 1UNPA 2WXLA 2LOXA 3Q8EA 4FJVB 3PT2B 2C5LC 4REZA 3RCZA 4IKGA 1K51A 3M1IB 4WWNA 1J7CA 3D8DA 3L54A 1SE9A 3RFZB 5BYSA 1ZC4B 4L1BA 4ZDVA 3MPXA 3VH3B 2YT2A 3ZXRA 1ZGUB 3AEGB 1XCGA 1DYNA 3R2TA 1D5ZC 1JWUD 4ZRJA 5TR5A 4WWMA 3U30A 2KCJA 1YX5B 3VH4B 4KX6B 3NVVA 1VLBA 1JW9D 1UZXB 4EMOA 4W9JA 3UQBA 3HQCA 2MH7A 4P6VF 1XEEA 2CR5A 1P5TA 1I4PA 2KK8A 3RNEC 3NOBA 4DDID 3JW0X 2MQJA 3OHMB 3TO1A 3P7ZA 1XLNA 4J3OD 1QF6A 1I35A 2IO3B 5KHQA 2KGXB 2P0FA 1E90A 1T77A 2LGYA 2C60A 2HTME 1B9RA 3TJPA 4WWPA 2K5PA 2GBRA 1C4PA 1FFVA 3Q3JA 2R2YA 2DKPA 3GYOA 3NG0A 4E71A 3P1MA 2RDGA 5DPTA 2PMVA 2DHZA 3AE6B 5JXVA 4L23A 2N0YA 4MGYE 3SO6A 1XXGA 3AE1B 1DBHA 3AI5A 3AECB 3MJ5A 2IY1B 1ZE3D 1J19A 1NTVA 1UGJA 4UDUC 1V97A 2DYBA 2QILA 1WGYA 2WDTB 3DVNU 3O13A 2W3SA 2K9XA 1JQ4A 3MHZA 1RAXA 1NYQA 3AEEB 3JSVB 2MWSB 2LFIA 2KOXA 2KKCA 4C7ZA 4CQNA 1RJ2A 2MBHA 2D9VA 2AQ2B 1PGBA 1STEA 1WJ4A 2L1AA 3PZ7A 4KGTA 3PTFC 4EFOA 4EOYA 1NI2A 4WURA 3WAOA 2D9XA 2O6VD 2KMCA 1FOEA 2MP2A 3FAHA 4JGHB 3HM6X 5DIFB 1C4CA 2Q13A 3RN9C 1WR6E 3BVZA 2D3GA 1TJEA 1YJJA 1E5WA 1X1MA 3OANA 2QMTA 3E56A 1B55A 1V61A 4HWIB 1OQRA 1WJ6A 1A5RA 1XODA 2UVMA 4EEWA 1PDXA 3GP7A 1R4NB 3ZO5B 4RCOA 1U5DA 2TSSA 3C0RB 2KFKA 4GDLB 3SNHA 2MFQA 3Q3FA 2LVPA 2GCJA 5LOPB 1QQGA 3O96A 2XEWA 2I1KA 1UNSA 1GB1A 2L1CA 1FB8A 2YEPB 3ONSA 3L17A 3GZNI 2I38A 1DGJA 1BTKA 2BB6A 2WXRA 2GOWA 2D9ZA 2LI5A 4JL9A 5LLIA 1QQRA 3ECIA 4ANWA 4MH0E 4NPNA 1ZUD2 3AU4A 2HE7A 2Y5CA 3ODOA 3DBRI 4HK2A 2C7HA 3UZTA 3OAWA 2LXAA 3LJ3A 2KWVB 2KC1A 4HB0B 3QCAA 2FCMA 4RF1A 4C56C 3TCAA 3S2AA 3HIEA 4NZLB 2H88B 4XC2A 4YT0B 1J8CA 2VH2A 1GJZA 2GBMA 3APCA 2E3TA 2DN6A 3L0WB 3HUIA 4PT5A 4HAYB 3V5WA 2K8EA 2WP9B 4KSKC 5HG2A 4XDCA 2D4QA 2R0DA 1KTKA 3ABVB 3AEDB 2KXJA 2NBVB 3M3JA 4HPMB 2GB1A 1Q1OA 2ZEQA 1W1HA 3LYYA 1WI1A 1UGMA 3ZLZA 2XK5A 4KGRA 3QARA 4TMAB 2IGGA 2M17A 3A9JA 2SEBD 3TIXA 1OEYA 4HCPB 3QX1A 2MHJA 2IGHA 4NAWB 4RF0A 1YJ1A 1JWMD 1AWEA 2LWPA 3AE4B 1NYRA 4HXDA 1V5PA 4ACFA 2HD5B 4W9CA 1ZSQA 1SB3C 3N3KB 5EFXA 3B2GA 2NBUA 1GPXA 4N58A 2MWNB 3PG7A 4ZRIA 1WJMA 1E8XA 1I4XA 5LXIB 1FHWA 1W1DA 4DX8A 3FILB 3IHPC 2NCNA 4AP4C 4I6PA 4K2OA 4DIXA 2EC1A 1N5WA 5L83A 3NZ3A 4ANXA 5BYQA 5IAAC 5L95C 2K2UA 1MIXA 1I4QA 1FRDA 1WZ0A 1L6VA 4G11A 2IO0B 1LM8B 4WQMA 5D3WA 1E6EB 1OFFA 2WLBA 4K3BA 1HZ5A 3T9LA 3P6AA 1WMHB 4URKA 3GOEA 1M94A 1NENB 4F7UP 4HAUB 2GBNA 1XT9B 1KRHA 4CHMA 2KDMA 3U7ZA 4F7HA 3TFMA 2RGFA 2ADZA 2FBWB 2PLPA 2G4DB 5JH5C 1CQVA 3HIZA 2AEHA 1DYQA 1L4DB 4XDDA 1I4RA 4LDTD 3I9V1 4K7UA 5HFYA 4A6FA 3PSEB 5IO9A 2P0HA 1WH3A 2ZPNA 3PSCA 5DH9B 3A98B 1MFWA 2JU6X 3C8YA 2JQRB 1GUAB 3DPDA 3WIMA 3BZDB 3AU5A 5AZFA 2OEDA 4I6NB 4IOIE 3L13A 2JRHA 4BBNF 3AXCA 2LRUA 4E74A 4ZYSA 4MJSB 4DWFA 2HJ8A 3E9SA 3IAS1 4OSNA 2RPVA 2Z8LA 1PMSA 3EHVA 3BK1A 2YVCA 1MAIA 3U52E 2KAJA 3DHIC 2C9WB 3TEXA 1WXSA 4GN1A 1UPQA 3HVDA 4A5KA 2N9EB 1DDVA 3IBEA 3V3XA 5DHFB 4FULA 4IWOA 3RCPA 4QJ3B 2ON8A 2DA0A 1KH0A 2WXNA 2L0FA 4NQLB 4BKSD 4Q2JA 4DHZE 2C7MB 5EE3A 2DX5A 1U5FA 1TBEA 1C76A 2VZKB 2YRYA 1EF5A 1GG3A 2KC2A 2ZNVB 1HZ6A 1R4MI 2O2VB 1LW3A 2P8VA 1TJ6A 4KHBA 1YQ3B 1JMLA 5HE0A 4AJYB 4LJPB 3PHXB 1XO3A 3ZIMA 2IZVB 5E6JA 5DHAB 1MIZB 4GNKB 2YT1A 1DOYA 2L0TA 5KQ4A 2Y3AA 3ULCA 2CJNA 1L0YB 4HPLB 2PW9A 3NY5A 4FJYA 2MJDA 4KGSA 1WGHA 2AQ3B 1EM7A 1S3SG 1SHCA 3PRMB 4A55A 2LUMA 2KDIA 1WXVA 4KIKB 3IVFA 2W2XD 2MA9B 3NJTA 1VR9A 2KN5A 1YN4A 4W9IA 1FPYA 1ZVRA 1L6UA 2G9HD 2JF5A 2L3ZA 3GE8C 3VHTC 2D10A 3A4SC 4KKIA 2Z59B 4M0WB 1GOZA 3RNFC 1J0GA 3R66C 3U12A 1EWCA 3RMKC 1HA5A 3ENEA 3NVYA 3T06A 1KFYB 3TL5A 5IA7A 4QJ4B 3T8MA 5J3YA 3VOQA 2ELAA 2KUPA 2K8BA 1C79A 1UBIA 3RI7C 1UF0A 1FHXA 2CKHB 3H8HA 4IM2A 4XZ4A 2RSUA 4F8CB 1WIAA 3A1QA 4LTUA 2RDHA 2JVCA 2V3PA 1P98A 2DBYA 4P1CC 2ICIA 1K52A 4BZAA 2L8JA 4Z2NA 2MBOA 1PGAA 2LZ6A 5G5HA 1JWSD 2RRFA 3L16A 1V5MA 2KDBA 2DZJA 1UELA 2N7JA 1N6ZA 4G0NB 2EKEC 3AE3B 1MG4A 5IKCM 2NTTA 1TIFA 3CXBB 3NSUA 4NQKE 3L4PA 1WFYA 5HKHA 1XLQA 2XQNM 4ZHPA 4HCNB 2DYOA 4RNAA 1NI3A 2LD9A 5EE9A 1AYFA 4AQ7A 1MI1A 1ESFA 4IWQA 1N5XA 2KMAA 5CHFA 3ML4A 3DBHB 1C77A 3I57A 3SDLC 2BS2B 3M63B 1NTYA
chains in the Genus database with same CATH topology
2V3SA 3ZNZB 3ZUNA 3KUCB 4JIOU 2KLCA 2Z0DB 5KQ1A 2AWTA 3PRPB 2MRPA 5HE2A 2FIDA 4CHKA 1Z2MA 1YIWA 4DHJB 3KW5B 3TMPB 3WANA 2KTRA 1X86A 1F9JA 4DK5A 2KWCA 3KYCD 4NJ7A 4BVUC 3JSVA 1G6JA 2MDXA 1I2HA 1UNRA 3P2BA 4LJOB 3UQAA 1C3TA 3ZDMC 4IC7B 4P7IA 4AWJA 1NDDA 2K6DB 2RSGA 2NS5A 5C23A 2I1JA 3EC8A 2UZRA 2L05A 3RUIB 2WX1A 4H8SA 4GDLA 4KZ0A 3DOWA 5AZGA 5J18A 2OTXA 2FCNA 2MW5A 1V86A 2GBJA 4GIVA 3ZNHB 1LXDA 2RLOA 5D2MB 3VFKA 4I6LB 4HJKA 4ZYNA 3UGBB 4IUMB 2V4LA 4DXAB 4NY0A 4F1SA 3WAPA 2AYOB 3A33B 1FXTB 2R09A 2LULA 4D0NB 3VAWA 1WYWB 1KI1B 2H7DA 4FLHA 3H6NA 1FHOA 3ML9A 2ZCCA 4KHAA 3NHEB 2YSZA 5CHVC 2MSED 2IO2B 3MTNB 5E6OA 1KJTA 3VTUA 2VSZA 4DHZB 4A20A 3ULBA 3R3MA 2DHKA 2KWUB 2D9YA 1WI0A 2NPTB 2WX0A 4FADA 4DDGD 2ELBA 3AULA 2KHWB 1P3QU 5C5BB 1Q67A 1IPGA 2K1FA 3QIJA 4GDKB 3CF6E 1WZ3A 2CAYA 2JWZA 3CSTA 2B3AA 2J0MA 3TW1A 1V5OA 2FNJB 4TKNA 3H9DA 2GMIC 2O6VA 4TQ0A 5D6JB 1XR0B 3DXCA 3CIKA 3KUDB 2BPSA 4W9KA 2JPHA 1WMHA 3ZRFA 3PLUA 1TGZB 1FGZA 2W2XC 1LB1A 3KVFB 5CX3A 2LUEA 5C6RA 2KTFA 1BT0A 3TVVA 1V6EA 3W1SA 3RULA 1GC7A 4HDOA 1WXAA 2ZJDA 3SHQA 2NVUI 4BOZB 1MKEA 3UF8A 3QK0A 3ZTDA 4M8MA 3ZW3A 3B08A 2D2QA 4MK0A 4MJSA 4K2PA 1R4NI 3QWZB 4GZUA 3A9KB 1P1AA 2DFKA 2KX0A 5E6NA 4M8NA 1V2YA 2KO3A 2PE6B 3N7CA 1TZ1A 4MDKE 1RRPB 2EJ8A 3QJZA 2NR2A 1WM3A 2NZ8B 2DHJA 1I42A 3K9OB 4TUUA 4WJOA 2DYQA 2FIFA 4PS8A 2ROZB 1TXDA 2QHOA 1OY2A 5HE3A 1KOTA 3N32A 3MDBC 1S1QB 1TTNA 1Y5OA 5CLQB 2KFKB 3H7PB 4W9FA 2MLBA 4DX90 3APFA 1J0WA 2YT0A 2GJYA 4KDLB 2QKLA 2C7NB 1WX8A 2BCJA 2WYQA 4HB4B 4DBBA 2KQ7A 3UIOB 2PPHA 3D8EA 2PE9A 4WJQA 1WXMA 2K8HA 4EUTA 3VVWB 3PZDA 1OEYJ 4AJWA 4GB9A 2CU1A 3N30A 2Y8GA 2AL3A 2G45B 1WF9A 4ICUA 2RGNB 3A8QA 4PS7A 1MG8A 4HAVB 1BAKA 1PQSA 2OQBA 4B95A 5EDSA 1OQYA 2KX3A 4MSQB 1OMWA 1GC6A 4IW0A 4FBJB 4MEMA 2N9XA 3VXWA 3B1LX 4EKUA 1WVHA 1VD2A 4DHJD 1Q5WB 2RD0A 1U27A 2D07B 1Z87A 1XQQA 3PRZA 1U5GA 5C79A 5JHAA 2PJHA 2V1YA 3DCGA 5J3TA 3QC8B 1AQCA 2RPQA 5KHOA 2DZIA 2KJRA 1EO6A 2FUHB 5D27A 4CYEA 5KCVA 4BKSA 1NBFC 3M95A 3VUWA 2AL6A 1WGQA 1X11A 4HAXB 3HM3A 5J3QA 2LJ5A 4IAPA 1UH6A 1EGXA 1Z5SB 3MJWA 2FJLA 5GMVA 3QQ8B 2Y8FA 5FR6A 5JHHA 1U5EA 1Y19B 4WQOB 2A4ZA 2K39A 4KZCA 4FA6A 4ICVA 1XD3B 2DLWA 4HATB 2W2WA 1K5GB 4B9KA 4B6HA 1V80A 2LGXA 3OLMD 4FN2A 4W9EA 3NS8A 3F0WA 4GGQA 2CS4A 4MM3A 2KJ6A 5GOWB 4J6IA 4WAAA 5DPSA 3KH0A 5AEKB 5L81A 4NSWA 1DDMA 3W1SC 1E8YA 3WYFB 1LFDA 2JT4B 2KFJA 2FCSA 4LDTB 2YS1A 1M7EA 4ZRKA 1WJUA 2NMBA 3DVGX 4II3B 4L6EA 3H7SA 2HTHB 2EMTA 4Y94A 3SYXA 1OGWA 1OQNA 2JXXA 5DI9B 4MGKE 2K8CA 3B0AA 3PREA 4MT7A 1SGHA 3V62A 2LASA 3PEGA 3UIPB 3DDCB 1L7YA 2XBBC 5E6PA 3ZKJC 1QZEA 4A6KA 2DYMA 3DBSA 2DX1A 1IYFA 3D32A 2KVRA 2MBQA 2J0KA 2CODA 2IBIB 3MHSD 2VRRB 2LOZA 2ZPYA 3DVNV 5JLJB 1KM7A 5C16A 3G9WA 1WG7A 2GS0A 4GSWA 2CRFA 5D3VA 2ZZPB 3IFWB 1U2BA 4MGIE 2RVBB 4HB2B 1K5DB 3D8FA 3EFUA 2X18A 4EZJA 2CHXA 3KUZA 1E8WA 5J17A 5C5BA 3DBHI 1KLVA 1WJNA 3A1QB 1VCBA 2LGDA 3RZWC 3A4RA 1W1GA 1KZ7A 1Q0WB 1V49A 2VRWB 2BGFA 5G2NA 2UWQA 2LVQA 2ZVOA 2KD0A 3PHWB 3PGEA 4K7WA 4FJZA 3NZUA 2MBEA 2J0JA 3W1YA 1UPRA 1ZM0A 3KRXA 4DBGA 2BYEA 4RMAA 2DZMA 4OVVA 2DAJA 4YONA 3OJ3A 4RM9A 1RFAA 3PLVA 2EMSA 1EUVB 1IRSA 2Y7BA 3QA8A 4PQ0A 3M62B 1UNQA 1WR1A 1M7RA 2KDEB 3DXEA 1ZKHA 1WGGA 3ZNID 2IY0B 4TQ1A 1FGYA 2N7EA 1WY8A 1WX7A 4GPTB 4GOCA 4MSMB 2PZ1A 1WRDB 4F7ZA 4K17A 4FHKA 2DTCA 3X23A 2KTRB 2PEAA 4NAWA 3A9KA 3ODWA 3APDA 1X1FA 1MPHA 3SU8X 2KANA 4CHJA 4WVFB 3ZRCA 4AUQC 2J7QB 5CHWA 4C0AA 5AZHA 1D3ZA 4EZLA 4FHJA 3U8ZA 2GCLA 2BWES 5D3XA 5FI0A 2LG1A 2NBWB 2BYVE 1LQBA 3PP2A 2OOBB 1WJ1A 2N1VA 2BKFA 3ZVVA 1DROA 4KDIC 5BO4B 2KQSA 4ANVA 1PLSA 2Y5BB 3H7PA 4HAWB 1UEFA 4N9F4 2I5FA 3PV1A 2H7EA 2D11A 1I7AA 3FM8C 5D7GA 2M1MA 1V5UA 3RZFA 4BBNC 1V81A 2ROVA 4GMVA 1RLFA 5C1ZA 1X1GA 1P0RA 2Z0QA 4IOYX 2CHWA 2MCNB 3WA0A 4OVUA 1WE6A 2JY6A 1YX6B 1U4AA 2M8SA 2K2JA 2QKMA 3HHMA 3DQVA 2RNRB 4GXBA 4K1RB 4NNJB 5D3YA 3UINB 2IYBA 4BKGA 3PS6A 2OJRA 1H4RA 3V60A 2YS3A 1ISNA 3QWMA 2L2IA 4B6WA 1H8CA 2CY5A 2IO1B 3PVLA 3GYPA 4TYZA 2YS5A 1RRBA 2G4SA 4F7GA 4BKTA 2M38A 4IG7B 2K00A 3V6CB 1WGUA 4KAXB 2Z0PA 4HLEA 4ANUA 3BY4B 3I3TB 1V88A 1GNUA 2CHZA 2MP2B 2N4FA 1HE8A 2J59M 2O2VA 2P0DA 4PS3A 3ZTCA 4ASWC 3PVUA 4EZKA 2DENB 3QHTA 2BYFA 2COAA 3V6EB 1U29A 2COFA 1P9DU 3PPAA 5FI1A 1MK9B 1YD8U 2UYZB 2JZ3B 3ZNGC 3ML8A 3RD2A 3PVWA 2LVOA 2O6VB 1EAZA 3OJ4B 1TQZA 4KIKA 1SIFA 3ALBA 3QBVB 5JP4A 1EF1A 3HW2B 3LDZE 3QAQA 4AOFA 3DXDA 4MELA 2REXA 2ASQA 4HVBA 4MGZE 3DBLI 1H10A 3VDZA 1UBQA 3AJ4A 2BWFA 2DZKA 4HB3B 4IM0A 2M14A 3WALA 2IFSA 2FCQA 4WWOA 3KSYA 1CMXB 2BKRB 2JZZA 2M0XA 4JQWC 2RR9A 4HDQA 2R2OA 2XK5B 1ZW7A 4HAZB 1P6SA 3JVZX 1K8RB 3A9JB 2L76A 1BWNA 3FSSA 2G35A 4II2B 1C1YB 2DKQA 2N23A 1KZGA 1XKEA 2DHIA 1WGDA 1ZC3B 4A3PA 4PNKA 1AARA 3V61A 3VTVA 1V89A 4PYUA 2Z0OA 5D94A 2KDFB 3KRWA 1Y8RC 3TBLD 2DYNA 4KSLC 1E7UA 3EECA 1X05A 2RUKB 4HHVA 2HTHA 1FAOA 3L08A 3HK0A 4G50A 3FEHA 5J2RA 2W9NA 4X57B 4MY6A 2I5CA 3K9PB 1EVHA 2L00B 3SUZA 5DPWA 2D9WA 1IP9A 2FAZA 1WX9A 1UD7A 2LXCA 5DPRA 2LYDA 5JHBA 5LXHA 1E8ZA 2JP2A 2UZSA 3ODXA 3VTWA 4W9HA 2R2QA 4WJPA 3RYTA 1PFJA 1DDWA 3H1UA 4TV3A 4A6FB 4G3XB 3WAMA 1XX0A 3DVGY 2DAFA 1BTNA 4KVGB 3CSFA 4YL8A 5G55A 2COCA 2L7RA 1E7VA 4XX5A 4PYZA 3NZSA 3KZ1A 1OTRB 4A6HA 2Z0EB 4K7SA 2YLMA 3RT3B 1V9JA 2KLGA 4K81A 3A8PA 2JUOA 4GU2A 2M4NA 3KY9A 1P3RA 4E3CA 3JYUA 2ZVNA 4IFSA 4BFRA 1NU2A 3ZDTA 2JRIB 5JHGA 4BOSC 4NJ6A 4WJNA 4W9GA 3VUXA 2K25A 2E2XA 2VKIA 2CY4A 4BBKA 3VIAA 4GMXB 2WWZA 2N9PC 4XWXA 2DX5B 3BINA 1V5TA 3CMMB 3O65B 1QC6A 4IM3A 3F5RA 3VUYA 2ZCBA 1L2NA 4KHBB 2K6QA 1XD4A 3ZVRA 4CO7A 5CTRC 3IG3A 4KV2A 5DCNA 3BJIA 2YF0A 1MK7B 3L10B 5CLLB 4JLCA 4WSFA 2LKOA 3X0WA 4KHOA 3KYDD 2GBKA 3LJUX 4IWPA 1YQBA 2ZNVC 3SV1A 3SD5A 2N7DA 1WE7A 2MBBB 1JRUA 3U7DA 5JZEB 2MKRA 2KZRA 2N1WA 1WM2A 2BF8B 1N3HA 4W9LA 3R7QA 4LCDE 1T0YA 2V76A 2LRWA 2NPTA 3VQIA 4EJNA 2G3QB 2IYDB 4RM8A 4Z2MB 2A5UA 4W9DA 2KNBA 2KJHB 5HE1A 4WJ7A 4GDKA 3R7RA 4A3OA 1WGRA 5LONB 2MX2A 1UNPA 2LOXA 4FJVB 3PT2B 2C5LC 3RCZA 3M1IB 4WWNA 3D8DA 3L54A 1SE9A 1ZC4B 4ZDVA 3MPXA 3VH3B 1ZGUB 1XCGA 1DYNA 4ZRJA 5TR5A 3U30A 2KCJA 1YX5B 3VH4B 1UZXB 4EMOA 4W9JA 3UQBA 3HQCA 2CR5A 1P5TA 2KK8A 3NOBA 4DDID 3JW0X 2MQJA 3TO1A 3P7ZA 1I35A 2IO3B 5KHQA 2KGXB 2P0FA 1E90A 2LGYA 2C60A 3TJPA 4WWPA 2GBRA 3Q3JA 2DKPA 3GYOA 4E71A 5DPTA 2DHZA 2N0YA 4MGYE 3SO6A 1DBHA 3AI5A 2IY1B 1J19A 1NTVA 2DYBA 1WGYA 2WDTB 3DVNU 1RAXA 3JSVB 2MWSB 2KOXA 2KKCA 1RJ2A 2MBHA 2D9VA 1WJ4A 3PTFC 4EFOA 4EOYA 1NI2A 3WAOA 2D9XA 2O6VD 2KMCA 1FOEA 2MP2A 4JGHB 3HM6X 5DIFB 2Q13A 1WR6E 2D3GA 1E5WA 1X1MA 3OANA 1B55A 1V61A 4HWIB 1WJ6A 1A5RA 1XODA 2UVMA 4EEWA 3ZO5B 1U5DA 3C0RB 2KFKA 4GDLB 3SNHA 2MFQA 3Q3FA 2LVPA 2GCJA 5LOPB 1QQGA 3O96A 2XEWA 2I1KA 2L1CA 1FB8A 3ONSA 3L17A 3GZNI 1BTKA 2GOWA 2D9ZA 2LI5A 4JL9A 5LLIA 3ECIA 4ANWA 4MH0E 4NPNA 3AU4A 2HE7A 3ODOA 3DBRI 4HK2A 2C7HA 3UZTA 3OAWA 2LXAA 3LJ3A 2KWVB 2KC1A 4HB0B 3QCAA 2FCMA 3TCAA 3S2AA 4XC2A 1GJZA 1J8CA 2GBMA 3APCA 2DN6A 3L0WB 4HAYB 3V5WA 4KSKC 2D4QA 2R0DA 2KXJA 2NBVB 3M3JA 4HPMB 1Q1OA 2ZEQA 1W1HA 1WI1A 1UGMA 3ZLZA 2XK5A 3QARA 3A9JA 2M17A 3TIXA 1OEYA 4HCPB 3QX1A 4NAWB 1YJ1A 1AWEA 2LWPA 4HXDA 1V5PA 2HD5B 4W9CA 1ZSQA 3N3KB 5EFXA 2NBUA 2MWNB 3PG7A 4ZRIA 1WJMA 1E8XA 5LXIB 1FHWA 1W1DA 4DX8A 3IHPC 2NCNA 4AP4C 4I6PA 4K2OA 2EC1A 5L83A 4ANXA 5IAAC 5L95C 2K2UA 1MIXA 1WZ0A 4G11A 2IO0B 1LM8B 5D3WA 3T9LA 3P6AA 1WMHB 4URKA 3GOEA 1M94A 4F7UP 4HAUB 2GBNA 1XT9B 4CHMA 4F7HA 3TFMA 2RGFA 2ADZA 2G4DB 5JH5C 3HIZA 2AEHA 4LDTD 4K7UA 4A6FA 3PSEB 2P0HA 1WH3A 2ZPNA 3PSCA 5DH9B 3A98B 1GUAB 3DPDA 3WIMA 3AU5A 5AZFA 4I6NB 3L13A 2JRHA 4BBNF 3AXCA 2LRUA 4E74A 4MJSB 4DWFA 2HJ8A 1PMSA 3EHVA 2YVCA 1MAIA 2C9WB 1WXSA 4GN1A 1UPQA 4A5KA 2N9EB 1DDVA 3IBEA 5DHFB 4FULA 4IWOA 3RCPA 2DA0A 2L0FA 4NQLB 4BKSD 4DHZE 2C7MB 2DX5A 1U5FA 1TBEA 2YRYA 1EF5A 1GG3A 2KC2A 2ZNVB 1R4MI 2O2VB 1LW3A 2P8VA 1TJ6A 5HE0A 4AJYB 4LJPB 3PHXB 3ZIMA 2IZVB 5DHAB 1MIZB 2YT1A 2L0TA 5KQ4A 3ULCA 4HPLB 3NY5A 4FJYA 1WGHA 1S3SG 1SHCA 3PRMB 2KDIA 4KIKB 1WXVA 3IVFA 2W2XD 2MA9B 2KN5A 4W9IA 1ZVRA 2JF5A 2L3ZA 3VHTC 2D10A 3A4SC 2Z59B 4M0WB 1J0GA 3R66C 3ENEA 3T06A 3TL5A 5IA7A 3T8MA 5J3YA 3VOQA 2ELAA 2KUPA 2K8BA 1UBIA 1FHXA 2CKHB 4IM2A 4XZ4A 2RSUA 4F8CB 1WIAA 3A1QA 2JVCA 1P98A 2L8JA 4Z2NA 2MBOA 2LZ6A 3L16A 1V5MA 2KDBA 2DZJA 1UELA 4G0NB 2EKEC 3CXBB 3NSUA 4NQKE 5HKHA 1WFYA 2XQNM 4HCNB 2DYOA 2LD9A 4IWQA 2KMAA 5CHFA 3ML4A 3SDLC 3M63B 1NTYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2V3S A;  3ZNZ B;  3ZUN A;  3KUC B;  4JIO U;  2KLC A;  2Z0D B;  5KQ1 A;  2AWT A;  3PRP B;  2MRP A;  5HE2 A;  2FID A;  4CHK A;  1Z2M A;  1YIW A;  4DHJ B;  3KW5 B;  3TMP B;  3WAN A;  2KTR A;  1X86 A;  1F9J A;  4DK5 A;  2KWC A;  3KYC D;  4NJ7 A;  4BVU C;  3JSV A;  1G6J A;  2MDX A;  1I2H A;  1UNR A;  3P2B A;  4LJO B;  3UQA A;  1C3T A;  3ZDM C;  4IC7 B;  4P7I A;  4AWJ A;  1NDD A;  2K6D B;  2RSG A;  2NS5 A;  5C23 A;  2I1J A;  3EC8 A;  2UZR A;  2L05 A;  3RUI B;  2WX1 A;  4H8S A;  4GDL A;  4KZ0 A;  3DOW A;  5AZG A;  5J18 A;  2OTX A;  2FCN A;  2MW5 A;  1V86 A;  2GBJ A;  4GIV A;  3ZNH B;  1LXD A;  2RLO A;  5D2M B;  3VFK A;  4I6L B;  4HJK A;  4ZYN A;  3UGB B;  4IUM B;  2V4L A;  4DXA B;  4NY0 A;  4F1S A;  3WAP A;  2AYO B;  3A33 B;  1FXT B;  2R09 A;  2LUL A;  4D0N B;  3VAW A;  1WYW B;  1KI1 B;  2H7D A;  4FLH A;  3H6N A;  1FHO A;  3ML9 A;  2ZCC A;  4KHA A;  3NHE B;  2YSZ A;  5CHV C;  2MSE D;  2IO2 B;  3MTN B;  5E6O A;  1KJT A;  3VTU A;  2VSZ A;  4DHZ B;  4A20 A;  3ULB A;  3R3M A;  2DHK A;  2KWU B;  2D9Y A;  1WI0 A;  2NPT B;  2WX0 A;  4FAD A;  4DDG D;  2ELB A;  3AUL A;  2KHW B;  1P3Q U;  5C5B B;  1Q67 A;  1IPG A;  2K1F A;  3QIJ A;  4GDK B;  3CF6 E;  1WZ3 A;  2CAY A;  2JWZ A;  3CST A;  2B3A A;  2J0M A;  3TW1 A;  1V5O A;  2FNJ B;  4TKN A;  3H9D A;  2GMI C;  2O6V A;  4TQ0 A;  5D6J B;  1XR0 B;  3DXC A;  3CIK A;  3KUD B;  2BPS A;  4W9K A;  2JPH A;  1WMH A;  3ZRF A;  3PLU A;  1TGZ B;  1FGZ A;  2W2X C;  1LB1 A;  3KVF B;  5CX3 A;  2LUE A;  5C6R A;  2KTF A;  1BT0 A;  3TVV A;  1V6E A;  3W1S A;  3RUL A;  1GC7 A;  4HDO A;  1WXA A;  2ZJD A;  3SHQ A;  2NVU I;  4BOZ B;  1MKE A;  3UF8 A;  3QK0 A;  3ZTD A;  4M8M A;  3ZW3 A;  3B08 A;  2D2Q A;  4MK0 A;  4MJS A;  4K2P A;  1R4N I;  3QWZ B;  4GZU A;  3A9K B;  1P1A A;  2DFK A;  2KX0 A;  5E6N A;  4M8N A;  1V2Y A;  2KO3 A;  2PE6 B;  3N7C A;  1TZ1 A;  4MDK E;  1RRP B;  2EJ8 A;  3QJZ A;  2NR2 A;  1WM3 A;  2NZ8 B;  2DHJ A;  1I42 A;  3K9O B;  4TUU A;  4WJO A;  2DYQ A;  2FIF A;  4PS8 A;  2ROZ B;  1TXD A;  2QHO A;  1OY2 A;  5HE3 A;  1KOT A;  3N32 A;  3MDB C;  1S1Q B;  1TTN A;  1Y5O A;  5CLQ B;  2KFK B;  3H7P B;  4W9F A;  2MLB A;  4DX9 0;  3APF A;  1J0W A;  2YT0 A;  2GJY A;  4KDL B;  2QKL A;  2C7N B;  1WX8 A;  2BCJ A;  2WYQ A;  4HB4 B;  4DBB A;  2KQ7 A;  3UIO B;  2PPH A;  3D8E A;  2PE9 A;  4WJQ A;  1WXM A;  2K8H A;  4EUT A;  3VVW B;  3PZD A;  1OEY J;  4AJW A;  4GB9 A;  2CU1 A;  3N30 A;  2Y8G A;  2AL3 A;  2G45 B;  1WF9 A;  4ICU A;  2RGN B;  3A8Q A;  4PS7 A;  1MG8 A;  4HAV B;  1BAK A;  1PQS A;  2OQB A;  4B95 A;  5EDS A;  1OQY A;  2KX3 A;  4MSQ B;  1OMW A;  1GC6 A;  4IW0 A;  4FBJ B;  4MEM A;  2N9X A;  3VXW A;  3B1L X;  4EKU A;  1WVH A;  1VD2 A;  4DHJ D;  1Q5W B;  2RD0 A;  1U27 A;  2D07 B;  1Z87 A;  1XQQ A;  3PRZ A;  1U5G A;  5C79 A;  5JHA A;  2PJH A;  2V1Y A;  3DCG A;  5J3T A;  3QC8 B;  1AQC A;  2RPQ A;  5KHO A;  2DZI A;  2KJR A;  1EO6 A;  2FUH B;  5D27 A;  4CYE A;  5KCV A;  4BKS A;  1NBF C;  3M95 A;  3VUW A;  2AL6 A;  1WGQ A;  1X11 A;  4HAX B;  3HM3 A;  5J3Q A;  2LJ5 A;  4IAP A;  1UH6 A;  1EGX A;  1Z5S B;  3MJW A;  2FJL A;  5GMV A;  3QQ8 B;  2Y8F A;  5FR6 A;  5JHH A;  1U5E A;  1Y19 B;  4WQO B;  2A4Z A;  2K39 A;  4KZC A;  4FA6 A;  4ICV A;  1XD3 B;  2DLW A;  4HAT B;  2W2W A;  1K5G B;  4B9K A;  4B6H A;  1V80 A;  2LGX A;  3OLM D;  4FN2 A;  4W9E A;  3NS8 A;  3F0W A;  4GGQ A;  2CS4 A;  4MM3 A;  2KJ6 A;  5GOW B;  4J6I A;  4WAA A;  5DPS A;  3KH0 A;  5AEK B;  5L81 A;  4NSW A;  1DDM A;  3W1S C;  1E8Y A;  3WYF B;  1LFD A;  2JT4 B;  2KFJ A;  2FCS A;  4LDT B;  2YS1 A;  1M7E A;  4ZRK A;  1WJU A;  2NMB A;  3DVG X;  4II3 B;  4L6E A;  3H7S A;  2HTH B;  2EMT A;  4Y94 A;  3SYX A;  1OGW A;  1OQN A;  2JXX A;  5DI9 B;  4MGK E;  2K8C A;  3B0A A;  3PRE A;  4MT7 A;  1SGH A;  3V62 A;  2LAS A;  3PEG A;  3UIP B;  3DDC B;  1L7Y A;  2XBB C;  5E6P A;  3ZKJ C;  1QZE A;  4A6K A;  2DYM A;  3DBS A;  2DX1 A;  1IYF A;  3D32 A;  2KVR A;  2MBQ A;  2J0K A;  2COD A;  2IBI B;  3MHS D;  2VRR B;  2LOZ A;  2ZPY A;  3DVN V;  5JLJ B;  1KM7 A;  5C16 A;  3G9W A;  1WG7 A;  2GS0 A;  4GSW A;  2CRF A;  5D3V A;  2ZZP B;  3IFW B;  1U2B A;  4MGI E;  2RVB B;  4HB2 B;  1K5D B;  3D8F A;  3EFU A;  2X18 A;  4EZJ A;  2CHX A;  3KUZ A;  1E8W A;  5J17 A;  5C5B A;  3DBH I;  1KLV A;  1WJN A;  3A1Q B;  1VCB A;  2LGD A;  3RZW C;  3A4R A;  1W1G A;  1KZ7 A;  1Q0W B;  1V49 A;  2VRW B;  2BGF A;  5G2N A;  2UWQ A;  2LVQ A;  2ZVO A;  2KD0 A;  3PHW B;  3PGE A;  4K7W A;  4FJZ A;  3NZU A;  2MBE A;  2J0J A;  3W1Y A;  1UPR A;  1ZM0 A;  3KRX A;  4DBG A;  2BYE A;  4RMA A;  2DZM A;  4OVV A;  2DAJ A;  4YON A;  3OJ3 A;  4RM9 A;  1RFA A;  3PLV A;  2EMS A;  1EUV B;  1IRS A;  2Y7B A;  3QA8 A;  4PQ0 A;  3M62 B;  1UNQ A;  1WR1 A;  1M7R A;  2KDE B;  3DXE A;  1ZKH A;  1WGG A;  3ZNI D;  2IY0 B;  4TQ1 A;  1FGY A;  2N7E A;  1WY8 A;  1WX7 A;  4GPT B;  4GOC A;  4MSM B;  2PZ1 A;  1WRD B;  4F7Z A;  4K17 A;  4FHK A;  2DTC A;  3X23 A;  2KTR B;  2PEA A;  4NAW A;  3A9K A;  3ODW A;  3APD A;  1X1F A;  1MPH A;  3SU8 X;  2KAN A;  4CHJ A;  4WVF B;  3ZRC A;  4AUQ C;  2J7Q B;  5CHW A;  4C0A A;  5AZH A;  1D3Z A;  4EZL A;  4FHJ A;  3U8Z A;  2GCL A;  2BWE S;  5D3X A;  5FI0 A;  2LG1 A;  2NBW B;  2BYV E;  1LQB A;  3PP2 A;  2OOB B;  1WJ1 A;  2N1V A;  2BKF A;  3ZVV A;  1DRO A;  4KDI C;  5BO4 B;  2KQS A;  4ANV A;  1PLS A;  2Y5B B;  3H7P A;  4HAW B;  1UEF A;  4N9F 4;  2I5F A;  3PV1 A;  2H7E A;  2D11 A;  1I7A A;  3FM8 C;  5D7G A;  2M1M A;  1V5U A;  3RZF A;  4BBN C;  1V81 A;  2ROV A;  4GMV A;  1RLF A;  5C1Z A;  1X1G A;  1P0R A;  2Z0Q A;  4IOY X;  2CHW A;  2MCN B;  3WA0 A;  4OVU A;  1WE6 A;  2JY6 A;  1YX6 B;  1U4A A;  2M8S A;  2K2J A;  2QKM A;  3HHM A;  3DQV A;  2RNR B;  4GXB A;  4K1R B;  4NNJ B;  5D3Y A;  3UIN B;  2IYB A;  4BKG A;  3PS6 A;  2OJR A;  1H4R A;  3V60 A;  2YS3 A;  1ISN A;  3QWM A;  2L2I A;  4B6W A;  1H8C A;  2CY5 A;  2IO1 B;  3PVL A;  3GYP A;  4TYZ A;  2YS5 A;  1RRB A;  2G4S A;  4F7G A;  4BKT A;  2M38 A;  4IG7 B;  2K00 A;  3V6C B;  1WGU A;  4KAX B;  2Z0P A;  4HLE A;  4ANU A;  3BY4 B;  3I3T B;  1V88 A;  1GNU A;  2CHZ A;  2MP2 B;  2N4F A;  1HE8 A;  2J59 M;  2O2V A;  2P0D A;  4PS3 A;  3ZTC A;  4ASW C;  3PVU A;  4EZK A;  2DEN B;  3QHT A;  2BYF A;  2COA A;  3V6E B;  1U29 A;  2COF A;  1P9D U;  3PPA A;  5FI1 A;  1MK9 B;  1YD8 U;  2UYZ B;  2JZ3 B;  3ZNG C;  3ML8 A;  3RD2 A;  3PVW A;  2LVO A;  2O6V B;  1EAZ A;  3OJ4 B;  1TQZ A;  4KIK A;  1SIF A;  3ALB A;  3QBV B;  5JP4 A;  1EF1 A;  3HW2 B;  3LDZ E;  3QAQ A;  4AOF A;  3DXD A;  4MEL A;  2REX A;  2ASQ A;  4HVB A;  4MGZ E;  3DBL I;  1H10 A;  3VDZ A;  1UBQ A;  3AJ4 A;  2BWF A;  2DZK A;  4HB3 B;  4IM0 A;  2M14 A;  3WAL A;  2IFS A;  2FCQ A;  4WWO A;  3KSY A;  1CMX B;  2BKR B;  2JZZ A;  2M0X A;  4JQW C;  2RR9 A;  4HDQ A;  2R2O A;  2XK5 B;  1ZW7 A;  4HAZ B;  1P6S A;  3JVZ X;  1K8R B;  3A9J B;  2L76 A;  1BWN A;  3FSS A;  2G35 A;  4II2 B;  1C1Y B;  2DKQ A;  2N23 A;  1KZG A;  1XKE A;  2DHI A;  1WGD A;  1ZC3 B;  4A3P A;  4PNK A;  1AAR A;  3V61 A;  3VTV A;  1V89 A;  4PYU A;  2Z0O A;  5D94 A;  2KDF B;  3KRW A;  1Y8R C;  3TBL D;  2DYN A;  4KSL C;  1E7U A;  3EEC A;  1X05 A;  2RUK B;  4HHV A;  2HTH A;  1FAO A;  3L08 A;  3HK0 A;  4G50 A;  3FEH A;  5J2R A;  2W9N A;  4X57 B;  4MY6 A;  2I5C A;  3K9P B;  1EVH A;  2L00 B;  3SUZ A;  5DPW A;  2D9W A;  1IP9 A;  2FAZ A;  1WX9 A;  1UD7 A;  2LXC A;  5DPR A;  2LYD A;  5JHB A;  5LXH A;  1E8Z A;  2JP2 A;  2UZS A;  3ODX A;  3VTW A;  4W9H A;  2R2Q A;  4WJP A;  3RYT A;  1PFJ A;  1DDW A;  3H1U A;  4TV3 A;  4A6F B;  4G3X B;  3WAM A;  1XX0 A;  3DVG Y;  2DAF A;  1BTN A;  4KVG B;  3CSF A;  4YL8 A;  5G55 A;  2COC A;  2L7R A;  1E7V A;  4XX5 A;  4PYZ A;  3NZS A;  3KZ1 A;  1OTR B;  4A6H A;  2Z0E B;  4K7S A;  2YLM A;  3RT3 B;  1V9J A;  2KLG A;  4K81 A;  3A8P A;  2JUO A;  4GU2 A;  2M4N A;  3KY9 A;  1P3R A;  4E3C A;  3JYU A;  2ZVN A;  4IFS A;  4BFR A;  1NU2 A;  3ZDT A;  2JRI B;  5JHG A;  4BOS C;  4NJ6 A;  4WJN A;  4W9G A;  3VUX A;  2K25 A;  2E2X A;  2VKI A;  2CY4 A;  4BBK A;  3VIA A;  4GMX B;  2WWZ A;  2N9P C;  4XWX A;  2DX5 B;  3BIN A;  1V5T A;  3CMM B;  3O65 B;  1QC6 A;  4IM3 A;  3F5R A;  3VUY A;  2ZCB A;  1L2N A;  4KHB B;  2K6Q A;  1XD4 A;  3ZVR A;  4CO7 A;  5CTR C;  3IG3 A;  4KV2 A;  5DCN A;  3BJI A;  2YF0 A;  1MK7 B;  3L10 B;  5CLL B;  4JLC A;  4WSF A;  2LKO A;  3X0W A;  4KHO A;  3KYD D;  2GBK A;  3LJU X;  4IWP A;  1YQB A;  2ZNV C;  3SV1 A;  3SD5 A;  2N7D A;  1WE7 A;  2MBB B;  1JRU A;  3U7D A;  5JZE B;  2MKR A;  2KZR A;  2N1W A;  1WM2 A;  2BF8 B;  1N3H A;  4W9L A;  3R7Q A;  4LCD E;  1T0Y A;  2V76 A;  2LRW A;  2NPT A;  3VQI A;  4EJN A;  2G3Q B;  2IYD B;  4RM8 A;  4Z2M B;  2A5U A;  4W9D A;  2KNB A;  2KJH B;  5HE1 A;  4WJ7 A;  4GDK A;  3R7R A;  4A3O A;  1WGR A;  5LON B;  2MX2 A;  1UNP A;  2LOX A;  4FJV B;  3PT2 B;  2C5L C;  3RCZ A;  3M1I B;  4WWN A;  3D8D A;  3L54 A;  1SE9 A;  1ZC4 B;  4ZDV A;  3MPX A;  3VH3 B;  1ZGU B;  1XCG A;  1DYN A;  4ZRJ A;  5TR5 A;  3U30 A;  2KCJ A;  1YX5 B;  3VH4 B;  1UZX B;  4EMO A;  4W9J A;  3UQB A;  3HQC A;  2CR5 A;  1P5T A;  2KK8 A;  3NOB A;  4DDI D;  3JW0 X;  2MQJ A;  3TO1 A;  3P7Z A;  1I35 A;  2IO3 B;  5KHQ A;  2KGX B;  2P0F A;  1E90 A;  2LGY A;  2C60 A;  3TJP A;  4WWP A;  2GBR A;  3Q3J A;  2DKP A;  3GYO A;  4E71 A;  5DPT A;  2DHZ A;  2N0Y A;  4MGY E;  3SO6 A;  1DBH A;  3AI5 A;  2IY1 B;  1J19 A;  1NTV A;  2DYB A;  1WGY A;  2WDT B;  3DVN U;  1RAX A;  3JSV B;  2MWS B;  2KOX A;  2KKC A;  1RJ2 A;  2MBH A;  2D9V A;  1WJ4 A;  3PTF C;  4EFO A;  4EOY A;  1NI2 A;  3WAO A;  2D9X A;  2O6V D;  2KMC A;  1FOE A;  2MP2 A;  4JGH B;  3HM6 X;  5DIF B;  2Q13 A;  1WR6 E;  2D3G A;  1E5W A;  1X1M A;  3OAN A;  1B55 A;  1V61 A;  4HWI B;  1WJ6 A;  1A5R A;  1XOD A;  2UVM A;  4EEW A;  3ZO5 B;  1U5D A;  3C0R B;  2KFK A;  4GDL B;  3SNH A;  2MFQ A;  3Q3F A;  2LVP A;  2GCJ A;  5LOP B;  1QQG A;  3O96 A;  2XEW A;  2I1K A;  2L1C A;  1FB8 A;  3ONS A;  3L17 A;  3GZN I;  1BTK A;  2GOW A;  2D9Z A;  2LI5 A;  4JL9 A;  5LLI A;  3ECI A;  4ANW A;  4MH0 E;  4NPN A;  3AU4 A;  2HE7 A;  3ODO A;  3DBR I;  4HK2 A;  2C7H A;  3UZT A;  3OAW A;  2LXA A;  3LJ3 A;  2KWV B;  2KC1 A;  4HB0 B;  3QCA A;  2FCM A;  3TCA A;  3S2A A;  4XC2 A;  1GJZ A;  1J8C A;  2GBM A;  3APC A;  2DN6 A;  3L0W B;  4HAY B;  3V5W A;  4KSK C;  2D4Q A;  2R0D A;  2KXJ A;  2NBV B;  3M3J A;  4HPM B;  1Q1O A;  2ZEQ A;  1W1H A;  1WI1 A;  1UGM A;  3ZLZ A;  2XK5 A;  3QAR A;  3A9J A;  2M17 A;  3TIX A;  1OEY A;  4HCP B;  3QX1 A;  4NAW B;  1YJ1 A;  1AWE A;  2LWP A;  4HXD A;  1V5P A;  2HD5 B;  4W9C A;  1ZSQ A;  3N3K B;  5EFX A;  2NBU A;  2MWN B;  3PG7 A;  4ZRI A;  1WJM A;  1E8X A;  5LXI B;  1FHW A;  1W1D A;  4DX8 A;  3IHP C;  2NCN A;  4AP4 C;  4I6P A;  4K2O A;  2EC1 A;  5L83 A;  4ANX A;  5IAA C;  5L95 C;  2K2U A;  1MIX A;  1WZ0 A;  4G11 A;  2IO0 B;  1LM8 B;  5D3W A;  3T9L A;  3P6A A;  1WMH B;  4URK A;  3GOE A;  1M94 A;  4F7U P;  4HAU B;  2GBN A;  1XT9 B;  4CHM A;  4F7H A;  3TFM A;  2RGF A;  2ADZ A;  2G4D B;  5JH5 C;  3HIZ A;  2AEH A;  4LDT D;  4K7U A;  4A6F A;  3PSE B;  2P0H A;  1WH3 A;  2ZPN A;  3PSC A;  5DH9 B;  3A98 B;  1GUA B;  3DPD A;  3WIM A;  3AU5 A;  5AZF A;  4I6N B;  3L13 A;  2JRH A;  4BBN F;  3AXC A;  2LRU A;  4E74 A;  4MJS B;  4DWF A;  2HJ8 A;  1PMS A;  3EHV A;  2YVC A;  1MAI A;  2C9W B;  1WXS A;  4GN1 A;  1UPQ A;  4A5K A;  2N9E B;  1DDV A;  3IBE A;  5DHF B;  4FUL A;  4IWO A;  3RCP A;  2DA0 A;  2L0F A;  4NQL B;  4BKS D;  4DHZ E;  2C7M B;  2DX5 A;  1U5F A;  1TBE A;  2YRY A;  1EF5 A;  1GG3 A;  2KC2 A;  2ZNV B;  1R4M I;  2O2V B;  1LW3 A;  2P8V A;  1TJ6 A;  5HE0 A;  4AJY B;  4LJP B;  3PHX B;  3ZIM A;  2IZV B;  5DHA B;  1MIZ B;  2YT1 A;  2L0T A;  5KQ4 A;  3ULC A;  4HPL B;  3NY5 A;  4FJY A;  1WGH A;  1S3S G;  1SHC A;  3PRM B;  2KDI A;  4KIK B;  1WXV A;  3IVF A;  2W2X D;  2MA9 B;  2KN5 A;  4W9I A;  1ZVR A;  2JF5 A;  2L3Z A;  3VHT C;  2D10 A;  3A4S C;  2Z59 B;  4M0W B;  1J0G A;  3R66 C;  3ENE A;  3T06 A;  3TL5 A;  5IA7 A;  3T8M A;  5J3Y A;  3VOQ A;  2ELA A;  2KUP A;  2K8B A;  1UBI A;  1FHX A;  2CKH B;  4IM2 A;  4XZ4 A;  2RSU A;  4F8C B;  1WIA A;  3A1Q A;  2JVC A;  1P98 A;  2L8J A;  4Z2N A;  2MBO A;  2LZ6 A;  3L16 A;  1V5M A;  2KDB A;  2DZJ A;  1UEL A;  4G0N B;  2EKE C;  3CXB B;  3NSU A;  4NQK E;  5HKH A;  1WFY A;  2XQN M;  4HCN B;  2DYO A;  2LD9 A;  4IWQ A;  2KMA A;  5CHF A;  3ML4 A;  3SDL C;  3M63 B;  1NTY A; 
#chains in the Genus database with same CATH topology
 2V3S A;  3ZNZ B;  3ZUN A;  3KUC B;  1RM6 C;  4JIO U;  3IXS A;  2KLC A;  4XWW A;  2KIE A;  2Z0D B;  5KQ1 A;  4YSY B;  3P63 A;  2AWT A;  3PRP B;  2MRP A;  3NVW A;  5HE2 A;  2FID A;  4CHK A;  1N61 A;  4LNN A;  1VRA B;  1Z2M A;  1YIW A;  1LGR A;  1FMA D;  3NRZ A;  4DHJ B;  3KW5 B;  1UWX A;  3ZGZ A;  4B0M A;  5FR3 A;  2QCZ A;  3NVZ A;  3TMP B;  3WAN A;  2KTR A;  1X86 A;  1F9J A;  4DK5 A;  2KWC A;  3KYC D;  4NJ7 A;  4LLG M;  3T3N A;  4BVU C;  3JSV A;  1G6J A;  2MDX A;  2NTS A;  1I2H A;  1UNR A;  3P2B A;  4LJO B;  1XLP A;  3UQA A;  1C3T A;  3ZDM C;  1V1O A;  4IC7 B;  4JPS A;  1PYW D;  4P7I A;  4AWJ A;  4US8 A;  1NDD A;  2W3R A;  1TYG B;  2EEL A;  2K6D B;  3FKY A;  2RSG A;  4RGT A;  2NS5 A;  3T3O A;  4S17 A;  5C23 A;  1ROE A;  1FRR A;  1RYJ A;  2GI9 A;  2I1J A;  3EC8 A;  4MM3 B;  2LEK A;  4USA A;  2M0A A;  1YQ4 B;  2UZR A;  2X8X X;  2L05 A;  3RUI B;  2WX1 A;  4H8S A;  1FFU A;  1PGX A;  4JWS C;  3N20 C;  2G1E A;  4GDL A;  4KZ0 A;  3Q6B A;  1F2R I;  3DOW A;  4DXG A;  1MVK A;  5AZG A;  5J18 A;  1L0V B;  2OTX A;  3TEZ A;  2WXQ A;  2FCN A;  4NAM A;  2V4I B;  1FM0 D;  2JXT A;  2MW5 A;  1V86 A;  2GBJ A;  2WU5 B;  4GIV A;  1EU4 A;  5AUK A;  3ZNH B;  1LXD A;  2RLO A;  5D2M B;  3VFK A;  4I6L B;  4HJK A;  1ENF A;  4ZYN A;  3UGB B;  4OW0 A;  4IUM B;  2KN4 A;  2BW2 A;  2V4L A;  4AS1 A;  3DCX A;  4DXA B;  4NY0 A;  4F1S A;  3MC9 A;  3WAP A;  1Q10 A;  2WXH A;  2KQ4 X;  2IND C;  2AYO B;  3A33 B;  1FXT B;  2XN9 C;  2R09 A;  2LUL A;  4D0N B;  3VAW A;  1WYW B;  1KI1 B;  1V1P B;  2H7D A;  4FLH A;  4B0E A;  3H6N A;  1FHO A;  3ML9 A;  2ZCC A;  4KHA A;  3NHE B;  2YSZ A;  1T3Q A;  5CHV C;  2MSE D;  2IO2 B;  3MTN B;  5E6O A;  3RNG C;  1ZDX A;  1KJT A;  3VTU A;  2LHE A;  2VSZ A;  2FUG 1;  4ZHO A;  1SXT A;  4DHZ B;  4A20 A;  3ULB A;  3R3M A;  1E10 A;  2DHK A;  1JWB D;  2QEJ C;  2KWU B;  2D9Y A;  1WI0 A;  2NPT B;  2WX0 A;  2INP E;  4FAD A;  4OHJ A;  4DDG D;  2ELB A;  3AUL A;  3AMZ A;  3HSA A;  4A90 A;  3EUB 2;  2KHW B;  1SEB D;  2KT7 A;  1P3Q U;  5C5B B;  1Q67 A;  1IPG A;  4QJ5 B;  2K1F A;  4FXC A;  3QIJ A;  4GDK B;  3CF6 E;  2HJ1 A;  1WZ3 A;  2CAY A;  2JWZ A;  4HSI A;  4JWU C;  3CST A;  2B3A A;  2J0M A;  3TW1 A;  1V5O A;  1XCT L;  2FNJ B;  4TKN A;  3H9D A;  2GMI C;  2O6V A;  1BXT A;  4RGM A;  4TQ0 A;  2OJW A;  2PTL A;  1XR0 B;  5D6J B;  3DXC A;  5AUI A;  1B1Z A;  3CIK A;  3KUD B;  4RH6 A;  2BPS A;  4W9K A;  4JE3 B;  4WAF A;  2JPH A;  1WMH A;  1SE4 A;  3ZRF A;  2KIG A;  3PLU A;  1TGZ B;  3TUO A;  3C19 A;  1FGZ A;  2Y5P A;  2W2X C;  1LB1 A;  3KVF B;  4HJG E;  1N62 A;  1R7S A;  1M4V A;  5CX3 A;  2LUE A;  5C6R A;  4C80 A;  2KTF A;  1BT0 A;  5IOI A;  3TVV A;  1V6E A;  3W1S A;  3RUL A;  4C00 A;  1GC7 A;  2Z4D A;  4HDO A;  1DOI A;  1MI0 A;  1WXA A;  2PKO A;  4YSZ B;  2BBC A;  2ZJD A;  4PK1 A;  1WYG A;  3SHQ A;  2NVU I;  4BOZ B;  1MKE A;  3UF8 A;  1QIL A;  3QK0 A;  2N0S B;  1WXQ A;  3ZTD A;  5BMH A;  3RNB C;  1UWM A;  4M8M A;  2VZK D;  3ZW3 A;  3B08 A;  2D2Q A;  3AE8 B;  4OZC A;  4MK0 A;  3TEY A;  2K3U A;  1V8C A;  4MJS A;  4K2P A;  1R4N I;  3QWZ B;  4GZU A;  3KWL A;  3A9K B;  1P1A A;  2DFK A;  2KX0 A;  4QAY A;  2K0P A;  2XNA C;  3DBL B;  2KWD A;  5E6N A;  4M8N A;  1V2Y A;  1FEH A;  3P4P B;  2KO3 A;  2PE6 B;  3N7C A;  1TZ1 A;  4MDK E;  2ONQ A;  1RRP B;  2EJ8 A;  3QJZ A;  2QJL A;  2NR2 A;  2WXI A;  2BQQ A;  1WM3 A;  1HQR D;  2NZ8 B;  1XCQ L;  1QKZ A;  2DHJ A;  1I42 A;  1ZP0 B;  1MHX A;  3K9O B;  4IDI A;  2INC C;  4TUU A;  2AX5 A;  3AH7 A;  4WJO A;  2DYQ A;  4DXF A;  2FIF A;  2NMQ A;  5LG4 B;  4PS8 A;  4TSS A;  1IBX A;  2ROZ B;  1TXD A;  2QHO A;  1JWA D;  1OY2 A;  5HE3 A;  1KOT A;  3BK2 A;  3N32 A;  3MDB C;  1S1Q B;  1TTN A;  2ACZ B;  2MEK A;  2W82 A;  1Y5O A;  5CLQ B;  2KFK B;  3H7P B;  4W9F A;  2MLB A;  4DX9 0;  3APF A;  1J0W A;  2J53 A;  4YSX B;  2WHI A;  2YT0 A;  2GJY A;  1SJE D;  1ZPS A;  4KDL B;  3VR8 B;  2QKL A;  2C7N B;  1GAQ B;  2IPK D;  5D3I B;  1WX8 A;  2BCJ A;  3BVG A;  1EU3 A;  2WYQ A;  4HB4 B;  4DBB A;  1YN5 A;  2KQ7 A;  3BII D;  4OVZ A;  3UIO B;  2PPH A;  3D8E A;  4YWG G;  1ET6 A;  2PE9 A;  4WJQ A;  1WXM A;  2K8H A;  4EUT A;  3VVW B;  3PZD A;  1OEY J;  4US9 A;  5BMI A;  4XE0 A;  2PVO D;  2RDB C;  4GB9 A;  2CU1 A;  4AJW A;  3Q8C A;  1BUI C;  3ZJV A;  2WU2 B;  3N30 A;  1D6E C;  2Y8G A;  4HRS A;  2AL3 A;  1XLO A;  2G45 B;  3KLS X;  1WF9 A;  4ICU A;  2RGN B;  3A8Q A;  2IGD A;  4PS7 A;  3AB5 A;  3MFG A;  1K50 A;  1MG8 A;  2JWU A;  2MJ3 A;  4HAV B;  2E6X A;  1VZ8 A;  4HPP A;  1BAK A;  1PQS A;  2OQB A;  4B95 A;  3U4E G;  5EDS A;  1FNU A;  1OQY A;  2KX3 A;  1FO4 A;  4MSQ B;  1OMW A;  4HKQ A;  1GC6 A;  4IW0 A;  4FBJ B;  2I2Y A;  4MEM A;  2N9X A;  3DHG C;  3Q3O C;  3VXW A;  1D5X C;  3B1L X;  4EKU A;  1WVH A;  2W55 A;  1VD2 A;  4DHJ D;  1Q5W B;  2RD0 A;  1SE2 A;  1U27 A;  2D07 B;  2WNM A;  2WDV B;  1Z87 A;  1CZP A;  2VH1 A;  2WXO A;  2ZW1 A;  1QOG A;  1YOV B;  4XWT A;  1XQQ A;  3PRZ A;  1VZ6 A;  2V9H A;  1U5G A;  5C79 A;  5JHA A;  2PJH A;  2V1Y A;  3DCG A;  5J3T A;  3FC4 A;  3QC8 B;  2J4X A;  1AQC A;  2RPQ A;  3KWV A;  5KHO A;  4HRO A;  2DZI A;  2KJR A;  1EO6 A;  2LJI A;  2FUH B;  5D27 A;  4CYE A;  1JAL A;  5KCV A;  4LNK A;  1T0Q C;  4BKS A;  1NBF C;  2J52 A;  5T8I A;  3M95 A;  3VUW A;  2AL6 A;  5TSS A;  1WGQ A;  1X11 A;  4HAX B;  3HM3 A;  4BAX A;  5J3Q A;  2LJ5 A;  4IAP A;  1UH6 A;  1EGX A;  3OG5 A;  1SSN A;  1Z5S B;  3MJW A;  2FJL A;  5GMV A;  3AE2 B;  3QQ8 B;  2Y8F A;  5FR6 A;  5JHH A;  1U5E A;  1Y19 B;  4WQO B;  2A4Z A;  2K39 A;  4KZC A;  4FA6 A;  1ZXI A;  4ICV A;  1XD3 B;  2LGS A;  1BML C;  1FXI A;  2DLW A;  4HAT B;  2W2W A;  1K5G B;  3UI3 A;  4B9K A;  2D3C A;  4B6H A;  1V80 A;  2LGX A;  1ZXH A;  3OLM D;  4FN2 A;  3A58 A;  4W9E A;  3NS8 A;  3F0W A;  4GGQ A;  2CS4 A;  4MM3 A;  2KJ6 A;  3AEA B;  5GOW B;  4J6I A;  4WAA A;  5DPS A;  3KH0 A;  5AEK B;  5M4Y B;  1AW7 A;  5L81 A;  4NSW A;  3BWU D;  3TEW A;  1DDM A;  3W1S C;  1GB4 A;  4JX1 C;  1E8Y A;  3WYF B;  4LNF A;  1LFD A;  3SFE B;  2JT4 B;  2QIE B;  4MAC A;  2KR0 A;  2KFJ A;  2FCS A;  2N9L A;  4LDT B;  2YS1 A;  4HKZ E;  3AV8 A;  1M7E A;  4ZRK A;  1WJU A;  4XYC A;  1QLB B;  2WXK A;  3CWI A;  3HRD D;  2NMB A;  3DVG X;  4II3 B;  4L6E A;  3H7S A;  5HI1 A;  4L1R A;  4ARI A;  2HTH B;  2EMT A;  4Y94 A;  3SYX A;  1OGW A;  4K3C A;  1KLU D;  1OQN A;  4GOU A;  3HVZ A;  2JXX A;  1L4Z B;  2V0G A;  5DI9 B;  4MGK E;  4A6Q A;  4OZB A;  4WIP A;  4YTN B;  4S0R A;  3VR9 B;  2K8C A;  4LK0 M;  1WWT A;  3B0A A;  3PRE A;  4MT7 A;  1SGH A;  3V62 A;  2LAS A;  3PEG A;  3URY A;  2EKI A;  2WXM A;  3UIP B;  3DDC B;  1L7Y A;  3KQ4 A;  2XBB C;  3RNA C;  5E6P A;  3ZKJ C;  2WS3 B;  1RFK A;  2DNF A;  1QZE A;  4A6K A;  2DYM A;  2D3A A;  3VRB B;  3DBS A;  3DWG C;  2DX1 A;  1IYF A;  3D32 A;  2KVR A;  3Q3M C;  5I2M A;  3W5U B;  2MBQ A;  1ET9 A;  2J0K A;  2COD A;  2IBI B;  3MHS D;  2VRR B;  2LOZ A;  2ZPY A;  3DVN V;  5JLJ B;  3P4R B;  1KM7 A;  2JYT A;  5C16 A;  1MJD A;  3G9W A;  5G5G A;  1WG7 A;  2GS0 A;  4GSW A;  3TSS A;  2CRF A;  5D3V A;  2ZZP B;  3IFW B;  1F52 A;  1U2B A;  4XGA B;  1C9F A;  3B77 A;  3MC8 A;  1YJI A;  4MGI E;  2RVB B;  3SR6 A;  3AEB B;  4HB2 B;  1K5D B;  3D8F A;  3EFU A;  2X18 A;  3AEF B;  4ARC A;  4EZJ A;  2CHX A;  1HTQ A;  2QDF A;  3KUZ A;  1E8W A;  5J17 A;  5C5B A;  3DBH I;  2GUM A;  1F1H A;  1KLV A;  1WJN A;  1AWD A;  3P4Q B;  3A1Q B;  1VCB A;  2J42 A;  2LGD A;  2BTE A;  3RZW C;  2BS4 B;  3A4R A;  1W1G A;  1KZ7 A;  1Q0W B;  1V49 A;  4MH8 A;  3LXF A;  2VRW B;  1ACC A;  2BGF A;  5G2N A;  2UWQ A;  3N9Y C;  1MPE A;  4C4V B;  2WQY B;  2LVQ A;  1QOA A;  2ZVO A;  2BT6 A;  2RMM A;  2KD0 A;  3PHW B;  3PGE A;  1FXA A;  3N1Z C;  4FJZ A;  1Y56 A;  4K7W A;  1ZDV A;  3NZU A;  1J7A A;  2MBE A;  4OZA A;  2J0J A;  3W1Y A;  1UPR A;  1ZM0 A;  3KRX A;  4DBG A;  2BYE A;  1FNV A;  1I4G A;  3NWA A;  4RMA A;  1FCC C;  2DZM A;  1LO5 D;  4OVV A;  2D3B A;  2DAJ A;  4YON A;  3LB8 C;  3OJ3 A;  3I5J C;  2AQ1 B;  4RM9 A;  1FNW A;  1RFA A;  3PLV A;  2EMS A;  1EUV B;  1IRS A;  3AN1 A;  2Y7B A;  3QA8 A;  1VJK A;  4PQ0 A;  3M62 B;  1EWY C;  1UNQ A;  2IDY A;  3J9C A;  1WR1 A;  4LNI A;  1M7R A;  2KDE B;  2NBV A;  3DXE A;  1ZKH A;  1WGG A;  3ZNI D;  2IY0 B;  4TQ1 A;  3MP9 A;  4OT1 A;  1FGY A;  1VZ7 A;  2N7E A;  1WY8 A;  1YNT E;  1FCL A;  1SIJ A;  3GZN B;  1WX7 A;  4GPT B;  4GOC A;  3IT4 B;  4MSM B;  2PZ1 A;  1WRD B;  4F7Z A;  1VDV A;  4K17 A;  4FHK A;  5IRS A;  1F77 A;  2DTC A;  3X23 A;  2KTR B;  2PEA A;  4NAW A;  3A9K A;  3DBR B;  3ODW A;  3APD A;  4H2A A;  1X1F A;  1F2R C;  1MPH A;  3SU8 X;  2KAN A;  2L83 A;  4CHJ A;  4WVF B;  3ZRC A;  4AUQ C;  2J7Q B;  1TY2 A;  1JCK B;  2QSD A;  1T5X D;  1TS2 A;  1IGD A;  5CHW A;  4YTM B;  4C0A A;  5AZH A;  1D3Z A;  4EZL A;  4FHJ A;  4ZRP A;  1YMH E;  3FIL A;  2FE8 A;  3IAM 1;  3U8Z A;  3ZJT A;  2GCL A;  2BWE S;  5D3X A;  4HEA 1;  5BYR A;  5FI0 A;  2NBW B;  2LG1 A;  1QOB A;  2BYV E;  1LQB A;  1D4B A;  2JX5 A;  3PP2 A;  3B9J A;  4GLS C;  2OOB B;  1WJ1 A;  4C7Y A;  2N1V A;  2BKF A;  3ZVV A;  1DRO A;  1ZOY B;  3BYT B;  4KDI C;  5BO4 B;  1I7H A;  2KQS A;  4ANV A;  1PLS A;  2Y5B B;  2MJE A;  1WRI A;  3H7P A;  4HAW B;  1TKY A;  1UEF A;  4M01 A;  4N9F 4;  2I5F A;  1SJH D;  3PV1 A;  3Q2A C;  2H7E A;  2D11 A;  1I7A A;  1E9M A;  3GE3 C;  3FM8 C;  2SAK A;  5D7G A;  2M1M A;  1V5U A;  3RZF A;  4BBN C;  2L32 A;  1V81 A;  2ROV A;  4GMV A;  1RLF A;  2M19 A;  5C1Z A;  1X1G A;  1P0R A;  1NEK B;  2Z0Q A;  4NJC A;  4IOY X;  2CHW A;  2MCN B;  3WA0 A;  4OVU A;  5H92 C;  1CK1 A;  2KUQ A;  1WE6 A;  2JY6 A;  1YX6 B;  2WDR B;  1U4A A;  2M8S A;  1N63 A;  2K2J A;  2QKM A;  3HHM A;  3DQV A;  2RNR B;  1KF6 B;  2Z13 A;  5BMG A;  1SE3 A;  4GXB A;  2KMM A;  1TT5 B;  2JYE A;  4K1R B;  4NNJ B;  5D3Y A;  3UIN B;  5EE1 A;  5IP4 D;  2IYB A;  5H8Y E;  4BKG A;  3PS6 A;  2OJR A;  1H4R A;  3MC0 B;  3V60 A;  2L52 A;  3AE9 B;  1ZYI A;  1T0R C;  2YS3 A;  1ISN A;  3QWM A;  2L2I A;  4B6W A;  2PVG C;  1H8C A;  2CY5 A;  2IO1 B;  3PVL A;  1TZO A;  2IJ0 A;  3GYP A;  4TYZ A;  3ZQ4 A;  2YS5 A;  1RRB A;  2G4S A;  4F7G A;  4BKT A;  2M38 A;  2K49 A;  4IG7 B;  2K00 A;  2BB5 A;  3V6C B;  1WGU A;  4KAX B;  2Z0P A;  5FK9 C;  4HLE A;  3W2D A;  4ANU A;  1MHH E;  3BY4 B;  3I3T B;  1V88 A;  1TKE A;  2WDQ B;  1GNU A;  1E0Z A;  2CHZ A;  2ZKM X;  1D5M C;  1TKG A;  2MP2 B;  3N1X C;  2CU3 A;  1C4A A;  1T6B X;  3BVM A;  3R8B A;  2N4F A;  1HE8 A;  3EGR A;  4MT5 A;  5FKA C;  3Q14 C;  2J59 M;  2H89 B;  2O2V A;  2P0D A;  4PS3 A;  3ZTC A;  1FIQ A;  4ASW C;  3PVU A;  4EZK A;  1CJE A;  2DEN B;  3QHT A;  3NS1 A;  2ZW0 A;  2BYF A;  3ETR A;  2COA A;  3V6E B;  1U29 A;  3DWM A;  2COF A;  1P9D U;  3Q8A A;  3PPA A;  4RGO S;  5FI1 A;  1MK9 B;  1YD8 U;  2UYZ B;  3ZXV A;  2JZ3 B;  4P1B C;  3DHH C;  3W5V B;  3ZNG C;  3ML8 A;  3RD2 A;  3AM9 A;  1F0Z A;  3PVW A;  2D5G A;  2LVO A;  2O6V B;  1QOF A;  1EAZ A;  3OJ4 B;  1TQZ A;  4KIK A;  2W54 A;  2Q5W D;  4D6W A;  4LNO A;  2WXJ A;  3PZ8 A;  1SIF A;  5LNK 1;  3V05 A;  3ALB A;  3QBV B;  5JP4 A;  2Z59 A;  4M0W A;  1EF1 A;  3HW2 B;  3LDZ E;  1R4M B;  3QAQ A;  4AOF A;  3DXD A;  2LGI A;  1P7E A;  4MEL A;  2REX A;  2ASQ A;  3Q8F A;  4HVB A;  5IN7 A;  5I2S A;  4MGZ E;  3DBL I;  1H10 A;  2WXP A;  3VDZ A;  1UBQ A;  3AJ4 A;  4QXA B;  2BWF A;  2DZK A;  4O1N A;  4HB3 B;  2R61 A;  4IM0 A;  2M14 A;  1RWS A;  1A70 A;  3U2S C;  1JRP A;  3WAL A;  2IFS A;  2FCQ A;  2K22 A;  1QT9 A;  4WWO A;  3KSY A;  1CMX B;  5MPO A;  2BKR B;  2JZZ A;  2M0X A;  4JQW C;  2JZP A;  2RR9 A;  4HDQ A;  2KVZ A;  4YTP B;  1HXY D;  2R2O A;  2WXF A;  2XK5 B;  1ZW7 A;  3NWD A;  4HAZ B;  1P6S A;  3JVZ X;  1K8R B;  3A9J B;  2L76 A;  2WXG A;  1BWN A;  4ZOH C;  3FSS A;  2G35 A;  4II2 B;  1C1Y B;  2DKQ A;  2N23 A;  1K53 A;  1OQQ A;  1KZG A;  4A9A A;  4P16 A;  1AN8 A;  1XKE A;  2DHI A;  1WGD A;  1ZC3 B;  4A3P A;  3RNC C;  3OWE B;  4N6E B;  4PNK A;  3VRA B;  1AAR A;  3V61 A;  1KLG D;  3VTV A;  1V89 A;  3GS2 A;  4PYU A;  2Z0O A;  4RGN A;  5D94 A;  2KDF B;  3KRW A;  1Y8R C;  1C78 A;  3TBL D;  2M56 B;  2DYN A;  4KSL C;  1E7U A;  2JSV X;  4ITK A;  3EEC A;  1X05 A;  2RUK B;  4HHV A;  1TS3 A;  2HTH A;  3W9C B;  1FAO A;  1WGK A;  3L08 A;  3HK0 A;  4L2Y A;  1XF5 L;  1UUP A;  3FEH A;  4G50 A;  1J7B A;  5J2R A;  2V3N A;  5C3J B;  2W9N A;  4YXD B;  4X57 B;  4DQO C;  1SBB B;  1P7F A;  1IBX B;  4MY6 A;  2N9K A;  2I5C A;  2BS3 B;  3K9P B;  2BVC A;  1EVH A;  3P4S B;  2L00 B;  3SUZ A;  3IT6 B;  5DPW A;  2D9W A;  1TS5 A;  1IP9 A;  3EFC A;  2FAZ A;  1DOX A;  1WX9 A;  1UD7 A;  2LXC A;  5DPR A;  2KYW A;  2LYD A;  5JHB A;  1JRO A;  1HEZ E;  5LXH A;  1E8Z A;  1L5P A;  3ZJU A;  1N60 A;  2JP2 A;  2UZS A;  4KKJ A;  3ODX A;  3VTW A;  4A8X C;  1FD6 A;  4W9H A;  2R2Q A;  4WJP A;  3RYT A;  1PFJ A;  1DDW A;  4ZRQ A;  3H1U A;  4CSQ A;  4D2K A;  4TV3 A;  3Q8B A;  4A6F B;  4G3X B;  3WAM A;  1XX0 A;  1T0S C;  1PFD A;  3DVG Y;  2DAF A;  2UU7 A;  1BTN A;  2GLS A;  3RPF C;  4KVG B;  3CSF A;  4YL8 A;  3I63 C;  5G55 A;  2COC A;  2L7R A;  1E7V A;  1HTO A;  4N59 A;  2B76 B;  2LMC A;  4XX5 A;  4PYZ A;  3NZS A;  1NVI D;  3NUH B;  3KZ1 A;  1OTR B;  4A6H A;  2Z0E B;  4K7S A;  3AE5 B;  5I4D A;  2YLM A;  3RT3 B;  1V9J A;  3Q3N C;  2KLG A;  3ZYY X;  4K81 A;  3A8P A;  2JUO A;  4GU2 A;  2M4N A;  3KY9 A;  5D3D A;  1P3R A;  5C2T B;  4E3C A;  3JYU A;  2ZVN A;  3NW8 A;  4IFS A;  4BFR A;  4C4V A;  2YEP F;  1SF0 A;  1NU2 A;  3ZDT A;  2JRI B;  5JHG A;  4BOS C;  2FJU B;  4NJ6 A;  4WJN A;  4W9G A;  3VUX A;  2K25 A;  2E2X A;  2VKI A;  2CJO A;  2CY4 A;  4BBK A;  3VIA A;  4GMX B;  2Z14 A;  3B2F A;  3EA6 A;  2WWZ A;  2N9P C;  4XWX A;  2DX5 B;  3CIR B;  4WH4 A;  2DWQ A;  2QC8 A;  3BIN A;  2INN E;  3SFD B;  1E7P B;  1V5T A;  3N1Y C;  2WGS A;  3CMM B;  3O65 B;  3SEB A;  2KAC A;  1TY0 A;  3WCQ A;  1QC6 A;  4IM3 A;  3F5R A;  3VUY A;  1PUT A;  2ZCB A;  1L2N A;  4KHB B;  2K6Q A;  5GXG B;  1XD4 A;  3ZVR A;  4CO7 A;  3FVC A;  2DLB A;  5CTR C;  1L0X B;  3IG3 A;  4KV2 A;  5DCN A;  5HHD G;  1V1P A;  3BJI A;  2YF0 A;  1MK7 B;  3L10 B;  5CLL B;  4JLC A;  3GB1 A;  4WSF A;  2LKO A;  3BYY B;  3AE7 B;  3X0W A;  4KHO A;  3KYD D;  2GBK A;  4RFB A;  3LJU X;  1YN3 A;  4IWP A;  1YQB A;  2ZNV C;  3SV1 A;  3P42 A;  5EE0 A;  3SD5 A;  4M02 A;  2N7D A;  1WE7 A;  3PO0 A;  2OHF A;  2MBB B;  1JRU A;  3U7D A;  3NWF A;  4M00 A;  5JZE B;  2MKR A;  2HDE A;  2KZR A;  1IUE A;  2N1W A;  1WM2 A;  1WSP A;  2X38 A;  2BF8 B;  1N3H A;  4W9L A;  2GRI A;  3R7Q A;  4LCD E;  2PIA A;  3R2I A;  1T0Y A;  1IGC A;  2LRW A;  2V76 A;  2NPT A;  3VQI A;  4EJN A;  2G3Q B;  2IYD B;  4R3D A;  3Q69 A;  2BYT A;  1TS4 A;  4RM8 A;  4Z2M B;  2A5U A;  4W9D A;  2KNB A;  2LHD A;  2KJH B;  5HE1 A;  4WJ7 A;  4GDK A;  3R7R A;  4A3O A;  4EE2 A;  1I4H A;  1WGR A;  5LON B;  2MX2 A;  1UNP A;  2WXL A;  2LOX A;  3Q8E A;  4FJV B;  3PT2 B;  2C5L C;  4REZ A;  3RCZ A;  4IKG A;  1K51 A;  3M1I B;  4WWN A;  1J7C A;  3D8D A;  3L54 A;  1SE9 A;  3RFZ B;  5BYS A;  1ZC4 B;  4L1B A;  4ZDV A;  3MPX A;  3VH3 B;  2YT2 A;  3ZXR A;  1ZGU B;  3AEG B;  1XCG A;  1DYN A;  3R2T A;  1D5Z C;  1JWU D;  4ZRJ A;  5TR5 A;  4WWM A;  3U30 A;  2KCJ A;  1YX5 B;  3VH4 B;  4KX6 B;  3NVV A;  1VLB A;  1JW9 D;  1UZX B;  4EMO A;  4W9J A;  3UQB A;  3HQC A;  2MH7 A;  4P6V F;  1XEE A;  2CR5 A;  1P5T A;  1I4P A;  2KK8 A;  3RNE C;  3NOB A;  4DDI D;  3JW0 X;  2MQJ A;  3OHM B;  3TO1 A;  3P7Z A;  1XLN A;  4J3O D;  1QF6 A;  1I35 A;  2IO3 B;  5KHQ A;  2KGX B;  2P0F A;  1E90 A;  1T77 A;  2LGY A;  2C60 A;  2HTM E;  1B9R A;  3TJP A;  4WWP A;  2K5P A;  2GBR A;  1C4P A;  1FFV A;  3Q3J A;  2R2Y A;  2DKP A;  3GYO A;  3NG0 A;  4E71 A;  3P1M A;  2RDG A;  5DPT A;  2PMV A;  2DHZ A;  3AE6 B;  5JXV A;  4L23 A;  2N0Y A;  4MGY E;  3SO6 A;  1XXG A;  3AE1 B;  1DBH A;  3AI5 A;  3AEC B;  3MJ5 A;  2IY1 B;  1ZE3 D;  1J19 A;  1NTV A;  1UGJ A;  4UDU C;  1V97 A;  2DYB A;  2QIL A;  1WGY A;  2WDT B;  3DVN U;  3O13 A;  2W3S A;  2K9X A;  1JQ4 A;  3MHZ A;  1RAX A;  1NYQ A;  3AEE B;  3JSV B;  2MWS B;  2LFI A;  2KOX A;  2KKC A;  4C7Z A;  4CQN A;  1RJ2 A;  2MBH A;  2D9V A;  2AQ2 B;  1PGB A;  1STE A;  1WJ4 A;  2L1A A;  3PZ7 A;  4KGT A;  3PTF C;  4EFO A;  4EOY A;  1NI2 A;  4WUR A;  3WAO A;  2D9X A;  2O6V D;  2KMC A;  1FOE A;  2MP2 A;  3FAH A;  4JGH B;  3HM6 X;  5DIF B;  1C4C A;  2Q13 A;  3RN9 C;  1WR6 E;  3BVZ A;  2D3G A;  1TJE A;  1YJJ A;  1E5W A;  1X1M A;  3OAN A;  2QMT A;  3E56 A;  1B55 A;  1V61 A;  4HWI B;  1OQR A;  1WJ6 A;  1A5R A;  1XOD A;  2UVM A;  4EEW A;  1PDX A;  3GP7 A;  1R4N B;  3ZO5 B;  4RCO A;  1U5D A;  2TSS A;  3C0R B;  2KFK A;  4GDL B;  3SNH A;  2MFQ A;  3Q3F A;  2LVP A;  2GCJ A;  5LOP B;  1QQG A;  3O96 A;  2XEW A;  2I1K A;  1UNS A;  1GB1 A;  2L1C A;  1FB8 A;  2YEP B;  3ONS A;  3L17 A;  3GZN I;  2I38 A;  1DGJ A;  1BTK A;  2BB6 A;  2WXR A;  2GOW A;  2D9Z A;  2LI5 A;  4JL9 A;  5LLI A;  1QQR A;  3ECI A;  4ANW A;  4MH0 E;  4NPN A;  1ZUD 2;  3AU4 A;  2HE7 A;  2Y5C A;  3ODO A;  3DBR I;  4HK2 A;  2C7H A;  3UZT A;  3OAW A;  2LXA A;  3LJ3 A;  2KWV B;  2KC1 A;  4HB0 B;  3QCA A;  2FCM A;  4RF1 A;  4C56 C;  3TCA A;  3S2A A;  3HIE A;  4NZL B;  2H88 B;  4XC2 A;  4YT0 B;  1J8C A;  2VH2 A;  1GJZ A;  2GBM A;  3APC A;  2E3T A;  2DN6 A;  3L0W B;  3HUI A;  4PT5 A;  4HAY B;  3V5W A;  2K8E A;  2WP9 B;  4KSK C;  5HG2 A;  4XDC A;  2D4Q A;  2R0D A;  1KTK A;  3ABV B;  3AED B;  2KXJ A;  2NBV B;  3M3J A;  4HPM B;  2GB1 A;  1Q1O A;  2ZEQ A;  1W1H A;  3LYY A;  1WI1 A;  1UGM A;  3ZLZ A;  2XK5 A;  4KGR A;  3QAR A;  4TMA B;  2IGG A;  2M17 A;  3A9J A;  2SEB D;  3TIX A;  1OEY A;  4HCP B;  3QX1 A;  2MHJ A;  2IGH A;  4NAW B;  4RF0 A;  1YJ1 A;  1JWM D;  1AWE A;  2LWP A;  3AE4 B;  1NYR A;  4HXD A;  1V5P A;  4ACF A;  2HD5 B;  4W9C A;  1ZSQ A;  1SB3 C;  3N3K B;  5EFX A;  3B2G A;  2NBU A;  1GPX A;  4N58 A;  2MWN B;  3PG7 A;  4ZRI A;  1WJM A;  1E8X A;  1I4X A;  5LXI B;  1FHW A;  1W1D A;  4DX8 A;  3FIL B;  3IHP C;  2NCN A;  4AP4 C;  4I6P A;  4K2O A;  4DIX A;  2EC1 A;  1N5W A;  5L83 A;  3NZ3 A;  4ANX A;  5BYQ A;  5IAA C;  5L95 C;  2K2U A;  1MIX A;  1I4Q A;  1FRD A;  1WZ0 A;  1L6V A;  4G11 A;  2IO0 B;  1LM8 B;  4WQM A;  5D3W A;  1E6E B;  1OFF A;  2WLB A;  4K3B A;  1HZ5 A;  3T9L A;  3P6A A;  1WMH B;  4URK A;  3GOE A;  1M94 A;  1NEN B;  4F7U P;  4HAU B;  2GBN A;  1XT9 B;  1KRH A;  4CHM A;  2KDM A;  3U7Z A;  4F7H A;  3TFM A;  2RGF A;  2ADZ A;  2FBW B;  2PLP A;  2G4D B;  5JH5 C;  1CQV A;  3HIZ A;  2AEH A;  1DYQ A;  1L4D B;  4XDD A;  1I4R A;  4LDT D;  3I9V 1;  4K7U A;  5HFY A;  4A6F A;  3PSE B;  5IO9 A;  2P0H A;  1WH3 A;  2ZPN A;  3PSC A;  5DH9 B;  3A98 B;  1MFW A;  2JU6 X;  3C8Y A;  2JQR B;  1GUA B;  3DPD A;  3WIM A;  3BZD B;  3AU5 A;  5AZF A;  2OED A;  4I6N B;  4IOI E;  3L13 A;  2JRH A;  4BBN F;  3AXC A;  2LRU A;  4E74 A;  4ZYS A;  4MJS B;  4DWF A;  2HJ8 A;  3E9S A;  3IAS 1;  4OSN A;  2RPV A;  2Z8L A;  1PMS A;  3EHV A;  3BK1 A;  2YVC A;  1MAI A;  3U52 E;  2KAJ A;  3DHI C;  2C9W B;  3TEX A;  1WXS A;  4GN1 A;  1UPQ A;  3HVD A;  4A5K A;  2N9E B;  1DDV A;  3IBE A;  3V3X A;  5DHF B;  4FUL A;  4IWO A;  3RCP A;  4QJ3 B;  2ON8 A;  2DA0 A;  1KH0 A;  2WXN A;  2L0F A;  4NQL B;  4BKS D;  4Q2J A;  4DHZ E;  2C7M B;  5EE3 A;  2DX5 A;  1U5F A;  1TBE A;  1C76 A;  2VZK B;  2YRY A;  1EF5 A;  1GG3 A;  2KC2 A;  2ZNV B;  1HZ6 A;  1R4M I;  2O2V B;  1LW3 A;  2P8V A;  1TJ6 A;  4KHB A;  1YQ3 B;  1JML A;  5HE0 A;  4AJY B;  4LJP B;  3PHX B;  1XO3 A;  3ZIM A;  2IZV B;  5E6J A;  5DHA B;  1MIZ B;  4GNK B;  2YT1 A;  1DOY A;  2L0T A;  5KQ4 A;  2Y3A A;  3ULC A;  2CJN A;  1L0Y B;  4HPL B;  2PW9 A;  3NY5 A;  4FJY A;  2MJD A;  4KGS A;  1WGH A;  2AQ3 B;  1EM7 A;  1S3S G;  1SHC A;  3PRM B;  4A55 A;  2LUM A;  2KDI A;  1WXV A;  4KIK B;  3IVF A;  2W2X D;  2MA9 B;  3NJT A;  1VR9 A;  2KN5 A;  1YN4 A;  4W9I A;  1FPY A;  1ZVR A;  1L6U A;  2G9H D;  2JF5 A;  2L3Z A;  3GE8 C;  3VHT C;  2D10 A;  3A4S C;  4KKI A;  2Z59 B;  4M0W B;  1GOZ A;  3RNF C;  1J0G A;  3R66 C;  3U12 A;  1EWC A;  3RMK C;  1HA5 A;  3ENE A;  3NVY A;  3T06 A;  1KFY B;  3TL5 A;  5IA7 A;  4QJ4 B;  3T8M A;  5J3Y A;  3VOQ A;  2ELA A;  2KUP A;  2K8B A;  1C79 A;  1UBI A;  3RI7 C;  1UF0 A;  1FHX A;  2CKH B;  3H8H A;  4IM2 A;  4XZ4 A;  2RSU A;  4F8C B;  1WIA A;  3A1Q A;  4LTU A;  2RDH A;  2JVC A;  2V3P A;  1P98 A;  2DBY A;  4P1C C;  2ICI A;  1K52 A;  4BZA A;  2L8J A;  4Z2N A;  2MBO A;  1PGA A;  2LZ6 A;  5G5H A;  1JWS D;  2RRF A;  3L16 A;  1V5M A;  2KDB A;  2DZJ A;  1UEL A;  2N7J A;  1N6Z A;  4G0N B;  2EKE C;  3AE3 B;  1MG4 A;  5IKC M;  2NTT A;  1TIF A;  3CXB B;  3NSU A;  4NQK E;  3L4P A;  1WFY A;  5HKH A;  1XLQ A;  2XQN M;  4ZHP A;  4HCN B;  2DYO A;  4RNA A;  1NI3 A;  2LD9 A;  5EE9 A;  1AYF A;  4AQ7 A;  1MI1 A;  1ESF A;  4IWQ A;  1N5X A;  2KMA A;  5CHF A;  3ML4 A;  3DBH B;  1C77 A;  3I57 A;  3SDL C;  2BS2 B;  3M63 B;  1NTY A; 
#chains in the Genus database with same CATH homology
 2V3S A;  3ZNZ B;  3ZUN A;  3KUC B;  4JIO U;  2KLC A;  2Z0D B;  5KQ1 A;  2AWT A;  3PRP B;  2MRP A;  5HE2 A;  2FID A;  4CHK A;  1Z2M A;  1YIW A;  4DHJ B;  3KW5 B;  3TMP B;  3WAN A;  2KTR A;  1X86 A;  1F9J A;  4DK5 A;  2KWC A;  3KYC D;  4NJ7 A;  4BVU C;  3JSV A;  1G6J A;  2MDX A;  1I2H A;  1UNR A;  3P2B A;  4LJO B;  3UQA A;  1C3T A;  3ZDM C;  4IC7 B;  4P7I A;  4AWJ A;  1NDD A;  2K6D B;  2RSG A;  2NS5 A;  5C23 A;  2I1J A;  3EC8 A;  2UZR A;  2L05 A;  3RUI B;  2WX1 A;  4H8S A;  4GDL A;  4KZ0 A;  3DOW A;  5AZG A;  5J18 A;  2OTX A;  2FCN A;  2MW5 A;  1V86 A;  2GBJ A;  4GIV A;  3ZNH B;  1LXD A;  2RLO A;  5D2M B;  3VFK A;  4I6L B;  4HJK A;  4ZYN A;  3UGB B;  4IUM B;  2V4L A;  4DXA B;  4NY0 A;  4F1S A;  3WAP A;  2AYO B;  3A33 B;  1FXT B;  2R09 A;  2LUL A;  4D0N B;  3VAW A;  1WYW B;  1KI1 B;  2H7D A;  4FLH A;  3H6N A;  1FHO A;  3ML9 A;  2ZCC A;  4KHA A;  3NHE B;  2YSZ A;  5CHV C;  2MSE D;  2IO2 B;  3MTN B;  5E6O A;  1KJT A;  3VTU A;  2VSZ A;  4DHZ B;  4A20 A;  3ULB A;  3R3M A;  2DHK A;  2KWU B;  2D9Y A;  1WI0 A;  2NPT B;  2WX0 A;  4FAD A;  4DDG D;  2ELB A;  3AUL A;  2KHW B;  1P3Q U;  5C5B B;  1Q67 A;  1IPG A;  2K1F A;  3QIJ A;  4GDK B;  3CF6 E;  1WZ3 A;  2CAY A;  2JWZ A;  3CST A;  2B3A A;  2J0M A;  3TW1 A;  1V5O A;  2FNJ B;  4TKN A;  3H9D A;  2GMI C;  2O6V A;  4TQ0 A;  5D6J B;  1XR0 B;  3DXC A;  3CIK A;  3KUD B;  2BPS A;  4W9K A;  2JPH A;  1WMH A;  3ZRF A;  3PLU A;  1TGZ B;  1FGZ A;  2W2X C;  1LB1 A;  3KVF B;  5CX3 A;  2LUE A;  5C6R A;  2KTF A;  1BT0 A;  3TVV A;  1V6E A;  3W1S A;  3RUL A;  1GC7 A;  4HDO A;  1WXA A;  2ZJD A;  3SHQ A;  2NVU I;  4BOZ B;  1MKE A;  3UF8 A;  3QK0 A;  3ZTD A;  4M8M A;  3ZW3 A;  3B08 A;  2D2Q A;  4MK0 A;  4MJS A;  4K2P A;  1R4N I;  3QWZ B;  4GZU A;  3A9K B;  1P1A A;  2DFK A;  2KX0 A;  5E6N A;  4M8N A;  1V2Y A;  2KO3 A;  2PE6 B;  3N7C A;  1TZ1 A;  4MDK E;  1RRP B;  2EJ8 A;  3QJZ A;  2NR2 A;  1WM3 A;  2NZ8 B;  2DHJ A;  1I42 A;  3K9O B;  4TUU A;  4WJO A;  2DYQ A;  2FIF A;  4PS8 A;  2ROZ B;  1TXD A;  2QHO A;  1OY2 A;  5HE3 A;  1KOT A;  3N32 A;  3MDB C;  1S1Q B;  1TTN A;  1Y5O A;  5CLQ B;  2KFK B;  3H7P B;  4W9F A;  2MLB A;  4DX9 0;  3APF A;  1J0W A;  2YT0 A;  2GJY A;  4KDL B;  2QKL A;  2C7N B;  1WX8 A;  2BCJ A;  2WYQ A;  4HB4 B;  4DBB A;  2KQ7 A;  3UIO B;  2PPH A;  3D8E A;  2PE9 A;  4WJQ A;  1WXM A;  2K8H A;  4EUT A;  3VVW B;  3PZD A;  1OEY J;  4AJW A;  4GB9 A;  2CU1 A;  3N30 A;  2Y8G A;  2AL3 A;  2G45 B;  1WF9 A;  4ICU A;  2RGN B;  3A8Q A;  4PS7 A;  1MG8 A;  4HAV B;  1BAK A;  1PQS A;  2OQB A;  4B95 A;  5EDS A;  1OQY A;  2KX3 A;  4MSQ B;  1OMW A;  1GC6 A;  4IW0 A;  4FBJ B;  4MEM A;  2N9X A;  3VXW A;  3B1L X;  4EKU A;  1WVH A;  1VD2 A;  4DHJ D;  1Q5W B;  2RD0 A;  1U27 A;  2D07 B;  1Z87 A;  1XQQ A;  3PRZ A;  1U5G A;  5C79 A;  5JHA A;  2PJH A;  2V1Y A;  3DCG A;  5J3T A;  3QC8 B;  1AQC A;  2RPQ A;  5KHO A;  2DZI A;  2KJR A;  1EO6 A;  2FUH B;  5D27 A;  4CYE A;  5KCV A;  4BKS A;  1NBF C;  3M95 A;  3VUW A;  2AL6 A;  1WGQ A;  1X11 A;  4HAX B;  3HM3 A;  5J3Q A;  2LJ5 A;  4IAP A;  1UH6 A;  1EGX A;  1Z5S B;  3MJW A;  2FJL A;  5GMV A;  3QQ8 B;  2Y8F A;  5FR6 A;  5JHH A;  1U5E A;  1Y19 B;  4WQO B;  2A4Z A;  2K39 A;  4KZC A;  4FA6 A;  4ICV A;  1XD3 B;  2DLW A;  4HAT B;  2W2W A;  1K5G B;  4B9K A;  4B6H A;  1V80 A;  2LGX A;  3OLM D;  4FN2 A;  4W9E A;  3NS8 A;  3F0W A;  4GGQ A;  2CS4 A;  4MM3 A;  2KJ6 A;  5GOW B;  4J6I A;  4WAA A;  5DPS A;  3KH0 A;  5AEK B;  5L81 A;  4NSW A;  1DDM A;  3W1S C;  1E8Y A;  3WYF B;  1LFD A;  2JT4 B;  2KFJ A;  2FCS A;  4LDT B;  2YS1 A;  1M7E A;  4ZRK A;  1WJU A;  2NMB A;  3DVG X;  4II3 B;  4L6E A;  3H7S A;  2HTH B;  2EMT A;  4Y94 A;  3SYX A;  1OGW A;  1OQN A;  2JXX A;  5DI9 B;  4MGK E;  2K8C A;  3B0A A;  3PRE A;  4MT7 A;  1SGH A;  3V62 A;  2LAS A;  3PEG A;  3UIP B;  3DDC B;  1L7Y A;  2XBB C;  5E6P A;  3ZKJ C;  1QZE A;  4A6K A;  2DYM A;  3DBS A;  2DX1 A;  1IYF A;  3D32 A;  2KVR A;  2MBQ A;  2J0K A;  2COD A;  2IBI B;  3MHS D;  2VRR B;  2LOZ A;  2ZPY A;  3DVN V;  5JLJ B;  1KM7 A;  5C16 A;  3G9W A;  1WG7 A;  2GS0 A;  4GSW A;  2CRF A;  5D3V A;  2ZZP B;  3IFW B;  1U2B A;  4MGI E;  2RVB B;  4HB2 B;  1K5D B;  3D8F A;  3EFU A;  2X18 A;  4EZJ A;  2CHX A;  3KUZ A;  1E8W A;  5J17 A;  5C5B A;  3DBH I;  1KLV A;  1WJN A;  3A1Q B;  1VCB A;  2LGD A;  3RZW C;  3A4R A;  1W1G A;  1KZ7 A;  1Q0W B;  1V49 A;  2VRW B;  2BGF A;  5G2N A;  2UWQ A;  2LVQ A;  2ZVO A;  2KD0 A;  3PHW B;  3PGE A;  4K7W A;  4FJZ A;  3NZU A;  2MBE A;  2J0J A;  3W1Y A;  1UPR A;  1ZM0 A;  3KRX A;  4DBG A;  2BYE A;  4RMA A;  2DZM A;  4OVV A;  2DAJ A;  4YON A;  3OJ3 A;  4RM9 A;  1RFA A;  3PLV A;  2EMS A;  1EUV B;  1IRS A;  2Y7B A;  3QA8 A;  4PQ0 A;  3M62 B;  1UNQ A;  1WR1 A;  1M7R A;  2KDE B;  3DXE A;  1ZKH A;  1WGG A;  3ZNI D;  2IY0 B;  4TQ1 A;  1FGY A;  2N7E A;  1WY8 A;  1WX7 A;  4GPT B;  4GOC A;  4MSM B;  2PZ1 A;  1WRD B;  4F7Z A;  4K17 A;  4FHK A;  2DTC A;  3X23 A;  2KTR B;  2PEA A;  4NAW A;  3A9K A;  3ODW A;  3APD A;  1X1F A;  1MPH A;  3SU8 X;  2KAN A;  4CHJ A;  4WVF B;  3ZRC A;  4AUQ C;  2J7Q B;  5CHW A;  4C0A A;  5AZH A;  1D3Z A;  4EZL A;  4FHJ A;  3U8Z A;  2GCL A;  2BWE S;  5D3X A;  5FI0 A;  2LG1 A;  2NBW B;  2BYV E;  1LQB A;  3PP2 A;  2OOB B;  1WJ1 A;  2N1V A;  2BKF A;  3ZVV A;  1DRO A;  4KDI C;  5BO4 B;  2KQS A;  4ANV A;  1PLS A;  2Y5B B;  3H7P A;  4HAW B;  1UEF A;  4N9F 4;  2I5F A;  3PV1 A;  2H7E A;  2D11 A;  1I7A A;  3FM8 C;  5D7G A;  2M1M A;  1V5U A;  3RZF A;  4BBN C;  1V81 A;  2ROV A;  4GMV A;  1RLF A;  5C1Z A;  1X1G A;  1P0R A;  2Z0Q A;  4IOY X;  2CHW A;  2MCN B;  3WA0 A;  4OVU A;  1WE6 A;  2JY6 A;  1YX6 B;  1U4A A;  2M8S A;  2K2J A;  2QKM A;  3HHM A;  3DQV A;  2RNR B;  4GXB A;  4K1R B;  4NNJ B;  5D3Y A;  3UIN B;  2IYB A;  4BKG A;  3PS6 A;  2OJR A;  1H4R A;  3V60 A;  2YS3 A;  1ISN A;  3QWM A;  2L2I A;  4B6W A;  1H8C A;  2CY5 A;  2IO1 B;  3PVL A;  3GYP A;  4TYZ A;  2YS5 A;  1RRB A;  2G4S A;  4F7G A;  4BKT A;  2M38 A;  4IG7 B;  2K00 A;  3V6C B;  1WGU A;  4KAX B;  2Z0P A;  4HLE A;  4ANU A;  3BY4 B;  3I3T B;  1V88 A;  1GNU A;  2CHZ A;  2MP2 B;  2N4F A;  1HE8 A;  2J59 M;  2O2V A;  2P0D A;  4PS3 A;  3ZTC A;  4ASW C;  3PVU A;  4EZK A;  2DEN B;  3QHT A;  2BYF A;  2COA A;  3V6E B;  1U29 A;  2COF A;  1P9D U;  3PPA A;  5FI1 A;  1MK9 B;  1YD8 U;  2UYZ B;  2JZ3 B;  3ZNG C;  3ML8 A;  3RD2 A;  3PVW A;  2LVO A;  2O6V B;  1EAZ A;  3OJ4 B;  1TQZ A;  4KIK A;  1SIF A;  3ALB A;  3QBV B;  5JP4 A;  1EF1 A;  3HW2 B;  3LDZ E;  3QAQ A;  4AOF A;  3DXD A;  4MEL A;  2REX A;  2ASQ A;  4HVB A;  4MGZ E;  3DBL I;  1H10 A;  3VDZ A;  1UBQ A;  3AJ4 A;  2BWF A;  2DZK A;  4HB3 B;  4IM0 A;  2M14 A;  3WAL A;  2IFS A;  2FCQ A;  4WWO A;  3KSY A;  1CMX B;  2BKR B;  2JZZ A;  2M0X A;  4JQW C;  2RR9 A;  4HDQ A;  2R2O A;  2XK5 B;  1ZW7 A;  4HAZ B;  1P6S A;  3JVZ X;  1K8R B;  3A9J B;  2L76 A;  1BWN A;  3FSS A;  2G35 A;  4II2 B;  1C1Y B;  2DKQ A;  2N23 A;  1KZG A;  1XKE A;  2DHI A;  1WGD A;  1ZC3 B;  4A3P A;  4PNK A;  1AAR A;  3V61 A;  3VTV A;  1V89 A;  4PYU A;  2Z0O A;  5D94 A;  2KDF B;  3KRW A;  1Y8R C;  3TBL D;  2DYN A;  4KSL C;  1E7U A;  3EEC A;  1X05 A;  2RUK B;  4HHV A;  2HTH A;  1FAO A;  3L08 A;  3HK0 A;  4G50 A;  3FEH A;  5J2R A;  2W9N A;  4X57 B;  4MY6 A;  2I5C A;  3K9P B;  1EVH A;  2L00 B;  3SUZ A;  5DPW A;  2D9W A;  1IP9 A;  2FAZ A;  1WX9 A;  1UD7 A;  2LXC A;  5DPR A;  2LYD A;  5JHB A;  5LXH A;  1E8Z A;  2JP2 A;  2UZS A;  3ODX A;  3VTW A;  4W9H A;  2R2Q A;  4WJP A;  3RYT A;  1PFJ A;  1DDW A;  3H1U A;  4TV3 A;  4A6F B;  4G3X B;  3WAM A;  1XX0 A;  3DVG Y;  2DAF A;  1BTN A;  4KVG B;  3CSF A;  4YL8 A;  5G55 A;  2COC A;  2L7R A;  1E7V A;  4XX5 A;  4PYZ A;  3NZS A;  3KZ1 A;  1OTR B;  4A6H A;  2Z0E B;  4K7S A;  2YLM A;  3RT3 B;  1V9J A;  2KLG A;  4K81 A;  3A8P A;  2JUO A;  4GU2 A;  2M4N A;  3KY9 A;  1P3R A;  4E3C A;  3JYU A;  2ZVN A;  4IFS A;  4BFR A;  1NU2 A;  3ZDT A;  2JRI B;  5JHG A;  4BOS C;  4NJ6 A;  4WJN A;  4W9G A;  3VUX A;  2K25 A;  2E2X A;  2VKI A;  2CY4 A;  4BBK A;  3VIA A;  4GMX B;  2WWZ A;  2N9P C;  4XWX A;  2DX5 B;  3BIN A;  1V5T A;  3CMM B;  3O65 B;  1QC6 A;  4IM3 A;  3F5R A;  3VUY A;  2ZCB A;  1L2N A;  4KHB B;  2K6Q A;  1XD4 A;  3ZVR A;  4CO7 A;  5CTR C;  3IG3 A;  4KV2 A;  5DCN A;  3BJI A;  2YF0 A;  1MK7 B;  3L10 B;  5CLL B;  4JLC A;  4WSF A;  2LKO A;  3X0W A;  4KHO A;  3KYD D;  2GBK A;  3LJU X;  4IWP A;  1YQB A;  2ZNV C;  3SV1 A;  3SD5 A;  2N7D A;  1WE7 A;  2MBB B;  1JRU A;  3U7D A;  5JZE B;  2MKR A;  2KZR A;  2N1W A;  1WM2 A;  2BF8 B;  1N3H A;  4W9L A;  3R7Q A;  4LCD E;  1T0Y A;  2V76 A;  2LRW A;  2NPT A;  3VQI A;  4EJN A;  2G3Q B;  2IYD B;  4RM8 A;  4Z2M B;  2A5U A;  4W9D A;  2KNB A;  2KJH B;  5HE1 A;  4WJ7 A;  4GDK A;  3R7R A;  4A3O A;  1WGR A;  5LON B;  2MX2 A;  1UNP A;  2LOX A;  4FJV B;  3PT2 B;  2C5L C;  3RCZ A;  3M1I B;  4WWN A;  3D8D A;  3L54 A;  1SE9 A;  1ZC4 B;  4ZDV A;  3MPX A;  3VH3 B;  1ZGU B;  1XCG A;  1DYN A;  4ZRJ A;  5TR5 A;  3U30 A;  2KCJ A;  1YX5 B;  3VH4 B;  1UZX B;  4EMO A;  4W9J A;  3UQB A;  3HQC A;  2CR5 A;  1P5T A;  2KK8 A;  3NOB A;  4DDI D;  3JW0 X;  2MQJ A;  3TO1 A;  3P7Z A;  1I35 A;  2IO3 B;  5KHQ A;  2KGX B;  2P0F A;  1E90 A;  2LGY A;  2C60 A;  3TJP A;  4WWP A;  2GBR A;  3Q3J A;  2DKP A;  3GYO A;  4E71 A;  5DPT A;  2DHZ A;  2N0Y A;  4MGY E;  3SO6 A;  1DBH A;  3AI5 A;  2IY1 B;  1J19 A;  1NTV A;  2DYB A;  1WGY A;  2WDT B;  3DVN U;  1RAX A;  3JSV B;  2MWS B;  2KOX A;  2KKC A;  1RJ2 A;  2MBH A;  2D9V A;  1WJ4 A;  3PTF C;  4EFO A;  4EOY A;  1NI2 A;  3WAO A;  2D9X A;  2O6V D;  2KMC A;  1FOE A;  2MP2 A;  4JGH B;  3HM6 X;  5DIF B;  2Q13 A;  1WR6 E;  2D3G A;  1E5W A;  1X1M A;  3OAN A;  1B55 A;  1V61 A;  4HWI B;  1WJ6 A;  1A5R A;  1XOD A;  2UVM A;  4EEW A;  3ZO5 B;  1U5D A;  3C0R B;  2KFK A;  4GDL B;  3SNH A;  2MFQ A;  3Q3F A;  2LVP A;  2GCJ A;  5LOP B;  1QQG A;  3O96 A;  2XEW A;  2I1K A;  2L1C A;  1FB8 A;  3ONS A;  3L17 A;  3GZN I;  1BTK A;  2GOW A;  2D9Z A;  2LI5 A;  4JL9 A;  5LLI A;  3ECI A;  4ANW A;  4MH0 E;  4NPN A;  3AU4 A;  2HE7 A;  3ODO A;  3DBR I;  4HK2 A;  2C7H A;  3UZT A;  3OAW A;  2LXA A;  3LJ3 A;  2KWV B;  2KC1 A;  4HB0 B;  3QCA A;  2FCM A;  3TCA A;  3S2A A;  4XC2 A;  1GJZ A;  1J8C A;  2GBM A;  3APC A;  2DN6 A;  3L0W B;  4HAY B;  3V5W A;  4KSK C;  2D4Q A;  2R0D A;  2KXJ A;  2NBV B;  3M3J A;  4HPM B;  1Q1O A;  2ZEQ A;  1W1H A;  1WI1 A;  1UGM A;  3ZLZ A;  2XK5 A;  3QAR A;  3A9J A;  2M17 A;  3TIX A;  1OEY A;  4HCP B;  3QX1 A;  4NAW B;  1YJ1 A;  1AWE A;  2LWP A;  4HXD A;  1V5P A;  2HD5 B;  4W9C A;  1ZSQ A;  3N3K B;  5EFX A;  2NBU A;  2MWN B;  3PG7 A;  4ZRI A;  1WJM A;  1E8X A;  5LXI B;  1FHW A;  1W1D A;  4DX8 A;  3IHP C;  2NCN A;  4AP4 C;  4I6P A;  4K2O A;  2EC1 A;  5L83 A;  4ANX A;  5IAA C;  5L95 C;  2K2U A;  1MIX A;  1WZ0 A;  4G11 A;  2IO0 B;  1LM8 B;  5D3W A;  3T9L A;  3P6A A;  1WMH B;  4URK A;  3GOE A;  1M94 A;  4F7U P;  4HAU B;  2GBN A;  1XT9 B;  4CHM A;  4F7H A;  3TFM A;  2RGF A;  2ADZ A;  2G4D B;  5JH5 C;  3HIZ A;  2AEH A;  4LDT D;  4K7U A;  4A6F A;  3PSE B;  2P0H A;  1WH3 A;  2ZPN A;  3PSC A;  5DH9 B;  3A98 B;  1GUA B;  3DPD A;  3WIM A;  3AU5 A;  5AZF A;  4I6N B;  3L13 A;  2JRH A;  4BBN F;  3AXC A;  2LRU A;  4E74 A;  4MJS B;  4DWF A;  2HJ8 A;  1PMS A;  3EHV A;  2YVC A;  1MAI A;  2C9W B;  1WXS A;  4GN1 A;  1UPQ A;  4A5K A;  2N9E B;  1DDV A;  3IBE A;  5DHF B;  4FUL A;  4IWO A;  3RCP A;  2DA0 A;  2L0F A;  4NQL B;  4BKS D;  4DHZ E;  2C7M B;  2DX5 A;  1U5F A;  1TBE A;  2YRY A;  1EF5 A;  1GG3 A;  2KC2 A;  2ZNV B;  1R4M I;  2O2V B;  1LW3 A;  2P8V A;  1TJ6 A;  5HE0 A;  4AJY B;  4LJP B;  3PHX B;  3ZIM A;  2IZV B;  5DHA B;  1MIZ B;  2YT1 A;  2L0T A;  5KQ4 A;  3ULC A;  4HPL B;  3NY5 A;  4FJY A;  1WGH A;  1S3S G;  1SHC A;  3PRM B;  2KDI A;  4KIK B;  1WXV A;  3IVF A;  2W2X D;  2MA9 B;  2KN5 A;  4W9I A;  1ZVR A;  2JF5 A;  2L3Z A;  3VHT C;  2D10 A;  3A4S C;  2Z59 B;  4M0W B;  1J0G A;  3R66 C;  3ENE A;  3T06 A;  3TL5 A;  5IA7 A;  3T8M A;  5J3Y A;  3VOQ A;  2ELA A;  2KUP A;  2K8B A;  1UBI A;  1FHX A;  2CKH B;  4IM2 A;  4XZ4 A;  2RSU A;  4F8C B;  1WIA A;  3A1Q A;  2JVC A;  1P98 A;  2L8J A;  4Z2N A;  2MBO A;  2LZ6 A;  3L16 A;  1V5M A;  2KDB A;  2DZJ A;  1UEL A;  4G0N B;  2EKE C;  3CXB B;  3NSU A;  4NQK E;  5HKH A;  1WFY A;  2XQN M;  4HCN B;  2DYO A;  2LD9 A;  4IWQ A;  2KMA A;  5CHF A;  3ML4 A;  3SDL C;  3M63 B;  1NTY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...