1RRPB

Structure of the ran-gppnhp-ranbd1 complex
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
134
structure length
134
Chain Sequence
HFEPVVPLPDKIEVKTGEEDEEEFFCNRAKLFRFDVESKEWKERGIGNVKILRHKTSGKIRLLMRREQVLKICANHYISPDMKLTPNAGSDRSFVWHALDYADELPKPEQLAIRFKTPEEAALFKCKFEEAQSI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RAN
publication title Structure of a Ran-binding domain complexed with Ran bound to a GTP analogue: implications for nuclear transport.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Complex (small gtpase/nuclear protein)
total genus 27
structure length 134
sequence length 134
chains with identical sequence D
ec nomenclature
pdb deposition date 1999-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00638 Ran_BP1 RanBP1 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 1rrpB00
2J0KA 1PLSA 5FI0A 1U5FA 3ML4A 1ZC3B 3FSSA 2JP2A 3F0WA 1WGUA 2MFQA 3MDBC 3D8DA 2DLWA 2EMSA 1BAKA 4GXBA 4HAWB 1XODA 2DA0A 1XR0B 4K2PA 4NY0A 3KRWA 2UZRA 5KQ1A 1FHXA 3PVWA 3IVFA 2K2UA 1BTKA 2KGXB 2GCLA 1BTNA 1V61A 1WJ1A 4MK0A 2DHKA 3DXEA 4CYEA 3AU4A 1PFJA 1UNQA 2KCJA 3FM8C 1V89A 4XWXA 3X23A 3SYXA 5C5BA 3GYOA 4WJ7A 4KAXB 2DTCA 5JLJB 4IFSA 3D8EA 2ROVA 1MIZB 2LOZA 3T06A 2AL6A 3PSCA 1U2BA 1UPQA 2D9XA 4L6EA 1U27A 1XKEA 4PNKA 4MT7A 2Z0OA 1OQNA 2MDXA 3AU5A 4NSWA 5GOWB 5D27A 4ZRJA 1FHOA 2ZPYA 3TO1A 2DKPA 2EMTA 2ELAA 5EFXA 1I7AA 1RJ2A 5JP4A 2MWNB 4GMXB 3GYPA 3HW2B 2W2XC 2ELBA 3NSUA 1M7EA 1FGZA 2QKMA 5D3VA 5C16A 4KHAA 1XD4A 1BWNA 4ZRKA 4BBKA 1Y5OA 4C0AA 2BCJA 2OQBA 3SUZA 3CIKA 5DI9B 4TYZA 3TCAA 4F7UP 2M14A 2CRFA 3HQCA 5JHGA 1X11A 2Y8FA 2G35A 1DBHA 5LONB 5D3WA 4Y94A 1U5DA 3QBVB 1X1GA 3LJUX 2GJYA 1AWEA 1MAIA 1KZGA 2ROZB 1NI2A 3ODWA 5J3TA 1QQGA 2D10A 2COAA 4HDQA 1Q67A 1LB1A 3A8PA 1N3HA 4EMOA 5C79A 1B55A 1WI1A 1QC6A 2YVCA 2EJ8A 4Z2MB 4A6HA 2NMBA 1UNRA 2Y7BA 3V5WA 2UVMA 3ODOA 1M7RA 2D9WA 1GG3A 1V5MA 1ISNA 2H7DA 2P0DA 3ULBA 5D3XA 4HATB 1NU2A 3DXCA 3QWMA 4GPTB 2EC1A 2YT0A 4HAXB 1V5PA 2Z0QA 2L2IA 1P6SA 1DDMA 4F7HA 4TKNA 3CXBB 2D2QA 4IOYX 1FB8A 5LOPB 4CHMA 2YRYA 1MPHA 1MK9B 3F5RA 2MKRA 2RVBB 1MIXA 3PG7A 4HB2B 2L1CA 3RCPA 2VRWB 3PVUA 3KRXA 2CY5A 1MK7B 4HAZB 1W1HA 1MKEA 2CY4A 3SV1A 2V76A 4KHBB 3WA0A 3O96A 2VSZA 2DHJA 5DHFB 1H10A 1UPRA 5C5BB 4HB0B 5J3QA 1K5GB 2CAYA 2IYBA 3D8FA 3TW1A 4DX8A 1J0WA 1DROA 3KY9A 2OTXA 2D9VA 2YS1A 5FI1A 3PP2A 4KHOA 3KSYA 5HE3A 2N23A 4A5KA 2DKQA 3PVLA 2LG1A 4GMVA 1WVHA 2CODA 4GN1A 1RRPB 3DXDA 3M1IB 4HAUB 5JHHA 2YS3A 5CLQB 2D4QA 4HAVB 1DDWA 1V5UA 4EJNA 1IRSA 1GC6A 1UEFA 1OMWA 2GS0A 1FHWA 5C6RA 3TFMA 2UZSA 1FOEA 3QIJA 1EGXA 2M38A 3BINA 2RUKB 2I1JA 4A6FA 3SNHA 4HAYB 4PQ0A 3SO6A 4ZRIA 4A6KA 3A98B 1LW3A 1EF1A 1XX0A 3OANA 5L81A 1UNPA 1W1DA 2P0FA 2DYQA 3N7CA 2H7EA 1Y19B 2RNRB 2RGNB 1WJMA 4HB3B 1PMSA 3FEHA 1FGYA 3BJIA 2NZ8B 4K81A 4YONA 2XQNM 4F7GA 1U29A 2IFSA 2YS5A 5HE2A 1EAZA 1DDVA 2FJLA 4B6HA 3KZ1A 5DHAB 4IAPA 2RLOA 3A8QA 4EKUA 5HE1A 4D0NB 2DX5A 1E5WA 1TXDA 2AEHA 1U5EA 2Q13A 3U8ZA 1ZM0A 2W2XD 2DN6A 4DBBA 5DH9B 2YSZA 1SGHA 1XCGA 3G9WA 1WGQA 2K2JA 2LULA 3ULCA 1NTVA 2J0JA 4YL8A 3TVVA 5KCVA 1Z87A 2QKLA 2PZ1A 1J19A 1H4RA 1W1GA 4P7IA 4WSFA 5J3YA 3VIAA 2VKIA 3MPXA 4DXAB 1KZ7A 2P8VA 3P7ZA 4K2OA 2P0HA 4MY6A 1AQCA 1P5TA 2ADZA 1EVHA 2COCA 5CLLB 3UZTA 2I5FA 2R09A 2J0MA 1TQZA 1I2HA 2N0YA 1X1FA 2K00A 2KUPA 3VOQA 4HDOA 2Y8GA 2I5CA 1K5DB 4HHVA 2COFA 2Z0PA 2DX1A 2DHIA 2E2XA 2X18A 3HK0A 2HTHB 1ZC4B 3U7DA 2D9ZA 1ZVRA 1DYNA 2GCJA 2DFKA 4Z2NA 1X86A 2I1KA 4CHJA 1WG7A 1ZSQA 1U5GA 2LYDA 2HE7A 3ZVRA 4HB4B 1GC7A 1OY2A 1P3RA 3PEGA 1FAOA 3PZDA 2D9YA 2DYNA 2LOXA 1NTYA 4GZUA 5HE0A 5KQ4A 1V88A 5DIFB 2W2WA 3AJ4A 2J59M 3ODXA 2R0DA 4H8SA 3P6AA 3WYFB 1SHCA 1KI1B 2D11A 1TJ6A 2YT1A 4KVGB 4A6FB 5D3YA 4DX90 4K17A 2LKOA 4WVFB 3ZDTA 2YF0A 2RSGA 1X05A
chains in the Genus database with same CATH superfamily
2J0KA 1PLSA 5FI0A 1U5FA 3ML4A 1ZC3B 3FSSA 2JP2A 3F0WA 1WGUA 2MFQA 3MDBC 3HSAA 3D8DA 4GNKB 2DLWA 2EMSA 1BAKA 4GXBA 4HAWB 1XODA 2DA0A 1XR0B 4K2PA 4NY0A 3KRWA 2UZRA 5KQ1A 1FHXA 2GUMA 3PVWA 3IVFA 2K2UA 1BTKA 2KGXB 2GCLA 1BTNA 1V61A 4KHBA 1WJ1A 4MK0A 4D6WA 2DHKA 3DXEA 4CYEA 3AU4A 1PFJA 1UNQA 2KCJA 3FM8C 1V89A 4XWXA 3X23A 3SYXA 5C5BA 3NWFA 3GYOA 4WJ7A 4KAXB 2DTCA 5JLJB 4IFSA 3D8EA 2ROVA 1MIZB 2LOZA 3T06A 2AL6A 3PSCA 1U2BA 2YT2A 1UPQA 2D9XA 4L6EA 1U27A 1XKEA 4PNKA 4QJ4B 4MT7A 2Z0OA 1OQNA 2MDXA 3AU5A 4NSWA 5GOWB 5D27A 3OHMB 4ZRJA 4DIXA 1FHOA 2ZPYA 3TO1A 1T77A 2DKPA 2EMTA 2ELAA 5EFXA 1I7AA 1RJ2A 5JP4A 2MWNB 4GMXB 3GYPA 3HW2B 2W2XC 2ELBA 3NSUA 1M7EA 1FGZA 2QKMA 5D3VA 5C16A 4KHAA 1XD4A 1BWNA 4ZRKA 4BBKA 1Y5OA 4C0AA 2BCJA 2OQBA 3SUZA 3CIKA 5DI9B 4TYZA 3TCAA 4F7UP 2M14A 2CRFA 3HQCA 5JHGA 1X11A 2Y8FA 2G35A 1DBHA 5LONB 5D3WA 4Y94A 1U5DA 3QBVB 1X1GA 3LJUX 2GJYA 1AWEA 1MAIA 1KZGA 2ROZB 1NI2A 3ODWA 5J3TA 1QQGA 2D10A 2KR0A 2COAA 4HDQA 1Q67A 1LB1A 3A8PA 1N3HA 4EMOA 5C79A 1B55A 1WI1A 1QC6A 2YVCA 5IRSA 2EJ8A 4Z2MB 4A6HA 2NMBA 1UNRA 2Y7BA 3V5WA 4QJ3B 2UVMA 3ODOA 1M7RA 2D9WA 1GG3A 1V5MA 1ISNA 2H7DA 2P0DA 3ULBA 4HSIA 5D3XA 4HATB 1NU2A 3DXCA 3QWMA 4QXAB 4GPTB 2EC1A 2YT0A 4HAXB 1V5PA 2Z0QA 2L2IA 1P6SA 1DDMA 4F7HA 4TKNA 3CXBB 2D2QA 4IOYX 1FB8A 5LOPB 4CHMA 2YRYA 1MPHA 2RRFA 1MK9B 3F5RA 2MKRA 2RVBB 1MIXA 3PG7A 4HB2B 2L1CA 3RCPA 2VRWB 3PVUA 3KRXA 4OT1A 4OSNA 2CY5A 1MK7B 4HAZB 1W1HA 1MKEA 2CY4A 3SV1A 2V76A 3A58A 4KHBB 5I2SA 3WA0A 3O96A 3U12A 2VSZA 2DHJA 5DHFB 1H10A 1UPRA 5C5BB 4HB0B 5J3QA 1K5GB 2CAYA 2IYBA 3D8FA 3TW1A 4DX8A 1J0WA 4GOUA 1DROA 3KY9A 2OTXA 3B77A 2D9VA 2KUQA 2YS1A 5FI1A 3PP2A 4KHOA 3KSYA 5HE3A 2N23A 4A5KA 2Z59A 2DKQA 3PVLA 2K8EA 2LG1A 3NWAA 4GMVA 5M4YB 1WVHA 2CODA 4GN1A 1RRPB 3DXDA 3M1IB 4HAUB 5JHHA 2YS3A 5CLQB 2D4QA 4HAVB 1DDWA 1V5UA 4EJNA 1IRSA 1GC6A 1UEFA 1OMWA 2GS0A 1FHWA 5C6RA 3TFMA 2UZSA 1FOEA 3QIJA 1EGXA 2M38A 3BINA 5I2MA 2ZKMX 2RUKB 4CSQA 2I1JA 4A6FA 3SNHA 4HAYB 4PQ0A 3SO6A 4ZRIA 4A6KA 3A98B 3FVCA 1LW3A 1EF1A 1XX0A 3OANA 5L81A 1UNPA 1W1DA 5LG4B 2P0FA 2DYQA 3N7CA 2H7EA 2Z14A 1Y19B 2RNRB 2Z4DA 2RGNB 1WJMA 4HB3B 1PMSA 3FEHA 1FGYA 3BJIA 4L1RA 2NZ8B 2R2YA 4K81A 4YONA 2XQNM 4F7GA 1U29A 2IFSA 1MI1A 2YS5A 5HE2A 1EAZA 1DDVA 2FJLA 4B6HA 3KZ1A 5DHAB 4IAPA 2RLOA 3A8QA 4EKUA 2KIGA 5HE1A 4D0NB 1ZYIA 2DX5A 1E5WA 1TXDA 2AEHA 1U5EA 2Q13A 3U8ZA 3NWDA 3HIEA 1ZM0A 2W2XD 2KIEA 2DN6A 4DBBA 5DH9B 2YSZA 1SGHA 1XCGA 3G9WA 1WGQA 2K2JA 2LULA 3ULCA 1NTVA 2J0JA 4YL8A 3TVVA 5KCVA 1Z87A 3DCXA 2QKLA 2PZ1A 1J19A 1H4RA 1W1GA 4P7IA 4WSFA 5J3YA 3VIAA 2VKIA 3MPXA 4DXAB 1KZ7A 2P8VA 3P7ZA 4K2OA 2P0HA 4MY6A 1AQCA 1P5TA 2ADZA 1EVHA 2COCA 5CLLB 3UZTA 2I5FA 2R09A 2J0MA 1TQZA 1I2HA 2N0YA 1X1FA 2K00A 2KUPA 2FJUB 3VOQA 4HDOA 2Y8GA 2I5CA 1K5DB 4HHVA 2COFA 2Z0PA 2NBVA 2DX1A 2DHIA 2E2XA 2X18A 3HK0A 2HTHB 1ZC4B 3U7DA 2D9ZA 1ZVRA 1DYNA 2GCJA 2DFKA 2K49A 4Z2NA 1X86A 2I1KA 4CHJA 1WG7A 1ZSQA 1U5GA 2LYDA 2HE7A 3ZVRA 4HB4B 1GC7A 1OY2A 1P3RA 3PEGA 1FAOA 3PZDA 2D9YA 2DYNA 2LOXA 1NTYA 4GZUA 5HE0A 5KQ4A 1V88A 5DIFB 2W2WA 3AJ4A 4QJ5B 2J59M 3ODXA 2R0DA 4H8SA 3P6AA 3WYFB 1SHCA 1KI1B 3NW8A 2D11A 1TJ6A 2YT1A 4KVGB 4A6FB 2Z13A 5D3YA 4DX90 4K17A 2LKOA 4WVFB 3ZDTA 2YF0A 2RSGA 1X05A
chains in the Genus database with same CATH topology
2J0KA 1PLSA 5FI0A 1U5FA 3ML4A 1ZC3B 3FSSA 2JP2A 3F0WA 1WGUA 2MFQA 3MDBC 3D8DA 2DLWA 2EMSA 1BAKA 4GXBA 4HAWB 1XODA 2DA0A 1XR0B 4K2PA 4NY0A 3KRWA 2UZRA 5KQ1A 1FHXA 3PVWA 3IVFA 2K2UA 1BTKA 2KGXB 2GCLA 1BTNA 1V61A 1WJ1A 4MK0A 2DHKA 3DXEA 4CYEA 3AU4A 1PFJA 1UNQA 2KCJA 3FM8C 1V89A 4XWXA 3X23A 3SYXA 5C5BA 3GYOA 4WJ7A 4KAXB 2DTCA 5JLJB 4IFSA 3D8EA 2ROVA 1MIZB 2LOZA 3T06A 2AL6A 3PSCA 1U2BA 1UPQA 2D9XA 4L6EA 1U27A 1XKEA 4PNKA 4MT7A 2Z0OA 1OQNA 2MDXA 3AU5A 4NSWA 5GOWB 5D27A 4ZRJA 1FHOA 2ZPYA 3TO1A 2DKPA 2EMTA 2ELAA 5EFXA 1I7AA 1RJ2A 5JP4A 2MWNB 4GMXB 3GYPA 3HW2B 2W2XC 2ELBA 3NSUA 1M7EA 1FGZA 2QKMA 5D3VA 5C16A 4KHAA 1XD4A 1BWNA 4ZRKA 4BBKA 1Y5OA 4C0AA 2BCJA 2OQBA 3SUZA 3CIKA 5DI9B 4TYZA 3TCAA 4F7UP 2M14A 2CRFA 3HQCA 5JHGA 1X11A 2Y8FA 2G35A 1DBHA 5LONB 5D3WA 4Y94A 1U5DA 3QBVB 1X1GA 3LJUX 2GJYA 1AWEA 1MAIA 1KZGA 2ROZB 1NI2A 3ODWA 5J3TA 1QQGA 2D10A 2COAA 4HDQA 1Q67A 1LB1A 3A8PA 1N3HA 4EMOA 5C79A 1B55A 1WI1A 1QC6A 2YVCA 2EJ8A 4Z2MB 4A6HA 2NMBA 1UNRA 2Y7BA 3V5WA 2UVMA 3ODOA 1M7RA 2D9WA 1GG3A 1V5MA 1ISNA 2H7DA 2P0DA 3ULBA 5D3XA 4HATB 1NU2A 3DXCA 3QWMA 4GPTB 2EC1A 2YT0A 4HAXB 1V5PA 2Z0QA 2L2IA 1P6SA 1DDMA 4F7HA 4TKNA 3CXBB 2D2QA 4IOYX 1FB8A 5LOPB 4CHMA 2YRYA 1MPHA 1MK9B 3F5RA 2MKRA 2RVBB 1MIXA 3PG7A 4HB2B 2L1CA 3RCPA 2VRWB 3PVUA 3KRXA 2CY5A 1MK7B 4HAZB 1W1HA 1MKEA 2CY4A 3SV1A 2V76A 4KHBB 3WA0A 3O96A 2VSZA 2DHJA 5DHFB 1H10A 1UPRA 5C5BB 4HB0B 5J3QA 1K5GB 2CAYA 2IYBA 3D8FA 3TW1A 4DX8A 1J0WA 1DROA 3KY9A 2OTXA 2D9VA 2YS1A 5FI1A 3PP2A 4KHOA 3KSYA 5HE3A 2N23A 4A5KA 2DKQA 3PVLA 2LG1A 4GMVA 1WVHA 2CODA 4GN1A 1RRPB 3DXDA 3M1IB 4HAUB 5JHHA 2YS3A 5CLQB 2D4QA 4HAVB 1DDWA 1V5UA 4EJNA 1IRSA 1GC6A 1UEFA 1OMWA 2GS0A 1FHWA 5C6RA 3TFMA 2UZSA 1FOEA 3QIJA 1EGXA 2M38A 3BINA 2RUKB 2I1JA 4A6FA 3SNHA 4HAYB 4PQ0A 3SO6A 4ZRIA 4A6KA 3A98B 1LW3A 1EF1A 1XX0A 3OANA 5L81A 1UNPA 1W1DA 2P0FA 2DYQA 3N7CA 2H7EA 1Y19B 2RNRB 2RGNB 1WJMA 4HB3B 1PMSA 3FEHA 1FGYA 3BJIA 2NZ8B 4K81A 4YONA 2XQNM 4F7GA 1U29A 2IFSA 2YS5A 5HE2A 1EAZA 1DDVA 2FJLA 4B6HA 3KZ1A 5DHAB 4IAPA 2RLOA 3A8QA 4EKUA 5HE1A 4D0NB 2DX5A 1E5WA 1TXDA 2AEHA 1U5EA 2Q13A 3U8ZA 1ZM0A 2W2XD 2DN6A 4DBBA 5DH9B 2YSZA 1SGHA 1XCGA 3G9WA 1WGQA 2K2JA 2LULA 3ULCA 1NTVA 2J0JA 4YL8A 3TVVA 5KCVA 1Z87A 2QKLA 2PZ1A 1J19A 1H4RA 1W1GA 4P7IA 4WSFA 5J3YA 3VIAA 2VKIA 3MPXA 4DXAB 1KZ7A 2P8VA 3P7ZA 4K2OA 2P0HA 4MY6A 1AQCA 1P5TA 2ADZA 1EVHA 2COCA 5CLLB 3UZTA 2I5FA 2R09A 2J0MA 1TQZA 1I2HA 2N0YA 1X1FA 2K00A 2KUPA 3VOQA 4HDOA 2Y8GA 2I5CA 1K5DB 4HHVA 2COFA 2Z0PA 2DX1A 2DHIA 2E2XA 2X18A 3HK0A 2HTHB 1ZC4B 3U7DA 2D9ZA 1ZVRA 1DYNA 2GCJA 2DFKA 4Z2NA 1X86A 2I1KA 4CHJA 1WG7A 1ZSQA 1U5GA 2LYDA 2HE7A 3ZVRA 4HB4B 1GC7A 1OY2A 1P3RA 3PEGA 1FAOA 3PZDA 2D9YA 2DYNA 2LOXA 1NTYA 4GZUA 5HE0A 5KQ4A 1V88A 5DIFB 2W2WA 3AJ4A 2J59M 3ODXA 2R0DA 4H8SA 3P6AA 3WYFB 1SHCA 1KI1B 2D11A 1TJ6A 2YT1A 4KVGB 4A6FB 5D3YA 4DX90 4K17A 2LKOA 4WVFB 3ZDTA 2YF0A 2RSGA 1X05A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2J0K A;  1PLS A;  5FI0 A;  1U5F A;  3ML4 A;  1ZC3 B;  3FSS A;  2JP2 A;  3F0W A;  1WGU A;  2MFQ A;  3MDB C;  3D8D A;  2DLW A;  2EMS A;  1BAK A;  4GXB A;  4HAW B;  1XOD A;  2DA0 A;  1XR0 B;  4K2P A;  4NY0 A;  3KRW A;  2UZR A;  5KQ1 A;  1FHX A;  3PVW A;  3IVF A;  2K2U A;  1BTK A;  2KGX B;  2GCL A;  1BTN A;  1V61 A;  1WJ1 A;  4MK0 A;  2DHK A;  3DXE A;  4CYE A;  3AU4 A;  1PFJ A;  1UNQ A;  2KCJ A;  3FM8 C;  1V89 A;  4XWX A;  3X23 A;  3SYX A;  5C5B A;  3GYO A;  4WJ7 A;  4KAX B;  2DTC A;  5JLJ B;  4IFS A;  3D8E A;  2ROV A;  1MIZ B;  2LOZ A;  3T06 A;  2AL6 A;  3PSC A;  1U2B A;  1UPQ A;  2D9X A;  4L6E A;  1U27 A;  1XKE A;  4PNK A;  4MT7 A;  2Z0O A;  1OQN A;  2MDX A;  3AU5 A;  4NSW A;  5GOW B;  5D27 A;  4ZRJ A;  1FHO A;  2ZPY A;  3TO1 A;  2DKP A;  2EMT A;  2ELA A;  5EFX A;  1I7A A;  1RJ2 A;  5JP4 A;  2MWN B;  4GMX B;  3GYP A;  3HW2 B;  2W2X C;  2ELB A;  3NSU A;  1M7E A;  1FGZ A;  2QKM A;  5D3V A;  5C16 A;  4KHA A;  1XD4 A;  1BWN A;  4ZRK A;  4BBK A;  1Y5O A;  4C0A A;  2BCJ A;  2OQB A;  3SUZ A;  3CIK A;  5DI9 B;  4TYZ A;  3TCA A;  4F7U P;  2M14 A;  2CRF A;  3HQC A;  5JHG A;  1X11 A;  2Y8F A;  2G35 A;  1DBH A;  5LON B;  5D3W A;  4Y94 A;  1U5D A;  3QBV B;  1X1G A;  3LJU X;  2GJY A;  1AWE A;  1MAI A;  1KZG A;  2ROZ B;  1NI2 A;  3ODW A;  5J3T A;  1QQG A;  2D10 A;  2COA A;  4HDQ A;  1Q67 A;  1LB1 A;  3A8P A;  1N3H A;  4EMO A;  5C79 A;  1B55 A;  1WI1 A;  1QC6 A;  2YVC A;  2EJ8 A;  4Z2M B;  4A6H A;  2NMB A;  1UNR A;  2Y7B A;  3V5W A;  2UVM A;  3ODO A;  1M7R A;  2D9W A;  1GG3 A;  1V5M A;  1ISN A;  2H7D A;  2P0D A;  3ULB A;  5D3X A;  4HAT B;  1NU2 A;  3DXC A;  3QWM A;  4GPT B;  2EC1 A;  2YT0 A;  4HAX B;  1V5P A;  2Z0Q A;  2L2I A;  1P6S A;  1DDM A;  4F7H A;  4TKN A;  3CXB B;  2D2Q A;  4IOY X;  1FB8 A;  5LOP B;  4CHM A;  2YRY A;  1MPH A;  1MK9 B;  3F5R A;  2MKR A;  2RVB B;  1MIX A;  3PG7 A;  4HB2 B;  2L1C A;  3RCP A;  2VRW B;  3PVU A;  3KRX A;  2CY5 A;  1MK7 B;  4HAZ B;  1W1H A;  1MKE A;  2CY4 A;  3SV1 A;  2V76 A;  4KHB B;  3WA0 A;  3O96 A;  2VSZ A;  2DHJ A;  5DHF B;  1H10 A;  1UPR A;  5C5B B;  4HB0 B;  5J3Q A;  1K5G B;  2CAY A;  2IYB A;  3D8F A;  3TW1 A;  4DX8 A;  1J0W A;  1DRO A;  3KY9 A;  2OTX A;  2D9V A;  2YS1 A;  5FI1 A;  3PP2 A;  4KHO A;  3KSY A;  5HE3 A;  2N23 A;  4A5K A;  2DKQ A;  3PVL A;  2LG1 A;  4GMV A;  1WVH A;  2COD A;  4GN1 A;  1RRP B;  3DXD A;  3M1I B;  4HAU B;  5JHH A;  2YS3 A;  5CLQ B;  2D4Q A;  4HAV B;  1DDW A;  1V5U A;  4EJN A;  1IRS A;  1GC6 A;  1UEF A;  1OMW A;  2GS0 A;  1FHW A;  5C6R A;  3TFM A;  2UZS A;  1FOE A;  3QIJ A;  1EGX A;  2M38 A;  3BIN A;  2RUK B;  2I1J A;  4A6F A;  3SNH A;  4HAY B;  4PQ0 A;  3SO6 A;  4ZRI A;  4A6K A;  3A98 B;  1LW3 A;  1EF1 A;  1XX0 A;  3OAN A;  5L81 A;  1UNP A;  1W1D A;  2P0F A;  2DYQ A;  3N7C A;  2H7E A;  1Y19 B;  2RNR B;  2RGN B;  1WJM A;  4HB3 B;  1PMS A;  3FEH A;  1FGY A;  3BJI A;  2NZ8 B;  4K81 A;  4YON A;  2XQN M;  4F7G A;  1U29 A;  2IFS A;  2YS5 A;  5HE2 A;  1EAZ A;  1DDV A;  2FJL A;  4B6H A;  3KZ1 A;  5DHA B;  4IAP A;  2RLO A;  3A8Q A;  4EKU A;  5HE1 A;  4D0N B;  2DX5 A;  1E5W A;  1TXD A;  2AEH A;  1U5E A;  2Q13 A;  3U8Z A;  1ZM0 A;  2W2X D;  2DN6 A;  4DBB A;  5DH9 B;  2YSZ A;  1SGH A;  1XCG A;  3G9W A;  1WGQ A;  2K2J A;  2LUL A;  3ULC A;  1NTV A;  2J0J A;  4YL8 A;  3TVV A;  5KCV A;  1Z87 A;  2QKL A;  2PZ1 A;  1J19 A;  1H4R A;  1W1G A;  4P7I A;  4WSF A;  5J3Y A;  3VIA A;  2VKI A;  3MPX A;  4DXA B;  1KZ7 A;  2P8V A;  3P7Z A;  4K2O A;  2P0H A;  4MY6 A;  1AQC A;  1P5T A;  2ADZ A;  1EVH A;  2COC A;  5CLL B;  3UZT A;  2I5F A;  2R09 A;  2J0M A;  1TQZ A;  1I2H A;  2N0Y A;  1X1F A;  2K00 A;  2KUP A;  3VOQ A;  4HDO A;  2Y8G A;  2I5C A;  1K5D B;  4HHV A;  2COF A;  2Z0P A;  2DX1 A;  2DHI A;  2E2X A;  2X18 A;  3HK0 A;  2HTH B;  1ZC4 B;  3U7D A;  2D9Z A;  1ZVR A;  1DYN A;  2GCJ A;  2DFK A;  4Z2N A;  1X86 A;  2I1K A;  4CHJ A;  1WG7 A;  1ZSQ A;  1U5G A;  2LYD A;  2HE7 A;  3ZVR A;  4HB4 B;  1GC7 A;  1OY2 A;  1P3R A;  3PEG A;  1FAO A;  3PZD A;  2D9Y A;  2DYN A;  2LOX A;  1NTY A;  4GZU A;  5HE0 A;  5KQ4 A;  1V88 A;  5DIF B;  2W2W A;  3AJ4 A;  2J59 M;  3ODX A;  2R0D A;  4H8S A;  3P6A A;  3WYF B;  1SHC A;  1KI1 B;  2D11 A;  1TJ6 A;  2YT1 A;  4KVG B;  4A6F B;  5D3Y A;  4DX9 0;  4K17 A;  2LKO A;  4WVF B;  3ZDT A;  2YF0 A;  2RSG A;  1X05 A; 
#chains in the Genus database with same CATH topology
 2J0K A;  1PLS A;  5FI0 A;  1U5F A;  3ML4 A;  1ZC3 B;  3FSS A;  2JP2 A;  3F0W A;  1WGU A;  2MFQ A;  3MDB C;  3HSA A;  3D8D A;  4GNK B;  2DLW A;  2EMS A;  1BAK A;  4GXB A;  4HAW B;  1XOD A;  2DA0 A;  1XR0 B;  4K2P A;  4NY0 A;  3KRW A;  2UZR A;  5KQ1 A;  1FHX A;  2GUM A;  3PVW A;  3IVF A;  2K2U A;  1BTK A;  2KGX B;  2GCL A;  1BTN A;  1V61 A;  4KHB A;  1WJ1 A;  4MK0 A;  4D6W A;  2DHK A;  3DXE A;  4CYE A;  3AU4 A;  1PFJ A;  1UNQ A;  2KCJ A;  3FM8 C;  1V89 A;  4XWX A;  3X23 A;  3SYX A;  5C5B A;  3NWF A;  3GYO A;  4WJ7 A;  4KAX B;  2DTC A;  5JLJ B;  4IFS A;  3D8E A;  2ROV A;  1MIZ B;  2LOZ A;  3T06 A;  2AL6 A;  3PSC A;  1U2B A;  2YT2 A;  1UPQ A;  2D9X A;  4L6E A;  1U27 A;  1XKE A;  4PNK A;  4QJ4 B;  4MT7 A;  2Z0O A;  1OQN A;  2MDX A;  3AU5 A;  4NSW A;  5GOW B;  5D27 A;  3OHM B;  4ZRJ A;  4DIX A;  1FHO A;  2ZPY A;  3TO1 A;  1T77 A;  2DKP A;  2EMT A;  2ELA A;  5EFX A;  1I7A A;  1RJ2 A;  5JP4 A;  2MWN B;  4GMX B;  3GYP A;  3HW2 B;  2W2X C;  2ELB A;  3NSU A;  1M7E A;  1FGZ A;  2QKM A;  5D3V A;  5C16 A;  4KHA A;  1XD4 A;  1BWN A;  4ZRK A;  4BBK A;  1Y5O A;  4C0A A;  2BCJ A;  2OQB A;  3SUZ A;  3CIK A;  5DI9 B;  4TYZ A;  3TCA A;  4F7U P;  2M14 A;  2CRF A;  3HQC A;  5JHG A;  1X11 A;  2Y8F A;  2G35 A;  1DBH A;  5LON B;  5D3W A;  4Y94 A;  1U5D A;  3QBV B;  1X1G A;  3LJU X;  2GJY A;  1AWE A;  1MAI A;  1KZG A;  2ROZ B;  1NI2 A;  3ODW A;  5J3T A;  1QQG A;  2D10 A;  2KR0 A;  2COA A;  4HDQ A;  1Q67 A;  1LB1 A;  3A8P A;  1N3H A;  4EMO A;  5C79 A;  1B55 A;  1WI1 A;  1QC6 A;  2YVC A;  5IRS A;  2EJ8 A;  4Z2M B;  4A6H A;  2NMB A;  1UNR A;  2Y7B A;  3V5W A;  4QJ3 B;  2UVM A;  3ODO A;  1M7R A;  2D9W A;  1GG3 A;  1V5M A;  1ISN A;  2H7D A;  2P0D A;  3ULB A;  4HSI A;  5D3X A;  4HAT B;  1NU2 A;  3DXC A;  3QWM A;  4QXA B;  4GPT B;  2EC1 A;  2YT0 A;  4HAX B;  1V5P A;  2Z0Q A;  2L2I A;  1P6S A;  1DDM A;  4F7H A;  4TKN A;  3CXB B;  2D2Q A;  4IOY X;  1FB8 A;  5LOP B;  4CHM A;  2YRY A;  1MPH A;  2RRF A;  1MK9 B;  3F5R A;  2MKR A;  2RVB B;  1MIX A;  3PG7 A;  4HB2 B;  2L1C A;  3RCP A;  2VRW B;  3PVU A;  3KRX A;  4OT1 A;  4OSN A;  2CY5 A;  1MK7 B;  4HAZ B;  1W1H A;  1MKE A;  2CY4 A;  3SV1 A;  2V76 A;  3A58 A;  4KHB B;  5I2S A;  3WA0 A;  3O96 A;  3U12 A;  2VSZ A;  2DHJ A;  5DHF B;  1H10 A;  1UPR A;  5C5B B;  4HB0 B;  5J3Q A;  1K5G B;  2CAY A;  2IYB A;  3D8F A;  3TW1 A;  4DX8 A;  1J0W A;  4GOU A;  1DRO A;  3KY9 A;  2OTX A;  3B77 A;  2D9V A;  2KUQ A;  2YS1 A;  5FI1 A;  3PP2 A;  4KHO A;  3KSY A;  5HE3 A;  2N23 A;  4A5K A;  2Z59 A;  2DKQ A;  3PVL A;  2K8E A;  2LG1 A;  3NWA A;  4GMV A;  5M4Y B;  1WVH A;  2COD A;  4GN1 A;  1RRP B;  3DXD A;  3M1I B;  4HAU B;  5JHH A;  2YS3 A;  5CLQ B;  2D4Q A;  4HAV B;  1DDW A;  1V5U A;  4EJN A;  1IRS A;  1GC6 A;  1UEF A;  1OMW A;  2GS0 A;  1FHW A;  5C6R A;  3TFM A;  2UZS A;  1FOE A;  3QIJ A;  1EGX A;  2M38 A;  3BIN A;  5I2M A;  2ZKM X;  2RUK B;  4CSQ A;  2I1J A;  4A6F A;  3SNH A;  4HAY B;  4PQ0 A;  3SO6 A;  4ZRI A;  4A6K A;  3A98 B;  3FVC A;  1LW3 A;  1EF1 A;  1XX0 A;  3OAN A;  5L81 A;  1UNP A;  1W1D A;  5LG4 B;  2P0F A;  2DYQ A;  3N7C A;  2H7E A;  2Z14 A;  1Y19 B;  2RNR B;  2Z4D A;  2RGN B;  1WJM A;  4HB3 B;  1PMS A;  3FEH A;  1FGY A;  3BJI A;  4L1R A;  2NZ8 B;  2R2Y A;  4K81 A;  4YON A;  2XQN M;  4F7G A;  1U29 A;  2IFS A;  1MI1 A;  2YS5 A;  5HE2 A;  1EAZ A;  1DDV A;  2FJL A;  4B6H A;  3KZ1 A;  5DHA B;  4IAP A;  2RLO A;  3A8Q A;  4EKU A;  2KIG A;  5HE1 A;  4D0N B;  1ZYI A;  2DX5 A;  1E5W A;  1TXD A;  2AEH A;  1U5E A;  2Q13 A;  3U8Z A;  3NWD A;  3HIE A;  1ZM0 A;  2W2X D;  2KIE A;  2DN6 A;  4DBB A;  5DH9 B;  2YSZ A;  1SGH A;  1XCG A;  3G9W A;  1WGQ A;  2K2J A;  2LUL A;  3ULC A;  1NTV A;  2J0J A;  4YL8 A;  3TVV A;  5KCV A;  1Z87 A;  3DCX A;  2QKL A;  2PZ1 A;  1J19 A;  1H4R A;  1W1G A;  4P7I A;  4WSF A;  5J3Y A;  3VIA A;  2VKI A;  3MPX A;  4DXA B;  1KZ7 A;  2P8V A;  3P7Z A;  4K2O A;  2P0H A;  4MY6 A;  1AQC A;  1P5T A;  2ADZ A;  1EVH A;  2COC A;  5CLL B;  3UZT A;  2I5F A;  2R09 A;  2J0M A;  1TQZ A;  1I2H A;  2N0Y A;  1X1F A;  2K00 A;  2KUP A;  2FJU B;  3VOQ A;  4HDO A;  2Y8G A;  2I5C A;  1K5D B;  4HHV A;  2COF A;  2Z0P A;  2NBV A;  2DX1 A;  2DHI A;  2E2X A;  2X18 A;  3HK0 A;  2HTH B;  1ZC4 B;  3U7D A;  2D9Z A;  1ZVR A;  1DYN A;  2GCJ A;  2DFK A;  2K49 A;  4Z2N A;  1X86 A;  2I1K A;  4CHJ A;  1WG7 A;  1ZSQ A;  1U5G A;  2LYD A;  2HE7 A;  3ZVR A;  4HB4 B;  1GC7 A;  1OY2 A;  1P3R A;  3PEG A;  1FAO A;  3PZD A;  2D9Y A;  2DYN A;  2LOX A;  1NTY A;  4GZU A;  5HE0 A;  5KQ4 A;  1V88 A;  5DIF B;  2W2W A;  3AJ4 A;  4QJ5 B;  2J59 M;  3ODX A;  2R0D A;  4H8S A;  3P6A A;  3WYF B;  1SHC A;  1KI1 B;  3NW8 A;  2D11 A;  1TJ6 A;  2YT1 A;  4KVG B;  4A6F B;  2Z13 A;  5D3Y A;  4DX9 0;  4K17 A;  2LKO A;  4WVF B;  3ZDT A;  2YF0 A;  2RSG A;  1X05 A; 
#chains in the Genus database with same CATH homology
 2J0K A;  1PLS A;  5FI0 A;  1U5F A;  3ML4 A;  1ZC3 B;  3FSS A;  2JP2 A;  3F0W A;  1WGU A;  2MFQ A;  3MDB C;  3D8D A;  2DLW A;  2EMS A;  1BAK A;  4GXB A;  4HAW B;  1XOD A;  2DA0 A;  1XR0 B;  4K2P A;  4NY0 A;  3KRW A;  2UZR A;  5KQ1 A;  1FHX A;  3PVW A;  3IVF A;  2K2U A;  1BTK A;  2KGX B;  2GCL A;  1BTN A;  1V61 A;  1WJ1 A;  4MK0 A;  2DHK A;  3DXE A;  4CYE A;  3AU4 A;  1PFJ A;  1UNQ A;  2KCJ A;  3FM8 C;  1V89 A;  4XWX A;  3X23 A;  3SYX A;  5C5B A;  3GYO A;  4WJ7 A;  4KAX B;  2DTC A;  5JLJ B;  4IFS A;  3D8E A;  2ROV A;  1MIZ B;  2LOZ A;  3T06 A;  2AL6 A;  3PSC A;  1U2B A;  1UPQ A;  2D9X A;  4L6E A;  1U27 A;  1XKE A;  4PNK A;  4MT7 A;  2Z0O A;  1OQN A;  2MDX A;  3AU5 A;  4NSW A;  5GOW B;  5D27 A;  4ZRJ A;  1FHO A;  2ZPY A;  3TO1 A;  2DKP A;  2EMT A;  2ELA A;  5EFX A;  1I7A A;  1RJ2 A;  5JP4 A;  2MWN B;  4GMX B;  3GYP A;  3HW2 B;  2W2X C;  2ELB A;  3NSU A;  1M7E A;  1FGZ A;  2QKM A;  5D3V A;  5C16 A;  4KHA A;  1XD4 A;  1BWN A;  4ZRK A;  4BBK A;  1Y5O A;  4C0A A;  2BCJ A;  2OQB A;  3SUZ A;  3CIK A;  5DI9 B;  4TYZ A;  3TCA A;  4F7U P;  2M14 A;  2CRF A;  3HQC A;  5JHG A;  1X11 A;  2Y8F A;  2G35 A;  1DBH A;  5LON B;  5D3W A;  4Y94 A;  1U5D A;  3QBV B;  1X1G A;  3LJU X;  2GJY A;  1AWE A;  1MAI A;  1KZG A;  2ROZ B;  1NI2 A;  3ODW A;  5J3T A;  1QQG A;  2D10 A;  2COA A;  4HDQ A;  1Q67 A;  1LB1 A;  3A8P A;  1N3H A;  4EMO A;  5C79 A;  1B55 A;  1WI1 A;  1QC6 A;  2YVC A;  2EJ8 A;  4Z2M B;  4A6H A;  2NMB A;  1UNR A;  2Y7B A;  3V5W A;  2UVM A;  3ODO A;  1M7R A;  2D9W A;  1GG3 A;  1V5M A;  1ISN A;  2H7D A;  2P0D A;  3ULB A;  5D3X A;  4HAT B;  1NU2 A;  3DXC A;  3QWM A;  4GPT B;  2EC1 A;  2YT0 A;  4HAX B;  1V5P A;  2Z0Q A;  2L2I A;  1P6S A;  1DDM A;  4F7H A;  4TKN A;  3CXB B;  2D2Q A;  4IOY X;  1FB8 A;  5LOP B;  4CHM A;  2YRY A;  1MPH A;  1MK9 B;  3F5R A;  2MKR A;  2RVB B;  1MIX A;  3PG7 A;  4HB2 B;  2L1C A;  3RCP A;  2VRW B;  3PVU A;  3KRX A;  2CY5 A;  1MK7 B;  4HAZ B;  1W1H A;  1MKE A;  2CY4 A;  3SV1 A;  2V76 A;  4KHB B;  3WA0 A;  3O96 A;  2VSZ A;  2DHJ A;  5DHF B;  1H10 A;  1UPR A;  5C5B B;  4HB0 B;  5J3Q A;  1K5G B;  2CAY A;  2IYB A;  3D8F A;  3TW1 A;  4DX8 A;  1J0W A;  1DRO A;  3KY9 A;  2OTX A;  2D9V A;  2YS1 A;  5FI1 A;  3PP2 A;  4KHO A;  3KSY A;  5HE3 A;  2N23 A;  4A5K A;  2DKQ A;  3PVL A;  2LG1 A;  4GMV A;  1WVH A;  2COD A;  4GN1 A;  1RRP B;  3DXD A;  3M1I B;  4HAU B;  5JHH A;  2YS3 A;  5CLQ B;  2D4Q A;  4HAV B;  1DDW A;  1V5U A;  4EJN A;  1IRS A;  1GC6 A;  1UEF A;  1OMW A;  2GS0 A;  1FHW A;  5C6R A;  3TFM A;  2UZS A;  1FOE A;  3QIJ A;  1EGX A;  2M38 A;  3BIN A;  2RUK B;  2I1J A;  4A6F A;  3SNH A;  4HAY B;  4PQ0 A;  3SO6 A;  4ZRI A;  4A6K A;  3A98 B;  1LW3 A;  1EF1 A;  1XX0 A;  3OAN A;  5L81 A;  1UNP A;  1W1D A;  2P0F A;  2DYQ A;  3N7C A;  2H7E A;  1Y19 B;  2RNR B;  2RGN B;  1WJM A;  4HB3 B;  1PMS A;  3FEH A;  1FGY A;  3BJI A;  2NZ8 B;  4K81 A;  4YON A;  2XQN M;  4F7G A;  1U29 A;  2IFS A;  2YS5 A;  5HE2 A;  1EAZ A;  1DDV A;  2FJL A;  4B6H A;  3KZ1 A;  5DHA B;  4IAP A;  2RLO A;  3A8Q A;  4EKU A;  5HE1 A;  4D0N B;  2DX5 A;  1E5W A;  1TXD A;  2AEH A;  1U5E A;  2Q13 A;  3U8Z A;  1ZM0 A;  2W2X D;  2DN6 A;  4DBB A;  5DH9 B;  2YSZ A;  1SGH A;  1XCG A;  3G9W A;  1WGQ A;  2K2J A;  2LUL A;  3ULC A;  1NTV A;  2J0J A;  4YL8 A;  3TVV A;  5KCV A;  1Z87 A;  2QKL A;  2PZ1 A;  1J19 A;  1H4R A;  1W1G A;  4P7I A;  4WSF A;  5J3Y A;  3VIA A;  2VKI A;  3MPX A;  4DXA B;  1KZ7 A;  2P8V A;  3P7Z A;  4K2O A;  2P0H A;  4MY6 A;  1AQC A;  1P5T A;  2ADZ A;  1EVH A;  2COC A;  5CLL B;  3UZT A;  2I5F A;  2R09 A;  2J0M A;  1TQZ A;  1I2H A;  2N0Y A;  1X1F A;  2K00 A;  2KUP A;  3VOQ A;  4HDO A;  2Y8G A;  2I5C A;  1K5D B;  4HHV A;  2COF A;  2Z0P A;  2DX1 A;  2DHI A;  2E2X A;  2X18 A;  3HK0 A;  2HTH B;  1ZC4 B;  3U7D A;  2D9Z A;  1ZVR A;  1DYN A;  2GCJ A;  2DFK A;  4Z2N A;  1X86 A;  2I1K A;  4CHJ A;  1WG7 A;  1ZSQ A;  1U5G A;  2LYD A;  2HE7 A;  3ZVR A;  4HB4 B;  1GC7 A;  1OY2 A;  1P3R A;  3PEG A;  1FAO A;  3PZD A;  2D9Y A;  2DYN A;  2LOX A;  1NTY A;  4GZU A;  5HE0 A;  5KQ4 A;  1V88 A;  5DIF B;  2W2W A;  3AJ4 A;  2J59 M;  3ODX A;  2R0D A;  4H8S A;  3P6A A;  3WYF B;  1SHC A;  1KI1 B;  2D11 A;  1TJ6 A;  2YT1 A;  4KVG B;  4A6F B;  5D3Y A;  4DX9 0;  4K17 A;  2LKO A;  4WVF B;  3ZDT A;  2YF0 A;  2RSG A;  1X05 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...