1FGZA

Grp1 ph domain (unliganded)
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
127
structure length
127
Chain Sequence
b'TFFNPDREGWLLKLGGRVKTWKRRWFILTDNCLYYFEYTTDKEPRGIIPLENLSIREVLDPRKPNCFELYNPSHKGQVIKACKTEADGRVVEGNHVVYRISAPSPEEKEEWMKSIKASISRDPFYDM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords GRP1
publication title Structural basis of 3-phosphoinositide recognition by pleckstrin homology domains.
pubmed doi rcsb
source organism Mus musculus
molecule tags Signaling protein
total genus 20
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2000-07-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00169 PH PH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 1fgzA00
1DROA 2VRWB 2W2WA 4BBKA 1MK7B 5CLLB 4ZRIA 2RNRB 5HE1A 2UVMA 3D8DA 2VKIA 2LYDA 2RLOA 2CODA 2YS3A 1V89A 5HE2A 2GJYA 3ULCA 5FI0A 2W2XC 2YT1A 2E2XA 5L81A 2L2IA 1WI1A 1OY2A 3PG7A 1OMWA 2DFKA 4EJNA 5D3XA 4B6HA 2EMSA 2YSZA 1P5TA 4TYZA 3KZ1A 5CLQB 1TQZA 4EKUA 1EF1A 2J59M 2YVCA 3OANA 1UPQA 2AL6A 3T06A 1Y5OA 2Y8FA 2OTXA 4HB3B 2LULA 2D2QA 5FI1A 5D3VA 4DX90 5KCVA 1SGHA 3AU5A 2NMBA 2UZSA 1WJ1A 3BJIA 1Z87A 4GN1A 4ZRJA 5HE3A 3QBVB 3DXDA 1FB8A 4HAWB 2MDXA 2H7EA 1IRSA 5EFXA 2DHJA 1EGXA 1FOEA 4HB4B 4PNKA 1DYNA 1PLSA 1BWNA 2COCA 5KQ4A 5HE0A 1H4RA 2RUKB 1LW3A 2W2XD 2KCJA 2DX1A 2DYNA 4HAUB 5C16A 5GOWB 2DKPA 3KSYA 2Y7BA 3TCAA 2DX5A 2ROZB 1FGYA 3P7ZA 4C0AA 3HK0A 3WYFB 4GZUA 3TO1A 1Y19B 4D0NB 1GC7A 2YF0A 2YS5A 1K5DB 5LONB 1RJ2A 3CXBB 1NTYA 5J3YA 2DYQA 2I5FA 4XWXA 1U29A 2G35A 3NSUA 2P0DA 1I2HA 1H10A 2FJLA 1MIXA 3KRXA 2M38A 2I5CA 4YONA 3VIAA 2IFSA 1XR0B 2IYBA 3U8ZA 1UNPA 1BTKA 4HAXB 1MPHA 1X11A 4ZRKA 1LB1A 4MT7A 4Z2MB 1DDMA 3F0WA 4TKNA 2YRYA 1DDVA 1U5FA 2H7DA 1B55A 1OQNA 2MWNB 3GYOA 1P6SA 3PVWA 1ZM0A 4A5KA 4P7IA 4NSWA 1U5EA 1XCGA 4K17A 2NZ8B 2D9ZA 2D10A 4GMVA 3PP2A 3FSSA 2LOXA 4EMOA 4KHOA 2MFQA 1PFJA 1V5MA 1ZVRA 1V88A 4KHAA 1UNRA 5KQ1A 4A6FA 3SV1A 2D9WA 1V5PA 3A8QA 1ZC4B 4HDQA 4WJ7A 3U7DA 3SNHA 2YS1A 5C79A 2DN6A 4WVFB 1XX0A 1FHWA 1QQGA 3KRWA 2R0DA 3DXEA 1RRPB 5D3YA 2ADZA 1BTNA 3SYXA 3SUZA 1U5DA 2UZRA 2V76A 2BCJA 3N7CA 3A98B 5C5BA 3MDBC 2D9VA 2D11A 3LJUX 1UEFA 2PZ1A 4L6EA 3AU4A 2GS0A 4H8SA 5JHGA 2AEHA 4K2PA 2LKOA 2ZPYA 2GCLA 1ISNA 3ODOA 2X18A 4F7UP 4IOYX 1FHOA 2P0HA 2ELAA 3TFMA 3M1IB 3UZTA 1U27A 4HAYB 2LG1A 3TW1A 5JP4A 2MKRA 2P8VA 2I1JA 1Q67A 3A8PA 4DXAB 5D3WA 2M14A 2OQBA 2P0FA 3DXCA 1EVHA 2RVBB 3PEGA 1WVHA 2Q13A 4WSFA 3PZDA 3ZDTA 1W1HA 4Z2NA 1X1GA 2DA0A 2N0YA 4CYEA 1MAIA 2VSZA 4HB2B 3QIJA 2DHKA 5C5BB 3GYPA 1MK9B 3ZVRA 3IVFA 3KY9A 4HAZB 4IFSA 4HAVB 4YL8A 5JLJB 3RCPA 2D9YA 4GMXB 1M7RA 1WGUA 4NY0A 2YT0A 4KHBB 1E5WA 2GCJA 1GC6A 1WJMA 4K81A 4A6KA 1XODA 2CY5A 1DDWA 1UPRA 3D8FA 3D8EA 2J0KA 4KAXB 2QKMA 4MY6A 1TJ6A 3HQCA 3ULBA 2JP2A 4HATB 2HE7A 2HTHB 4MK0A 4GXBA 4CHMA 2Z0QA 2XQNM 1AWEA 1K5GB 4F7GA 2QKLA 5DIFB 3ODXA 3HW2B 4HHVA 2ELBA 1P3RA 1QC6A 1M7EA 1XKEA 2CRFA 3VOQA 1FGZA 3ML4A 1V61A 1TXDA 2N23A 5DHAB 4HB0B 1EAZA 3PSCA 2DHIA 1BAKA 2D4QA 2Y8GA 1NU2A 2I1KA 1PMSA 1W1GA 3F5RA 1FAOA 3X23A 5DI9B 1ZSQA 2J0MA 1I7AA 3P6AA 4GPTB 3BINA 5C6RA 5J3TA 5J3QA 1WGQA 1ZC3B 1SHCA 1X1FA 3O96A 5DH9B 2CAYA 1KZ7A 2DTCA 2KGXB 5JHHA 2CY4A 1DBHA 2EC1A 4KVGB 2Z0PA 2Z0OA 3MPXA 4A6FB 5DHFB 1U2BA 2L1CA 1V5UA 3SO6A 1NI2A 3CIKA 4F7HA 3ODWA 4CHJA 2DLWA 2COFA 1N3HA 2KUPA 1XD4A 1MKEA 5D27A 3TVVA 1NTVA 4K2OA 3FEHA 2K2UA 1KI1B 4PQ0A 4DX8A 2K00A 3FM8C 4IAPA 2RSGA 1AQCA 4DBBA 2J0JA 2ROVA 1GG3A 1U5GA 2LOZA 2R09A 4Y94A 1KZGA 1J19A 3AJ4A 1MIZB 2COAA 1FHXA 1WG7A 4A6HA 1J0WA 3WA0A 2EMTA 1W1DA 3QWMA 1X86A 5LOPB 3PVLA 3PVUA 2EJ8A 2DKQA 2RGNB 3G9WA 4HDOA 2K2JA 1X05A 2D9XA 3V5WA 1UNQA
chains in the Genus database with same CATH superfamily
1DROA 2VRWB 1MI1A 2W2WA 4BBKA 1MK7B 5CLLB 4ZRIA 2RNRB 5HE1A 2UVMA 3D8DA 2VKIA 2LYDA 2RLOA 2CODA 2YS3A 1V89A 5HE2A 2GJYA 3ULCA 5FI0A 2W2XC 2YT1A 2E2XA 5L81A 2L2IA 1WI1A 1OY2A 3PG7A 1OMWA 2DFKA 4EJNA 5D3XA 4B6HA 2EMSA 2YSZA 1P5TA 4TYZA 3KZ1A 5CLQB 1TQZA 4EKUA 1EF1A 2J59M 2YVCA 3OANA 1UPQA 2AL6A 3T06A 1Y5OA 2Y8FA 2OTXA 4HB3B 2LULA 2D2QA 5FI1A 5D3VA 4DX90 5KCVA 1SGHA 2RRFA 3AU5A 2NMBA 2UZSA 1WJ1A 3BJIA 1Z87A 4GN1A 1ZYIA 4ZRJA 5HE3A 3QBVB 3DXDA 1FB8A 4HAWB 2MDXA 2H7EA 1IRSA 5EFXA 2DHJA 1EGXA 1FOEA 4HB4B 4PNKA 1DYNA 1PLSA 3FVCA 1BWNA 2COCA 5KQ4A 5HE0A 5I2MA 1H4RA 2RUKB 1LW3A 2W2XD 2KCJA 2DX1A 2DYNA 4HAUB 4GNKB 5GOWB 5C16A 2DKPA 3KSYA 2Y7BA 3U12A 3TCAA 2DX5A 2ROZB 1FGYA 3P7ZA 4C0AA 3HK0A 3WYFB 3NW8A 4GZUA 3TO1A 1Y19B 4D0NB 3B77A 1GC7A 2YF0A 2YS5A 1K5DB 5LONB 3HIEA 1RJ2A 3CXBB 1NTYA 5J3YA 2DYQA 2I5FA 4XWXA 1U29A 2G35A 3NSUA 2P0DA 1I2HA 1H10A 2FJLA 1MIXA 3KRXA 2M38A 2I5CA 4YONA 3VIAA 2IFSA 1XR0B 2IYBA 3U8ZA 1UNPA 1BTKA 4HAXB 5M4YB 1MPHA 1X11A 4ZRKA 1LB1A 4MT7A 5LG4B 4Z2MB 1DDMA 3F0WA 4L1RA 4TKNA 2YRYA 1DDVA 1U5FA 2H7DA 1B55A 1OQNA 2MWNB 3GYOA 1P6SA 3PVWA 1ZM0A 4A5KA 4P7IA 4NSWA 1U5EA 1XCGA 3NWDA 4K17A 2NZ8B 2D9ZA 2D10A 2KIEA 4GMVA 3PP2A 3FSSA 2LOXA 4EMOA 4KHOA 2MFQA 1PFJA 1V5MA 1ZVRA 2ZKMX 1V88A 4KHAA 1UNRA 2GUMA 5KQ1A 2Z4DA 4A6FA 2FJUB 3SV1A 2D9WA 1V5PA 2Z59A 3A8QA 1ZC4B 2NBVA 4HDQA 4WJ7A 3U7DA 3SNHA 2YS1A 5C79A 2DN6A 4WVFB 1XX0A 1FHWA 1QQGA 3KRWA 2R0DA 3DXEA 1RRPB 5D3YA 2ADZA 1BTNA 3SYXA 3SUZA 1U5DA 2UZRA 2V76A 2BCJA 3N7CA 3A98B 5C5BA 3MDBC 2D9VA 2D11A 3LJUX 1UEFA 4OSNA 2PZ1A 4L6EA 3DCXA 3AU4A 2GS0A 4H8SA 3NWFA 5JHGA 2AEHA 4K2PA 1T77A 2LKOA 3NWAA 2ZPYA 2GCLA 1ISNA 4KHBA 3ODOA 2X18A 4F7UP 2KIGA 4QJ3B 4IOYX 1FHOA 2Z13A 2P0HA 2ELAA 3TFMA 3M1IB 3UZTA 1U27A 4HAYB 2LG1A 3TW1A 5JP4A 2MKRA 4QXAB 2P8VA 2I1JA 1Q67A 3A8PA 4DXAB 5D3WA 2M14A 2OQBA 2P0FA 3DXCA 1EVHA 2RVBB 3PEGA 1WVHA 2Q13A 4WSFA 3PZDA 3ZDTA 1W1HA 4Z2NA 1X1GA 2DA0A 2N0YA 4CYEA 1MAIA 4QJ4B 2VSZA 4HB2B 3QIJA 2DHKA 5C5BB 3GYPA 1MK9B 3ZVRA 3IVFA 3KY9A 4HAZB 4IFSA 4HAVB 4YL8A 5JLJB 3RCPA 2D9YA 4GMXB 1M7RA 1WGUA 4NY0A 2YT0A 4KHBB 1E5WA 2GCJA 1GC6A 1WJMA 4K81A 4A6KA 4HSIA 1XODA 2YT2A 2CY5A 1DDWA 1UPRA 3D8FA 3D8EA 2J0KA 4KAXB 2QKMA 4MY6A 1TJ6A 3HQCA 2Z14A 3ULBA 2JP2A 5IRSA 4HATB 2HE7A 2HTHB 4MK0A 2R2YA 4GOUA 4GXBA 4CHMA 2Z0QA 2XQNM 1AWEA 1K5GB 4F7GA 2QKLA 5DIFB 3ODXA 3HW2B 4HHVA 2ELBA 4CSQA 1P3RA 1QC6A 1M7EA 1XKEA 2CRFA 3VOQA 1FGZA 3ML4A 1V61A 1TXDA 2N23A 5DHAB 4HB0B 1EAZA 3PSCA 2DHIA 1BAKA 2K8EA 2D4QA 2Y8GA 1NU2A 2I1KA 5I2SA 1PMSA 1W1GA 3F5RA 1FAOA 3X23A 5DI9B 4QJ5B 1ZSQA 2J0MA 1I7AA 3A58A 3P6AA 4GPTB 3BINA 5C6RA 5J3TA 5J3QA 1WGQA 1ZC3B 1SHCA 1X1FA 3O96A 5DH9B 2CAYA 1KZ7A 2DTCA 2KGXB 5JHHA 2CY4A 1DBHA 2EC1A 2KUQA 4KVGB 2Z0PA 2Z0OA 3MPXA 4A6FB 5DHFB 1U2BA 2L1CA 1V5UA 3SO6A 1NI2A 3HSAA 2KR0A 3CIKA 4F7HA 3ODWA 4CHJA 2DLWA 2COFA 1N3HA 2KUPA 1XD4A 1MKEA 5D27A 3TVVA 1NTVA 4K2OA 3FEHA 2K2UA 1KI1B 4PQ0A 4DX8A 2K00A 3FM8C 4OT1A 4IAPA 4DIXA 2RSGA 1AQCA 4DBBA 2J0JA 2ROVA 1GG3A 1U5GA 2LOZA 2R09A 4D6WA 4Y94A 1KZGA 1J19A 3AJ4A 1MIZB 2COAA 1FHXA 1WG7A 4A6HA 1J0WA 3WA0A 2EMTA 1W1DA 3QWMA 1X86A 3OHMB 5LOPB 3PVLA 3PVUA 2EJ8A 2DKQA 2RGNB 3G9WA 4HDOA 2K2JA 2K49A 1X05A 2D9XA 3V5WA 1UNQA
chains in the Genus database with same CATH topology
1DROA 2VRWB 2W2WA 4BBKA 1MK7B 5CLLB 4ZRIA 2RNRB 5HE1A 2UVMA 3D8DA 2VKIA 2LYDA 2RLOA 2CODA 2YS3A 1V89A 5HE2A 2GJYA 3ULCA 5FI0A 2W2XC 2YT1A 2E2XA 5L81A 2L2IA 1WI1A 1OY2A 3PG7A 1OMWA 2DFKA 4EJNA 5D3XA 4B6HA 2EMSA 2YSZA 1P5TA 4TYZA 3KZ1A 5CLQB 1TQZA 4EKUA 1EF1A 2J59M 2YVCA 3OANA 1UPQA 2AL6A 3T06A 1Y5OA 2Y8FA 2OTXA 4HB3B 2LULA 2D2QA 5FI1A 5D3VA 4DX90 5KCVA 1SGHA 3AU5A 2NMBA 2UZSA 1WJ1A 3BJIA 1Z87A 4GN1A 4ZRJA 5HE3A 3QBVB 3DXDA 1FB8A 4HAWB 2MDXA 2H7EA 1IRSA 5EFXA 2DHJA 1EGXA 1FOEA 4HB4B 4PNKA 1DYNA 1PLSA 1BWNA 2COCA 5KQ4A 5HE0A 1H4RA 2RUKB 1LW3A 2W2XD 2KCJA 2DX1A 2DYNA 4HAUB 5C16A 5GOWB 2DKPA 3KSYA 2Y7BA 3TCAA 2DX5A 2ROZB 1FGYA 3P7ZA 4C0AA 3HK0A 3WYFB 4GZUA 3TO1A 1Y19B 4D0NB 1GC7A 2YF0A 2YS5A 1K5DB 5LONB 1RJ2A 3CXBB 1NTYA 5J3YA 2DYQA 2I5FA 4XWXA 1U29A 2G35A 3NSUA 2P0DA 1I2HA 1H10A 2FJLA 1MIXA 3KRXA 2M38A 2I5CA 4YONA 3VIAA 2IFSA 1XR0B 2IYBA 3U8ZA 1UNPA 1BTKA 4HAXB 1MPHA 1X11A 4ZRKA 1LB1A 4MT7A 4Z2MB 1DDMA 3F0WA 4TKNA 2YRYA 1DDVA 1U5FA 2H7DA 1B55A 1OQNA 2MWNB 3GYOA 1P6SA 3PVWA 1ZM0A 4A5KA 4P7IA 4NSWA 1U5EA 1XCGA 4K17A 2NZ8B 2D9ZA 2D10A 4GMVA 3PP2A 3FSSA 2LOXA 4EMOA 4KHOA 2MFQA 1PFJA 1V5MA 1ZVRA 1V88A 4KHAA 1UNRA 5KQ1A 4A6FA 3SV1A 2D9WA 1V5PA 3A8QA 1ZC4B 4HDQA 4WJ7A 3U7DA 3SNHA 2YS1A 5C79A 2DN6A 4WVFB 1XX0A 1FHWA 1QQGA 3KRWA 2R0DA 3DXEA 1RRPB 5D3YA 2ADZA 1BTNA 3SYXA 3SUZA 1U5DA 2UZRA 2V76A 2BCJA 3N7CA 3A98B 5C5BA 3MDBC 2D9VA 2D11A 3LJUX 1UEFA 2PZ1A 4L6EA 3AU4A 2GS0A 4H8SA 5JHGA 2AEHA 4K2PA 2LKOA 2ZPYA 2GCLA 1ISNA 3ODOA 2X18A 4F7UP 4IOYX 1FHOA 2P0HA 2ELAA 3TFMA 3M1IB 3UZTA 1U27A 4HAYB 2LG1A 3TW1A 5JP4A 2MKRA 2P8VA 2I1JA 1Q67A 3A8PA 4DXAB 5D3WA 2M14A 2OQBA 2P0FA 3DXCA 1EVHA 2RVBB 3PEGA 1WVHA 2Q13A 4WSFA 3PZDA 3ZDTA 1W1HA 4Z2NA 1X1GA 2DA0A 2N0YA 4CYEA 1MAIA 2VSZA 4HB2B 3QIJA 2DHKA 5C5BB 3GYPA 1MK9B 3ZVRA 3IVFA 3KY9A 4HAZB 4IFSA 4HAVB 4YL8A 5JLJB 3RCPA 2D9YA 4GMXB 1M7RA 1WGUA 4NY0A 2YT0A 4KHBB 1E5WA 2GCJA 1GC6A 1WJMA 4K81A 4A6KA 1XODA 2CY5A 1DDWA 1UPRA 3D8FA 3D8EA 2J0KA 4KAXB 2QKMA 4MY6A 1TJ6A 3HQCA 3ULBA 2JP2A 4HATB 2HE7A 2HTHB 4MK0A 4GXBA 4CHMA 2Z0QA 2XQNM 1AWEA 1K5GB 4F7GA 2QKLA 5DIFB 3ODXA 3HW2B 4HHVA 2ELBA 1P3RA 1QC6A 1M7EA 1XKEA 2CRFA 3VOQA 1FGZA 3ML4A 1V61A 1TXDA 2N23A 5DHAB 4HB0B 1EAZA 3PSCA 2DHIA 1BAKA 2D4QA 2Y8GA 1NU2A 2I1KA 1PMSA 1W1GA 3F5RA 1FAOA 3X23A 5DI9B 1ZSQA 2J0MA 1I7AA 3P6AA 4GPTB 3BINA 5C6RA 5J3TA 5J3QA 1WGQA 1ZC3B 1SHCA 1X1FA 3O96A 5DH9B 2CAYA 1KZ7A 2DTCA 2KGXB 5JHHA 2CY4A 1DBHA 2EC1A 4KVGB 2Z0PA 2Z0OA 3MPXA 4A6FB 5DHFB 1U2BA 2L1CA 1V5UA 3SO6A 1NI2A 3CIKA 4F7HA 3ODWA 4CHJA 2DLWA 2COFA 1N3HA 2KUPA 1XD4A 1MKEA 5D27A 3TVVA 1NTVA 4K2OA 3FEHA 2K2UA 1KI1B 4PQ0A 4DX8A 2K00A 3FM8C 4IAPA 2RSGA 1AQCA 4DBBA 2J0JA 2ROVA 1GG3A 1U5GA 2LOZA 2R09A 4Y94A 1KZGA 1J19A 3AJ4A 1MIZB 2COAA 1FHXA 1WG7A 4A6HA 1J0WA 3WA0A 2EMTA 1W1DA 3QWMA 1X86A 5LOPB 3PVLA 3PVUA 2EJ8A 2DKQA 2RGNB 3G9WA 4HDOA 2K2JA 1X05A 2D9XA 3V5WA 1UNQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DRO A;  2VRW B;  2W2W A;  4BBK A;  1MK7 B;  5CLL B;  4ZRI A;  2RNR B;  5HE1 A;  2UVM A;  3D8D A;  2VKI A;  2LYD A;  2RLO A;  2COD A;  2YS3 A;  1V89 A;  5HE2 A;  2GJY A;  3ULC A;  5FI0 A;  2W2X C;  2YT1 A;  2E2X A;  5L81 A;  2L2I A;  1WI1 A;  1OY2 A;  3PG7 A;  1OMW A;  2DFK A;  4EJN A;  5D3X A;  4B6H A;  2EMS A;  2YSZ A;  1P5T A;  4TYZ A;  3KZ1 A;  5CLQ B;  1TQZ A;  4EKU A;  1EF1 A;  2J59 M;  2YVC A;  3OAN A;  1UPQ A;  2AL6 A;  3T06 A;  1Y5O A;  2Y8F A;  2OTX A;  4HB3 B;  2LUL A;  2D2Q A;  5FI1 A;  5D3V A;  4DX9 0;  5KCV A;  1SGH A;  3AU5 A;  2NMB A;  2UZS A;  1WJ1 A;  3BJI A;  1Z87 A;  4GN1 A;  4ZRJ A;  5HE3 A;  3QBV B;  3DXD A;  1FB8 A;  4HAW B;  2MDX A;  2H7E A;  1IRS A;  5EFX A;  2DHJ A;  1EGX A;  1FOE A;  4HB4 B;  4PNK A;  1DYN A;  1PLS A;  1BWN A;  2COC A;  5KQ4 A;  5HE0 A;  1H4R A;  2RUK B;  1LW3 A;  2W2X D;  2KCJ A;  2DX1 A;  2DYN A;  4HAU B;  5C16 A;  5GOW B;  2DKP A;  3KSY A;  2Y7B A;  3TCA A;  2DX5 A;  2ROZ B;  1FGY A;  3P7Z A;  4C0A A;  3HK0 A;  3WYF B;  4GZU A;  3TO1 A;  1Y19 B;  4D0N B;  1GC7 A;  2YF0 A;  2YS5 A;  1K5D B;  5LON B;  1RJ2 A;  3CXB B;  1NTY A;  5J3Y A;  2DYQ A;  2I5F A;  4XWX A;  1U29 A;  2G35 A;  3NSU A;  2P0D A;  1I2H A;  1H10 A;  2FJL A;  1MIX A;  3KRX A;  2M38 A;  2I5C A;  4YON A;  3VIA A;  2IFS A;  1XR0 B;  2IYB A;  3U8Z A;  1UNP A;  1BTK A;  4HAX B;  1MPH A;  1X11 A;  4ZRK A;  1LB1 A;  4MT7 A;  4Z2M B;  1DDM A;  3F0W A;  4TKN A;  2YRY A;  1DDV A;  1U5F A;  2H7D A;  1B55 A;  1OQN A;  2MWN B;  3GYO A;  1P6S A;  3PVW A;  1ZM0 A;  4A5K A;  4P7I A;  4NSW A;  1U5E A;  1XCG A;  4K17 A;  2NZ8 B;  2D9Z A;  2D10 A;  4GMV A;  3PP2 A;  3FSS A;  2LOX A;  4EMO A;  4KHO A;  2MFQ A;  1PFJ A;  1V5M A;  1ZVR A;  1V88 A;  4KHA A;  1UNR A;  5KQ1 A;  4A6F A;  3SV1 A;  2D9W A;  1V5P A;  3A8Q A;  1ZC4 B;  4HDQ A;  4WJ7 A;  3U7D A;  3SNH A;  2YS1 A;  5C79 A;  2DN6 A;  4WVF B;  1XX0 A;  1FHW A;  1QQG A;  3KRW A;  2R0D A;  3DXE A;  1RRP B;  5D3Y A;  2ADZ A;  1BTN A;  3SYX A;  3SUZ A;  1U5D A;  2UZR A;  2V76 A;  2BCJ A;  3N7C A;  3A98 B;  5C5B A;  3MDB C;  2D9V A;  2D11 A;  3LJU X;  1UEF A;  2PZ1 A;  4L6E A;  3AU4 A;  2GS0 A;  4H8S A;  5JHG A;  2AEH A;  4K2P A;  2LKO A;  2ZPY A;  2GCL A;  1ISN A;  3ODO A;  2X18 A;  4F7U P;  4IOY X;  1FHO A;  2P0H A;  2ELA A;  3TFM A;  3M1I B;  3UZT A;  1U27 A;  4HAY B;  2LG1 A;  3TW1 A;  5JP4 A;  2MKR A;  2P8V A;  2I1J A;  1Q67 A;  3A8P A;  4DXA B;  5D3W A;  2M14 A;  2OQB A;  2P0F A;  3DXC A;  1EVH A;  2RVB B;  3PEG A;  1WVH A;  2Q13 A;  4WSF A;  3PZD A;  3ZDT A;  1W1H A;  4Z2N A;  1X1G A;  2DA0 A;  2N0Y A;  4CYE A;  1MAI A;  2VSZ A;  4HB2 B;  3QIJ A;  2DHK A;  5C5B B;  3GYP A;  1MK9 B;  3ZVR A;  3IVF A;  3KY9 A;  4HAZ B;  4IFS A;  4HAV B;  4YL8 A;  5JLJ B;  3RCP A;  2D9Y A;  4GMX B;  1M7R A;  1WGU A;  4NY0 A;  2YT0 A;  4KHB B;  1E5W A;  2GCJ A;  1GC6 A;  1WJM A;  4K81 A;  4A6K A;  1XOD A;  2CY5 A;  1DDW A;  1UPR A;  3D8F A;  3D8E A;  2J0K A;  4KAX B;  2QKM A;  4MY6 A;  1TJ6 A;  3HQC A;  3ULB A;  2JP2 A;  4HAT B;  2HE7 A;  2HTH B;  4MK0 A;  4GXB A;  4CHM A;  2Z0Q A;  2XQN M;  1AWE A;  1K5G B;  4F7G A;  2QKL A;  5DIF B;  3ODX A;  3HW2 B;  4HHV A;  2ELB A;  1P3R A;  1QC6 A;  1M7E A;  1XKE A;  2CRF A;  3VOQ A;  1FGZ A;  3ML4 A;  1V61 A;  1TXD A;  2N23 A;  5DHA B;  4HB0 B;  1EAZ A;  3PSC A;  2DHI A;  1BAK A;  2D4Q A;  2Y8G A;  1NU2 A;  2I1K A;  1PMS A;  1W1G A;  3F5R A;  1FAO A;  3X23 A;  5DI9 B;  1ZSQ A;  2J0M A;  1I7A A;  3P6A A;  4GPT B;  3BIN A;  5C6R A;  5J3T A;  5J3Q A;  1WGQ A;  1ZC3 B;  1SHC A;  1X1F A;  3O96 A;  5DH9 B;  2CAY A;  1KZ7 A;  2DTC A;  2KGX B;  5JHH A;  2CY4 A;  1DBH A;  2EC1 A;  4KVG B;  2Z0P A;  2Z0O A;  3MPX A;  4A6F B;  5DHF B;  1U2B A;  2L1C A;  1V5U A;  3SO6 A;  1NI2 A;  3CIK A;  4F7H A;  3ODW A;  4CHJ A;  2DLW A;  2COF A;  1N3H A;  2KUP A;  1XD4 A;  1MKE A;  5D27 A;  3TVV A;  1NTV A;  4K2O A;  3FEH A;  2K2U A;  1KI1 B;  4PQ0 A;  4DX8 A;  2K00 A;  3FM8 C;  4IAP A;  2RSG A;  1AQC A;  4DBB A;  2J0J A;  2ROV A;  1GG3 A;  1U5G A;  2LOZ A;  2R09 A;  4Y94 A;  1KZG A;  1J19 A;  3AJ4 A;  1MIZ B;  2COA A;  1FHX A;  1WG7 A;  4A6H A;  1J0W A;  3WA0 A;  2EMT A;  1W1D A;  3QWM A;  1X86 A;  5LOP B;  3PVL A;  3PVU A;  2EJ8 A;  2DKQ A;  2RGN B;  3G9W A;  4HDO A;  2K2J A;  1X05 A;  2D9X A;  3V5W A;  1UNQ A; 
#chains in the Genus database with same CATH topology
 1DRO A;  2VRW B;  1MI1 A;  2W2W A;  4BBK A;  1MK7 B;  5CLL B;  4ZRI A;  2RNR B;  5HE1 A;  2UVM A;  3D8D A;  2VKI A;  2LYD A;  2RLO A;  2COD A;  2YS3 A;  1V89 A;  5HE2 A;  2GJY A;  3ULC A;  5FI0 A;  2W2X C;  2YT1 A;  2E2X A;  5L81 A;  2L2I A;  1WI1 A;  1OY2 A;  3PG7 A;  1OMW A;  2DFK A;  4EJN A;  5D3X A;  4B6H A;  2EMS A;  2YSZ A;  1P5T A;  4TYZ A;  3KZ1 A;  5CLQ B;  1TQZ A;  4EKU A;  1EF1 A;  2J59 M;  2YVC A;  3OAN A;  1UPQ A;  2AL6 A;  3T06 A;  1Y5O A;  2Y8F A;  2OTX A;  4HB3 B;  2LUL A;  2D2Q A;  5FI1 A;  5D3V A;  4DX9 0;  5KCV A;  1SGH A;  2RRF A;  3AU5 A;  2NMB A;  2UZS A;  1WJ1 A;  3BJI A;  1Z87 A;  4GN1 A;  1ZYI A;  4ZRJ A;  5HE3 A;  3QBV B;  3DXD A;  1FB8 A;  4HAW B;  2MDX A;  2H7E A;  1IRS A;  5EFX A;  2DHJ A;  1EGX A;  1FOE A;  4HB4 B;  4PNK A;  1DYN A;  1PLS A;  3FVC A;  1BWN A;  2COC A;  5KQ4 A;  5HE0 A;  5I2M A;  1H4R A;  2RUK B;  1LW3 A;  2W2X D;  2KCJ A;  2DX1 A;  2DYN A;  4HAU B;  4GNK B;  5GOW B;  5C16 A;  2DKP A;  3KSY A;  2Y7B A;  3U12 A;  3TCA A;  2DX5 A;  2ROZ B;  1FGY A;  3P7Z A;  4C0A A;  3HK0 A;  3WYF B;  3NW8 A;  4GZU A;  3TO1 A;  1Y19 B;  4D0N B;  3B77 A;  1GC7 A;  2YF0 A;  2YS5 A;  1K5D B;  5LON B;  3HIE A;  1RJ2 A;  3CXB B;  1NTY A;  5J3Y A;  2DYQ A;  2I5F A;  4XWX A;  1U29 A;  2G35 A;  3NSU A;  2P0D A;  1I2H A;  1H10 A;  2FJL A;  1MIX A;  3KRX A;  2M38 A;  2I5C A;  4YON A;  3VIA A;  2IFS A;  1XR0 B;  2IYB A;  3U8Z A;  1UNP A;  1BTK A;  4HAX B;  5M4Y B;  1MPH A;  1X11 A;  4ZRK A;  1LB1 A;  4MT7 A;  5LG4 B;  4Z2M B;  1DDM A;  3F0W A;  4L1R A;  4TKN A;  2YRY A;  1DDV A;  1U5F A;  2H7D A;  1B55 A;  1OQN A;  2MWN B;  3GYO A;  1P6S A;  3PVW A;  1ZM0 A;  4A5K A;  4P7I A;  4NSW A;  1U5E A;  1XCG A;  3NWD A;  4K17 A;  2NZ8 B;  2D9Z A;  2D10 A;  2KIE A;  4GMV A;  3PP2 A;  3FSS A;  2LOX A;  4EMO A;  4KHO A;  2MFQ A;  1PFJ A;  1V5M A;  1ZVR A;  2ZKM X;  1V88 A;  4KHA A;  1UNR A;  2GUM A;  5KQ1 A;  2Z4D A;  4A6F A;  2FJU B;  3SV1 A;  2D9W A;  1V5P A;  2Z59 A;  3A8Q A;  1ZC4 B;  2NBV A;  4HDQ A;  4WJ7 A;  3U7D A;  3SNH A;  2YS1 A;  5C79 A;  2DN6 A;  4WVF B;  1XX0 A;  1FHW A;  1QQG A;  3KRW A;  2R0D A;  3DXE A;  1RRP B;  5D3Y A;  2ADZ A;  1BTN A;  3SYX A;  3SUZ A;  1U5D A;  2UZR A;  2V76 A;  2BCJ A;  3N7C A;  3A98 B;  5C5B A;  3MDB C;  2D9V A;  2D11 A;  3LJU X;  1UEF A;  4OSN A;  2PZ1 A;  4L6E A;  3DCX A;  3AU4 A;  2GS0 A;  4H8S A;  3NWF A;  5JHG A;  2AEH A;  4K2P A;  1T77 A;  2LKO A;  3NWA A;  2ZPY A;  2GCL A;  1ISN A;  4KHB A;  3ODO A;  2X18 A;  4F7U P;  2KIG A;  4QJ3 B;  4IOY X;  1FHO A;  2Z13 A;  2P0H A;  2ELA A;  3TFM A;  3M1I B;  3UZT A;  1U27 A;  4HAY B;  2LG1 A;  3TW1 A;  5JP4 A;  2MKR A;  4QXA B;  2P8V A;  2I1J A;  1Q67 A;  3A8P A;  4DXA B;  5D3W A;  2M14 A;  2OQB A;  2P0F A;  3DXC A;  1EVH A;  2RVB B;  3PEG A;  1WVH A;  2Q13 A;  4WSF A;  3PZD A;  3ZDT A;  1W1H A;  4Z2N A;  1X1G A;  2DA0 A;  2N0Y A;  4CYE A;  1MAI A;  4QJ4 B;  2VSZ A;  4HB2 B;  3QIJ A;  2DHK A;  5C5B B;  3GYP A;  1MK9 B;  3ZVR A;  3IVF A;  3KY9 A;  4HAZ B;  4IFS A;  4HAV B;  4YL8 A;  5JLJ B;  3RCP A;  2D9Y A;  4GMX B;  1M7R A;  1WGU A;  4NY0 A;  2YT0 A;  4KHB B;  1E5W A;  2GCJ A;  1GC6 A;  1WJM A;  4K81 A;  4A6K A;  4HSI A;  1XOD A;  2YT2 A;  2CY5 A;  1DDW A;  1UPR A;  3D8F A;  3D8E A;  2J0K A;  4KAX B;  2QKM A;  4MY6 A;  1TJ6 A;  3HQC A;  2Z14 A;  3ULB A;  2JP2 A;  5IRS A;  4HAT B;  2HE7 A;  2HTH B;  4MK0 A;  2R2Y A;  4GOU A;  4GXB A;  4CHM A;  2Z0Q A;  2XQN M;  1AWE A;  1K5G B;  4F7G A;  2QKL A;  5DIF B;  3ODX A;  3HW2 B;  4HHV A;  2ELB A;  4CSQ A;  1P3R A;  1QC6 A;  1M7E A;  1XKE A;  2CRF A;  3VOQ A;  1FGZ A;  3ML4 A;  1V61 A;  1TXD A;  2N23 A;  5DHA B;  4HB0 B;  1EAZ A;  3PSC A;  2DHI A;  1BAK A;  2K8E A;  2D4Q A;  2Y8G A;  1NU2 A;  2I1K A;  5I2S A;  1PMS A;  1W1G A;  3F5R A;  1FAO A;  3X23 A;  5DI9 B;  4QJ5 B;  1ZSQ A;  2J0M A;  1I7A A;  3A58 A;  3P6A A;  4GPT B;  3BIN A;  5C6R A;  5J3T A;  5J3Q A;  1WGQ A;  1ZC3 B;  1SHC A;  1X1F A;  3O96 A;  5DH9 B;  2CAY A;  1KZ7 A;  2DTC A;  2KGX B;  5JHH A;  2CY4 A;  1DBH A;  2EC1 A;  2KUQ A;  4KVG B;  2Z0P A;  2Z0O A;  3MPX A;  4A6F B;  5DHF B;  1U2B A;  2L1C A;  1V5U A;  3SO6 A;  1NI2 A;  3HSA A;  2KR0 A;  3CIK A;  4F7H A;  3ODW A;  4CHJ A;  2DLW A;  2COF A;  1N3H A;  2KUP A;  1XD4 A;  1MKE A;  5D27 A;  3TVV A;  1NTV A;  4K2O A;  3FEH A;  2K2U A;  1KI1 B;  4PQ0 A;  4DX8 A;  2K00 A;  3FM8 C;  4OT1 A;  4IAP A;  4DIX A;  2RSG A;  1AQC A;  4DBB A;  2J0J A;  2ROV A;  1GG3 A;  1U5G A;  2LOZ A;  2R09 A;  4D6W A;  4Y94 A;  1KZG A;  1J19 A;  3AJ4 A;  1MIZ B;  2COA A;  1FHX A;  1WG7 A;  4A6H A;  1J0W A;  3WA0 A;  2EMT A;  1W1D A;  3QWM A;  1X86 A;  3OHM B;  5LOP B;  3PVL A;  3PVU A;  2EJ8 A;  2DKQ A;  2RGN B;  3G9W A;  4HDO A;  2K2J A;  2K49 A;  1X05 A;  2D9X A;  3V5W A;  1UNQ A; 
#chains in the Genus database with same CATH homology
 1DRO A;  2VRW B;  2W2W A;  4BBK A;  1MK7 B;  5CLL B;  4ZRI A;  2RNR B;  5HE1 A;  2UVM A;  3D8D A;  2VKI A;  2LYD A;  2RLO A;  2COD A;  2YS3 A;  1V89 A;  5HE2 A;  2GJY A;  3ULC A;  5FI0 A;  2W2X C;  2YT1 A;  2E2X A;  5L81 A;  2L2I A;  1WI1 A;  1OY2 A;  3PG7 A;  1OMW A;  2DFK A;  4EJN A;  5D3X A;  4B6H A;  2EMS A;  2YSZ A;  1P5T A;  4TYZ A;  3KZ1 A;  5CLQ B;  1TQZ A;  4EKU A;  1EF1 A;  2J59 M;  2YVC A;  3OAN A;  1UPQ A;  2AL6 A;  3T06 A;  1Y5O A;  2Y8F A;  2OTX A;  4HB3 B;  2LUL A;  2D2Q A;  5FI1 A;  5D3V A;  4DX9 0;  5KCV A;  1SGH A;  3AU5 A;  2NMB A;  2UZS A;  1WJ1 A;  3BJI A;  1Z87 A;  4GN1 A;  4ZRJ A;  5HE3 A;  3QBV B;  3DXD A;  1FB8 A;  4HAW B;  2MDX A;  2H7E A;  1IRS A;  5EFX A;  2DHJ A;  1EGX A;  1FOE A;  4HB4 B;  4PNK A;  1DYN A;  1PLS A;  1BWN A;  2COC A;  5KQ4 A;  5HE0 A;  1H4R A;  2RUK B;  1LW3 A;  2W2X D;  2KCJ A;  2DX1 A;  2DYN A;  4HAU B;  5C16 A;  5GOW B;  2DKP A;  3KSY A;  2Y7B A;  3TCA A;  2DX5 A;  2ROZ B;  1FGY A;  3P7Z A;  4C0A A;  3HK0 A;  3WYF B;  4GZU A;  3TO1 A;  1Y19 B;  4D0N B;  1GC7 A;  2YF0 A;  2YS5 A;  1K5D B;  5LON B;  1RJ2 A;  3CXB B;  1NTY A;  5J3Y A;  2DYQ A;  2I5F A;  4XWX A;  1U29 A;  2G35 A;  3NSU A;  2P0D A;  1I2H A;  1H10 A;  2FJL A;  1MIX A;  3KRX A;  2M38 A;  2I5C A;  4YON A;  3VIA A;  2IFS A;  1XR0 B;  2IYB A;  3U8Z A;  1UNP A;  1BTK A;  4HAX B;  1MPH A;  1X11 A;  4ZRK A;  1LB1 A;  4MT7 A;  4Z2M B;  1DDM A;  3F0W A;  4TKN A;  2YRY A;  1DDV A;  1U5F A;  2H7D A;  1B55 A;  1OQN A;  2MWN B;  3GYO A;  1P6S A;  3PVW A;  1ZM0 A;  4A5K A;  4P7I A;  4NSW A;  1U5E A;  1XCG A;  4K17 A;  2NZ8 B;  2D9Z A;  2D10 A;  4GMV A;  3PP2 A;  3FSS A;  2LOX A;  4EMO A;  4KHO A;  2MFQ A;  1PFJ A;  1V5M A;  1ZVR A;  1V88 A;  4KHA A;  1UNR A;  5KQ1 A;  4A6F A;  3SV1 A;  2D9W A;  1V5P A;  3A8Q A;  1ZC4 B;  4HDQ A;  4WJ7 A;  3U7D A;  3SNH A;  2YS1 A;  5C79 A;  2DN6 A;  4WVF B;  1XX0 A;  1FHW A;  1QQG A;  3KRW A;  2R0D A;  3DXE A;  1RRP B;  5D3Y A;  2ADZ A;  1BTN A;  3SYX A;  3SUZ A;  1U5D A;  2UZR A;  2V76 A;  2BCJ A;  3N7C A;  3A98 B;  5C5B A;  3MDB C;  2D9V A;  2D11 A;  3LJU X;  1UEF A;  2PZ1 A;  4L6E A;  3AU4 A;  2GS0 A;  4H8S A;  5JHG A;  2AEH A;  4K2P A;  2LKO A;  2ZPY A;  2GCL A;  1ISN A;  3ODO A;  2X18 A;  4F7U P;  4IOY X;  1FHO A;  2P0H A;  2ELA A;  3TFM A;  3M1I B;  3UZT A;  1U27 A;  4HAY B;  2LG1 A;  3TW1 A;  5JP4 A;  2MKR A;  2P8V A;  2I1J A;  1Q67 A;  3A8P A;  4DXA B;  5D3W A;  2M14 A;  2OQB A;  2P0F A;  3DXC A;  1EVH A;  2RVB B;  3PEG A;  1WVH A;  2Q13 A;  4WSF A;  3PZD A;  3ZDT A;  1W1H A;  4Z2N A;  1X1G A;  2DA0 A;  2N0Y A;  4CYE A;  1MAI A;  2VSZ A;  4HB2 B;  3QIJ A;  2DHK A;  5C5B B;  3GYP A;  1MK9 B;  3ZVR A;  3IVF A;  3KY9 A;  4HAZ B;  4IFS A;  4HAV B;  4YL8 A;  5JLJ B;  3RCP A;  2D9Y A;  4GMX B;  1M7R A;  1WGU A;  4NY0 A;  2YT0 A;  4KHB B;  1E5W A;  2GCJ A;  1GC6 A;  1WJM A;  4K81 A;  4A6K A;  1XOD A;  2CY5 A;  1DDW A;  1UPR A;  3D8F A;  3D8E A;  2J0K A;  4KAX B;  2QKM A;  4MY6 A;  1TJ6 A;  3HQC A;  3ULB A;  2JP2 A;  4HAT B;  2HE7 A;  2HTH B;  4MK0 A;  4GXB A;  4CHM A;  2Z0Q A;  2XQN M;  1AWE A;  1K5G B;  4F7G A;  2QKL A;  5DIF B;  3ODX A;  3HW2 B;  4HHV A;  2ELB A;  1P3R A;  1QC6 A;  1M7E A;  1XKE A;  2CRF A;  3VOQ A;  1FGZ A;  3ML4 A;  1V61 A;  1TXD A;  2N23 A;  5DHA B;  4HB0 B;  1EAZ A;  3PSC A;  2DHI A;  1BAK A;  2D4Q A;  2Y8G A;  1NU2 A;  2I1K A;  1PMS A;  1W1G A;  3F5R A;  1FAO A;  3X23 A;  5DI9 B;  1ZSQ A;  2J0M A;  1I7A A;  3P6A A;  4GPT B;  3BIN A;  5C6R A;  5J3T A;  5J3Q A;  1WGQ A;  1ZC3 B;  1SHC A;  1X1F A;  3O96 A;  5DH9 B;  2CAY A;  1KZ7 A;  2DTC A;  2KGX B;  5JHH A;  2CY4 A;  1DBH A;  2EC1 A;  4KVG B;  2Z0P A;  2Z0O A;  3MPX A;  4A6F B;  5DHF B;  1U2B A;  2L1C A;  1V5U A;  3SO6 A;  1NI2 A;  3CIK A;  4F7H A;  3ODW A;  4CHJ A;  2DLW A;  2COF A;  1N3H A;  2KUP A;  1XD4 A;  1MKE A;  5D27 A;  3TVV A;  1NTV A;  4K2O A;  3FEH A;  2K2U A;  1KI1 B;  4PQ0 A;  4DX8 A;  2K00 A;  3FM8 C;  4IAP A;  2RSG A;  1AQC A;  4DBB A;  2J0J A;  2ROV A;  1GG3 A;  1U5G A;  2LOZ A;  2R09 A;  4Y94 A;  1KZG A;  1J19 A;  3AJ4 A;  1MIZ B;  2COA A;  1FHX A;  1WG7 A;  4A6H A;  1J0W A;  3WA0 A;  2EMT A;  1W1D A;  3QWM A;  1X86 A;  5LOP B;  3PVL A;  3PVU A;  2EJ8 A;  2DKQ A;  2RGN B;  3G9W A;  4HDO A;  2K2J A;  1X05 A;  2D9X A;  3V5W A;  1UNQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...