1FGZA

Grp1 ph domain (unliganded)
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
127
structure length
127
Chain Sequence
TFFNPDREGWLLKLGGRVKTWKRRWFILTDNCLYYFEYTTDKEPRGIIPLENLSIREVLDPRKPNCFELYNPSHKGQVIKACKTEADGRVVEGNHVVYRISAPSPEEKEEWMKSIKASISRDPFYDM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Signaling protein
molecule keywords GRP1
publication title Structural basis of 3-phosphoinositide recognition by pleckstrin homology domains.
pubmed doi rcsb
source organism Mus musculus
total genus 20
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2000-07-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00169 PH PH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 1fgzA00
1V88A 4A6FB 2I5CA 5JP4A 1WVHA 1XD4A 2YF0A 3AJ4A 2W2XC 1QC6A 4HDQA 4HATB 1ZVRA 4KHOA 1V61A 3ODWA 3ML4A 2YRYA 3SUZA 4K2OA 1SGHA 3PEGA 1TXDA 2MKRA 3KRXA 2VKIA 3FEHA 1LB1A 1PLSA 5DHFB 1GC6A 3D8FA 1Q67A 2COCA 2HE7A 1AQCA 2HTHB 4HHVA 5DH9B 3AU4A 3X23A 2IYBA 1FHXA 1FGYA 1XKEA 2COFA 1J19A 3PVWA 2BCJA 2K00A 4BBKA 2YS5A 3GYPA 2I1JA 1BTKA 5D3VA 2J0JA 1N3HA 4ZRIA 1V89A 3N7CA 2P0FA 2D10A 4Y94A 1GC7A 2OQBA 1W1HA 1P5TA 4MT7A 4YONA 1Z87A 2DYNA 2YVCA 1UNRA 1MK9B 1Y19B 4A6FA 3KY9A 1BAKA 3UZTA 1MAIA 3SV1A 2P8VA 5HE1A 2GJYA 5J3QA 1H10A 2AEHA 3A98B 4ZRJA 3SO6A 4IOYX 2LKOA 1IRSA 3AU5A 3TCAA 2D9WA 4HAYB 2DFKA 4HB2B 2V76A 1OY2A 1NTVA 1UEFA 5D3XA 4IAPA 2G35A 3GYOA 5JHHA 1P3RA 1MIXA 1ZM0A 3CXBB 4PQ0A 4TYZA 3TFMA 1M7EA 1U5GA 2DHJA 3QWMA 4A5KA 3D8DA 1FHOA 1DROA 1BTNA 1K5DB 2RSGA 3DXEA 1PMSA 1RJ2A 2DN6A 1DDVA 4KHAA 1MKEA 1SHCA 3KSYA 1GG3A 2YS3A 3O96A 4GPTB 5FI1A 2IFSA 2J59M 3P6AA 4HAWB 4DXAB 2ZPYA 1ZSQA 3HW2B 5CLQB 1DDMA 2ADZA 2PZ1A 1XCGA 3PZDA 3NSUA 1X1FA 4Z2NA 2K2JA 2FJLA 2RNRB 1V5MA 1QQGA 2AL6A 1RRPB 5KQ4A 2R09A 1Y5OA 5DI9B 3KRWA 5JLJB 3PVUA 3HQCA 3OANA 3FM8C 3PVLA 3DXCA 2M38A 2CY4A 3QIJA 2ROVA 4K81A 3VOQA 1DDWA 1I7AA 1E5WA 3PP2A 4HDOA 5J3TA 4NY0A 2GCJA 2XQNM 4GZUA 3SYXA 1OQNA 1V5UA 2EJ8A 2LG1A 1ISNA 2GCLA 3G9WA 2D11A 4IFSA 2X18A 2YSZA 3KZ1A 1K5GB 1NI2A 1FAOA 3LJUX 3ULCA 1AWEA 2ROZB 4EMOA 4WSFA 5C79A 5D3YA 2DX1A 2LOXA 2KCJA 2D9YA 2CAYA 1ZC4B 2R0DA 2W2WA 2CY5A 3IVFA 1XR0B 2LYDA 1XODA 1LW3A 4KVGB 3A8QA 1U5FA 2ELAA 1U29A 1UNQA 4YL8A 2RVBB 3MDBC 2I5FA 2Q13A 1NTYA 2GS0A 3WYFB 1FHWA 4A6HA 2N23A 1KZ7A 3M1IB 3ZVRA 2CRFA 5GOWB 2QKMA 4HB3B 1U5DA 2EMSA 3QBVB 2D9ZA 4KHBB 2RGNB 2NMBA 2Z0OA 2YT1A 3V5WA 4F7HA 1TJ6A 4CHMA 1P6SA 5HE2A 4K17A 4MK0A 5HE0A 4CHJA 1WI1A 4GXBA 5D27A 3DXDA 3BINA 2UVMA 2Y8GA 2RLOA 2DKPA 4NSWA 4HAXB 5EFXA 5KQ1A 4C0AA 2NZ8B 2MFQA 1H4RA 4HB4B 5DHAB 1WJ1A 1X05A 3F0WA 4HAUB 2W2XD 4ZRKA 2OTXA 1DYNA 2K2UA 4DX90 5J3YA 1UPQA 2ELBA 1U2BA 1EAZA 4CYEA 1W1DA 2J0KA 2I1KA 2JP2A 3WA0A 2UZSA 2COAA 3ODXA 3PG7A 1MK7B 1UPRA 2H7DA 1FB8A 2QKLA 4F7GA 5C16A 2DX5A 3BJIA 5D3WA 3TW1A 1OMWA 2EC1A 1NU2A 3F5RA 4F7UP 2D9VA 1X1GA 2P0DA 3CIKA 5DIFB 5LONB 1EGXA 5CLLB 2DHIA 3RCPA 2L2IA 5FI0A 1U27A 4HB0B 1EF1A 2Z0QA 4D0NB 1I2HA 4PNKA 3ULBA 2VSZA 2H7EA 1BWNA 5C5BB 5JHGA 1MIZB 2D2QA 5HE3A 4H8SA 1FOEA 4EKUA 3T06A 2KUPA 1J0WA 2D4QA 3D8EA 2L1CA 4WJ7A 1KZGA 5LOPB 3TVVA 2E2XA 1ZC3B 4L6EA 2DYQA 1EVHA 3P7ZA 2YS1A 2KGXB 3HK0A 2DHKA 2M14A 3A8PA 3PSCA 3SNHA 1U5EA 4MY6A 2LOZA 3ZDTA 4GN1A 1PFJA 4Z2MB 1TQZA 2RUKB 1X86A 2CODA 1B55A 2MWNB 2P0HA 3U8ZA 5C6RA 4B6HA 4EJNA 2N0YA 1UNPA 1WGUA 2Y8FA 4GMXB 3VIAA 3U7DA 4DBBA 2D9XA 1FGZA 2DLWA 2J0MA 3FSSA 4TKNA 1WGQA 1X11A 1V5PA 4HAVB 1KI1B 1XX0A 1DBHA 2YT0A 2Z0PA 2DTCA 2LULA 3TO1A 1WJMA 5L81A 2DKQA 5C5BA 4GMVA 2VRWB 4WVFB 1W1GA 2DA0A 2EMTA 4A6KA 3ODOA 4XWXA 1WG7A 2UZRA 3MPXA 4DX8A 4P7IA 2Y7BA 4K2PA 2MDXA 5KCVA 4HAZB 1MPHA 1M7RA 4KAXB
chains in the Genus database with same CATH superfamily
1V88A 4A6FB 2I5CA 5JP4A 1WVHA 1XD4A 2YF0A 3AJ4A 2W2XC 1QC6A 4HDQA 4HATB 1ZVRA 4KHOA 1V61A 3ODWA 3ML4A 2YRYA 3SUZA 4K2OA 1SGHA 3PEGA 1TXDA 2MKRA 3KRXA 2VKIA 3FEHA 1LB1A 1PLSA 5DHFB 2FJUB 1GC6A 3D8FA 1Q67A 2COCA 2HE7A 1AQCA 2HTHB 4HHVA 5DH9B 3AU4A 3X23A 3DCXA 2IYBA 1FHXA 1FGYA 1XKEA 2COFA 1J19A 3PVWA 2BCJA 2K00A 4BBKA 2YS5A 3GYPA 2I1JA 1BTKA 5D3VA 2J0JA 1N3HA 4ZRIA 1V89A 3N7CA 2P0FA 2D10A 4Y94A 1GC7A 2OQBA 1W1HA 1P5TA 4MT7A 4YONA 1Z87A 2DYNA 2YVCA 4DIXA 1UNRA 1MK9B 1Y19B 4A6FA 3KY9A 1BAKA 3UZTA 1MAIA 3SV1A 2P8VA 5HE1A 2GJYA 5J3QA 1H10A 2AEHA 3A98B 4ZRJA 3SO6A 4IOYX 3NW8A 2LKOA 5I2MA 1IRSA 3AU5A 3TCAA 2D9WA 4HAYB 2DFKA 4HB2B 2Z59A 2V76A 1OY2A 1NTVA 1UEFA 5D3XA 4IAPA 2G35A 5IRSA 3GYOA 5JHHA 1T77A 1P3RA 1MIXA 1ZM0A 3CXBB 4PQ0A 4TYZA 3TFMA 1M7EA 1U5GA 2KIEA 2DHJA 3QWMA 4A5KA 3D8DA 1FHOA 4QJ4B 1DROA 1BTNA 4GOUA 2K8EA 1K5DB 2RSGA 1MI1A 3DXEA 1PMSA 1RJ2A 4HSIA 2DN6A 1DDVA 4KHAA 1MKEA 1SHCA 1GG3A 3KSYA 2YS3A 3O96A 4GPTB 5FI1A 2IFSA 2J59M 3P6AA 4HAWB 4DXAB 2ZPYA 1ZSQA 3HW2B 5CLQB 1DDMA 2ADZA 2PZ1A 1XCGA 3PZDA 3NSUA 4D6WA 1X1FA 4Z2NA 2K2JA 2FJLA 4OT1A 2RNRB 1V5MA 1QQGA 2AL6A 1RRPB 5KQ4A 2R09A 1Y5OA 5DI9B 3KRWA 4L1RA 5JLJB 3PVUA 3HQCA 3OANA 3FM8C 3PVLA 2Z13A 3DXCA 2Z4DA 2M38A 3HSAA 2CY4A 1ZYIA 3QIJA 2ROVA 4K81A 3VOQA 1DDWA 1I7AA 1E5WA 3PP2A 4HDOA 5J3TA 4NY0A 2GCJA 2XQNM 4GZUA 3HIEA 3SYXA 1OQNA 1V5UA 2EJ8A 2LG1A 1ISNA 2GCLA 3G9WA 2D11A 4IFSA 2Z14A 2X18A 2YSZA 3KZ1A 1K5GB 1NI2A 3FVCA 1FAOA 3LJUX 3ULCA 1AWEA 2ROZB 4EMOA 4WSFA 5C79A 5D3YA 2GUMA 2DX1A 2LOXA 2KCJA 2D9YA 2CAYA 5I2SA 1ZC4B 2R0DA 2W2WA 2CY5A 3IVFA 1XR0B 2LYDA 1XODA 1LW3A 4KVGB 3A8QA 1U5FA 2ELAA 1U29A 1UNQA 4YL8A 2RVBB 3MDBC 2I5FA 2Q13A 1NTYA 2GS0A 3WYFB 4QJ3B 1FHWA 4A6HA 2N23A 1KZ7A 3M1IB 3ZVRA 2CRFA 5GOWB 2QKMA 4HB3B 1U5DA 2EMSA 3QBVB 2D9ZA 4KHBB 2RGNB 2NMBA 2Z0OA 2ZKMX 2YT1A 3V5WA 4F7HA 1TJ6A 4CHMA 1P6SA 5HE2A 4K17A 4MK0A 5HE0A 4CHJA 1WI1A 4GXBA 5D27A 3DXDA 3BINA 2UVMA 2Y8GA 4CSQA 4OSNA 2RLOA 2DKPA 4NSWA 4HAXB 5EFXA 5KQ1A 4C0AA 2KR0A 2NZ8B 2MFQA 1H4RA 4HB4B 5DHAB 4GNKB 1WJ1A 1X05A 3F0WA 4HAUB 2W2XD 4ZRKA 2OTXA 1DYNA 2K2UA 4DX90 5J3YA 1UPQA 2ELBA 1U2BA 1EAZA 4CYEA 1W1DA 2J0KA 2I1KA 2JP2A 3WA0A 2UZSA 2COAA 3ODXA 3PG7A 1MK7B 3OHMB 1UPRA 2H7DA 1FB8A 2QKLA 4F7GA 5C16A 2DX5A 3BJIA 5D3WA 3TW1A 1OMWA 2EC1A 1NU2A 2R2YA 3F5RA 4F7UP 3NWDA 2D9VA 2NBVA 1X1GA 2P0DA 3CIKA 5DIFB 4QJ5B 5LONB 5CLLB 2DHIA 1EGXA 4KHBA 3RCPA 3U12A 2L2IA 5FI0A 1U27A 4HB0B 1EF1A 2Z0QA 4D0NB 1I2HA 4PNKA 3ULBA 2VSZA 2H7EA 1BWNA 5C5BB 5JHGA 1MIZB 2D2QA 5HE3A 4H8SA 1FOEA 4EKUA 3T06A 5M4YB 2KUPA 1J0WA 2D4QA 3D8EA 2L1CA 4WJ7A 1KZGA 5LOPB 3TVVA 2E2XA 1ZC3B 4L6EA 2DYQA 1EVHA 2KGXB 2YS1A 3P7ZA 3HK0A 2DHKA 2M14A 3A8PA 3PSCA 3SNHA 1U5EA 2KIGA 4MY6A 2LOZA 3ZDTA 4GN1A 1PFJA 4Z2MB 1TQZA 2RUKB 1X86A 2CODA 1B55A 2MWNB 3A58A 2P0HA 3U8ZA 5C6RA 4B6HA 4EJNA 2N0YA 1UNPA 1WGUA 2Y8FA 4GMXB 3VIAA 3U7DA 4QXAB 4DBBA 2D9XA 1FGZA 2DLWA 2J0MA 3FSSA 4TKNA 2K49A 1WGQA 1X11A 1V5PA 4HAVB 1KI1B 1XX0A 3NWFA 3B77A 1DBHA 2YT0A 2Z0PA 2DTCA 2KUQA 2LULA 3TO1A 1WJMA 5L81A 2DKQA 5C5BA 4GMVA 2VRWB 4WVFB 1W1GA 2RRFA 2DA0A 2EMTA 4A6KA 3NWAA 3ODOA 4XWXA 1WG7A 2UZRA 3MPXA 4DX8A 4P7IA 2YT2A 2Y7BA 4K2PA 2MDXA 5KCVA 4HAZB 1MPHA 1M7RA 4KAXB 5LG4B
chains in the Genus database with same CATH topology
1V88A 4A6FB 2I5CA 5JP4A 1WVHA 1XD4A 2YF0A 3AJ4A 2W2XC 1QC6A 4HDQA 4HATB 1ZVRA 4KHOA 1V61A 3ODWA 3ML4A 2YRYA 3SUZA 4K2OA 1SGHA 3PEGA 1TXDA 2MKRA 3KRXA 2VKIA 3FEHA 1LB1A 1PLSA 5DHFB 1GC6A 3D8FA 1Q67A 2COCA 2HE7A 1AQCA 2HTHB 4HHVA 5DH9B 3AU4A 3X23A 2IYBA 1FHXA 1FGYA 1XKEA 2COFA 1J19A 3PVWA 2BCJA 2K00A 4BBKA 2YS5A 3GYPA 2I1JA 1BTKA 5D3VA 2J0JA 1N3HA 4ZRIA 1V89A 3N7CA 2P0FA 2D10A 4Y94A 1GC7A 2OQBA 1W1HA 1P5TA 4MT7A 4YONA 1Z87A 2DYNA 2YVCA 1UNRA 1MK9B 1Y19B 4A6FA 3KY9A 1BAKA 3UZTA 1MAIA 3SV1A 2P8VA 5HE1A 2GJYA 5J3QA 1H10A 2AEHA 3A98B 4ZRJA 3SO6A 4IOYX 2LKOA 1IRSA 3AU5A 3TCAA 2D9WA 4HAYB 2DFKA 4HB2B 2V76A 1OY2A 1NTVA 1UEFA 5D3XA 4IAPA 2G35A 3GYOA 5JHHA 1P3RA 1MIXA 1ZM0A 3CXBB 4PQ0A 4TYZA 3TFMA 1M7EA 1U5GA 2DHJA 3QWMA 4A5KA 3D8DA 1FHOA 1DROA 1BTNA 1K5DB 2RSGA 3DXEA 1PMSA 1RJ2A 2DN6A 1DDVA 4KHAA 1MKEA 1SHCA 3KSYA 1GG3A 2YS3A 3O96A 4GPTB 5FI1A 2IFSA 2J59M 3P6AA 4HAWB 4DXAB 2ZPYA 1ZSQA 3HW2B 5CLQB 1DDMA 2ADZA 2PZ1A 1XCGA 3PZDA 3NSUA 1X1FA 4Z2NA 2K2JA 2FJLA 2RNRB 1V5MA 1QQGA 2AL6A 1RRPB 5KQ4A 2R09A 1Y5OA 5DI9B 3KRWA 5JLJB 3PVUA 3HQCA 3OANA 3FM8C 3PVLA 3DXCA 2M38A 2CY4A 3QIJA 2ROVA 4K81A 3VOQA 1DDWA 1I7AA 1E5WA 3PP2A 4HDOA 5J3TA 4NY0A 2GCJA 2XQNM 4GZUA 3SYXA 1OQNA 1V5UA 2EJ8A 2LG1A 1ISNA 2GCLA 3G9WA 2D11A 4IFSA 2X18A 2YSZA 3KZ1A 1K5GB 1NI2A 1FAOA 3LJUX 3ULCA 1AWEA 2ROZB 4EMOA 4WSFA 5C79A 5D3YA 2DX1A 2LOXA 2KCJA 2D9YA 2CAYA 1ZC4B 2R0DA 2W2WA 2CY5A 3IVFA 1XR0B 2LYDA 1XODA 1LW3A 4KVGB 3A8QA 1U5FA 2ELAA 1U29A 1UNQA 4YL8A 2RVBB 3MDBC 2I5FA 2Q13A 1NTYA 2GS0A 3WYFB 1FHWA 4A6HA 2N23A 1KZ7A 3M1IB 3ZVRA 2CRFA 5GOWB 2QKMA 4HB3B 1U5DA 2EMSA 3QBVB 2D9ZA 4KHBB 2RGNB 2NMBA 2Z0OA 2YT1A 3V5WA 4F7HA 1TJ6A 4CHMA 1P6SA 5HE2A 4K17A 4MK0A 5HE0A 4CHJA 1WI1A 4GXBA 5D27A 3DXDA 3BINA 2UVMA 2Y8GA 2RLOA 2DKPA 4NSWA 4HAXB 5EFXA 5KQ1A 4C0AA 2NZ8B 2MFQA 1H4RA 4HB4B 5DHAB 1WJ1A 1X05A 3F0WA 4HAUB 2W2XD 4ZRKA 2OTXA 1DYNA 2K2UA 4DX90 5J3YA 1UPQA 2ELBA 1U2BA 1EAZA 4CYEA 1W1DA 2J0KA 2I1KA 2JP2A 3WA0A 2UZSA 2COAA 3ODXA 3PG7A 1MK7B 1UPRA 2H7DA 1FB8A 2QKLA 4F7GA 5C16A 2DX5A 3BJIA 5D3WA 3TW1A 1OMWA 2EC1A 1NU2A 3F5RA 4F7UP 2D9VA 1X1GA 2P0DA 3CIKA 5DIFB 5LONB 1EGXA 5CLLB 2DHIA 3RCPA 2L2IA 5FI0A 1U27A 4HB0B 1EF1A 2Z0QA 4D0NB 1I2HA 4PNKA 3ULBA 2VSZA 2H7EA 1BWNA 5C5BB 5JHGA 1MIZB 2D2QA 5HE3A 4H8SA 1FOEA 4EKUA 3T06A 2KUPA 1J0WA 2D4QA 3D8EA 2L1CA 4WJ7A 1KZGA 5LOPB 3TVVA 2E2XA 1ZC3B 4L6EA 2DYQA 1EVHA 3P7ZA 2YS1A 2KGXB 3HK0A 2DHKA 2M14A 3A8PA 3PSCA 3SNHA 1U5EA 4MY6A 2LOZA 3ZDTA 4GN1A 1PFJA 4Z2MB 1TQZA 2RUKB 1X86A 2CODA 1B55A 2MWNB 2P0HA 3U8ZA 5C6RA 4B6HA 4EJNA 2N0YA 1UNPA 1WGUA 2Y8FA 4GMXB 3VIAA 3U7DA 4DBBA 2D9XA 1FGZA 2DLWA 2J0MA 3FSSA 4TKNA 1WGQA 1X11A 1V5PA 4HAVB 1KI1B 1XX0A 1DBHA 2YT0A 2Z0PA 2DTCA 2LULA 3TO1A 1WJMA 5L81A 2DKQA 5C5BA 4GMVA 2VRWB 4WVFB 1W1GA 2DA0A 2EMTA 4A6KA 3ODOA 4XWXA 1WG7A 2UZRA 3MPXA 4DX8A 4P7IA 2Y7BA 4K2PA 2MDXA 5KCVA 4HAZB 1MPHA 1M7RA 4KAXB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1V88 A;  4A6F B;  2I5C A;  5JP4 A;  1WVH A;  1XD4 A;  2YF0 A;  3AJ4 A;  2W2X C;  1QC6 A;  4HDQ A;  4HAT B;  1ZVR A;  4KHO A;  1V61 A;  3ODW A;  3ML4 A;  2YRY A;  3SUZ A;  4K2O A;  1SGH A;  3PEG A;  1TXD A;  2MKR A;  3KRX A;  2VKI A;  3FEH A;  1LB1 A;  1PLS A;  5DHF B;  1GC6 A;  3D8F A;  1Q67 A;  2COC A;  2HE7 A;  1AQC A;  2HTH B;  4HHV A;  5DH9 B;  3AU4 A;  3X23 A;  2IYB A;  1FHX A;  1FGY A;  1XKE A;  2COF A;  1J19 A;  3PVW A;  2BCJ A;  2K00 A;  4BBK A;  2YS5 A;  3GYP A;  2I1J A;  1BTK A;  5D3V A;  2J0J A;  1N3H A;  4ZRI A;  1V89 A;  3N7C A;  2P0F A;  2D10 A;  4Y94 A;  1GC7 A;  2OQB A;  1W1H A;  1P5T A;  4MT7 A;  4YON A;  1Z87 A;  2DYN A;  2YVC A;  1UNR A;  1MK9 B;  1Y19 B;  4A6F A;  3KY9 A;  1BAK A;  3UZT A;  1MAI A;  3SV1 A;  2P8V A;  5HE1 A;  2GJY A;  5J3Q A;  1H10 A;  2AEH A;  3A98 B;  4ZRJ A;  3SO6 A;  4IOY X;  2LKO A;  1IRS A;  3AU5 A;  3TCA A;  2D9W A;  4HAY B;  2DFK A;  4HB2 B;  2V76 A;  1OY2 A;  1NTV A;  1UEF A;  5D3X A;  4IAP A;  2G35 A;  3GYO A;  5JHH A;  1P3R A;  1MIX A;  1ZM0 A;  3CXB B;  4PQ0 A;  4TYZ A;  3TFM A;  1M7E A;  1U5G A;  2DHJ A;  3QWM A;  4A5K A;  3D8D A;  1FHO A;  1DRO A;  1BTN A;  1K5D B;  2RSG A;  3DXE A;  1PMS A;  1RJ2 A;  2DN6 A;  1DDV A;  4KHA A;  1MKE A;  1SHC A;  3KSY A;  1GG3 A;  2YS3 A;  3O96 A;  4GPT B;  5FI1 A;  2IFS A;  2J59 M;  3P6A A;  4HAW B;  4DXA B;  2ZPY A;  1ZSQ A;  3HW2 B;  5CLQ B;  1DDM A;  2ADZ A;  2PZ1 A;  1XCG A;  3PZD A;  3NSU A;  1X1F A;  4Z2N A;  2K2J A;  2FJL A;  2RNR B;  1V5M A;  1QQG A;  2AL6 A;  1RRP B;  5KQ4 A;  2R09 A;  1Y5O A;  5DI9 B;  3KRW A;  5JLJ B;  3PVU A;  3HQC A;  3OAN A;  3FM8 C;  3PVL A;  3DXC A;  2M38 A;  2CY4 A;  3QIJ A;  2ROV A;  4K81 A;  3VOQ A;  1DDW A;  1I7A A;  1E5W A;  3PP2 A;  4HDO A;  5J3T A;  4NY0 A;  2GCJ A;  2XQN M;  4GZU A;  3SYX A;  1OQN A;  1V5U A;  2EJ8 A;  2LG1 A;  1ISN A;  2GCL A;  3G9W A;  2D11 A;  4IFS A;  2X18 A;  2YSZ A;  3KZ1 A;  1K5G B;  1NI2 A;  1FAO A;  3LJU X;  3ULC A;  1AWE A;  2ROZ B;  4EMO A;  4WSF A;  5C79 A;  5D3Y A;  2DX1 A;  2LOX A;  2KCJ A;  2D9Y A;  2CAY A;  1ZC4 B;  2R0D A;  2W2W A;  2CY5 A;  3IVF A;  1XR0 B;  2LYD A;  1XOD A;  1LW3 A;  4KVG B;  3A8Q A;  1U5F A;  2ELA A;  1U29 A;  1UNQ A;  4YL8 A;  2RVB B;  3MDB C;  2I5F A;  2Q13 A;  1NTY A;  2GS0 A;  3WYF B;  1FHW A;  4A6H A;  2N23 A;  1KZ7 A;  3M1I B;  3ZVR A;  2CRF A;  5GOW B;  2QKM A;  4HB3 B;  1U5D A;  2EMS A;  3QBV B;  2D9Z A;  4KHB B;  2RGN B;  2NMB A;  2Z0O A;  2YT1 A;  3V5W A;  4F7H A;  1TJ6 A;  4CHM A;  1P6S A;  5HE2 A;  4K17 A;  4MK0 A;  5HE0 A;  4CHJ A;  1WI1 A;  4GXB A;  5D27 A;  3DXD A;  3BIN A;  2UVM A;  2Y8G A;  2RLO A;  2DKP A;  4NSW A;  4HAX B;  5EFX A;  5KQ1 A;  4C0A A;  2NZ8 B;  2MFQ A;  1H4R A;  4HB4 B;  5DHA B;  1WJ1 A;  1X05 A;  3F0W A;  4HAU B;  2W2X D;  4ZRK A;  2OTX A;  1DYN A;  2K2U A;  4DX9 0;  5J3Y A;  1UPQ A;  2ELB A;  1U2B A;  1EAZ A;  4CYE A;  1W1D A;  2J0K A;  2I1K A;  2JP2 A;  3WA0 A;  2UZS A;  2COA A;  3ODX A;  3PG7 A;  1MK7 B;  1UPR A;  2H7D A;  1FB8 A;  2QKL A;  4F7G A;  5C16 A;  2DX5 A;  3BJI A;  5D3W A;  3TW1 A;  1OMW A;  2EC1 A;  1NU2 A;  3F5R A;  4F7U P;  2D9V A;  1X1G A;  2P0D A;  3CIK A;  5DIF B;  5LON B;  1EGX A;  5CLL B;  2DHI A;  3RCP A;  2L2I A;  5FI0 A;  1U27 A;  4HB0 B;  1EF1 A;  2Z0Q A;  4D0N B;  1I2H A;  4PNK A;  3ULB A;  2VSZ A;  2H7E A;  1BWN A;  5C5B B;  5JHG A;  1MIZ B;  2D2Q A;  5HE3 A;  4H8S A;  1FOE A;  4EKU A;  3T06 A;  2KUP A;  1J0W A;  2D4Q A;  3D8E A;  2L1C A;  4WJ7 A;  1KZG A;  5LOP B;  3TVV A;  2E2X A;  1ZC3 B;  4L6E A;  2DYQ A;  1EVH A;  3P7Z A;  2YS1 A;  2KGX B;  3HK0 A;  2DHK A;  2M14 A;  3A8P A;  3PSC A;  3SNH A;  1U5E A;  4MY6 A;  2LOZ A;  3ZDT A;  4GN1 A;  1PFJ A;  4Z2M B;  1TQZ A;  2RUK B;  1X86 A;  2COD A;  1B55 A;  2MWN B;  2P0H A;  3U8Z A;  5C6R A;  4B6H A;  4EJN A;  2N0Y A;  1UNP A;  1WGU A;  2Y8F A;  4GMX B;  3VIA A;  3U7D A;  4DBB A;  2D9X A;  1FGZ A;  2DLW A;  2J0M A;  3FSS A;  4TKN A;  1WGQ A;  1X11 A;  1V5P A;  4HAV B;  1KI1 B;  1XX0 A;  1DBH A;  2YT0 A;  2Z0P A;  2DTC A;  2LUL A;  3TO1 A;  1WJM A;  5L81 A;  2DKQ A;  5C5B A;  4GMV A;  2VRW B;  4WVF B;  1W1G A;  2DA0 A;  2EMT A;  4A6K A;  3ODO A;  4XWX A;  1WG7 A;  2UZR A;  3MPX A;  4DX8 A;  4P7I A;  2Y7B A;  4K2P A;  2MDX A;  5KCV A;  4HAZ B;  1MPH A;  1M7R A;  4KAX B; 
#chains in the Genus database with same CATH topology
 1V88 A;  4A6F B;  2I5C A;  5JP4 A;  1WVH A;  1XD4 A;  2YF0 A;  3AJ4 A;  2W2X C;  1QC6 A;  4HDQ A;  4HAT B;  1ZVR A;  4KHO A;  1V61 A;  3ODW A;  3ML4 A;  2YRY A;  3SUZ A;  4K2O A;  1SGH A;  3PEG A;  1TXD A;  2MKR A;  3KRX A;  2VKI A;  3FEH A;  1LB1 A;  1PLS A;  5DHF B;  2FJU B;  1GC6 A;  3D8F A;  1Q67 A;  2COC A;  2HE7 A;  1AQC A;  2HTH B;  4HHV A;  5DH9 B;  3AU4 A;  3X23 A;  3DCX A;  2IYB A;  1FHX A;  1FGY A;  1XKE A;  2COF A;  1J19 A;  3PVW A;  2BCJ A;  2K00 A;  4BBK A;  2YS5 A;  3GYP A;  2I1J A;  1BTK A;  5D3V A;  2J0J A;  1N3H A;  4ZRI A;  1V89 A;  3N7C A;  2P0F A;  2D10 A;  4Y94 A;  1GC7 A;  2OQB A;  1W1H A;  1P5T A;  4MT7 A;  4YON A;  1Z87 A;  2DYN A;  2YVC A;  4DIX A;  1UNR A;  1MK9 B;  1Y19 B;  4A6F A;  3KY9 A;  1BAK A;  3UZT A;  1MAI A;  3SV1 A;  2P8V A;  5HE1 A;  2GJY A;  5J3Q A;  1H10 A;  2AEH A;  3A98 B;  4ZRJ A;  3SO6 A;  4IOY X;  3NW8 A;  2LKO A;  5I2M A;  1IRS A;  3AU5 A;  3TCA A;  2D9W A;  4HAY B;  2DFK A;  4HB2 B;  2Z59 A;  2V76 A;  1OY2 A;  1NTV A;  1UEF A;  5D3X A;  4IAP A;  2G35 A;  5IRS A;  3GYO A;  5JHH A;  1T77 A;  1P3R A;  1MIX A;  1ZM0 A;  3CXB B;  4PQ0 A;  4TYZ A;  3TFM A;  1M7E A;  1U5G A;  2KIE A;  2DHJ A;  3QWM A;  4A5K A;  3D8D A;  1FHO A;  4QJ4 B;  1DRO A;  1BTN A;  4GOU A;  2K8E A;  1K5D B;  2RSG A;  1MI1 A;  3DXE A;  1PMS A;  1RJ2 A;  4HSI A;  2DN6 A;  1DDV A;  4KHA A;  1MKE A;  1SHC A;  1GG3 A;  3KSY A;  2YS3 A;  3O96 A;  4GPT B;  5FI1 A;  2IFS A;  2J59 M;  3P6A A;  4HAW B;  4DXA B;  2ZPY A;  1ZSQ A;  3HW2 B;  5CLQ B;  1DDM A;  2ADZ A;  2PZ1 A;  1XCG A;  3PZD A;  3NSU A;  4D6W A;  1X1F A;  4Z2N A;  2K2J A;  2FJL A;  4OT1 A;  2RNR B;  1V5M A;  1QQG A;  2AL6 A;  1RRP B;  5KQ4 A;  2R09 A;  1Y5O A;  5DI9 B;  3KRW A;  4L1R A;  5JLJ B;  3PVU A;  3HQC A;  3OAN A;  3FM8 C;  3PVL A;  2Z13 A;  3DXC A;  2Z4D A;  2M38 A;  3HSA A;  2CY4 A;  1ZYI A;  3QIJ A;  2ROV A;  4K81 A;  3VOQ A;  1DDW A;  1I7A A;  1E5W A;  3PP2 A;  4HDO A;  5J3T A;  4NY0 A;  2GCJ A;  2XQN M;  4GZU A;  3HIE A;  3SYX A;  1OQN A;  1V5U A;  2EJ8 A;  2LG1 A;  1ISN A;  2GCL A;  3G9W A;  2D11 A;  4IFS A;  2Z14 A;  2X18 A;  2YSZ A;  3KZ1 A;  1K5G B;  1NI2 A;  3FVC A;  1FAO A;  3LJU X;  3ULC A;  1AWE A;  2ROZ B;  4EMO A;  4WSF A;  5C79 A;  5D3Y A;  2GUM A;  2DX1 A;  2LOX A;  2KCJ A;  2D9Y A;  2CAY A;  5I2S A;  1ZC4 B;  2R0D A;  2W2W A;  2CY5 A;  3IVF A;  1XR0 B;  2LYD A;  1XOD A;  1LW3 A;  4KVG B;  3A8Q A;  1U5F A;  2ELA A;  1U29 A;  1UNQ A;  4YL8 A;  2RVB B;  3MDB C;  2I5F A;  2Q13 A;  1NTY A;  2GS0 A;  3WYF B;  4QJ3 B;  1FHW A;  4A6H A;  2N23 A;  1KZ7 A;  3M1I B;  3ZVR A;  2CRF A;  5GOW B;  2QKM A;  4HB3 B;  1U5D A;  2EMS A;  3QBV B;  2D9Z A;  4KHB B;  2RGN B;  2NMB A;  2Z0O A;  2ZKM X;  2YT1 A;  3V5W A;  4F7H A;  1TJ6 A;  4CHM A;  1P6S A;  5HE2 A;  4K17 A;  4MK0 A;  5HE0 A;  4CHJ A;  1WI1 A;  4GXB A;  5D27 A;  3DXD A;  3BIN A;  2UVM A;  2Y8G A;  4CSQ A;  4OSN A;  2RLO A;  2DKP A;  4NSW A;  4HAX B;  5EFX A;  5KQ1 A;  4C0A A;  2KR0 A;  2NZ8 B;  2MFQ A;  1H4R A;  4HB4 B;  5DHA B;  4GNK B;  1WJ1 A;  1X05 A;  3F0W A;  4HAU B;  2W2X D;  4ZRK A;  2OTX A;  1DYN A;  2K2U A;  4DX9 0;  5J3Y A;  1UPQ A;  2ELB A;  1U2B A;  1EAZ A;  4CYE A;  1W1D A;  2J0K A;  2I1K A;  2JP2 A;  3WA0 A;  2UZS A;  2COA A;  3ODX A;  3PG7 A;  1MK7 B;  3OHM B;  1UPR A;  2H7D A;  1FB8 A;  2QKL A;  4F7G A;  5C16 A;  2DX5 A;  3BJI A;  5D3W A;  3TW1 A;  1OMW A;  2EC1 A;  1NU2 A;  2R2Y A;  3F5R A;  4F7U P;  3NWD A;  2D9V A;  2NBV A;  1X1G A;  2P0D A;  3CIK A;  5DIF B;  4QJ5 B;  5LON B;  5CLL B;  2DHI A;  1EGX A;  4KHB A;  3RCP A;  3U12 A;  2L2I A;  5FI0 A;  1U27 A;  4HB0 B;  1EF1 A;  2Z0Q A;  4D0N B;  1I2H A;  4PNK A;  3ULB A;  2VSZ A;  2H7E A;  1BWN A;  5C5B B;  5JHG A;  1MIZ B;  2D2Q A;  5HE3 A;  4H8S A;  1FOE A;  4EKU A;  3T06 A;  5M4Y B;  2KUP A;  1J0W A;  2D4Q A;  3D8E A;  2L1C A;  4WJ7 A;  1KZG A;  5LOP B;  3TVV A;  2E2X A;  1ZC3 B;  4L6E A;  2DYQ A;  1EVH A;  2KGX B;  2YS1 A;  3P7Z A;  3HK0 A;  2DHK A;  2M14 A;  3A8P A;  3PSC A;  3SNH A;  1U5E A;  2KIG A;  4MY6 A;  2LOZ A;  3ZDT A;  4GN1 A;  1PFJ A;  4Z2M B;  1TQZ A;  2RUK B;  1X86 A;  2COD A;  1B55 A;  2MWN B;  3A58 A;  2P0H A;  3U8Z A;  5C6R A;  4B6H A;  4EJN A;  2N0Y A;  1UNP A;  1WGU A;  2Y8F A;  4GMX B;  3VIA A;  3U7D A;  4QXA B;  4DBB A;  2D9X A;  1FGZ A;  2DLW A;  2J0M A;  3FSS A;  4TKN A;  2K49 A;  1WGQ A;  1X11 A;  1V5P A;  4HAV B;  1KI1 B;  1XX0 A;  3NWF A;  3B77 A;  1DBH A;  2YT0 A;  2Z0P A;  2DTC A;  2KUQ A;  2LUL A;  3TO1 A;  1WJM A;  5L81 A;  2DKQ A;  5C5B A;  4GMV A;  2VRW B;  4WVF B;  1W1G A;  2RRF A;  2DA0 A;  2EMT A;  4A6K A;  3NWA A;  3ODO A;  4XWX A;  1WG7 A;  2UZR A;  3MPX A;  4DX8 A;  4P7I A;  2YT2 A;  2Y7B A;  4K2P A;  2MDX A;  5KCV A;  4HAZ B;  1MPH A;  1M7R A;  4KAX B;  5LG4 B; 
#chains in the Genus database with same CATH homology
 1V88 A;  4A6F B;  2I5C A;  5JP4 A;  1WVH A;  1XD4 A;  2YF0 A;  3AJ4 A;  2W2X C;  1QC6 A;  4HDQ A;  4HAT B;  1ZVR A;  4KHO A;  1V61 A;  3ODW A;  3ML4 A;  2YRY A;  3SUZ A;  4K2O A;  1SGH A;  3PEG A;  1TXD A;  2MKR A;  3KRX A;  2VKI A;  3FEH A;  1LB1 A;  1PLS A;  5DHF B;  1GC6 A;  3D8F A;  1Q67 A;  2COC A;  2HE7 A;  1AQC A;  2HTH B;  4HHV A;  5DH9 B;  3AU4 A;  3X23 A;  2IYB A;  1FHX A;  1FGY A;  1XKE A;  2COF A;  1J19 A;  3PVW A;  2BCJ A;  2K00 A;  4BBK A;  2YS5 A;  3GYP A;  2I1J A;  1BTK A;  5D3V A;  2J0J A;  1N3H A;  4ZRI A;  1V89 A;  3N7C A;  2P0F A;  2D10 A;  4Y94 A;  1GC7 A;  2OQB A;  1W1H A;  1P5T A;  4MT7 A;  4YON A;  1Z87 A;  2DYN A;  2YVC A;  1UNR A;  1MK9 B;  1Y19 B;  4A6F A;  3KY9 A;  1BAK A;  3UZT A;  1MAI A;  3SV1 A;  2P8V A;  5HE1 A;  2GJY A;  5J3Q A;  1H10 A;  2AEH A;  3A98 B;  4ZRJ A;  3SO6 A;  4IOY X;  2LKO A;  1IRS A;  3AU5 A;  3TCA A;  2D9W A;  4HAY B;  2DFK A;  4HB2 B;  2V76 A;  1OY2 A;  1NTV A;  1UEF A;  5D3X A;  4IAP A;  2G35 A;  3GYO A;  5JHH A;  1P3R A;  1MIX A;  1ZM0 A;  3CXB B;  4PQ0 A;  4TYZ A;  3TFM A;  1M7E A;  1U5G A;  2DHJ A;  3QWM A;  4A5K A;  3D8D A;  1FHO A;  1DRO A;  1BTN A;  1K5D B;  2RSG A;  3DXE A;  1PMS A;  1RJ2 A;  2DN6 A;  1DDV A;  4KHA A;  1MKE A;  1SHC A;  3KSY A;  1GG3 A;  2YS3 A;  3O96 A;  4GPT B;  5FI1 A;  2IFS A;  2J59 M;  3P6A A;  4HAW B;  4DXA B;  2ZPY A;  1ZSQ A;  3HW2 B;  5CLQ B;  1DDM A;  2ADZ A;  2PZ1 A;  1XCG A;  3PZD A;  3NSU A;  1X1F A;  4Z2N A;  2K2J A;  2FJL A;  2RNR B;  1V5M A;  1QQG A;  2AL6 A;  1RRP B;  5KQ4 A;  2R09 A;  1Y5O A;  5DI9 B;  3KRW A;  5JLJ B;  3PVU A;  3HQC A;  3OAN A;  3FM8 C;  3PVL A;  3DXC A;  2M38 A;  2CY4 A;  3QIJ A;  2ROV A;  4K81 A;  3VOQ A;  1DDW A;  1I7A A;  1E5W A;  3PP2 A;  4HDO A;  5J3T A;  4NY0 A;  2GCJ A;  2XQN M;  4GZU A;  3SYX A;  1OQN A;  1V5U A;  2EJ8 A;  2LG1 A;  1ISN A;  2GCL A;  3G9W A;  2D11 A;  4IFS A;  2X18 A;  2YSZ A;  3KZ1 A;  1K5G B;  1NI2 A;  1FAO A;  3LJU X;  3ULC A;  1AWE A;  2ROZ B;  4EMO A;  4WSF A;  5C79 A;  5D3Y A;  2DX1 A;  2LOX A;  2KCJ A;  2D9Y A;  2CAY A;  1ZC4 B;  2R0D A;  2W2W A;  2CY5 A;  3IVF A;  1XR0 B;  2LYD A;  1XOD A;  1LW3 A;  4KVG B;  3A8Q A;  1U5F A;  2ELA A;  1U29 A;  1UNQ A;  4YL8 A;  2RVB B;  3MDB C;  2I5F A;  2Q13 A;  1NTY A;  2GS0 A;  3WYF B;  1FHW A;  4A6H A;  2N23 A;  1KZ7 A;  3M1I B;  3ZVR A;  2CRF A;  5GOW B;  2QKM A;  4HB3 B;  1U5D A;  2EMS A;  3QBV B;  2D9Z A;  4KHB B;  2RGN B;  2NMB A;  2Z0O A;  2YT1 A;  3V5W A;  4F7H A;  1TJ6 A;  4CHM A;  1P6S A;  5HE2 A;  4K17 A;  4MK0 A;  5HE0 A;  4CHJ A;  1WI1 A;  4GXB A;  5D27 A;  3DXD A;  3BIN A;  2UVM A;  2Y8G A;  2RLO A;  2DKP A;  4NSW A;  4HAX B;  5EFX A;  5KQ1 A;  4C0A A;  2NZ8 B;  2MFQ A;  1H4R A;  4HB4 B;  5DHA B;  1WJ1 A;  1X05 A;  3F0W A;  4HAU B;  2W2X D;  4ZRK A;  2OTX A;  1DYN A;  2K2U A;  4DX9 0;  5J3Y A;  1UPQ A;  2ELB A;  1U2B A;  1EAZ A;  4CYE A;  1W1D A;  2J0K A;  2I1K A;  2JP2 A;  3WA0 A;  2UZS A;  2COA A;  3ODX A;  3PG7 A;  1MK7 B;  1UPR A;  2H7D A;  1FB8 A;  2QKL A;  4F7G A;  5C16 A;  2DX5 A;  3BJI A;  5D3W A;  3TW1 A;  1OMW A;  2EC1 A;  1NU2 A;  3F5R A;  4F7U P;  2D9V A;  1X1G A;  2P0D A;  3CIK A;  5DIF B;  5LON B;  1EGX A;  5CLL B;  2DHI A;  3RCP A;  2L2I A;  5FI0 A;  1U27 A;  4HB0 B;  1EF1 A;  2Z0Q A;  4D0N B;  1I2H A;  4PNK A;  3ULB A;  2VSZ A;  2H7E A;  1BWN A;  5C5B B;  5JHG A;  1MIZ B;  2D2Q A;  5HE3 A;  4H8S A;  1FOE A;  4EKU A;  3T06 A;  2KUP A;  1J0W A;  2D4Q A;  3D8E A;  2L1C A;  4WJ7 A;  1KZG A;  5LOP B;  3TVV A;  2E2X A;  1ZC3 B;  4L6E A;  2DYQ A;  1EVH A;  3P7Z A;  2YS1 A;  2KGX B;  3HK0 A;  2DHK A;  2M14 A;  3A8P A;  3PSC A;  3SNH A;  1U5E A;  4MY6 A;  2LOZ A;  3ZDT A;  4GN1 A;  1PFJ A;  4Z2M B;  1TQZ A;  2RUK B;  1X86 A;  2COD A;  1B55 A;  2MWN B;  2P0H A;  3U8Z A;  5C6R A;  4B6H A;  4EJN A;  2N0Y A;  1UNP A;  1WGU A;  2Y8F A;  4GMX B;  3VIA A;  3U7D A;  4DBB A;  2D9X A;  1FGZ A;  2DLW A;  2J0M A;  3FSS A;  4TKN A;  1WGQ A;  1X11 A;  1V5P A;  4HAV B;  1KI1 B;  1XX0 A;  1DBH A;  2YT0 A;  2Z0P A;  2DTC A;  2LUL A;  3TO1 A;  1WJM A;  5L81 A;  2DKQ A;  5C5B A;  4GMV A;  2VRW B;  4WVF B;  1W1G A;  2DA0 A;  2EMT A;  4A6K A;  3ODO A;  4XWX A;  1WG7 A;  2UZR A;  3MPX A;  4DX8 A;  4P7I A;  2Y7B A;  4K2P A;  2MDX A;  5KCV A;  4HAZ B;  1MPH A;  1M7R A;  4KAX B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...