1FGZA

Grp1 ph domain (unliganded)
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
127
structure length
127
Chain Sequence
TFFNPDREGWLLKLGGRVKTWKRRWFILTDNCLYYFEYTTDKEPRGIIPLENLSIREVLDPRKPNCFELYNPSHKGQVIKACKTEADGRVVEGNHVVYRISAPSPEEKEEWMKSIKASISRDPFYDM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords GRP1
publication title Structural basis of 3-phosphoinositide recognition by pleckstrin homology domains.
pubmed doi rcsb
source organism Mus musculus
molecule tags Signaling protein
total genus 20
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2000-07-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00169 PH PH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 1fgzA00
4GPTB 1ZC4B 2Z0PA 1ZC3B 3FM8C 2GCLA 1OY2A 2K2UA 4C0AA 2DN6A 3KRXA 5HE1A 2LOXA 2M38A 1U2BA 3U8ZA 5C6RA 1GC6A 2DTCA 4TKNA 2P0HA 2RNRB 2X18A 3WYFB 2DHKA 2GJYA 2DKPA 3MPXA 1TQZA 2DA0A 1FGZA 5J3TA 1U5FA 2COCA 1V5MA 1QC6A 5JHGA 4HB0B 4KVGB 1ISNA 2W2XC 4PQ0A 1UPRA 4HAVB 4IAPA 2P0DA 2DHJA 2CY4A 4KHOA 3DXDA 2W2WA 3NSUA 2Z0OA 3P6AA 1H4RA 2I5CA 2RLOA 3QWMA 4WJ7A 1U29A 3QBVB 4CHJA 1X86A 5CLLB 3PVLA 5J3YA 1Y19B 1MK7B 5FI0A 2L1CA 4A6HA 2YS5A 5DIFB 5FI1A 1WVHA 2M14A 4TYZA 5LOPB 1P3RA 3RCPA 3HK0A 1FHXA 1XODA 4F7UP 4IFSA 1X05A 2OTXA 1WJ1A 1RRPB 3OANA 2BCJA 2MFQA 2D2QA 2RVBB 4HATB 4Y94A 2ELBA 2JP2A 2DFKA 4HB2B 5EFXA 2I5FA 2N0YA 4P7IA 2ROVA 1DDWA 4HDOA 2MWNB 2LG1A 2YS1A 4L6EA 2YT1A 4HHVA 3A8PA 1I7AA 3SO6A 2VKIA 2Y8GA 4MT7A 1FGYA 3CXBB 3BINA 2H7DA 4KHAA 4HAYB 4Z2MB 1X1FA 2EMTA 5D27A 3AJ4A 3D8FA 4D0NB 1ZVRA 1XD4A 1XCGA 4HAUB 2I1KA 1MIXA 2QKMA 3BJIA 2VRWB 2D10A 3A98B 2QKLA 2D9XA 1KI1B 5L81A 1K5DB 3PSCA 5JHHA 4KAXB 1UPQA 3KRWA 2UVMA 2AEHA 2UZRA 2YRYA 1LB1A 4HB3B 1UNPA 3LJUX 1RJ2A 2NZ8B 1UNQA 5DHFB 2LKOA 4K17A 4GXBA 2DYNA 1XX0A 4A5KA 4CHMA 4ZRIA 1E5WA 2DYQA 3VIAA 2J0KA 2AL6A 3PVUA 5D3WA 2D9ZA 3PG7A 2G35A 2Y7BA 4NSWA 2K00A 5D3XA 1U5EA 2YS3A 4HDQA 4ZRKA 2D9YA 1MK9B 4IOYX 2GS0A 2ELAA 5J3QA 4DX8A 5DHAB 3UZTA 3KY9A 1W1GA 5GOWB 3T06A 2ROZB 1UEFA 2ZPYA 4GMXB 5C5BA 3ODXA 1PLSA 1FOEA 3ULBA 2P8VA 2XQNM 2IFSA 3P7ZA 4A6FA 1V5PA 1U5GA 1ZM0A 3ML4A 2P0FA 3SYXA 3ODOA 2DKQA 2H7EA 2VSZA 4GMVA 4K81A 3VOQA 4Z2NA 2COAA 3TVVA 4EMOA 1WGUA 2HTHB 1W1DA 4GZUA 2EMSA 4MK0A 3SV1A 1B55A 2FJLA 3WA0A 1MKEA 3TW1A 2DHIA 1J0WA 1OQNA 1LW3A 2YT0A 4DX90 1W1HA 3D8DA 2L2IA 1N3HA 4HB4B 4DBBA 2CRFA 2MDXA 2YF0A 1NU2A 2KCJA 1V61A 1WI1A 3F0WA 4ZRJA 2DX1A 1FAOA 1V5UA 1WGQA 2GCJA 4PNKA 5HE2A 1BWNA 4F7HA 2CODA 2R09A 1P5TA 2N23A 3PP2A 3DXEA 2RGNB 5KQ1A 1DDVA 1I2HA 3V5WA 3N7CA 3ZDTA 2K2JA 3PZDA 3TCAA 5C5BB 4HAWB 3TFMA 4F7GA 3O96A 4YONA 1EAZA 5D3YA 5JLJB 2LYDA 5D3VA 1SHCA 4A6FB 5DH9B 3IVFA 4BBKA 5C16A 5DI9B 2RSGA 2EJ8A 5CLQB 1NTYA 3GYOA 1TXDA 1MIZB 2Y8FA 4K2PA 1MAIA 1EGXA 1WJMA 3GYPA 4B6HA 1Z87A 2J0JA 1M7EA 2Z0QA 4MY6A 2R0DA 1FHOA 2KUPA 2E2XA 1H10A 2J59M 2ADZA 3QIJA 4YL8A 4DXAB 1Q67A 3DXCA 5LONB 1FB8A 1TJ6A 3FEHA 3SNHA 3KSYA 3ULCA 5HE0A 3D8EA 3F5RA 4A6KA 4HAXB 2YVCA 1XR0B 4EJNA 4WSFA 2CAYA 3G9WA 1QQGA 1K5GB 1BAKA 1U5DA 2CY5A 1WG7A 2KGXB 1DDMA 2UZSA 4HAZB 3PEGA 3U7DA 1U27A 1XKEA 3AU4A 1GC7A 1V89A 1DBHA 3CIKA 3HQCA 2PZ1A 2DX5A 4K2OA 3A8QA 1AWEA 3MDBC 1BTNA 1UNRA 1PMSA 1FHWA 1KZGA 2MKRA 2YSZA 1X1GA 3HW2B 5HE3A 4CYEA 2J0MA 1KZ7A 5JP4A 1M7RA 2D11A 2LOZA 2W2XD 3KZ1A 4XWXA 5C79A 5KQ4A 1X11A 1ZSQA 4GN1A 2NMBA 1DROA 3PVWA 1MPHA 2D4QA 3SUZA 1EF1A 2IYBA 4H8SA 2D9VA 3TO1A 2DLWA 1NTVA 1J19A 3FSSA 1SGHA 3AU5A 1PFJA 1V88A 2OQBA 2RUKB 3ZVRA 1IRSA 2LULA 4KHBB 3ODWA 3M1IB 1OMWA 1Y5OA 2Q13A 3X23A 2I1JA 1DYNA 4WVFB 2D9WA 1BTKA 4EKUA 2HE7A 4NY0A 5KCVA 1AQCA 1GG3A 2EC1A 1NI2A 2COFA 1P6SA 2V76A 1EVHA
chains in the Genus database with same CATH superfamily
4GPTB 1ZC4B 2Z0PA 1ZC3B 3FM8C 2GCLA 1OY2A 2K2UA 4C0AA 2DN6A 3KRXA 5HE1A 2LOXA 2M38A 1U2BA 3U8ZA 5C6RA 1GC6A 2DTCA 4TKNA 2P0HA 2RNRB 2X18A 3WYFB 2DHKA 4QJ3B 2GJYA 2DKPA 3MPXA 1TQZA 5M4YB 2DA0A 1FGZA 5J3TA 1U5FA 2COCA 1V5MA 2Z4DA 1QC6A 4KHBA 5JHGA 4HB0B 4KVGB 1ISNA 2W2XC 4PQ0A 5I2MA 1UPRA 4HAVB 4IAPA 2P0DA 2DHJA 2CY4A 4KHOA 2KR0A 3DXDA 2W2WA 3NSUA 2Z0OA 2YT2A 3P6AA 1H4RA 2I5CA 2RLOA 3DCXA 3QWMA 4WJ7A 3NWDA 1U29A 3QBVB 1MI1A 2ZKMX 4CHJA 1X86A 5CLLB 4QJ5B 3PVLA 5J3YA 1Y19B 1MK7B 5FI0A 2L1CA 4CSQA 4A6HA 2YS5A 5DIFB 5FI1A 1WVHA 2M14A 4TYZA 5LOPB 1P3RA 3RCPA 3HK0A 1FHXA 1XODA 4GNKB 4F7UP 4IFSA 1X05A 2OTXA 2NBVA 1WJ1A 1RRPB 3OANA 2BCJA 2MFQA 2D2QA 2RVBB 4L1RA 4HATB 4Y94A 3NWFA 2ELBA 2JP2A 2DFKA 4HB2B 5EFXA 2I5FA 2N0YA 4P7IA 2ROVA 1DDWA 4HDOA 5LG4B 2MWNB 2LG1A 2Z13A 2YS1A 5I2SA 4L6EA 2YT1A 4HHVA 4GOUA 3A8PA 1I7AA 3SO6A 2VKIA 2Y8GA 4MT7A 4QXAB 1FGYA 3CXBB 3BINA 2H7DA 4KHAA 4HAYB 4Z2MB 1X1FA 2EMTA 5D27A 3AJ4A 3D8FA 4D0NB 1ZVRA 1XD4A 1XCGA 4HAUB 2I1KA 1MIXA 2QKMA 3BJIA 2VRWB 2D10A 3A98B 2QKLA 2D9XA 1KI1B 5L81A 3A58A 1K5DB 3PSCA 5JHHA 4KAXB 1UPQA 3KRWA 2UVMA 2R2YA 2AEHA 2UZRA 2YRYA 1LB1A 4HB3B 1UNPA 3LJUX 1RJ2A 2NZ8B 1UNQA 5DHFB 2LKOA 4K17A 4OSNA 4GXBA 2DYNA 1XX0A 4A5KA 4CHMA 4ZRIA 1E5WA 2DYQA 3VIAA 2J0KA 2AL6A 3HSAA 3PVUA 2D9ZA 5D3WA 3PG7A 2G35A 2Y7BA 4NSWA 2K00A 5D3XA 1U5EA 2YS3A 4HDQA 4ZRKA 2D9YA 1MK9B 4IOYX 2GS0A 2ELAA 5J3QA 4DX8A 5DHAB 3UZTA 3KY9A 1W1GA 5GOWB 3T06A 2ROZB 1UEFA 1ZYIA 2ZPYA 4GMXB 5C5BA 3ODXA 1PLSA 1FOEA 2GUMA 3ULBA 2P8VA 2XQNM 2IFSA 3P7ZA 4A6FA 1V5PA 1U5GA 4DIXA 1ZM0A 3ML4A 2P0FA 3SYXA 3ODOA 2DKQA 2H7EA 2VSZA 3B77A 4GMVA 4K81A 3VOQA 4Z2NA 2COAA 3TVVA 4EMOA 1WGUA 2HTHB 1W1DA 4GZUA 2EMSA 4MK0A 3SV1A 1B55A 2FJLA 3WA0A 1MKEA 3TW1A 2DHIA 1J0WA 1OQNA 1LW3A 2YT0A 4DX90 1W1HA 3D8DA 2L2IA 1N3HA 4HB4B 4DBBA 2CRFA 2KIEA 2MDXA 2YF0A 2RRFA 1NU2A 2KCJA 1V61A 1WI1A 3F0WA 3HIEA 4ZRJA 2DX1A 1FAOA 1V5UA 1WGQA 2GCJA 4PNKA 2FJUB 5HE2A 1BWNA 4F7HA 2CODA 2R09A 4D6WA 3NW8A 1P5TA 2N23A 3PP2A 3DXEA 2RGNB 5KQ1A 1DDVA 1I2HA 3OHMB 3V5WA 3N7CA 3ZDTA 2K2JA 3PZDA 2Z59A 3TCAA 5C5BB 4HAWB 3TFMA 4F7GA 3O96A 4YONA 1EAZA 5D3YA 5JLJB 2LYDA 5D3VA 1SHCA 4A6FB 5DH9B 3IVFA 4BBKA 5C16A 5DI9B 2RSGA 2EJ8A 3U12A 5CLQB 1NTYA 3GYOA 1TXDA 1MIZB 2Y8FA 4K2PA 1MAIA 1EGXA 1WJMA 3GYPA 4B6HA 1Z87A 2J0JA 1M7EA 2Z0QA 4MY6A 2R0DA 1FHOA 2KUPA 2E2XA 1H10A 2J59M 2ADZA 3QIJA 4YL8A 4DXAB 1Q67A 3DXCA 5LONB 1FB8A 1TJ6A 2KUQA 3FEHA 3SNHA 3KSYA 3ULCA 5HE0A 3D8EA 3F5RA 4A6KA 4HAXB 2YVCA 1XR0B 4EJNA 4WSFA 2CAYA 3G9WA 2K49A 1QQGA 1K5GB 1BAKA 1U5DA 2CY5A 1WG7A 2KGXB 3FVCA 1DDMA 2UZSA 4HAZB 3PEGA 3U7DA 1U27A 1XKEA 3AU4A 1GC7A 1V89A 1DBHA 3CIKA 3HQCA 2PZ1A 2DX5A 4K2OA 3A8QA 1AWEA 2K8EA 3MDBC 1BTNA 1UNRA 4OT1A 1PMSA 1FHWA 1KZGA 2MKRA 2YSZA 1X1GA 3HW2B 5HE3A 4CYEA 2J0MA 5IRSA 1KZ7A 5JP4A 1M7RA 3NWAA 2D11A 2LOZA 2W2XD 3KZ1A 4XWXA 5C79A 5KQ4A 1X11A 1ZSQA 4GN1A 2NMBA 1DROA 3PVWA 1MPHA 2D4QA 3SUZA 1EF1A 2IYBA 4H8SA 2D9VA 3TO1A 2DLWA 1NTVA 1J19A 3FSSA 1SGHA 3AU5A 2KIGA 1PFJA 1V88A 2OQBA 2RUKB 3ZVRA 1IRSA 4HSIA 2LULA 4KHBB 3ODWA 3M1IB 1OMWA 1Y5OA 2Q13A 2Z14A 3X23A 2I1JA 1DYNA 4WVFB 2D9WA 4QJ4B 1BTKA 4EKUA 2HE7A 4NY0A 5KCVA 1AQCA 1GG3A 2EC1A 1NI2A 1T77A 2COFA 1P6SA 2V76A 1EVHA
chains in the Genus database with same CATH topology
4GPTB 1ZC4B 2Z0PA 1ZC3B 3FM8C 2GCLA 1OY2A 2K2UA 4C0AA 2DN6A 3KRXA 5HE1A 2LOXA 2M38A 1U2BA 3U8ZA 5C6RA 1GC6A 2DTCA 4TKNA 2P0HA 2RNRB 2X18A 3WYFB 2DHKA 2GJYA 2DKPA 3MPXA 1TQZA 2DA0A 1FGZA 5J3TA 1U5FA 2COCA 1V5MA 1QC6A 5JHGA 4HB0B 4KVGB 1ISNA 2W2XC 4PQ0A 1UPRA 4HAVB 4IAPA 2P0DA 2DHJA 2CY4A 4KHOA 3DXDA 2W2WA 3NSUA 2Z0OA 3P6AA 1H4RA 2I5CA 2RLOA 3QWMA 4WJ7A 1U29A 3QBVB 4CHJA 1X86A 5CLLB 3PVLA 5J3YA 1Y19B 1MK7B 5FI0A 2L1CA 4A6HA 2YS5A 5DIFB 5FI1A 1WVHA 2M14A 4TYZA 5LOPB 1P3RA 3RCPA 3HK0A 1FHXA 1XODA 4F7UP 4IFSA 1X05A 2OTXA 1WJ1A 1RRPB 3OANA 2BCJA 2MFQA 2D2QA 2RVBB 4HATB 4Y94A 2ELBA 2JP2A 2DFKA 4HB2B 5EFXA 2I5FA 2N0YA 4P7IA 2ROVA 1DDWA 4HDOA 2MWNB 2LG1A 2YS1A 4L6EA 2YT1A 4HHVA 3A8PA 1I7AA 3SO6A 2VKIA 2Y8GA 4MT7A 1FGYA 3CXBB 3BINA 2H7DA 4KHAA 4HAYB 4Z2MB 1X1FA 2EMTA 5D27A 3AJ4A 3D8FA 4D0NB 1ZVRA 1XD4A 1XCGA 4HAUB 2I1KA 1MIXA 2QKMA 3BJIA 2VRWB 2D10A 3A98B 2QKLA 2D9XA 1KI1B 5L81A 1K5DB 3PSCA 5JHHA 4KAXB 1UPQA 3KRWA 2UVMA 2AEHA 2UZRA 2YRYA 1LB1A 4HB3B 1UNPA 3LJUX 1RJ2A 2NZ8B 1UNQA 5DHFB 2LKOA 4K17A 4GXBA 2DYNA 1XX0A 4A5KA 4CHMA 4ZRIA 1E5WA 2DYQA 3VIAA 2J0KA 2AL6A 3PVUA 5D3WA 2D9ZA 3PG7A 2G35A 2Y7BA 4NSWA 2K00A 5D3XA 1U5EA 2YS3A 4HDQA 4ZRKA 2D9YA 1MK9B 4IOYX 2GS0A 2ELAA 5J3QA 4DX8A 5DHAB 3UZTA 3KY9A 1W1GA 5GOWB 3T06A 2ROZB 1UEFA 2ZPYA 4GMXB 5C5BA 3ODXA 1PLSA 1FOEA 3ULBA 2P8VA 2XQNM 2IFSA 3P7ZA 4A6FA 1V5PA 1U5GA 1ZM0A 3ML4A 2P0FA 3SYXA 3ODOA 2DKQA 2H7EA 2VSZA 4GMVA 4K81A 3VOQA 4Z2NA 2COAA 3TVVA 4EMOA 1WGUA 2HTHB 1W1DA 4GZUA 2EMSA 4MK0A 3SV1A 1B55A 2FJLA 3WA0A 1MKEA 3TW1A 2DHIA 1J0WA 1OQNA 1LW3A 2YT0A 4DX90 1W1HA 3D8DA 2L2IA 1N3HA 4HB4B 4DBBA 2CRFA 2MDXA 2YF0A 1NU2A 2KCJA 1V61A 1WI1A 3F0WA 4ZRJA 2DX1A 1FAOA 1V5UA 1WGQA 2GCJA 4PNKA 5HE2A 1BWNA 4F7HA 2CODA 2R09A 1P5TA 2N23A 3PP2A 3DXEA 2RGNB 5KQ1A 1DDVA 1I2HA 3V5WA 3N7CA 3ZDTA 2K2JA 3PZDA 3TCAA 5C5BB 4HAWB 3TFMA 4F7GA 3O96A 4YONA 1EAZA 5D3YA 5JLJB 2LYDA 5D3VA 1SHCA 4A6FB 5DH9B 3IVFA 4BBKA 5C16A 5DI9B 2RSGA 2EJ8A 5CLQB 1NTYA 3GYOA 1TXDA 1MIZB 2Y8FA 4K2PA 1MAIA 1EGXA 1WJMA 3GYPA 4B6HA 1Z87A 2J0JA 1M7EA 2Z0QA 4MY6A 2R0DA 1FHOA 2KUPA 2E2XA 1H10A 2J59M 2ADZA 3QIJA 4YL8A 4DXAB 1Q67A 3DXCA 5LONB 1FB8A 1TJ6A 3FEHA 3SNHA 3KSYA 3ULCA 5HE0A 3D8EA 3F5RA 4A6KA 4HAXB 2YVCA 1XR0B 4EJNA 4WSFA 2CAYA 3G9WA 1QQGA 1K5GB 1BAKA 1U5DA 2CY5A 1WG7A 2KGXB 1DDMA 2UZSA 4HAZB 3PEGA 3U7DA 1U27A 1XKEA 3AU4A 1GC7A 1V89A 1DBHA 3CIKA 3HQCA 2PZ1A 2DX5A 4K2OA 3A8QA 1AWEA 3MDBC 1BTNA 1UNRA 1PMSA 1FHWA 1KZGA 2MKRA 2YSZA 1X1GA 3HW2B 5HE3A 4CYEA 2J0MA 1KZ7A 5JP4A 1M7RA 2D11A 2LOZA 2W2XD 3KZ1A 4XWXA 5C79A 5KQ4A 1X11A 1ZSQA 4GN1A 2NMBA 1DROA 3PVWA 1MPHA 2D4QA 3SUZA 1EF1A 2IYBA 4H8SA 2D9VA 3TO1A 2DLWA 1NTVA 1J19A 3FSSA 1SGHA 3AU5A 1PFJA 1V88A 2OQBA 2RUKB 3ZVRA 1IRSA 2LULA 4KHBB 3ODWA 3M1IB 1OMWA 1Y5OA 2Q13A 3X23A 2I1JA 1DYNA 4WVFB 2D9WA 1BTKA 4EKUA 2HE7A 4NY0A 5KCVA 1AQCA 1GG3A 2EC1A 1NI2A 2COFA 1P6SA 2V76A 1EVHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GPT B;  1ZC4 B;  2Z0P A;  1ZC3 B;  3FM8 C;  2GCL A;  1OY2 A;  2K2U A;  4C0A A;  2DN6 A;  3KRX A;  5HE1 A;  2LOX A;  2M38 A;  1U2B A;  3U8Z A;  5C6R A;  1GC6 A;  2DTC A;  4TKN A;  2P0H A;  2RNR B;  2X18 A;  3WYF B;  2DHK A;  2GJY A;  2DKP A;  3MPX A;  1TQZ A;  2DA0 A;  1FGZ A;  5J3T A;  1U5F A;  2COC A;  1V5M A;  1QC6 A;  5JHG A;  4HB0 B;  4KVG B;  1ISN A;  2W2X C;  4PQ0 A;  1UPR A;  4HAV B;  4IAP A;  2P0D A;  2DHJ A;  2CY4 A;  4KHO A;  3DXD A;  2W2W A;  3NSU A;  2Z0O A;  3P6A A;  1H4R A;  2I5C A;  2RLO A;  3QWM A;  4WJ7 A;  1U29 A;  3QBV B;  4CHJ A;  1X86 A;  5CLL B;  3PVL A;  5J3Y A;  1Y19 B;  1MK7 B;  5FI0 A;  2L1C A;  4A6H A;  2YS5 A;  5DIF B;  5FI1 A;  1WVH A;  2M14 A;  4TYZ A;  5LOP B;  1P3R A;  3RCP A;  3HK0 A;  1FHX A;  1XOD A;  4F7U P;  4IFS A;  1X05 A;  2OTX A;  1WJ1 A;  1RRP B;  3OAN A;  2BCJ A;  2MFQ A;  2D2Q A;  2RVB B;  4HAT B;  4Y94 A;  2ELB A;  2JP2 A;  2DFK A;  4HB2 B;  5EFX A;  2I5F A;  2N0Y A;  4P7I A;  2ROV A;  1DDW A;  4HDO A;  2MWN B;  2LG1 A;  2YS1 A;  4L6E A;  2YT1 A;  4HHV A;  3A8P A;  1I7A A;  3SO6 A;  2VKI A;  2Y8G A;  4MT7 A;  1FGY A;  3CXB B;  3BIN A;  2H7D A;  4KHA A;  4HAY B;  4Z2M B;  1X1F A;  2EMT A;  5D27 A;  3AJ4 A;  3D8F A;  4D0N B;  1ZVR A;  1XD4 A;  1XCG A;  4HAU B;  2I1K A;  1MIX A;  2QKM A;  3BJI A;  2VRW B;  2D10 A;  3A98 B;  2QKL A;  2D9X A;  1KI1 B;  5L81 A;  1K5D B;  3PSC A;  5JHH A;  4KAX B;  1UPQ A;  3KRW A;  2UVM A;  2AEH A;  2UZR A;  2YRY A;  1LB1 A;  4HB3 B;  1UNP A;  3LJU X;  1RJ2 A;  2NZ8 B;  1UNQ A;  5DHF B;  2LKO A;  4K17 A;  4GXB A;  2DYN A;  1XX0 A;  4A5K A;  4CHM A;  4ZRI A;  1E5W A;  2DYQ A;  3VIA A;  2J0K A;  2AL6 A;  3PVU A;  5D3W A;  2D9Z A;  3PG7 A;  2G35 A;  2Y7B A;  4NSW A;  2K00 A;  5D3X A;  1U5E A;  2YS3 A;  4HDQ A;  4ZRK A;  2D9Y A;  1MK9 B;  4IOY X;  2GS0 A;  2ELA A;  5J3Q A;  4DX8 A;  5DHA B;  3UZT A;  3KY9 A;  1W1G A;  5GOW B;  3T06 A;  2ROZ B;  1UEF A;  2ZPY A;  4GMX B;  5C5B A;  3ODX A;  1PLS A;  1FOE A;  3ULB A;  2P8V A;  2XQN M;  2IFS A;  3P7Z A;  4A6F A;  1V5P A;  1U5G A;  1ZM0 A;  3ML4 A;  2P0F A;  3SYX A;  3ODO A;  2DKQ A;  2H7E A;  2VSZ A;  4GMV A;  4K81 A;  3VOQ A;  4Z2N A;  2COA A;  3TVV A;  4EMO A;  1WGU A;  2HTH B;  1W1D A;  4GZU A;  2EMS A;  4MK0 A;  3SV1 A;  1B55 A;  2FJL A;  3WA0 A;  1MKE A;  3TW1 A;  2DHI A;  1J0W A;  1OQN A;  1LW3 A;  2YT0 A;  4DX9 0;  1W1H A;  3D8D A;  2L2I A;  1N3H A;  4HB4 B;  4DBB A;  2CRF A;  2MDX A;  2YF0 A;  1NU2 A;  2KCJ A;  1V61 A;  1WI1 A;  3F0W A;  4ZRJ A;  2DX1 A;  1FAO A;  1V5U A;  1WGQ A;  2GCJ A;  4PNK A;  5HE2 A;  1BWN A;  4F7H A;  2COD A;  2R09 A;  1P5T A;  2N23 A;  3PP2 A;  3DXE A;  2RGN B;  5KQ1 A;  1DDV A;  1I2H A;  3V5W A;  3N7C A;  3ZDT A;  2K2J A;  3PZD A;  3TCA A;  5C5B B;  4HAW B;  3TFM A;  4F7G A;  3O96 A;  4YON A;  1EAZ A;  5D3Y A;  5JLJ B;  2LYD A;  5D3V A;  1SHC A;  4A6F B;  5DH9 B;  3IVF A;  4BBK A;  5C16 A;  5DI9 B;  2RSG A;  2EJ8 A;  5CLQ B;  1NTY A;  3GYO A;  1TXD A;  1MIZ B;  2Y8F A;  4K2P A;  1MAI A;  1EGX A;  1WJM A;  3GYP A;  4B6H A;  1Z87 A;  2J0J A;  1M7E A;  2Z0Q A;  4MY6 A;  2R0D A;  1FHO A;  2KUP A;  2E2X A;  1H10 A;  2J59 M;  2ADZ A;  3QIJ A;  4YL8 A;  4DXA B;  1Q67 A;  3DXC A;  5LON B;  1FB8 A;  1TJ6 A;  3FEH A;  3SNH A;  3KSY A;  3ULC A;  5HE0 A;  3D8E A;  3F5R A;  4A6K A;  4HAX B;  2YVC A;  1XR0 B;  4EJN A;  4WSF A;  2CAY A;  3G9W A;  1QQG A;  1K5G B;  1BAK A;  1U5D A;  2CY5 A;  1WG7 A;  2KGX B;  1DDM A;  2UZS A;  4HAZ B;  3PEG A;  3U7D A;  1U27 A;  1XKE A;  3AU4 A;  1GC7 A;  1V89 A;  1DBH A;  3CIK A;  3HQC A;  2PZ1 A;  2DX5 A;  4K2O A;  3A8Q A;  1AWE A;  3MDB C;  1BTN A;  1UNR A;  1PMS A;  1FHW A;  1KZG A;  2MKR A;  2YSZ A;  1X1G A;  3HW2 B;  5HE3 A;  4CYE A;  2J0M A;  1KZ7 A;  5JP4 A;  1M7R A;  2D11 A;  2LOZ A;  2W2X D;  3KZ1 A;  4XWX A;  5C79 A;  5KQ4 A;  1X11 A;  1ZSQ A;  4GN1 A;  2NMB A;  1DRO A;  3PVW A;  1MPH A;  2D4Q A;  3SUZ A;  1EF1 A;  2IYB A;  4H8S A;  2D9V A;  3TO1 A;  2DLW A;  1NTV A;  1J19 A;  3FSS A;  1SGH A;  3AU5 A;  1PFJ A;  1V88 A;  2OQB A;  2RUK B;  3ZVR A;  1IRS A;  2LUL A;  4KHB B;  3ODW A;  3M1I B;  1OMW A;  1Y5O A;  2Q13 A;  3X23 A;  2I1J A;  1DYN A;  4WVF B;  2D9W A;  1BTK A;  4EKU A;  2HE7 A;  4NY0 A;  5KCV A;  1AQC A;  1GG3 A;  2EC1 A;  1NI2 A;  2COF A;  1P6S A;  2V76 A;  1EVH A; 
#chains in the Genus database with same CATH topology
 4GPT B;  1ZC4 B;  2Z0P A;  1ZC3 B;  3FM8 C;  2GCL A;  1OY2 A;  2K2U A;  4C0A A;  2DN6 A;  3KRX A;  5HE1 A;  2LOX A;  2M38 A;  1U2B A;  3U8Z A;  5C6R A;  1GC6 A;  2DTC A;  4TKN A;  2P0H A;  2RNR B;  2X18 A;  3WYF B;  2DHK A;  4QJ3 B;  2GJY A;  2DKP A;  3MPX A;  1TQZ A;  5M4Y B;  2DA0 A;  1FGZ A;  5J3T A;  1U5F A;  2COC A;  1V5M A;  2Z4D A;  1QC6 A;  4KHB A;  5JHG A;  4HB0 B;  4KVG B;  1ISN A;  2W2X C;  4PQ0 A;  5I2M A;  1UPR A;  4HAV B;  4IAP A;  2P0D A;  2DHJ A;  2CY4 A;  4KHO A;  2KR0 A;  3DXD A;  2W2W A;  3NSU A;  2Z0O A;  2YT2 A;  3P6A A;  1H4R A;  2I5C A;  2RLO A;  3DCX A;  3QWM A;  4WJ7 A;  3NWD A;  1U29 A;  3QBV B;  1MI1 A;  2ZKM X;  4CHJ A;  1X86 A;  5CLL B;  4QJ5 B;  3PVL A;  5J3Y A;  1Y19 B;  1MK7 B;  5FI0 A;  2L1C A;  4CSQ A;  4A6H A;  2YS5 A;  5DIF B;  5FI1 A;  1WVH A;  2M14 A;  4TYZ A;  5LOP B;  1P3R A;  3RCP A;  3HK0 A;  1FHX A;  1XOD A;  4GNK B;  4F7U P;  4IFS A;  1X05 A;  2OTX A;  2NBV A;  1WJ1 A;  1RRP B;  3OAN A;  2BCJ A;  2MFQ A;  2D2Q A;  2RVB B;  4L1R A;  4HAT B;  4Y94 A;  3NWF A;  2ELB A;  2JP2 A;  2DFK A;  4HB2 B;  5EFX A;  2I5F A;  2N0Y A;  4P7I A;  2ROV A;  1DDW A;  4HDO A;  5LG4 B;  2MWN B;  2LG1 A;  2Z13 A;  2YS1 A;  5I2S A;  4L6E A;  2YT1 A;  4HHV A;  4GOU A;  3A8P A;  1I7A A;  3SO6 A;  2VKI A;  2Y8G A;  4MT7 A;  4QXA B;  1FGY A;  3CXB B;  3BIN A;  2H7D A;  4KHA A;  4HAY B;  4Z2M B;  1X1F A;  2EMT A;  5D27 A;  3AJ4 A;  3D8F A;  4D0N B;  1ZVR A;  1XD4 A;  1XCG A;  4HAU B;  2I1K A;  1MIX A;  2QKM A;  3BJI A;  2VRW B;  2D10 A;  3A98 B;  2QKL A;  2D9X A;  1KI1 B;  5L81 A;  3A58 A;  1K5D B;  3PSC A;  5JHH A;  4KAX B;  1UPQ A;  3KRW A;  2UVM A;  2R2Y A;  2AEH A;  2UZR A;  2YRY A;  1LB1 A;  4HB3 B;  1UNP A;  3LJU X;  1RJ2 A;  2NZ8 B;  1UNQ A;  5DHF B;  2LKO A;  4K17 A;  4OSN A;  4GXB A;  2DYN A;  1XX0 A;  4A5K A;  4CHM A;  4ZRI A;  1E5W A;  2DYQ A;  3VIA A;  2J0K A;  2AL6 A;  3HSA A;  3PVU A;  2D9Z A;  5D3W A;  3PG7 A;  2G35 A;  2Y7B A;  4NSW A;  2K00 A;  5D3X A;  1U5E A;  2YS3 A;  4HDQ A;  4ZRK A;  2D9Y A;  1MK9 B;  4IOY X;  2GS0 A;  2ELA A;  5J3Q A;  4DX8 A;  5DHA B;  3UZT A;  3KY9 A;  1W1G A;  5GOW B;  3T06 A;  2ROZ B;  1UEF A;  1ZYI A;  2ZPY A;  4GMX B;  5C5B A;  3ODX A;  1PLS A;  1FOE A;  2GUM A;  3ULB A;  2P8V A;  2XQN M;  2IFS A;  3P7Z A;  4A6F A;  1V5P A;  1U5G A;  4DIX A;  1ZM0 A;  3ML4 A;  2P0F A;  3SYX A;  3ODO A;  2DKQ A;  2H7E A;  2VSZ A;  3B77 A;  4GMV A;  4K81 A;  3VOQ A;  4Z2N A;  2COA A;  3TVV A;  4EMO A;  1WGU A;  2HTH B;  1W1D A;  4GZU A;  2EMS A;  4MK0 A;  3SV1 A;  1B55 A;  2FJL A;  3WA0 A;  1MKE A;  3TW1 A;  2DHI A;  1J0W A;  1OQN A;  1LW3 A;  2YT0 A;  4DX9 0;  1W1H A;  3D8D A;  2L2I A;  1N3H A;  4HB4 B;  4DBB A;  2CRF A;  2KIE A;  2MDX A;  2YF0 A;  2RRF A;  1NU2 A;  2KCJ A;  1V61 A;  1WI1 A;  3F0W A;  3HIE A;  4ZRJ A;  2DX1 A;  1FAO A;  1V5U A;  1WGQ A;  2GCJ A;  4PNK A;  2FJU B;  5HE2 A;  1BWN A;  4F7H A;  2COD A;  2R09 A;  4D6W A;  3NW8 A;  1P5T A;  2N23 A;  3PP2 A;  3DXE A;  2RGN B;  5KQ1 A;  1DDV A;  1I2H A;  3OHM B;  3V5W A;  3N7C A;  3ZDT A;  2K2J A;  3PZD A;  2Z59 A;  3TCA A;  5C5B B;  4HAW B;  3TFM A;  4F7G A;  3O96 A;  4YON A;  1EAZ A;  5D3Y A;  5JLJ B;  2LYD A;  5D3V A;  1SHC A;  4A6F B;  5DH9 B;  3IVF A;  4BBK A;  5C16 A;  5DI9 B;  2RSG A;  2EJ8 A;  3U12 A;  5CLQ B;  1NTY A;  3GYO A;  1TXD A;  1MIZ B;  2Y8F A;  4K2P A;  1MAI A;  1EGX A;  1WJM A;  3GYP A;  4B6H A;  1Z87 A;  2J0J A;  1M7E A;  2Z0Q A;  4MY6 A;  2R0D A;  1FHO A;  2KUP A;  2E2X A;  1H10 A;  2J59 M;  2ADZ A;  3QIJ A;  4YL8 A;  4DXA B;  1Q67 A;  3DXC A;  5LON B;  1FB8 A;  1TJ6 A;  2KUQ A;  3FEH A;  3SNH A;  3KSY A;  3ULC A;  5HE0 A;  3D8E A;  3F5R A;  4A6K A;  4HAX B;  2YVC A;  1XR0 B;  4EJN A;  4WSF A;  2CAY A;  3G9W A;  2K49 A;  1QQG A;  1K5G B;  1BAK A;  1U5D A;  2CY5 A;  1WG7 A;  2KGX B;  3FVC A;  1DDM A;  2UZS A;  4HAZ B;  3PEG A;  3U7D A;  1U27 A;  1XKE A;  3AU4 A;  1GC7 A;  1V89 A;  1DBH A;  3CIK A;  3HQC A;  2PZ1 A;  2DX5 A;  4K2O A;  3A8Q A;  1AWE A;  2K8E A;  3MDB C;  1BTN A;  1UNR A;  4OT1 A;  1PMS A;  1FHW A;  1KZG A;  2MKR A;  2YSZ A;  1X1G A;  3HW2 B;  5HE3 A;  4CYE A;  2J0M A;  5IRS A;  1KZ7 A;  5JP4 A;  1M7R A;  3NWA A;  2D11 A;  2LOZ A;  2W2X D;  3KZ1 A;  4XWX A;  5C79 A;  5KQ4 A;  1X11 A;  1ZSQ A;  4GN1 A;  2NMB A;  1DRO A;  3PVW A;  1MPH A;  2D4Q A;  3SUZ A;  1EF1 A;  2IYB A;  4H8S A;  2D9V A;  3TO1 A;  2DLW A;  1NTV A;  1J19 A;  3FSS A;  1SGH A;  3AU5 A;  2KIG A;  1PFJ A;  1V88 A;  2OQB A;  2RUK B;  3ZVR A;  1IRS A;  4HSI A;  2LUL A;  4KHB B;  3ODW A;  3M1I B;  1OMW A;  1Y5O A;  2Q13 A;  2Z14 A;  3X23 A;  2I1J A;  1DYN A;  4WVF B;  2D9W A;  4QJ4 B;  1BTK A;  4EKU A;  2HE7 A;  4NY0 A;  5KCV A;  1AQC A;  1GG3 A;  2EC1 A;  1NI2 A;  1T77 A;  2COF A;  1P6S A;  2V76 A;  1EVH A; 
#chains in the Genus database with same CATH homology
 4GPT B;  1ZC4 B;  2Z0P A;  1ZC3 B;  3FM8 C;  2GCL A;  1OY2 A;  2K2U A;  4C0A A;  2DN6 A;  3KRX A;  5HE1 A;  2LOX A;  2M38 A;  1U2B A;  3U8Z A;  5C6R A;  1GC6 A;  2DTC A;  4TKN A;  2P0H A;  2RNR B;  2X18 A;  3WYF B;  2DHK A;  2GJY A;  2DKP A;  3MPX A;  1TQZ A;  2DA0 A;  1FGZ A;  5J3T A;  1U5F A;  2COC A;  1V5M A;  1QC6 A;  5JHG A;  4HB0 B;  4KVG B;  1ISN A;  2W2X C;  4PQ0 A;  1UPR A;  4HAV B;  4IAP A;  2P0D A;  2DHJ A;  2CY4 A;  4KHO A;  3DXD A;  2W2W A;  3NSU A;  2Z0O A;  3P6A A;  1H4R A;  2I5C A;  2RLO A;  3QWM A;  4WJ7 A;  1U29 A;  3QBV B;  4CHJ A;  1X86 A;  5CLL B;  3PVL A;  5J3Y A;  1Y19 B;  1MK7 B;  5FI0 A;  2L1C A;  4A6H A;  2YS5 A;  5DIF B;  5FI1 A;  1WVH A;  2M14 A;  4TYZ A;  5LOP B;  1P3R A;  3RCP A;  3HK0 A;  1FHX A;  1XOD A;  4F7U P;  4IFS A;  1X05 A;  2OTX A;  1WJ1 A;  1RRP B;  3OAN A;  2BCJ A;  2MFQ A;  2D2Q A;  2RVB B;  4HAT B;  4Y94 A;  2ELB A;  2JP2 A;  2DFK A;  4HB2 B;  5EFX A;  2I5F A;  2N0Y A;  4P7I A;  2ROV A;  1DDW A;  4HDO A;  2MWN B;  2LG1 A;  2YS1 A;  4L6E A;  2YT1 A;  4HHV A;  3A8P A;  1I7A A;  3SO6 A;  2VKI A;  2Y8G A;  4MT7 A;  1FGY A;  3CXB B;  3BIN A;  2H7D A;  4KHA A;  4HAY B;  4Z2M B;  1X1F A;  2EMT A;  5D27 A;  3AJ4 A;  3D8F A;  4D0N B;  1ZVR A;  1XD4 A;  1XCG A;  4HAU B;  2I1K A;  1MIX A;  2QKM A;  3BJI A;  2VRW B;  2D10 A;  3A98 B;  2QKL A;  2D9X A;  1KI1 B;  5L81 A;  1K5D B;  3PSC A;  5JHH A;  4KAX B;  1UPQ A;  3KRW A;  2UVM A;  2AEH A;  2UZR A;  2YRY A;  1LB1 A;  4HB3 B;  1UNP A;  3LJU X;  1RJ2 A;  2NZ8 B;  1UNQ A;  5DHF B;  2LKO A;  4K17 A;  4GXB A;  2DYN A;  1XX0 A;  4A5K A;  4CHM A;  4ZRI A;  1E5W A;  2DYQ A;  3VIA A;  2J0K A;  2AL6 A;  3PVU A;  5D3W A;  2D9Z A;  3PG7 A;  2G35 A;  2Y7B A;  4NSW A;  2K00 A;  5D3X A;  1U5E A;  2YS3 A;  4HDQ A;  4ZRK A;  2D9Y A;  1MK9 B;  4IOY X;  2GS0 A;  2ELA A;  5J3Q A;  4DX8 A;  5DHA B;  3UZT A;  3KY9 A;  1W1G A;  5GOW B;  3T06 A;  2ROZ B;  1UEF A;  2ZPY A;  4GMX B;  5C5B A;  3ODX A;  1PLS A;  1FOE A;  3ULB A;  2P8V A;  2XQN M;  2IFS A;  3P7Z A;  4A6F A;  1V5P A;  1U5G A;  1ZM0 A;  3ML4 A;  2P0F A;  3SYX A;  3ODO A;  2DKQ A;  2H7E A;  2VSZ A;  4GMV A;  4K81 A;  3VOQ A;  4Z2N A;  2COA A;  3TVV A;  4EMO A;  1WGU A;  2HTH B;  1W1D A;  4GZU A;  2EMS A;  4MK0 A;  3SV1 A;  1B55 A;  2FJL A;  3WA0 A;  1MKE A;  3TW1 A;  2DHI A;  1J0W A;  1OQN A;  1LW3 A;  2YT0 A;  4DX9 0;  1W1H A;  3D8D A;  2L2I A;  1N3H A;  4HB4 B;  4DBB A;  2CRF A;  2MDX A;  2YF0 A;  1NU2 A;  2KCJ A;  1V61 A;  1WI1 A;  3F0W A;  4ZRJ A;  2DX1 A;  1FAO A;  1V5U A;  1WGQ A;  2GCJ A;  4PNK A;  5HE2 A;  1BWN A;  4F7H A;  2COD A;  2R09 A;  1P5T A;  2N23 A;  3PP2 A;  3DXE A;  2RGN B;  5KQ1 A;  1DDV A;  1I2H A;  3V5W A;  3N7C A;  3ZDT A;  2K2J A;  3PZD A;  3TCA A;  5C5B B;  4HAW B;  3TFM A;  4F7G A;  3O96 A;  4YON A;  1EAZ A;  5D3Y A;  5JLJ B;  2LYD A;  5D3V A;  1SHC A;  4A6F B;  5DH9 B;  3IVF A;  4BBK A;  5C16 A;  5DI9 B;  2RSG A;  2EJ8 A;  5CLQ B;  1NTY A;  3GYO A;  1TXD A;  1MIZ B;  2Y8F A;  4K2P A;  1MAI A;  1EGX A;  1WJM A;  3GYP A;  4B6H A;  1Z87 A;  2J0J A;  1M7E A;  2Z0Q A;  4MY6 A;  2R0D A;  1FHO A;  2KUP A;  2E2X A;  1H10 A;  2J59 M;  2ADZ A;  3QIJ A;  4YL8 A;  4DXA B;  1Q67 A;  3DXC A;  5LON B;  1FB8 A;  1TJ6 A;  3FEH A;  3SNH A;  3KSY A;  3ULC A;  5HE0 A;  3D8E A;  3F5R A;  4A6K A;  4HAX B;  2YVC A;  1XR0 B;  4EJN A;  4WSF A;  2CAY A;  3G9W A;  1QQG A;  1K5G B;  1BAK A;  1U5D A;  2CY5 A;  1WG7 A;  2KGX B;  1DDM A;  2UZS A;  4HAZ B;  3PEG A;  3U7D A;  1U27 A;  1XKE A;  3AU4 A;  1GC7 A;  1V89 A;  1DBH A;  3CIK A;  3HQC A;  2PZ1 A;  2DX5 A;  4K2O A;  3A8Q A;  1AWE A;  3MDB C;  1BTN A;  1UNR A;  1PMS A;  1FHW A;  1KZG A;  2MKR A;  2YSZ A;  1X1G A;  3HW2 B;  5HE3 A;  4CYE A;  2J0M A;  1KZ7 A;  5JP4 A;  1M7R A;  2D11 A;  2LOZ A;  2W2X D;  3KZ1 A;  4XWX A;  5C79 A;  5KQ4 A;  1X11 A;  1ZSQ A;  4GN1 A;  2NMB A;  1DRO A;  3PVW A;  1MPH A;  2D4Q A;  3SUZ A;  1EF1 A;  2IYB A;  4H8S A;  2D9V A;  3TO1 A;  2DLW A;  1NTV A;  1J19 A;  3FSS A;  1SGH A;  3AU5 A;  1PFJ A;  1V88 A;  2OQB A;  2RUK B;  3ZVR A;  1IRS A;  2LUL A;  4KHB B;  3ODW A;  3M1I B;  1OMW A;  1Y5O A;  2Q13 A;  3X23 A;  2I1J A;  1DYN A;  4WVF B;  2D9W A;  1BTK A;  4EKU A;  2HE7 A;  4NY0 A;  5KCV A;  1AQC A;  1GG3 A;  2EC1 A;  1NI2 A;  2COF A;  1P6S A;  2V76 A;  1EVH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...