1FGZA

Grp1 ph domain (unliganded)
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
127
structure length
127
Chain Sequence
TFFNPDREGWLLKLGGRVKTWKRRWFILTDNCLYYFEYTTDKEPRGIIPLENLSIREVLDPRKPNCFELYNPSHKGQVIKACKTEADGRVVEGNHVVYRISAPSPEEKEEWMKSIKASISRDPFYDM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural basis of 3-phosphoinositide recognition by pleckstrin homology domains.
pubmed doi rcsb
source organism Mus musculus
molecule tags Signaling protein
molecule keywords GRP1
total genus 20
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2000-07-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00169 PH PH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 1fgzA00
3CIKA 4HB3B 2GS0A 1TXDA 2NZ8B 2D4QA 1MIZB 1NU2A 2DYQA 1BTKA 4PNKA 2E2XA 3HW2B 4A6KA 2K00A 3QIJA 1LW3A 4K2OA 5D3XA 1WGQA 3D8EA 5C5BB 5J3YA 2HE7A 4L6EA 1DBHA 3MPXA 3PP2A 2P0FA 1P6SA 2RSGA 2Y8GA 4ZRJA 5C6RA 2QKLA 1UPQA 1MK9B 1TQZA 4H8SA 1X1FA 1FHOA 4IOYX 2YS1A 1FHWA 4D0NB 4F7HA 2RUKB 1MK7B 3PEGA 1FHXA 2XQNM 4NY0A 2Y7BA 2PZ1A 1E5WA 2ZPYA 1BAKA 3ODXA 1H4RA 3DXEA 1XX0A 3F0WA 4CHMA 1UNRA 2R09A 2Q13A 4NSWA 2CODA 1X1GA 4KHOA 2VRWB 3KSYA 2DHJA 1AQCA 2D9ZA 1ZSQA 5GOWB 4A6FA 1FOEA 4HDOA 2J59M 3PSCA 2YS5A 2IFSA 1DDWA 1NTVA 1NI2A 2W2XC 3DXCA 1W1HA 3HQCA 1K5GB 2I5FA 1V61A 3T06A 4K17A 4GMXB 4DXAB 1ZC3B 1FGZA 1XCGA 3QWMA 1XR0B 2ROVA 1ZVRA 3NSUA 3IVFA 5C16A 4P7IA 1DROA 1FAOA 2GJYA 5DHFB 2KCJA 3SYXA 2DN6A 1EVHA 2Z0QA 4DBBA 4HAZB 2COFA 3D8FA 1V89A 4IAPA 5HE1A 5C79A 3PVLA 1U5FA 1P3RA 2MKRA 3ULBA 1Q67A 1B55A 2X18A 1AWEA 2J0MA 1Y5OA 2VKIA 3A8QA 1PFJA 2DKPA 4KAXB 4WSFA 2D2QA 2J0JA 2LYDA 4WJ7A 3RCPA 2EJ8A 2AL6A 3U7DA 1X86A 1XD4A 3GYOA 1RRPB 2D10A 1FB8A 2Z0PA 3P6AA 3FSSA 3A8PA 2IYBA 5LOPB 2DTCA 2W2XD 2KUPA 2DFKA 2K2UA 3AU4A 4B6HA 1LB1A 1V5PA 5DH9B 1SGHA 1P5TA 4GXBA 3SNHA 2MFQA 1WVHA 3TFMA 3GYPA 3ZVRA 4EKUA 2I1JA 2ROZB 4HAXB 4ZRIA 1MPHA 5C5BA 2CRFA 4KHBB 4MK0A 2GCLA 1V5UA 2Z0OA 4HHVA 4KVGB 1Y19B 4PQ0A 5DIFB 3X23A 2ADZA 3LJUX 4HDQA 4A5KA 2ELAA 4Y94A 2EMSA 2I1KA 4IFSA 3MDBC 1DDVA 2COCA 2D9YA 4EMOA 1QC6A 2M14A 2RNRB 3AJ4A 3A98B 3BINA 5D3WA 1KZ7A 2DX5A 1WGUA 5D3YA 4HATB 4K81A 3SUZA 3PZDA 1WG7A 2L1CA 3F5RA 2LOXA 2AEHA 5DI9B 4BBKA 2KGXB 5HE2A 1DDMA 4GN1A 4HAUB 2GCJA 2OTXA 3ODWA 3DXDA 5D27A 3N7CA 4TKNA 3V5WA 4CYEA 1NTYA 1J19A 1K5DB 3WYFB 4C0AA 3SV1A 2W2WA 5CLLB 5JP4A 3ODOA 5HE0A 1M7RA 1RJ2A 5D3VA 1MIXA 1IRSA 2YT0A 1KZGA 2P0DA 1UEFA 3FM8C 2H7EA 1J0WA 2DA0A 5JHHA 4GZUA 4KHAA 2CY4A 1N3HA 1U5EA 4HB4B 2YSZA 1U27A 3VIAA 1GG3A 3OANA 2CY5A 1FGYA 5CLQB 4A6HA 2D9WA 1ISNA 1X11A 2DYNA 1UPRA 1W1DA 4ZRKA 3ZDTA 2QKMA 1W1GA 2UZSA 2DHIA 1KI1B 1BTNA 1GC6A 5J3TA 3TO1A 1Z87A 1OQNA 2YF0A 3P7ZA 1BWNA 3AU5A 1M7EA 2UVMA 1GC7A 2LKOA 1V5MA 1DYNA 5KCVA 2V76A 5JLJB 1U5GA 1ZC4B 3TVVA 1WI1A 5KQ4A 4TYZA 4HAWB 2RVBB 1EAZA 2LULA 5LONB 2DLWA 4F7GA 1EF1A 4GPTB 2P0HA 2J0KA 2LG1A 2DKQA 4GMVA 3VOQA 4DX90 2R0DA 3BJIA 3PVWA 3U8ZA 4Z2MB 3D8DA 5DHAB 1I2HA 2COAA 3M1IB 1U5DA 2M38A 3QBVB 5J3QA 5EFXA 4HB2B 3HK0A 1XKEA 1MKEA 2VSZA 2RGNB 1WJMA 1UNPA 1QQGA 1V88A 2K2JA 3ULCA 2D9VA 1SHCA 2YT1A 2FJLA 2RLOA 1ZM0A 4MT7A 2UZRA 2JP2A 3TCAA 1I7AA 2MWNB 2CAYA 2NMBA 2YRYA 4A6FB 2EC1A 5KQ1A 3FEHA 4F7UP 2N23A 4WVFB 5JHGA 1TJ6A 5FI1A 2P8VA 4MY6A 2DX1A 1OY2A 2DHKA 2Y8FA 4K2PA 1OMWA 3WA0A 4Z2NA 2LOZA 2D9XA 5FI0A 4CHJA 4EJNA 3TW1A 3KZ1A 1U2BA 1H10A 3KRWA 3KRXA 5HE3A 1PLSA 4YONA 1X05A 1UNQA 2YVCA 3PG7A 4HAVB 3SO6A 2ELBA 4XWXA 2YS3A 4HB0B 3KY9A 3PVUA 2D11A 1EGXA 1PMSA 1XODA 4HAYB 2HTHB 2MDXA 1MAIA 3UZTA 3ML4A 4DX8A 2L2IA 5L81A 2BCJA 3CXBB 3G9WA 2EMTA 3O96A 2I5CA 1U29A 1WJ1A 2G35A 2H7DA 2OQBA 2N0YA 4YL8A
chains in the Genus database with same CATH superfamily
3U12A 3CIKA 3NW8A 4HB3B 2GS0A 1TXDA 2NZ8B 2D4QA 2ZKMX 3NWAA 1MIZB 1NU2A 2DYQA 1BTKA 4PNKA 2E2XA 3HW2B 4A6KA 2K00A 1MI1A 3QIJA 1LW3A 4K2OA 5D3XA 1WGQA 3D8EA 5C5BB 2Z59A 5J3YA 2HE7A 4L6EA 1DBHA 3MPXA 3PP2A 2P0FA 1P6SA 2RSGA 2Y8GA 4ZRJA 3FVCA 5C6RA 2QKLA 1UPQA 1MK9B 5I2SA 1TQZA 4H8SA 1X1FA 1FHOA 4IOYX 2YS1A 1FHWA 4D0NB 4F7HA 2RUKB 1MK7B 3PEGA 1FHXA 2XQNM 4NY0A 4HSIA 2Y7BA 2PZ1A 2Z4DA 1E5WA 2ZPYA 1BAKA 3ODXA 1H4RA 3DXEA 1XX0A 3F0WA 4QXAB 4CHMA 1UNRA 2R09A 2Q13A 4NSWA 2CODA 1X1GA 4KHOA 2VRWB 2KR0A 3KSYA 2DHJA 1AQCA 2K49A 2D9ZA 1ZSQA 4OSNA 5GOWB 4A6FA 1FOEA 4HDOA 2J59M 3PSCA 1ZYIA 5LG4B 2YS5A 2IFSA 1DDWA 1NTVA 1NI2A 2W2XC 3DXCA 1W1HA 3HQCA 1K5GB 2I5FA 1V61A 3T06A 4K17A 4GMXB 4DXAB 1ZC3B 1FGZA 1XCGA 3QWMA 1XR0B 2ROVA 1ZVRA 3NSUA 3IVFA 5C16A 4P7IA 1DROA 1FAOA 2GJYA 5DHFB 2KCJA 3SYXA 2DN6A 1EVHA 2Z0QA 4DBBA 4HAZB 2COFA 1T77A 3D8FA 1V89A 4OT1A 4IAPA 5I2MA 5HE1A 5C79A 3PVLA 1U5FA 1P3RA 2MKRA 3ULBA 1Q67A 1B55A 2X18A 1AWEA 2J0MA 1Y5OA 2VKIA 3A8QA 1PFJA 2DKPA 2NBVA 4KAXB 4WSFA 2D2QA 2J0JA 2LYDA 4WJ7A 3RCPA 2EJ8A 2AL6A 3U7DA 1X86A 1XD4A 3GYOA 1RRPB 2D10A 1FB8A 2Z0PA 3P6AA 3FSSA 3A8PA 2Z14A 2IYBA 5LOPB 2DTCA 2W2XD 2KUPA 2DFKA 2K2UA 3AU4A 4B6HA 1LB1A 1V5PA 5DH9B 1SGHA 1P5TA 4GXBA 2YT2A 3A58A 3SNHA 2MFQA 1WVHA 3TFMA 3GYPA 3ZVRA 4EKUA 2I1JA 2ROZB 4HAXB 4ZRIA 1MPHA 5C5BA 2CRFA 4KHBB 4MK0A 2GCLA 1V5UA 2Z0OA 4HHVA 4KVGB 1Y19B 4PQ0A 2FJUB 5DIFB 3X23A 2ADZA 3LJUX 4HDQA 4QJ3B 4A5KA 2ELAA 4Y94A 2EMSA 2I1KA 4IFSA 3MDBC 1DDVA 2COCA 2D9YA 4EMOA 1QC6A 2M14A 2RNRB 3AJ4A 3A98B 3BINA 5D3WA 1KZ7A 2DX5A 1WGUA 5D3YA 4HATB 4K81A 3SUZA 4QJ5B 3PZDA 1WG7A 2KIEA 2L1CA 3F5RA 2LOXA 2AEHA 5DI9B 4BBKA 2KGXB 5HE2A 1DDMA 2GUMA 4GN1A 4HAUB 2GCJA 2OTXA 3ODWA 3DXDA 5D27A 3N7CA 4TKNA 3V5WA 4CYEA 1NTYA 1J19A 1K5DB 4GNKB 3WYFB 4C0AA 3SV1A 2W2WA 5CLLB 2KIGA 3ODOA 5JP4A 5HE0A 1M7RA 1RJ2A 5D3VA 1MIXA 1IRSA 2YT0A 1KZGA 2P0DA 1UEFA 3FM8C 2H7EA 1J0WA 2DA0A 5JHHA 4GZUA 4KHAA 2CY4A 1N3HA 1U5EA 4HB4B 2YSZA 1U27A 3VIAA 1GG3A 3OANA 2CY5A 1FGYA 5CLQB 4A6HA 2D9WA 1ISNA 1X11A 2DYNA 1UPRA 1W1DA 4ZRKA 3ZDTA 2QKMA 1W1GA 2UZSA 2DHIA 1KI1B 1BTNA 1GC6A 5J3TA 3TO1A 1Z87A 1OQNA 2YF0A 3P7ZA 1BWNA 3AU5A 1M7EA 4QJ4B 2UVMA 1GC7A 2LKOA 1V5MA 1DYNA 5KCVA 2V76A 5JLJB 1U5GA 1ZC4B 3TVVA 1WI1A 5KQ4A 4KHBA 4TYZA 4HAWB 2RVBB 1EAZA 2K8EA 2LULA 5LONB 2DLWA 2Z13A 4F7GA 4D6WA 1EF1A 4GPTB 2P0HA 3DCXA 2J0KA 2LG1A 2DKQA 4GMVA 3VOQA 4DX90 2R0DA 3BJIA 3PVWA 3U8ZA 4Z2MB 3D8DA 5DHAB 1I2HA 2COAA 3M1IB 1U5DA 2M38A 3QBVB 5J3QA 5EFXA 4HB2B 3HK0A 1XKEA 1MKEA 2VSZA 2RGNB 1WJMA 1UNPA 1QQGA 1V88A 2K2JA 3ULCA 2D9VA 1SHCA 2YT1A 5M4YB 2FJLA 2RLOA 1ZM0A 4MT7A 2UZRA 2JP2A 3TCAA 1I7AA 2MWNB 2CAYA 2NMBA 2YRYA 4A6FB 2EC1A 5KQ1A 3FEHA 4F7UP 2N23A 4WVFB 5JHGA 1TJ6A 5FI1A 2R2YA 2P8VA 4MY6A 3NWFA 2DX1A 1OY2A 2DHKA 2Y8FA 3OHMB 4K2PA 1OMWA 3WA0A 4DIXA 4Z2NA 2LOZA 2D9XA 5FI0A 4CHJA 4EJNA 3TW1A 3KZ1A 3B77A 1U2BA 1H10A 3KRWA 3KRXA 5HE3A 1PLSA 4YONA 2RRFA 1X05A 1UNQA 2YVCA 3PG7A 4HAVB 3SO6A 2ELBA 4XWXA 2YS3A 4HB0B 3KY9A 3PVUA 2D11A 3HIEA 1EGXA 1PMSA 1XODA 4HAYB 2HTHB 2MDXA 4CSQA 3HSAA 1MAIA 4GOUA 2KUQA 3UZTA 3ML4A 4DX8A 5IRSA 2L2IA 5L81A 4L1RA 2BCJA 3CXBB 3G9WA 2EMTA 3O96A 2I5CA 1U29A 1WJ1A 2G35A 2H7DA 2OQBA 2N0YA 4YL8A 3NWDA
chains in the Genus database with same CATH topology
3CIKA 4HB3B 2GS0A 1TXDA 2NZ8B 2D4QA 1MIZB 1NU2A 2DYQA 1BTKA 4PNKA 2E2XA 3HW2B 4A6KA 2K00A 3QIJA 1LW3A 4K2OA 5D3XA 1WGQA 3D8EA 5C5BB 5J3YA 2HE7A 4L6EA 1DBHA 3MPXA 3PP2A 2P0FA 1P6SA 2RSGA 2Y8GA 4ZRJA 5C6RA 2QKLA 1UPQA 1MK9B 1TQZA 4H8SA 1X1FA 1FHOA 4IOYX 2YS1A 1FHWA 4D0NB 4F7HA 2RUKB 1MK7B 3PEGA 1FHXA 2XQNM 4NY0A 2Y7BA 2PZ1A 1E5WA 2ZPYA 1BAKA 3ODXA 1H4RA 3DXEA 1XX0A 3F0WA 4CHMA 1UNRA 2R09A 2Q13A 4NSWA 2CODA 1X1GA 4KHOA 2VRWB 3KSYA 2DHJA 1AQCA 2D9ZA 1ZSQA 5GOWB 4A6FA 1FOEA 4HDOA 2J59M 3PSCA 2YS5A 2IFSA 1DDWA 1NTVA 1NI2A 2W2XC 3DXCA 1W1HA 3HQCA 1K5GB 2I5FA 1V61A 3T06A 4K17A 4GMXB 4DXAB 1ZC3B 1FGZA 1XCGA 3QWMA 1XR0B 2ROVA 1ZVRA 3NSUA 3IVFA 5C16A 4P7IA 1DROA 1FAOA 2GJYA 5DHFB 2KCJA 3SYXA 2DN6A 1EVHA 2Z0QA 4DBBA 4HAZB 2COFA 3D8FA 1V89A 4IAPA 5HE1A 5C79A 3PVLA 1U5FA 1P3RA 2MKRA 3ULBA 1Q67A 1B55A 2X18A 1AWEA 2J0MA 1Y5OA 2VKIA 3A8QA 1PFJA 2DKPA 4KAXB 4WSFA 2D2QA 2J0JA 2LYDA 4WJ7A 3RCPA 2EJ8A 2AL6A 3U7DA 1X86A 1XD4A 3GYOA 1RRPB 2D10A 1FB8A 2Z0PA 3P6AA 3FSSA 3A8PA 2IYBA 5LOPB 2DTCA 2W2XD 2KUPA 2DFKA 2K2UA 3AU4A 4B6HA 1LB1A 1V5PA 5DH9B 1SGHA 1P5TA 4GXBA 3SNHA 2MFQA 1WVHA 3TFMA 3GYPA 3ZVRA 4EKUA 2I1JA 2ROZB 4HAXB 4ZRIA 1MPHA 5C5BA 2CRFA 4KHBB 4MK0A 2GCLA 1V5UA 2Z0OA 4HHVA 4KVGB 1Y19B 4PQ0A 5DIFB 3X23A 2ADZA 3LJUX 4HDQA 4A5KA 2ELAA 4Y94A 2EMSA 2I1KA 4IFSA 3MDBC 1DDVA 2COCA 2D9YA 4EMOA 1QC6A 2M14A 2RNRB 3AJ4A 3A98B 3BINA 5D3WA 1KZ7A 2DX5A 1WGUA 5D3YA 4HATB 4K81A 3SUZA 3PZDA 1WG7A 2L1CA 3F5RA 2LOXA 2AEHA 5DI9B 4BBKA 2KGXB 5HE2A 1DDMA 4GN1A 4HAUB 2GCJA 2OTXA 3ODWA 3DXDA 5D27A 3N7CA 4TKNA 3V5WA 4CYEA 1NTYA 1J19A 1K5DB 3WYFB 4C0AA 3SV1A 2W2WA 5CLLB 5JP4A 3ODOA 5HE0A 1M7RA 1RJ2A 5D3VA 1MIXA 1IRSA 2YT0A 1KZGA 2P0DA 1UEFA 3FM8C 2H7EA 1J0WA 2DA0A 5JHHA 4GZUA 4KHAA 2CY4A 1N3HA 1U5EA 4HB4B 2YSZA 1U27A 3VIAA 1GG3A 3OANA 2CY5A 1FGYA 5CLQB 4A6HA 2D9WA 1ISNA 1X11A 2DYNA 1UPRA 1W1DA 4ZRKA 3ZDTA 2QKMA 1W1GA 2UZSA 2DHIA 1KI1B 1BTNA 1GC6A 5J3TA 3TO1A 1Z87A 1OQNA 2YF0A 3P7ZA 1BWNA 3AU5A 1M7EA 2UVMA 1GC7A 2LKOA 1V5MA 1DYNA 5KCVA 2V76A 5JLJB 1U5GA 1ZC4B 3TVVA 1WI1A 5KQ4A 4TYZA 4HAWB 2RVBB 1EAZA 2LULA 5LONB 2DLWA 4F7GA 1EF1A 4GPTB 2P0HA 2J0KA 2LG1A 2DKQA 4GMVA 3VOQA 4DX90 2R0DA 3BJIA 3PVWA 3U8ZA 4Z2MB 3D8DA 5DHAB 1I2HA 2COAA 3M1IB 1U5DA 2M38A 3QBVB 5J3QA 5EFXA 4HB2B 3HK0A 1XKEA 1MKEA 2VSZA 2RGNB 1WJMA 1UNPA 1QQGA 1V88A 2K2JA 3ULCA 2D9VA 1SHCA 2YT1A 2FJLA 2RLOA 1ZM0A 4MT7A 2UZRA 2JP2A 3TCAA 1I7AA 2MWNB 2CAYA 2NMBA 2YRYA 4A6FB 2EC1A 5KQ1A 3FEHA 4F7UP 2N23A 4WVFB 5JHGA 1TJ6A 5FI1A 2P8VA 4MY6A 2DX1A 1OY2A 2DHKA 2Y8FA 4K2PA 1OMWA 3WA0A 4Z2NA 2LOZA 2D9XA 5FI0A 4CHJA 4EJNA 3TW1A 3KZ1A 1U2BA 1H10A 3KRWA 3KRXA 5HE3A 1PLSA 4YONA 1X05A 1UNQA 2YVCA 3PG7A 4HAVB 3SO6A 2ELBA 4XWXA 2YS3A 4HB0B 3KY9A 3PVUA 2D11A 1EGXA 1PMSA 1XODA 4HAYB 2HTHB 2MDXA 1MAIA 3UZTA 3ML4A 4DX8A 2L2IA 5L81A 2BCJA 3CXBB 3G9WA 2EMTA 3O96A 2I5CA 1U29A 1WJ1A 2G35A 2H7DA 2OQBA 2N0YA 4YL8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CIK A;  4HB3 B;  2GS0 A;  1TXD A;  2NZ8 B;  2D4Q A;  1MIZ B;  1NU2 A;  2DYQ A;  1BTK A;  4PNK A;  2E2X A;  3HW2 B;  4A6K A;  2K00 A;  3QIJ A;  1LW3 A;  4K2O A;  5D3X A;  1WGQ A;  3D8E A;  5C5B B;  5J3Y A;  2HE7 A;  4L6E A;  1DBH A;  3MPX A;  3PP2 A;  2P0F A;  1P6S A;  2RSG A;  2Y8G A;  4ZRJ A;  5C6R A;  2QKL A;  1UPQ A;  1MK9 B;  1TQZ A;  4H8S A;  1X1F A;  1FHO A;  4IOY X;  2YS1 A;  1FHW A;  4D0N B;  4F7H A;  2RUK B;  1MK7 B;  3PEG A;  1FHX A;  2XQN M;  4NY0 A;  2Y7B A;  2PZ1 A;  1E5W A;  2ZPY A;  1BAK A;  3ODX A;  1H4R A;  3DXE A;  1XX0 A;  3F0W A;  4CHM A;  1UNR A;  2R09 A;  2Q13 A;  4NSW A;  2COD A;  1X1G A;  4KHO A;  2VRW B;  3KSY A;  2DHJ A;  1AQC A;  2D9Z A;  1ZSQ A;  5GOW B;  4A6F A;  1FOE A;  4HDO A;  2J59 M;  3PSC A;  2YS5 A;  2IFS A;  1DDW A;  1NTV A;  1NI2 A;  2W2X C;  3DXC A;  1W1H A;  3HQC A;  1K5G B;  2I5F A;  1V61 A;  3T06 A;  4K17 A;  4GMX B;  4DXA B;  1ZC3 B;  1FGZ A;  1XCG A;  3QWM A;  1XR0 B;  2ROV A;  1ZVR A;  3NSU A;  3IVF A;  5C16 A;  4P7I A;  1DRO A;  1FAO A;  2GJY A;  5DHF B;  2KCJ A;  3SYX A;  2DN6 A;  1EVH A;  2Z0Q A;  4DBB A;  4HAZ B;  2COF A;  3D8F A;  1V89 A;  4IAP A;  5HE1 A;  5C79 A;  3PVL A;  1U5F A;  1P3R A;  2MKR A;  3ULB A;  1Q67 A;  1B55 A;  2X18 A;  1AWE A;  2J0M A;  1Y5O A;  2VKI A;  3A8Q A;  1PFJ A;  2DKP A;  4KAX B;  4WSF A;  2D2Q A;  2J0J A;  2LYD A;  4WJ7 A;  3RCP A;  2EJ8 A;  2AL6 A;  3U7D A;  1X86 A;  1XD4 A;  3GYO A;  1RRP B;  2D10 A;  1FB8 A;  2Z0P A;  3P6A A;  3FSS A;  3A8P A;  2IYB A;  5LOP B;  2DTC A;  2W2X D;  2KUP A;  2DFK A;  2K2U A;  3AU4 A;  4B6H A;  1LB1 A;  1V5P A;  5DH9 B;  1SGH A;  1P5T A;  4GXB A;  3SNH A;  2MFQ A;  1WVH A;  3TFM A;  3GYP A;  3ZVR A;  4EKU A;  2I1J A;  2ROZ B;  4HAX B;  4ZRI A;  1MPH A;  5C5B A;  2CRF A;  4KHB B;  4MK0 A;  2GCL A;  1V5U A;  2Z0O A;  4HHV A;  4KVG B;  1Y19 B;  4PQ0 A;  5DIF B;  3X23 A;  2ADZ A;  3LJU X;  4HDQ A;  4A5K A;  2ELA A;  4Y94 A;  2EMS A;  2I1K A;  4IFS A;  3MDB C;  1DDV A;  2COC A;  2D9Y A;  4EMO A;  1QC6 A;  2M14 A;  2RNR B;  3AJ4 A;  3A98 B;  3BIN A;  5D3W A;  1KZ7 A;  2DX5 A;  1WGU A;  5D3Y A;  4HAT B;  4K81 A;  3SUZ A;  3PZD A;  1WG7 A;  2L1C A;  3F5R A;  2LOX A;  2AEH A;  5DI9 B;  4BBK A;  2KGX B;  5HE2 A;  1DDM A;  4GN1 A;  4HAU B;  2GCJ A;  2OTX A;  3ODW A;  3DXD A;  5D27 A;  3N7C A;  4TKN A;  3V5W A;  4CYE A;  1NTY A;  1J19 A;  1K5D B;  3WYF B;  4C0A A;  3SV1 A;  2W2W A;  5CLL B;  5JP4 A;  3ODO A;  5HE0 A;  1M7R A;  1RJ2 A;  5D3V A;  1MIX A;  1IRS A;  2YT0 A;  1KZG A;  2P0D A;  1UEF A;  3FM8 C;  2H7E A;  1J0W A;  2DA0 A;  5JHH A;  4GZU A;  4KHA A;  2CY4 A;  1N3H A;  1U5E A;  4HB4 B;  2YSZ A;  1U27 A;  3VIA A;  1GG3 A;  3OAN A;  2CY5 A;  1FGY A;  5CLQ B;  4A6H A;  2D9W A;  1ISN A;  1X11 A;  2DYN A;  1UPR A;  1W1D A;  4ZRK A;  3ZDT A;  2QKM A;  1W1G A;  2UZS A;  2DHI A;  1KI1 B;  1BTN A;  1GC6 A;  5J3T A;  3TO1 A;  1Z87 A;  1OQN A;  2YF0 A;  3P7Z A;  1BWN A;  3AU5 A;  1M7E A;  2UVM A;  1GC7 A;  2LKO A;  1V5M A;  1DYN A;  5KCV A;  2V76 A;  5JLJ B;  1U5G A;  1ZC4 B;  3TVV A;  1WI1 A;  5KQ4 A;  4TYZ A;  4HAW B;  2RVB B;  1EAZ A;  2LUL A;  5LON B;  2DLW A;  4F7G A;  1EF1 A;  4GPT B;  2P0H A;  2J0K A;  2LG1 A;  2DKQ A;  4GMV A;  3VOQ A;  4DX9 0;  2R0D A;  3BJI A;  3PVW A;  3U8Z A;  4Z2M B;  3D8D A;  5DHA B;  1I2H A;  2COA A;  3M1I B;  1U5D A;  2M38 A;  3QBV B;  5J3Q A;  5EFX A;  4HB2 B;  3HK0 A;  1XKE A;  1MKE A;  2VSZ A;  2RGN B;  1WJM A;  1UNP A;  1QQG A;  1V88 A;  2K2J A;  3ULC A;  2D9V A;  1SHC A;  2YT1 A;  2FJL A;  2RLO A;  1ZM0 A;  4MT7 A;  2UZR A;  2JP2 A;  3TCA A;  1I7A A;  2MWN B;  2CAY A;  2NMB A;  2YRY A;  4A6F B;  2EC1 A;  5KQ1 A;  3FEH A;  4F7U P;  2N23 A;  4WVF B;  5JHG A;  1TJ6 A;  5FI1 A;  2P8V A;  4MY6 A;  2DX1 A;  1OY2 A;  2DHK A;  2Y8F A;  4K2P A;  1OMW A;  3WA0 A;  4Z2N A;  2LOZ A;  2D9X A;  5FI0 A;  4CHJ A;  4EJN A;  3TW1 A;  3KZ1 A;  1U2B A;  1H10 A;  3KRW A;  3KRX A;  5HE3 A;  1PLS A;  4YON A;  1X05 A;  1UNQ A;  2YVC A;  3PG7 A;  4HAV B;  3SO6 A;  2ELB A;  4XWX A;  2YS3 A;  4HB0 B;  3KY9 A;  3PVU A;  2D11 A;  1EGX A;  1PMS A;  1XOD A;  4HAY B;  2HTH B;  2MDX A;  1MAI A;  3UZT A;  3ML4 A;  4DX8 A;  2L2I A;  5L81 A;  2BCJ A;  3CXB B;  3G9W A;  2EMT A;  3O96 A;  2I5C A;  1U29 A;  1WJ1 A;  2G35 A;  2H7D A;  2OQB A;  2N0Y A;  4YL8 A; 
#chains in the Genus database with same CATH topology
 3U12 A;  3CIK A;  3NW8 A;  4HB3 B;  2GS0 A;  1TXD A;  2NZ8 B;  2D4Q A;  2ZKM X;  3NWA A;  1MIZ B;  1NU2 A;  2DYQ A;  1BTK A;  4PNK A;  2E2X A;  3HW2 B;  4A6K A;  2K00 A;  1MI1 A;  3QIJ A;  1LW3 A;  4K2O A;  5D3X A;  1WGQ A;  3D8E A;  5C5B B;  2Z59 A;  5J3Y A;  2HE7 A;  4L6E A;  1DBH A;  3MPX A;  3PP2 A;  2P0F A;  1P6S A;  2RSG A;  2Y8G A;  4ZRJ A;  3FVC A;  5C6R A;  2QKL A;  1UPQ A;  1MK9 B;  5I2S A;  1TQZ A;  4H8S A;  1X1F A;  1FHO A;  4IOY X;  2YS1 A;  1FHW A;  4D0N B;  4F7H A;  2RUK B;  1MK7 B;  3PEG A;  1FHX A;  2XQN M;  4NY0 A;  4HSI A;  2Y7B A;  2PZ1 A;  2Z4D A;  1E5W A;  2ZPY A;  1BAK A;  3ODX A;  1H4R A;  3DXE A;  1XX0 A;  3F0W A;  4QXA B;  4CHM A;  1UNR A;  2R09 A;  2Q13 A;  4NSW A;  2COD A;  1X1G A;  4KHO A;  2VRW B;  2KR0 A;  3KSY A;  2DHJ A;  1AQC A;  2K49 A;  2D9Z A;  1ZSQ A;  4OSN A;  5GOW B;  4A6F A;  1FOE A;  4HDO A;  2J59 M;  3PSC A;  1ZYI A;  5LG4 B;  2YS5 A;  2IFS A;  1DDW A;  1NTV A;  1NI2 A;  2W2X C;  3DXC A;  1W1H A;  3HQC A;  1K5G B;  2I5F A;  1V61 A;  3T06 A;  4K17 A;  4GMX B;  4DXA B;  1ZC3 B;  1FGZ A;  1XCG A;  3QWM A;  1XR0 B;  2ROV A;  1ZVR A;  3NSU A;  3IVF A;  5C16 A;  4P7I A;  1DRO A;  1FAO A;  2GJY A;  5DHF B;  2KCJ A;  3SYX A;  2DN6 A;  1EVH A;  2Z0Q A;  4DBB A;  4HAZ B;  2COF A;  1T77 A;  3D8F A;  1V89 A;  4OT1 A;  4IAP A;  5I2M A;  5HE1 A;  5C79 A;  3PVL A;  1U5F A;  1P3R A;  2MKR A;  3ULB A;  1Q67 A;  1B55 A;  2X18 A;  1AWE A;  2J0M A;  1Y5O A;  2VKI A;  3A8Q A;  1PFJ A;  2DKP A;  2NBV A;  4KAX B;  4WSF A;  2D2Q A;  2J0J A;  2LYD A;  4WJ7 A;  3RCP A;  2EJ8 A;  2AL6 A;  3U7D A;  1X86 A;  1XD4 A;  3GYO A;  1RRP B;  2D10 A;  1FB8 A;  2Z0P A;  3P6A A;  3FSS A;  3A8P A;  2Z14 A;  2IYB A;  5LOP B;  2DTC A;  2W2X D;  2KUP A;  2DFK A;  2K2U A;  3AU4 A;  4B6H A;  1LB1 A;  1V5P A;  5DH9 B;  1SGH A;  1P5T A;  4GXB A;  2YT2 A;  3A58 A;  3SNH A;  2MFQ A;  1WVH A;  3TFM A;  3GYP A;  3ZVR A;  4EKU A;  2I1J A;  2ROZ B;  4HAX B;  4ZRI A;  1MPH A;  5C5B A;  2CRF A;  4KHB B;  4MK0 A;  2GCL A;  1V5U A;  2Z0O A;  4HHV A;  4KVG B;  1Y19 B;  4PQ0 A;  2FJU B;  5DIF B;  3X23 A;  2ADZ A;  3LJU X;  4HDQ A;  4QJ3 B;  4A5K A;  2ELA A;  4Y94 A;  2EMS A;  2I1K A;  4IFS A;  3MDB C;  1DDV A;  2COC A;  2D9Y A;  4EMO A;  1QC6 A;  2M14 A;  2RNR B;  3AJ4 A;  3A98 B;  3BIN A;  5D3W A;  1KZ7 A;  2DX5 A;  1WGU A;  5D3Y A;  4HAT B;  4K81 A;  3SUZ A;  4QJ5 B;  3PZD A;  1WG7 A;  2KIE A;  2L1C A;  3F5R A;  2LOX A;  2AEH A;  5DI9 B;  4BBK A;  2KGX B;  5HE2 A;  1DDM A;  2GUM A;  4GN1 A;  4HAU B;  2GCJ A;  2OTX A;  3ODW A;  3DXD A;  5D27 A;  3N7C A;  4TKN A;  3V5W A;  4CYE A;  1NTY A;  1J19 A;  1K5D B;  4GNK B;  3WYF B;  4C0A A;  3SV1 A;  2W2W A;  5CLL B;  2KIG A;  3ODO A;  5JP4 A;  5HE0 A;  1M7R A;  1RJ2 A;  5D3V A;  1MIX A;  1IRS A;  2YT0 A;  1KZG A;  2P0D A;  1UEF A;  3FM8 C;  2H7E A;  1J0W A;  2DA0 A;  5JHH A;  4GZU A;  4KHA A;  2CY4 A;  1N3H A;  1U5E A;  4HB4 B;  2YSZ A;  1U27 A;  3VIA A;  1GG3 A;  3OAN A;  2CY5 A;  1FGY A;  5CLQ B;  4A6H A;  2D9W A;  1ISN A;  1X11 A;  2DYN A;  1UPR A;  1W1D A;  4ZRK A;  3ZDT A;  2QKM A;  1W1G A;  2UZS A;  2DHI A;  1KI1 B;  1BTN A;  1GC6 A;  5J3T A;  3TO1 A;  1Z87 A;  1OQN A;  2YF0 A;  3P7Z A;  1BWN A;  3AU5 A;  1M7E A;  4QJ4 B;  2UVM A;  1GC7 A;  2LKO A;  1V5M A;  1DYN A;  5KCV A;  2V76 A;  5JLJ B;  1U5G A;  1ZC4 B;  3TVV A;  1WI1 A;  5KQ4 A;  4KHB A;  4TYZ A;  4HAW B;  2RVB B;  1EAZ A;  2K8E A;  2LUL A;  5LON B;  2DLW A;  2Z13 A;  4F7G A;  4D6W A;  1EF1 A;  4GPT B;  2P0H A;  3DCX A;  2J0K A;  2LG1 A;  2DKQ A;  4GMV A;  3VOQ A;  4DX9 0;  2R0D A;  3BJI A;  3PVW A;  3U8Z A;  4Z2M B;  3D8D A;  5DHA B;  1I2H A;  2COA A;  3M1I B;  1U5D A;  2M38 A;  3QBV B;  5J3Q A;  5EFX A;  4HB2 B;  3HK0 A;  1XKE A;  1MKE A;  2VSZ A;  2RGN B;  1WJM A;  1UNP A;  1QQG A;  1V88 A;  2K2J A;  3ULC A;  2D9V A;  1SHC A;  2YT1 A;  5M4Y B;  2FJL A;  2RLO A;  1ZM0 A;  4MT7 A;  2UZR A;  2JP2 A;  3TCA A;  1I7A A;  2MWN B;  2CAY A;  2NMB A;  2YRY A;  4A6F B;  2EC1 A;  5KQ1 A;  3FEH A;  4F7U P;  2N23 A;  4WVF B;  5JHG A;  1TJ6 A;  5FI1 A;  2R2Y A;  2P8V A;  4MY6 A;  3NWF A;  2DX1 A;  1OY2 A;  2DHK A;  2Y8F A;  3OHM B;  4K2P A;  1OMW A;  3WA0 A;  4DIX A;  4Z2N A;  2LOZ A;  2D9X A;  5FI0 A;  4CHJ A;  4EJN A;  3TW1 A;  3KZ1 A;  3B77 A;  1U2B A;  1H10 A;  3KRW A;  3KRX A;  5HE3 A;  1PLS A;  4YON A;  2RRF A;  1X05 A;  1UNQ A;  2YVC A;  3PG7 A;  4HAV B;  3SO6 A;  2ELB A;  4XWX A;  2YS3 A;  4HB0 B;  3KY9 A;  3PVU A;  2D11 A;  3HIE A;  1EGX A;  1PMS A;  1XOD A;  4HAY B;  2HTH B;  2MDX A;  4CSQ A;  3HSA A;  1MAI A;  4GOU A;  2KUQ A;  3UZT A;  3ML4 A;  4DX8 A;  5IRS A;  2L2I A;  5L81 A;  4L1R A;  2BCJ A;  3CXB B;  3G9W A;  2EMT A;  3O96 A;  2I5C A;  1U29 A;  1WJ1 A;  2G35 A;  2H7D A;  2OQB A;  2N0Y A;  4YL8 A;  3NWD A; 
#chains in the Genus database with same CATH homology
 3CIK A;  4HB3 B;  2GS0 A;  1TXD A;  2NZ8 B;  2D4Q A;  1MIZ B;  1NU2 A;  2DYQ A;  1BTK A;  4PNK A;  2E2X A;  3HW2 B;  4A6K A;  2K00 A;  3QIJ A;  1LW3 A;  4K2O A;  5D3X A;  1WGQ A;  3D8E A;  5C5B B;  5J3Y A;  2HE7 A;  4L6E A;  1DBH A;  3MPX A;  3PP2 A;  2P0F A;  1P6S A;  2RSG A;  2Y8G A;  4ZRJ A;  5C6R A;  2QKL A;  1UPQ A;  1MK9 B;  1TQZ A;  4H8S A;  1X1F A;  1FHO A;  4IOY X;  2YS1 A;  1FHW A;  4D0N B;  4F7H A;  2RUK B;  1MK7 B;  3PEG A;  1FHX A;  2XQN M;  4NY0 A;  2Y7B A;  2PZ1 A;  1E5W A;  2ZPY A;  1BAK A;  3ODX A;  1H4R A;  3DXE A;  1XX0 A;  3F0W A;  4CHM A;  1UNR A;  2R09 A;  2Q13 A;  4NSW A;  2COD A;  1X1G A;  4KHO A;  2VRW B;  3KSY A;  2DHJ A;  1AQC A;  2D9Z A;  1ZSQ A;  5GOW B;  4A6F A;  1FOE A;  4HDO A;  2J59 M;  3PSC A;  2YS5 A;  2IFS A;  1DDW A;  1NTV A;  1NI2 A;  2W2X C;  3DXC A;  1W1H A;  3HQC A;  1K5G B;  2I5F A;  1V61 A;  3T06 A;  4K17 A;  4GMX B;  4DXA B;  1ZC3 B;  1FGZ A;  1XCG A;  3QWM A;  1XR0 B;  2ROV A;  1ZVR A;  3NSU A;  3IVF A;  5C16 A;  4P7I A;  1DRO A;  1FAO A;  2GJY A;  5DHF B;  2KCJ A;  3SYX A;  2DN6 A;  1EVH A;  2Z0Q A;  4DBB A;  4HAZ B;  2COF A;  3D8F A;  1V89 A;  4IAP A;  5HE1 A;  5C79 A;  3PVL A;  1U5F A;  1P3R A;  2MKR A;  3ULB A;  1Q67 A;  1B55 A;  2X18 A;  1AWE A;  2J0M A;  1Y5O A;  2VKI A;  3A8Q A;  1PFJ A;  2DKP A;  4KAX B;  4WSF A;  2D2Q A;  2J0J A;  2LYD A;  4WJ7 A;  3RCP A;  2EJ8 A;  2AL6 A;  3U7D A;  1X86 A;  1XD4 A;  3GYO A;  1RRP B;  2D10 A;  1FB8 A;  2Z0P A;  3P6A A;  3FSS A;  3A8P A;  2IYB A;  5LOP B;  2DTC A;  2W2X D;  2KUP A;  2DFK A;  2K2U A;  3AU4 A;  4B6H A;  1LB1 A;  1V5P A;  5DH9 B;  1SGH A;  1P5T A;  4GXB A;  3SNH A;  2MFQ A;  1WVH A;  3TFM A;  3GYP A;  3ZVR A;  4EKU A;  2I1J A;  2ROZ B;  4HAX B;  4ZRI A;  1MPH A;  5C5B A;  2CRF A;  4KHB B;  4MK0 A;  2GCL A;  1V5U A;  2Z0O A;  4HHV A;  4KVG B;  1Y19 B;  4PQ0 A;  5DIF B;  3X23 A;  2ADZ A;  3LJU X;  4HDQ A;  4A5K A;  2ELA A;  4Y94 A;  2EMS A;  2I1K A;  4IFS A;  3MDB C;  1DDV A;  2COC A;  2D9Y A;  4EMO A;  1QC6 A;  2M14 A;  2RNR B;  3AJ4 A;  3A98 B;  3BIN A;  5D3W A;  1KZ7 A;  2DX5 A;  1WGU A;  5D3Y A;  4HAT B;  4K81 A;  3SUZ A;  3PZD A;  1WG7 A;  2L1C A;  3F5R A;  2LOX A;  2AEH A;  5DI9 B;  4BBK A;  2KGX B;  5HE2 A;  1DDM A;  4GN1 A;  4HAU B;  2GCJ A;  2OTX A;  3ODW A;  3DXD A;  5D27 A;  3N7C A;  4TKN A;  3V5W A;  4CYE A;  1NTY A;  1J19 A;  1K5D B;  3WYF B;  4C0A A;  3SV1 A;  2W2W A;  5CLL B;  5JP4 A;  3ODO A;  5HE0 A;  1M7R A;  1RJ2 A;  5D3V A;  1MIX A;  1IRS A;  2YT0 A;  1KZG A;  2P0D A;  1UEF A;  3FM8 C;  2H7E A;  1J0W A;  2DA0 A;  5JHH A;  4GZU A;  4KHA A;  2CY4 A;  1N3H A;  1U5E A;  4HB4 B;  2YSZ A;  1U27 A;  3VIA A;  1GG3 A;  3OAN A;  2CY5 A;  1FGY A;  5CLQ B;  4A6H A;  2D9W A;  1ISN A;  1X11 A;  2DYN A;  1UPR A;  1W1D A;  4ZRK A;  3ZDT A;  2QKM A;  1W1G A;  2UZS A;  2DHI A;  1KI1 B;  1BTN A;  1GC6 A;  5J3T A;  3TO1 A;  1Z87 A;  1OQN A;  2YF0 A;  3P7Z A;  1BWN A;  3AU5 A;  1M7E A;  2UVM A;  1GC7 A;  2LKO A;  1V5M A;  1DYN A;  5KCV A;  2V76 A;  5JLJ B;  1U5G A;  1ZC4 B;  3TVV A;  1WI1 A;  5KQ4 A;  4TYZ A;  4HAW B;  2RVB B;  1EAZ A;  2LUL A;  5LON B;  2DLW A;  4F7G A;  1EF1 A;  4GPT B;  2P0H A;  2J0K A;  2LG1 A;  2DKQ A;  4GMV A;  3VOQ A;  4DX9 0;  2R0D A;  3BJI A;  3PVW A;  3U8Z A;  4Z2M B;  3D8D A;  5DHA B;  1I2H A;  2COA A;  3M1I B;  1U5D A;  2M38 A;  3QBV B;  5J3Q A;  5EFX A;  4HB2 B;  3HK0 A;  1XKE A;  1MKE A;  2VSZ A;  2RGN B;  1WJM A;  1UNP A;  1QQG A;  1V88 A;  2K2J A;  3ULC A;  2D9V A;  1SHC A;  2YT1 A;  2FJL A;  2RLO A;  1ZM0 A;  4MT7 A;  2UZR A;  2JP2 A;  3TCA A;  1I7A A;  2MWN B;  2CAY A;  2NMB A;  2YRY A;  4A6F B;  2EC1 A;  5KQ1 A;  3FEH A;  4F7U P;  2N23 A;  4WVF B;  5JHG A;  1TJ6 A;  5FI1 A;  2P8V A;  4MY6 A;  2DX1 A;  1OY2 A;  2DHK A;  2Y8F A;  4K2P A;  1OMW A;  3WA0 A;  4Z2N A;  2LOZ A;  2D9X A;  5FI0 A;  4CHJ A;  4EJN A;  3TW1 A;  3KZ1 A;  1U2B A;  1H10 A;  3KRW A;  3KRX A;  5HE3 A;  1PLS A;  4YON A;  1X05 A;  1UNQ A;  2YVC A;  3PG7 A;  4HAV B;  3SO6 A;  2ELB A;  4XWX A;  2YS3 A;  4HB0 B;  3KY9 A;  3PVU A;  2D11 A;  1EGX A;  1PMS A;  1XOD A;  4HAY B;  2HTH B;  2MDX A;  1MAI A;  3UZT A;  3ML4 A;  4DX8 A;  2L2I A;  5L81 A;  2BCJ A;  3CXB B;  3G9W A;  2EMT A;  3O96 A;  2I5C A;  1U29 A;  1WJ1 A;  2G35 A;  2H7D A;  2OQB A;  2N0Y A;  4YL8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...