1RRPB

Structure of the ran-gppnhp-ranbd1 complex
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
134
structure length
134
Chain Sequence
HFEPVVPLPDKIEVKTGEEDEEEFFCNRAKLFRFDVESKEWKERGIGNVKILRHKTSGKIRLLMRREQVLKICANHYISPDMKLTPNAGSDRSFVWHALDYADELPKPEQLAIRFKTPEEAALFKCKFEEAQSI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Complex (small gtpase/nuclear protein)
molecule keywords RAN
publication title Structure of a Ran-binding domain complexed with Ran bound to a GTP analogue: implications for nuclear transport.
pubmed doi rcsb
source organism Homo sapiens
total genus 27
structure length 134
sequence length 134
chains with identical sequence D
ec nomenclature
pdb deposition date 1999-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00638 Ran_BP1 RanBP1 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 1rrpB00
1Y19B 1MIXA 1UNQA 3GYOA 1ISNA 4H8SA 1H10A 3D8DA 1V89A 4GMVA 1U27A 2L2IA 3FEHA 4MT7A 1MK7B 1X11A 4ZRKA 1Q67A 2I5CA 4GPTB 5DH9B 3CXBB 3AU5A 2CY4A 5D3VA 2UZSA 4EKUA 5C16A 3HK0A 1BTKA 3ODXA 1XD4A 2RNRB 3AJ4A 1U2BA 2DX1A 2DA0A 3CIKA 3F5RA 3QWMA 2D9WA 1NTYA 2EC1A 3MPXA 3DXCA 3G9WA 2QKLA 4K17A 3SUZA 3T06A 2J0KA 3KRXA 2DHJA 4KHAA 1XR0B 2Q13A 5KQ1A 2Y8GA 3RCPA 1DDVA 2N23A 4GMXB 1EVHA 1ZSQA 4EMOA 4Y94A 2E2XA 4HDQA 4D0NB 2Z0QA 2D2QA 2DLWA 1XODA 4IAPA 4HAXB 2MDXA 3WA0A 1EF1A 4HATB 3TFMA 2ROVA 3HQCA 1V61A 2DTCA 1FOEA 2VRWB 1U5DA 5DIFB 5J3QA 2RVBB 1WVHA 4HB2B 1WJMA 3PG7A 5CLQB 2RUKB 2Y8FA 5EFXA 1P3RA 2I1KA 2AEHA 2CODA 3TCAA 2DYNA 4C0AA 5J3YA 3ZDTA 2GJYA 3FM8C 2EMSA 1UNPA 4NSWA 4HAUB 2PZ1A 5HE1A 4TYZA 3WYFB 2D4QA 1MIZB 1U29A 4GZUA 1Y5OA 3P7ZA 1XKEA 2Y7BA 2LOZA 1MKEA 2LYDA 2D9YA 2D9ZA 1DYNA 2W2XC 2P0DA 4K2PA 1FAOA 2ELAA 2K00A 2X18A 4HB0B 4F7UP 1J0WA 1X05A 5J3TA 3PP2A 2CAYA 2RLOA 2P0HA 4DBBA 1FGZA 1W1HA 2RGNB 4F7GA 2FJLA 2IYBA 2LKOA 5KQ4A 5LONB 4HHVA 3GYPA 5C6RA 1RRPB 3M1IB 2CY5A 1TXDA 1ZVRA 3KZ1A 1UPRA 4KAXB 4BBKA 1TJ6A 4ZRJA 3TVVA 1LB1A 1W1DA 2D9VA 1RJ2A 2M14A 2COFA 4GN1A 2EMTA 3ODOA 5D3WA 2V76A 1BAKA 1PMSA 1WG7A 1X86A 2DN6A 2KCJA 1SGHA 2ZPYA 5GOWB 2DFKA 2YT1A 3PVUA 4CYEA 3KRWA 1DDMA 3QBVB 1XCGA 2NZ8B 1KZGA 4HDOA 1U5EA 1GC7A 3FSSA 1OY2A 3P6AA 2LULA 1ZC3B 4YONA 4DX8A 1DROA 1M7EA 2OQBA 2H7DA 3TW1A 2COCA 1B55A 4EJNA 3UZTA 1E5WA 1NTVA 4CHJA 2MFQA 1I7AA 3QIJA 4IFSA 1UNRA 2G35A 3DXEA 3PSCA 1OMWA 2J0JA 2YS3A 2UZRA 2I1JA 1KZ7A 3AU4A 4NY0A 5DHAB 3ULBA 3U7DA 1W1GA 3O96A 2CRFA 2L1CA 4WJ7A 4WVFB 4A6HA 1ZM0A 1UEFA 3D8EA 1NU2A 4PQ0A 5DI9B 3HW2B 2DX5A 3MDBC 5KCVA 4CHMA 3PVWA 5FI0A 1BWNA 1K5GB 5C79A 2M38A 4L6EA 4PNKA 2YVCA 4HB4B 1P5TA 3KY9A 3TO1A 5DHFB 1AQCA 2LOXA 3D8FA 2QKMA 3ML4A 2Z0PA 1FHXA 1AWEA 1MPHA 2YS1A 1BTNA 4HAVB 3X23A 2GCLA 1H4RA 1V88A 3LJUX 3SO6A 2R0DA 2HE7A 4A6FB 3PVLA 1N3HA 1ZC4B 4XWXA 1K5DB 1X1FA 3IVFA 5FI1A 4MK0A 4Z2NA 1NI2A 4KHBB 4K81A 1WI1A 5HE3A 3ODWA 4HAYB 1TQZA 2ELBA 2YSZA 4P7IA 4KHOA 2I5FA 2Z0OA 2DKQA 1U5GA 3SNHA 1WGQA 2N0YA 1V5MA 2BCJA 2W2WA 2UVMA 5JP4A 2VKIA 5JHGA 5CLLB 5C5BB 1P6SA 1GG3A 2ADZA 1J19A 1MK9B 2NMBA 2K2JA 4HAWB 2P0FA 3N7CA 2YF0A 1IRSA 2KUPA 4IOYX 2KGXB 1OQNA 4WSFA 2AL6A 1WJ1A 1SHCA 2YRYA 3A98B 4K2OA 4A5KA 4DX90 1QC6A 3A8PA 4A6FA 4HB3B 1M7RA 2ROZB 2EJ8A 1DBHA 1QQGA 3VIAA 5JHHA 2LG1A 2COAA 3NSUA 4TKNA 1KI1B 2RSGA 2YS5A 2D10A 2GCJA 3F0WA 3KSYA 3BINA 2MKRA 2GS0A 3A8QA 1FGYA 1LW3A 2K2UA 3SV1A 4ZRIA 2XQNM 1UPQA 3OANA 1GC6A 1I2HA 3PZDA 2JP2A 1DDWA 5C5BA 3VOQA 1FHOA 2H7EA 3BJIA 5L81A 4HAZB 1U5FA 2P8VA 1MAIA 1FHWA 1FB8A 1WGUA 2R09A 2OTXA 4KVGB 3U8ZA 2MWNB 2D11A 4MY6A 4A6KA 3PEGA 1PLSA 1X1GA 4Z2MB 5D3XA 1V5PA 2DKPA 2J59M 4DXAB 2YT0A 5D27A 5HE2A 2IFSA 4GXBA 2DHIA 1V5UA 2DHKA 5LOPB 1XX0A 1Z87A 3SYXA 5HE0A 3ZVRA 4YL8A 1EAZA 2VSZA 2D9XA 3ULCA 3DXDA 4F7HA 3V5WA 2J0MA 1PFJA 1EGXA 4B6HA 2HTHB 5JLJB 5D3YA 2DYQA 2W2XD
chains in the Genus database with same CATH superfamily
1Y19B 1MIXA 1UNQA 3GYOA 1ISNA 4H8SA 1H10A 3D8DA 1V89A 4GMVA 1U27A 2L2IA 3FEHA 4MT7A 1MK7B 1X11A 4ZRKA 4L1RA 1Q67A 2I5CA 4GPTB 5DH9B 3CXBB 3AU5A 2CY4A 5D3VA 2UZSA 4EKUA 5C16A 3HK0A 1BTKA 3ODXA 5LG4B 1XD4A 2RNRB 3AJ4A 1U2BA 2DX1A 2DA0A 3CIKA 3F5RA 5M4YB 3QWMA 2D9WA 1NTYA 2EC1A 4DIXA 3MPXA 3DXCA 3G9WA 2QKLA 4K17A 3SUZA 3T06A 2J0KA 3KRXA 2DHJA 4KHAA 1XR0B 2Q13A 5KQ1A 2Y8GA 3RCPA 1DDVA 2N23A 4GMXB 1EVHA 1ZSQA 4EMOA 4Y94A 2E2XA 4HDQA 4D0NB 2Z0QA 2D2QA 2DLWA 1XODA 4IAPA 4HAXB 2MDXA 3WA0A 1EF1A 4HATB 3TFMA 2ROVA 3HQCA 4HSIA 1V61A 2DTCA 1FOEA 2VRWB 1U5DA 4QXAB 5DIFB 5J3QA 2RVBB 1WVHA 4CSQA 4HB2B 1WJMA 3PG7A 4GOUA 5CLQB 2RUKB 2Y8FA 5EFXA 1P3RA 2I1KA 2AEHA 2CODA 3TCAA 2DYNA 4C0AA 5J3YA 3ZDTA 2GJYA 3U12A 3FM8C 2EMSA 1UNPA 2K8EA 5I2SA 4NSWA 4HAUB 2PZ1A 5HE1A 4TYZA 3WYFB 2D4QA 1MIZB 1U29A 4GZUA 1Y5OA 1XKEA 3P7ZA 2Y7BA 3NW8A 2LOZA 1MKEA 2LYDA 2D9YA 2Z59A 2D9ZA 1DYNA 2W2XC 2P0DA 4K2PA 3FVCA 1FAOA 2ELAA 2K00A 3B77A 2X18A 4HB0B 4F7UP 1J0WA 1X05A 4OT1A 5J3TA 3PP2A 2CAYA 2RLOA 2P0HA 4DBBA 1FGZA 1W1HA 2RGNB 4F7GA 2FJLA 2IYBA 2LKOA 5KQ4A 5LONB 4HHVA 2Z13A 3GYPA 5C6RA 1RRPB 4OSNA 3M1IB 2CY5A 1TXDA 1ZVRA 3KZ1A 1UPRA 4KAXB 4BBKA 1TJ6A 4ZRJA 3TVVA 1LB1A 1W1DA 2D9VA 1RJ2A 2M14A 2COFA 4GN1A 3NWFA 2EMTA 3ODOA 5D3WA 2V76A 1BAKA 1PMSA 1WG7A 1X86A 2DN6A 2KCJA 1SGHA 2ZPYA 5GOWB 2DFKA 2YT1A 3PVUA 4CYEA 3KRWA 1DDMA 3QBVB 1XCGA 2NZ8B 1KZGA 4HDOA 1U5EA 1GC7A 3FSSA 1OY2A 3P6AA 2LULA 1ZC3B 4YONA 2K49A 5IRSA 4DX8A 1DROA 1M7EA 2OQBA 2H7DA 5I2MA 3TW1A 2COCA 4QJ5B 1B55A 4EJNA 3UZTA 1E5WA 1NTVA 4CHJA 1ZYIA 2MFQA 1I7AA 3QIJA 2KUQA 4IFSA 1UNRA 2G35A 3DXEA 3PSCA 1OMWA 2J0JA 2YS3A 2UZRA 2I1JA 1KZ7A 3AU4A 4NY0A 5DHAB 3ULBA 3U7DA 1W1GA 3O96A 2CRFA 2L1CA 4WJ7A 4WVFB 4A6HA 1ZM0A 1UEFA 3D8EA 1NU2A 4PQ0A 5DI9B 3HW2B 2DX5A 3MDBC 5KCVA 4CHMA 1T77A 3PVWA 5FI0A 1BWNA 1K5GB 5C79A 2M38A 4L6EA 4PNKA 2YVCA 3A58A 3HSAA 4HB4B 1P5TA 3NWAA 3KY9A 3TO1A 5DHFB 1AQCA 2LOXA 3D8FA 2QKMA 3ML4A 2Z0PA 1FHXA 1AWEA 1MPHA 2YS1A 1BTNA 4HAVB 3X23A 2GCLA 1H4RA 1V88A 3LJUX 3SO6A 2R0DA 2HE7A 2YT2A 4A6FB 3PVLA 1N3HA 1ZC4B 4XWXA 1K5DB 1X1FA 3IVFA 2GUMA 5FI1A 2KIGA 4MK0A 4Z2NA 1NI2A 4KHBB 4K81A 1WI1A 5HE3A 3ODWA 4HAYB 1TQZA 2ELBA 2YSZA 4P7IA 3HIEA 4KHOA 2I5FA 2Z0OA 2DKQA 1U5GA 3SNHA 1WGQA 2N0YA 1V5MA 2BCJA 2W2WA 2UVMA 5JP4A 2VKIA 4QJ3B 2FJUB 5JHGA 5CLLB 3NWDA 5C5BB 2KR0A 1P6SA 1GG3A 2ADZA 1J19A 1MK9B 2NMBA 2K2JA 4HAWB 2P0FA 3N7CA 2YF0A 1IRSA 2KUPA 4IOYX 2RRFA 2KGXB 1OQNA 4WSFA 2AL6A 1WJ1A 1SHCA 2YRYA 3A98B 4K2OA 4D6WA 4A5KA 4DX90 1QC6A 3A8PA 3OHMB 4A6FA 4HB3B 1M7RA 2ROZB 2EJ8A 1DBHA 1QQGA 3VIAA 2Z4DA 5JHHA 2LG1A 2COAA 3NSUA 4TKNA 1KI1B 2R2YA 2RSGA 4KHBA 2YS5A 4QJ4B 2D10A 2GCJA 3F0WA 3KSYA 3BINA 2MKRA 3DCXA 2GS0A 3A8QA 1MI1A 1FGYA 1LW3A 2K2UA 3SV1A 4ZRIA 2NBVA 2KIEA 2XQNM 1UPQA 3OANA 2ZKMX 1GC6A 1I2HA 3PZDA 2JP2A 1DDWA 5C5BA 3VOQA 1FHOA 2H7EA 3BJIA 5L81A 4HAZB 1U5FA 2P8VA 1MAIA 1FHWA 1FB8A 1WGUA 2R09A 2OTXA 4KVGB 2Z14A 3U8ZA 2MWNB 2D11A 4MY6A 4A6KA 3PEGA 1PLSA 1X1GA 4Z2MB 5D3XA 1V5PA 2DKPA 2J59M 4DXAB 2YT0A 5D27A 5HE2A 2IFSA 4GXBA 2DHIA 1V5UA 2DHKA 5LOPB 1XX0A 1Z87A 3SYXA 5HE0A 3ZVRA 4YL8A 1EAZA 2VSZA 2D9XA 4GNKB 3DXDA 3ULCA 4F7HA 3V5WA 2J0MA 1PFJA 1EGXA 4B6HA 2HTHB 5JLJB 5D3YA 2DYQA 2W2XD
chains in the Genus database with same CATH topology
1Y19B 1MIXA 1UNQA 3GYOA 1ISNA 4H8SA 1H10A 3D8DA 1V89A 4GMVA 1U27A 2L2IA 3FEHA 4MT7A 1MK7B 1X11A 4ZRKA 1Q67A 2I5CA 4GPTB 5DH9B 3CXBB 3AU5A 2CY4A 5D3VA 2UZSA 4EKUA 5C16A 3HK0A 1BTKA 3ODXA 1XD4A 2RNRB 3AJ4A 1U2BA 2DX1A 2DA0A 3CIKA 3F5RA 3QWMA 2D9WA 1NTYA 2EC1A 3MPXA 3DXCA 3G9WA 2QKLA 4K17A 3SUZA 3T06A 2J0KA 3KRXA 2DHJA 4KHAA 1XR0B 2Q13A 5KQ1A 2Y8GA 3RCPA 1DDVA 2N23A 4GMXB 1EVHA 1ZSQA 4EMOA 4Y94A 2E2XA 4HDQA 4D0NB 2Z0QA 2D2QA 2DLWA 1XODA 4IAPA 4HAXB 2MDXA 3WA0A 1EF1A 4HATB 3TFMA 2ROVA 3HQCA 1V61A 2DTCA 1FOEA 2VRWB 1U5DA 5DIFB 5J3QA 2RVBB 1WVHA 4HB2B 1WJMA 3PG7A 5CLQB 2RUKB 2Y8FA 5EFXA 1P3RA 2I1KA 2AEHA 2CODA 3TCAA 2DYNA 4C0AA 5J3YA 3ZDTA 2GJYA 3FM8C 2EMSA 1UNPA 4NSWA 4HAUB 2PZ1A 5HE1A 4TYZA 3WYFB 2D4QA 1MIZB 1U29A 4GZUA 1Y5OA 3P7ZA 1XKEA 2Y7BA 2LOZA 1MKEA 2LYDA 2D9YA 2D9ZA 1DYNA 2W2XC 2P0DA 4K2PA 1FAOA 2ELAA 2K00A 2X18A 4HB0B 4F7UP 1J0WA 1X05A 5J3TA 3PP2A 2CAYA 2RLOA 2P0HA 4DBBA 1FGZA 1W1HA 2RGNB 4F7GA 2FJLA 2IYBA 2LKOA 5KQ4A 5LONB 4HHVA 3GYPA 5C6RA 1RRPB 3M1IB 2CY5A 1TXDA 1ZVRA 3KZ1A 1UPRA 4KAXB 4BBKA 1TJ6A 4ZRJA 3TVVA 1LB1A 1W1DA 2D9VA 1RJ2A 2M14A 2COFA 4GN1A 2EMTA 3ODOA 5D3WA 2V76A 1BAKA 1PMSA 1WG7A 1X86A 2DN6A 2KCJA 1SGHA 2ZPYA 5GOWB 2DFKA 2YT1A 3PVUA 4CYEA 3KRWA 1DDMA 3QBVB 1XCGA 2NZ8B 1KZGA 4HDOA 1U5EA 1GC7A 3FSSA 1OY2A 3P6AA 2LULA 1ZC3B 4YONA 4DX8A 1DROA 1M7EA 2OQBA 2H7DA 3TW1A 2COCA 1B55A 4EJNA 3UZTA 1E5WA 1NTVA 4CHJA 2MFQA 1I7AA 3QIJA 4IFSA 1UNRA 2G35A 3DXEA 3PSCA 1OMWA 2J0JA 2YS3A 2UZRA 2I1JA 1KZ7A 3AU4A 4NY0A 5DHAB 3ULBA 3U7DA 1W1GA 3O96A 2CRFA 2L1CA 4WJ7A 4WVFB 4A6HA 1ZM0A 1UEFA 3D8EA 1NU2A 4PQ0A 5DI9B 3HW2B 2DX5A 3MDBC 5KCVA 4CHMA 3PVWA 5FI0A 1BWNA 1K5GB 5C79A 2M38A 4L6EA 4PNKA 2YVCA 4HB4B 1P5TA 3KY9A 3TO1A 5DHFB 1AQCA 2LOXA 3D8FA 2QKMA 3ML4A 2Z0PA 1FHXA 1AWEA 1MPHA 2YS1A 1BTNA 4HAVB 3X23A 2GCLA 1H4RA 1V88A 3LJUX 3SO6A 2R0DA 2HE7A 4A6FB 3PVLA 1N3HA 1ZC4B 4XWXA 1K5DB 1X1FA 3IVFA 5FI1A 4MK0A 4Z2NA 1NI2A 4KHBB 4K81A 1WI1A 5HE3A 3ODWA 4HAYB 1TQZA 2ELBA 2YSZA 4P7IA 4KHOA 2I5FA 2Z0OA 2DKQA 1U5GA 3SNHA 1WGQA 2N0YA 1V5MA 2BCJA 2W2WA 2UVMA 5JP4A 2VKIA 5JHGA 5CLLB 5C5BB 1P6SA 1GG3A 2ADZA 1J19A 1MK9B 2NMBA 2K2JA 4HAWB 2P0FA 3N7CA 2YF0A 1IRSA 2KUPA 4IOYX 2KGXB 1OQNA 4WSFA 2AL6A 1WJ1A 1SHCA 2YRYA 3A98B 4K2OA 4A5KA 4DX90 1QC6A 3A8PA 4A6FA 4HB3B 1M7RA 2ROZB 2EJ8A 1DBHA 1QQGA 3VIAA 5JHHA 2LG1A 2COAA 3NSUA 4TKNA 1KI1B 2RSGA 2YS5A 2D10A 2GCJA 3F0WA 3KSYA 3BINA 2MKRA 2GS0A 3A8QA 1FGYA 1LW3A 2K2UA 3SV1A 4ZRIA 2XQNM 1UPQA 3OANA 1GC6A 1I2HA 3PZDA 2JP2A 1DDWA 5C5BA 3VOQA 1FHOA 2H7EA 3BJIA 5L81A 4HAZB 1U5FA 2P8VA 1MAIA 1FHWA 1FB8A 1WGUA 2R09A 2OTXA 4KVGB 3U8ZA 2MWNB 2D11A 4MY6A 4A6KA 3PEGA 1PLSA 1X1GA 4Z2MB 5D3XA 1V5PA 2DKPA 2J59M 4DXAB 2YT0A 5D27A 5HE2A 2IFSA 4GXBA 2DHIA 1V5UA 2DHKA 5LOPB 1XX0A 1Z87A 3SYXA 5HE0A 3ZVRA 4YL8A 1EAZA 2VSZA 2D9XA 3ULCA 3DXDA 4F7HA 3V5WA 2J0MA 1PFJA 1EGXA 4B6HA 2HTHB 5JLJB 5D3YA 2DYQA 2W2XD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Y19 B;  1MIX A;  1UNQ A;  3GYO A;  1ISN A;  4H8S A;  1H10 A;  3D8D A;  1V89 A;  4GMV A;  1U27 A;  2L2I A;  3FEH A;  4MT7 A;  1MK7 B;  1X11 A;  4ZRK A;  1Q67 A;  2I5C A;  4GPT B;  5DH9 B;  3CXB B;  3AU5 A;  2CY4 A;  5D3V A;  2UZS A;  4EKU A;  5C16 A;  3HK0 A;  1BTK A;  3ODX A;  1XD4 A;  2RNR B;  3AJ4 A;  1U2B A;  2DX1 A;  2DA0 A;  3CIK A;  3F5R A;  3QWM A;  2D9W A;  1NTY A;  2EC1 A;  3MPX A;  3DXC A;  3G9W A;  2QKL A;  4K17 A;  3SUZ A;  3T06 A;  2J0K A;  3KRX A;  2DHJ A;  4KHA A;  1XR0 B;  2Q13 A;  5KQ1 A;  2Y8G A;  3RCP A;  1DDV A;  2N23 A;  4GMX B;  1EVH A;  1ZSQ A;  4EMO A;  4Y94 A;  2E2X A;  4HDQ A;  4D0N B;  2Z0Q A;  2D2Q A;  2DLW A;  1XOD A;  4IAP A;  4HAX B;  2MDX A;  3WA0 A;  1EF1 A;  4HAT B;  3TFM A;  2ROV A;  3HQC A;  1V61 A;  2DTC A;  1FOE A;  2VRW B;  1U5D A;  5DIF B;  5J3Q A;  2RVB B;  1WVH A;  4HB2 B;  1WJM A;  3PG7 A;  5CLQ B;  2RUK B;  2Y8F A;  5EFX A;  1P3R A;  2I1K A;  2AEH A;  2COD A;  3TCA A;  2DYN A;  4C0A A;  5J3Y A;  3ZDT A;  2GJY A;  3FM8 C;  2EMS A;  1UNP A;  4NSW A;  4HAU B;  2PZ1 A;  5HE1 A;  4TYZ A;  3WYF B;  2D4Q A;  1MIZ B;  1U29 A;  4GZU A;  1Y5O A;  3P7Z A;  1XKE A;  2Y7B A;  2LOZ A;  1MKE A;  2LYD A;  2D9Y A;  2D9Z A;  1DYN A;  2W2X C;  2P0D A;  4K2P A;  1FAO A;  2ELA A;  2K00 A;  2X18 A;  4HB0 B;  4F7U P;  1J0W A;  1X05 A;  5J3T A;  3PP2 A;  2CAY A;  2RLO A;  2P0H A;  4DBB A;  1FGZ A;  1W1H A;  2RGN B;  4F7G A;  2FJL A;  2IYB A;  2LKO A;  5KQ4 A;  5LON B;  4HHV A;  3GYP A;  5C6R A;  1RRP B;  3M1I B;  2CY5 A;  1TXD A;  1ZVR A;  3KZ1 A;  1UPR A;  4KAX B;  4BBK A;  1TJ6 A;  4ZRJ A;  3TVV A;  1LB1 A;  1W1D A;  2D9V A;  1RJ2 A;  2M14 A;  2COF A;  4GN1 A;  2EMT A;  3ODO A;  5D3W A;  2V76 A;  1BAK A;  1PMS A;  1WG7 A;  1X86 A;  2DN6 A;  2KCJ A;  1SGH A;  2ZPY A;  5GOW B;  2DFK A;  2YT1 A;  3PVU A;  4CYE A;  3KRW A;  1DDM A;  3QBV B;  1XCG A;  2NZ8 B;  1KZG A;  4HDO A;  1U5E A;  1GC7 A;  3FSS A;  1OY2 A;  3P6A A;  2LUL A;  1ZC3 B;  4YON A;  4DX8 A;  1DRO A;  1M7E A;  2OQB A;  2H7D A;  3TW1 A;  2COC A;  1B55 A;  4EJN A;  3UZT A;  1E5W A;  1NTV A;  4CHJ A;  2MFQ A;  1I7A A;  3QIJ A;  4IFS A;  1UNR A;  2G35 A;  3DXE A;  3PSC A;  1OMW A;  2J0J A;  2YS3 A;  2UZR A;  2I1J A;  1KZ7 A;  3AU4 A;  4NY0 A;  5DHA B;  3ULB A;  3U7D A;  1W1G A;  3O96 A;  2CRF A;  2L1C A;  4WJ7 A;  4WVF B;  4A6H A;  1ZM0 A;  1UEF A;  3D8E A;  1NU2 A;  4PQ0 A;  5DI9 B;  3HW2 B;  2DX5 A;  3MDB C;  5KCV A;  4CHM A;  3PVW A;  5FI0 A;  1BWN A;  1K5G B;  5C79 A;  2M38 A;  4L6E A;  4PNK A;  2YVC A;  4HB4 B;  1P5T A;  3KY9 A;  3TO1 A;  5DHF B;  1AQC A;  2LOX A;  3D8F A;  2QKM A;  3ML4 A;  2Z0P A;  1FHX A;  1AWE A;  1MPH A;  2YS1 A;  1BTN A;  4HAV B;  3X23 A;  2GCL A;  1H4R A;  1V88 A;  3LJU X;  3SO6 A;  2R0D A;  2HE7 A;  4A6F B;  3PVL A;  1N3H A;  1ZC4 B;  4XWX A;  1K5D B;  1X1F A;  3IVF A;  5FI1 A;  4MK0 A;  4Z2N A;  1NI2 A;  4KHB B;  4K81 A;  1WI1 A;  5HE3 A;  3ODW A;  4HAY B;  1TQZ A;  2ELB A;  2YSZ A;  4P7I A;  4KHO A;  2I5F A;  2Z0O A;  2DKQ A;  1U5G A;  3SNH A;  1WGQ A;  2N0Y A;  1V5M A;  2BCJ A;  2W2W A;  2UVM A;  5JP4 A;  2VKI A;  5JHG A;  5CLL B;  5C5B B;  1P6S A;  1GG3 A;  2ADZ A;  1J19 A;  1MK9 B;  2NMB A;  2K2J A;  4HAW B;  2P0F A;  3N7C A;  2YF0 A;  1IRS A;  2KUP A;  4IOY X;  2KGX B;  1OQN A;  4WSF A;  2AL6 A;  1WJ1 A;  1SHC A;  2YRY A;  3A98 B;  4K2O A;  4A5K A;  4DX9 0;  1QC6 A;  3A8P A;  4A6F A;  4HB3 B;  1M7R A;  2ROZ B;  2EJ8 A;  1DBH A;  1QQG A;  3VIA A;  5JHH A;  2LG1 A;  2COA A;  3NSU A;  4TKN A;  1KI1 B;  2RSG A;  2YS5 A;  2D10 A;  2GCJ A;  3F0W A;  3KSY A;  3BIN A;  2MKR A;  2GS0 A;  3A8Q A;  1FGY A;  1LW3 A;  2K2U A;  3SV1 A;  4ZRI A;  2XQN M;  1UPQ A;  3OAN A;  1GC6 A;  1I2H A;  3PZD A;  2JP2 A;  1DDW A;  5C5B A;  3VOQ A;  1FHO A;  2H7E A;  3BJI A;  5L81 A;  4HAZ B;  1U5F A;  2P8V A;  1MAI A;  1FHW A;  1FB8 A;  1WGU A;  2R09 A;  2OTX A;  4KVG B;  3U8Z A;  2MWN B;  2D11 A;  4MY6 A;  4A6K A;  3PEG A;  1PLS A;  1X1G A;  4Z2M B;  5D3X A;  1V5P A;  2DKP A;  2J59 M;  4DXA B;  2YT0 A;  5D27 A;  5HE2 A;  2IFS A;  4GXB A;  2DHI A;  1V5U A;  2DHK A;  5LOP B;  1XX0 A;  1Z87 A;  3SYX A;  5HE0 A;  3ZVR A;  4YL8 A;  1EAZ A;  2VSZ A;  2D9X A;  3ULC A;  3DXD A;  4F7H A;  3V5W A;  2J0M A;  1PFJ A;  1EGX A;  4B6H A;  2HTH B;  5JLJ B;  5D3Y A;  2DYQ A;  2W2X D; 
#chains in the Genus database with same CATH topology
 1Y19 B;  1MIX A;  1UNQ A;  3GYO A;  1ISN A;  4H8S A;  1H10 A;  3D8D A;  1V89 A;  4GMV A;  1U27 A;  2L2I A;  3FEH A;  4MT7 A;  1MK7 B;  1X11 A;  4ZRK A;  4L1R A;  1Q67 A;  2I5C A;  4GPT B;  5DH9 B;  3CXB B;  3AU5 A;  2CY4 A;  5D3V A;  2UZS A;  4EKU A;  5C16 A;  3HK0 A;  1BTK A;  3ODX A;  5LG4 B;  1XD4 A;  2RNR B;  3AJ4 A;  1U2B A;  2DX1 A;  2DA0 A;  3CIK A;  3F5R A;  5M4Y B;  3QWM A;  2D9W A;  1NTY A;  2EC1 A;  4DIX A;  3MPX A;  3DXC A;  3G9W A;  2QKL A;  4K17 A;  3SUZ A;  3T06 A;  2J0K A;  3KRX A;  2DHJ A;  4KHA A;  1XR0 B;  2Q13 A;  5KQ1 A;  2Y8G A;  3RCP A;  1DDV A;  2N23 A;  4GMX B;  1EVH A;  1ZSQ A;  4EMO A;  4Y94 A;  2E2X A;  4HDQ A;  4D0N B;  2Z0Q A;  2D2Q A;  2DLW A;  1XOD A;  4IAP A;  4HAX B;  2MDX A;  3WA0 A;  1EF1 A;  4HAT B;  3TFM A;  2ROV A;  3HQC A;  4HSI A;  1V61 A;  2DTC A;  1FOE A;  2VRW B;  1U5D A;  4QXA B;  5DIF B;  5J3Q A;  2RVB B;  1WVH A;  4CSQ A;  4HB2 B;  1WJM A;  3PG7 A;  4GOU A;  5CLQ B;  2RUK B;  2Y8F A;  5EFX A;  1P3R A;  2I1K A;  2AEH A;  2COD A;  3TCA A;  2DYN A;  4C0A A;  5J3Y A;  3ZDT A;  2GJY A;  3U12 A;  3FM8 C;  2EMS A;  1UNP A;  2K8E A;  5I2S A;  4NSW A;  4HAU B;  2PZ1 A;  5HE1 A;  4TYZ A;  3WYF B;  2D4Q A;  1MIZ B;  1U29 A;  4GZU A;  1Y5O A;  1XKE A;  3P7Z A;  2Y7B A;  3NW8 A;  2LOZ A;  1MKE A;  2LYD A;  2D9Y A;  2Z59 A;  2D9Z A;  1DYN A;  2W2X C;  2P0D A;  4K2P A;  3FVC A;  1FAO A;  2ELA A;  2K00 A;  3B77 A;  2X18 A;  4HB0 B;  4F7U P;  1J0W A;  1X05 A;  4OT1 A;  5J3T A;  3PP2 A;  2CAY A;  2RLO A;  2P0H A;  4DBB A;  1FGZ A;  1W1H A;  2RGN B;  4F7G A;  2FJL A;  2IYB A;  2LKO A;  5KQ4 A;  5LON B;  4HHV A;  2Z13 A;  3GYP A;  5C6R A;  1RRP B;  4OSN A;  3M1I B;  2CY5 A;  1TXD A;  1ZVR A;  3KZ1 A;  1UPR A;  4KAX B;  4BBK A;  1TJ6 A;  4ZRJ A;  3TVV A;  1LB1 A;  1W1D A;  2D9V A;  1RJ2 A;  2M14 A;  2COF A;  4GN1 A;  3NWF A;  2EMT A;  3ODO A;  5D3W A;  2V76 A;  1BAK A;  1PMS A;  1WG7 A;  1X86 A;  2DN6 A;  2KCJ A;  1SGH A;  2ZPY A;  5GOW B;  2DFK A;  2YT1 A;  3PVU A;  4CYE A;  3KRW A;  1DDM A;  3QBV B;  1XCG A;  2NZ8 B;  1KZG A;  4HDO A;  1U5E A;  1GC7 A;  3FSS A;  1OY2 A;  3P6A A;  2LUL A;  1ZC3 B;  4YON A;  2K49 A;  5IRS A;  4DX8 A;  1DRO A;  1M7E A;  2OQB A;  2H7D A;  5I2M A;  3TW1 A;  2COC A;  4QJ5 B;  1B55 A;  4EJN A;  3UZT A;  1E5W A;  1NTV A;  4CHJ A;  1ZYI A;  2MFQ A;  1I7A A;  3QIJ A;  2KUQ A;  4IFS A;  1UNR A;  2G35 A;  3DXE A;  3PSC A;  1OMW A;  2J0J A;  2YS3 A;  2UZR A;  2I1J A;  1KZ7 A;  3AU4 A;  4NY0 A;  5DHA B;  3ULB A;  3U7D A;  1W1G A;  3O96 A;  2CRF A;  2L1C A;  4WJ7 A;  4WVF B;  4A6H A;  1ZM0 A;  1UEF A;  3D8E A;  1NU2 A;  4PQ0 A;  5DI9 B;  3HW2 B;  2DX5 A;  3MDB C;  5KCV A;  4CHM A;  1T77 A;  3PVW A;  5FI0 A;  1BWN A;  1K5G B;  5C79 A;  2M38 A;  4L6E A;  4PNK A;  2YVC A;  3A58 A;  3HSA A;  4HB4 B;  1P5T A;  3NWA A;  3KY9 A;  3TO1 A;  5DHF B;  1AQC A;  2LOX A;  3D8F A;  2QKM A;  3ML4 A;  2Z0P A;  1FHX A;  1AWE A;  1MPH A;  2YS1 A;  1BTN A;  4HAV B;  3X23 A;  2GCL A;  1H4R A;  1V88 A;  3LJU X;  3SO6 A;  2R0D A;  2HE7 A;  2YT2 A;  4A6F B;  3PVL A;  1N3H A;  1ZC4 B;  4XWX A;  1K5D B;  1X1F A;  3IVF A;  2GUM A;  5FI1 A;  2KIG A;  4MK0 A;  4Z2N A;  1NI2 A;  4KHB B;  4K81 A;  1WI1 A;  5HE3 A;  3ODW A;  4HAY B;  1TQZ A;  2ELB A;  2YSZ A;  4P7I A;  3HIE A;  4KHO A;  2I5F A;  2Z0O A;  2DKQ A;  1U5G A;  3SNH A;  1WGQ A;  2N0Y A;  1V5M A;  2BCJ A;  2W2W A;  2UVM A;  5JP4 A;  2VKI A;  4QJ3 B;  2FJU B;  5JHG A;  5CLL B;  3NWD A;  5C5B B;  2KR0 A;  1P6S A;  1GG3 A;  2ADZ A;  1J19 A;  1MK9 B;  2NMB A;  2K2J A;  4HAW B;  2P0F A;  3N7C A;  2YF0 A;  1IRS A;  2KUP A;  4IOY X;  2RRF A;  2KGX B;  1OQN A;  4WSF A;  2AL6 A;  1WJ1 A;  1SHC A;  2YRY A;  3A98 B;  4K2O A;  4D6W A;  4A5K A;  4DX9 0;  1QC6 A;  3A8P A;  3OHM B;  4A6F A;  4HB3 B;  1M7R A;  2ROZ B;  2EJ8 A;  1DBH A;  1QQG A;  3VIA A;  2Z4D A;  5JHH A;  2LG1 A;  2COA A;  3NSU A;  4TKN A;  1KI1 B;  2R2Y A;  2RSG A;  4KHB A;  2YS5 A;  4QJ4 B;  2D10 A;  2GCJ A;  3F0W A;  3KSY A;  3BIN A;  2MKR A;  3DCX A;  2GS0 A;  3A8Q A;  1MI1 A;  1FGY A;  1LW3 A;  2K2U A;  3SV1 A;  4ZRI A;  2NBV A;  2KIE A;  2XQN M;  1UPQ A;  3OAN A;  2ZKM X;  1GC6 A;  1I2H A;  3PZD A;  2JP2 A;  1DDW A;  5C5B A;  3VOQ A;  1FHO A;  2H7E A;  3BJI A;  5L81 A;  4HAZ B;  1U5F A;  2P8V A;  1MAI A;  1FHW A;  1FB8 A;  1WGU A;  2R09 A;  2OTX A;  4KVG B;  2Z14 A;  3U8Z A;  2MWN B;  2D11 A;  4MY6 A;  4A6K A;  3PEG A;  1PLS A;  1X1G A;  4Z2M B;  5D3X A;  1V5P A;  2DKP A;  2J59 M;  4DXA B;  2YT0 A;  5D27 A;  5HE2 A;  2IFS A;  4GXB A;  2DHI A;  1V5U A;  2DHK A;  5LOP B;  1XX0 A;  1Z87 A;  3SYX A;  5HE0 A;  3ZVR A;  4YL8 A;  1EAZ A;  2VSZ A;  2D9X A;  4GNK B;  3DXD A;  3ULC A;  4F7H A;  3V5W A;  2J0M A;  1PFJ A;  1EGX A;  4B6H A;  2HTH B;  5JLJ B;  5D3Y A;  2DYQ A;  2W2X D; 
#chains in the Genus database with same CATH homology
 1Y19 B;  1MIX A;  1UNQ A;  3GYO A;  1ISN A;  4H8S A;  1H10 A;  3D8D A;  1V89 A;  4GMV A;  1U27 A;  2L2I A;  3FEH A;  4MT7 A;  1MK7 B;  1X11 A;  4ZRK A;  1Q67 A;  2I5C A;  4GPT B;  5DH9 B;  3CXB B;  3AU5 A;  2CY4 A;  5D3V A;  2UZS A;  4EKU A;  5C16 A;  3HK0 A;  1BTK A;  3ODX A;  1XD4 A;  2RNR B;  3AJ4 A;  1U2B A;  2DX1 A;  2DA0 A;  3CIK A;  3F5R A;  3QWM A;  2D9W A;  1NTY A;  2EC1 A;  3MPX A;  3DXC A;  3G9W A;  2QKL A;  4K17 A;  3SUZ A;  3T06 A;  2J0K A;  3KRX A;  2DHJ A;  4KHA A;  1XR0 B;  2Q13 A;  5KQ1 A;  2Y8G A;  3RCP A;  1DDV A;  2N23 A;  4GMX B;  1EVH A;  1ZSQ A;  4EMO A;  4Y94 A;  2E2X A;  4HDQ A;  4D0N B;  2Z0Q A;  2D2Q A;  2DLW A;  1XOD A;  4IAP A;  4HAX B;  2MDX A;  3WA0 A;  1EF1 A;  4HAT B;  3TFM A;  2ROV A;  3HQC A;  1V61 A;  2DTC A;  1FOE A;  2VRW B;  1U5D A;  5DIF B;  5J3Q A;  2RVB B;  1WVH A;  4HB2 B;  1WJM A;  3PG7 A;  5CLQ B;  2RUK B;  2Y8F A;  5EFX A;  1P3R A;  2I1K A;  2AEH A;  2COD A;  3TCA A;  2DYN A;  4C0A A;  5J3Y A;  3ZDT A;  2GJY A;  3FM8 C;  2EMS A;  1UNP A;  4NSW A;  4HAU B;  2PZ1 A;  5HE1 A;  4TYZ A;  3WYF B;  2D4Q A;  1MIZ B;  1U29 A;  4GZU A;  1Y5O A;  3P7Z A;  1XKE A;  2Y7B A;  2LOZ A;  1MKE A;  2LYD A;  2D9Y A;  2D9Z A;  1DYN A;  2W2X C;  2P0D A;  4K2P A;  1FAO A;  2ELA A;  2K00 A;  2X18 A;  4HB0 B;  4F7U P;  1J0W A;  1X05 A;  5J3T A;  3PP2 A;  2CAY A;  2RLO A;  2P0H A;  4DBB A;  1FGZ A;  1W1H A;  2RGN B;  4F7G A;  2FJL A;  2IYB A;  2LKO A;  5KQ4 A;  5LON B;  4HHV A;  3GYP A;  5C6R A;  1RRP B;  3M1I B;  2CY5 A;  1TXD A;  1ZVR A;  3KZ1 A;  1UPR A;  4KAX B;  4BBK A;  1TJ6 A;  4ZRJ A;  3TVV A;  1LB1 A;  1W1D A;  2D9V A;  1RJ2 A;  2M14 A;  2COF A;  4GN1 A;  2EMT A;  3ODO A;  5D3W A;  2V76 A;  1BAK A;  1PMS A;  1WG7 A;  1X86 A;  2DN6 A;  2KCJ A;  1SGH A;  2ZPY A;  5GOW B;  2DFK A;  2YT1 A;  3PVU A;  4CYE A;  3KRW A;  1DDM A;  3QBV B;  1XCG A;  2NZ8 B;  1KZG A;  4HDO A;  1U5E A;  1GC7 A;  3FSS A;  1OY2 A;  3P6A A;  2LUL A;  1ZC3 B;  4YON A;  4DX8 A;  1DRO A;  1M7E A;  2OQB A;  2H7D A;  3TW1 A;  2COC A;  1B55 A;  4EJN A;  3UZT A;  1E5W A;  1NTV A;  4CHJ A;  2MFQ A;  1I7A A;  3QIJ A;  4IFS A;  1UNR A;  2G35 A;  3DXE A;  3PSC A;  1OMW A;  2J0J A;  2YS3 A;  2UZR A;  2I1J A;  1KZ7 A;  3AU4 A;  4NY0 A;  5DHA B;  3ULB A;  3U7D A;  1W1G A;  3O96 A;  2CRF A;  2L1C A;  4WJ7 A;  4WVF B;  4A6H A;  1ZM0 A;  1UEF A;  3D8E A;  1NU2 A;  4PQ0 A;  5DI9 B;  3HW2 B;  2DX5 A;  3MDB C;  5KCV A;  4CHM A;  3PVW A;  5FI0 A;  1BWN A;  1K5G B;  5C79 A;  2M38 A;  4L6E A;  4PNK A;  2YVC A;  4HB4 B;  1P5T A;  3KY9 A;  3TO1 A;  5DHF B;  1AQC A;  2LOX A;  3D8F A;  2QKM A;  3ML4 A;  2Z0P A;  1FHX A;  1AWE A;  1MPH A;  2YS1 A;  1BTN A;  4HAV B;  3X23 A;  2GCL A;  1H4R A;  1V88 A;  3LJU X;  3SO6 A;  2R0D A;  2HE7 A;  4A6F B;  3PVL A;  1N3H A;  1ZC4 B;  4XWX A;  1K5D B;  1X1F A;  3IVF A;  5FI1 A;  4MK0 A;  4Z2N A;  1NI2 A;  4KHB B;  4K81 A;  1WI1 A;  5HE3 A;  3ODW A;  4HAY B;  1TQZ A;  2ELB A;  2YSZ A;  4P7I A;  4KHO A;  2I5F A;  2Z0O A;  2DKQ A;  1U5G A;  3SNH A;  1WGQ A;  2N0Y A;  1V5M A;  2BCJ A;  2W2W A;  2UVM A;  5JP4 A;  2VKI A;  5JHG A;  5CLL B;  5C5B B;  1P6S A;  1GG3 A;  2ADZ A;  1J19 A;  1MK9 B;  2NMB A;  2K2J A;  4HAW B;  2P0F A;  3N7C A;  2YF0 A;  1IRS A;  2KUP A;  4IOY X;  2KGX B;  1OQN A;  4WSF A;  2AL6 A;  1WJ1 A;  1SHC A;  2YRY A;  3A98 B;  4K2O A;  4A5K A;  4DX9 0;  1QC6 A;  3A8P A;  4A6F A;  4HB3 B;  1M7R A;  2ROZ B;  2EJ8 A;  1DBH A;  1QQG A;  3VIA A;  5JHH A;  2LG1 A;  2COA A;  3NSU A;  4TKN A;  1KI1 B;  2RSG A;  2YS5 A;  2D10 A;  2GCJ A;  3F0W A;  3KSY A;  3BIN A;  2MKR A;  2GS0 A;  3A8Q A;  1FGY A;  1LW3 A;  2K2U A;  3SV1 A;  4ZRI A;  2XQN M;  1UPQ A;  3OAN A;  1GC6 A;  1I2H A;  3PZD A;  2JP2 A;  1DDW A;  5C5B A;  3VOQ A;  1FHO A;  2H7E A;  3BJI A;  5L81 A;  4HAZ B;  1U5F A;  2P8V A;  1MAI A;  1FHW A;  1FB8 A;  1WGU A;  2R09 A;  2OTX A;  4KVG B;  3U8Z A;  2MWN B;  2D11 A;  4MY6 A;  4A6K A;  3PEG A;  1PLS A;  1X1G A;  4Z2M B;  5D3X A;  1V5P A;  2DKP A;  2J59 M;  4DXA B;  2YT0 A;  5D27 A;  5HE2 A;  2IFS A;  4GXB A;  2DHI A;  1V5U A;  2DHK A;  5LOP B;  1XX0 A;  1Z87 A;  3SYX A;  5HE0 A;  3ZVR A;  4YL8 A;  1EAZ A;  2VSZ A;  2D9X A;  3ULC A;  3DXD A;  4F7H A;  3V5W A;  2J0M A;  1PFJ A;  1EGX A;  4B6H A;  2HTH B;  5JLJ B;  5D3Y A;  2DYQ A;  2W2X D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...