1FGZA

Grp1 ph domain (unliganded)
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
127
structure length
127
Chain Sequence
TFFNPDREGWLLKLGGRVKTWKRRWFILTDNCLYYFEYTTDKEPRGIIPLENLSIREVLDPRKPNCFELYNPSHKGQVIKACKTEADGRVVEGNHVVYRISAPSPEEKEEWMKSIKASISRDPFYDM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords GRP1
publication title Structural basis of 3-phosphoinositide recognition by pleckstrin homology domains.
pubmed doi rcsb
source organism Mus musculus
molecule tags Signaling protein
total genus 20
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2000-07-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00169 PH PH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 1fgzA00
4PQ0A 5C6RA 2Q13A 5DHAB 4K17A 4HAZB 1U5DA 3CXBB 3BJIA 1GC7A 2ZPYA 2CAYA 2CY4A 2COAA 2DHKA 1I2HA 3F0WA 4Y94A 2D4QA 2CY5A 1U2BA 2HTHB 4F7GA 5HE1A 2DYQA 1P5TA 4A6FB 3QBVB 2HE7A 2ADZA 2D9XA 2J0MA 4MT7A 2G35A 3ODOA 2L2IA 2YSZA 4A6KA 2OQBA 2Y8GA 3KY9A 2LKOA 2P8VA 2DHIA 1Z87A 1FHWA 4GZUA 3PP2A 3VOQA 4C0AA 5LOPB 4MK0A 2RVBB 3BINA 2VRWB 5D3WA 3QIJA 4HAVB 1W1DA 2KUPA 2D11A 3NSUA 3A8PA 3U7DA 1FGYA 5EFXA 3A8QA 2XQNM 1M7RA 2J59M 2QKMA 1ZM0A 1WVHA 2W2XD 4Z2NA 4K2OA 4L6EA 2YS1A 4HB2B 5JLJB 2AL6A 1FAOA 2DTCA 5KQ4A 2KCJA 2P0DA 2L1CA 5J3QA 3AU5A 2DN6A 2UVMA 5D3VA 2V76A 1MAIA 4KHAA 2YS3A 1ZC3B 2P0FA 2ROVA 5D27A 2PZ1A 2ROZB 3OANA 5HE2A 1UEFA 2RUKB 2RLOA 3X23A 5CLQB 3AU4A 1MK9B 1NTYA 5C16A 1ZC4B 1XODA 2R0DA 4GMVA 1XD4A 2MKRA 4KHOA 1BTNA 3IVFA 3GYOA 1UPRA 2I1KA 1DBHA 4WJ7A 2EJ8A 3TW1A 3P7ZA 2EMTA 3KRWA 3TCAA 4DX90 4CYEA 2Z0OA 4YL8A 2YT0A 2DHJA 2I5FA 1OQNA 2YRYA 2D10A 1DROA 2GS0A 4TYZA 1XX0A 5CLLB 2IYBA 1OY2A 3PZDA 5DIFB 1QC6A 1U5FA 5J3YA 1FB8A 1QQGA 4EJNA 4GXBA 2MDXA 1UNPA 3D8DA 4EKUA 4HAXB 3PVLA 3HQCA 1J19A 2RNRB 3P6AA 1EF1A 5JHHA 2I5CA 3VIAA 2MFQA 4GN1A 2Y7BA 3ML4A 1ZVRA 1WG7A 4NY0A 1RJ2A 2R09A 1V5UA 3ODXA 3ZVRA 3ULBA 3KZ1A 1WJ1A 1V88A 2DKQA 1GC6A 1NTVA 5HE0A 1V5PA 1MK7B 5DH9B 2LOXA 4HAYB 4D0NB 4WSFA 2LOZA 2NZ8B 1LW3A 5FI0A 1W1HA 1J0WA 3GYPA 1EVHA 4DXAB 3D8EA 1FHXA 4IFSA 5C5BA 1PFJA 3DXDA 1UNRA 3HW2B 2COCA 2ELBA 3SNHA 4K81A 3SO6A 3MDBC 1GG3A 4KVGB 1EGXA 2UZRA 5D3YA 3ODWA 3SYXA 3CIKA 4CHMA 2MWNB 2YF0A 2YT1A 3DXEA 4HAUB 4HB4B 1H4RA 1PLSA 4XWXA 2NMBA 1BWNA 5FI1A 1WI1A 2N0YA 4TKNA 2COFA 3MPXA 3PEGA 4ZRJA 4HAWB 1UPQA 4Z2MB 3KSYA 5GOWB 2YS5A 4IOYX 2CODA 1LB1A 1W1GA 2DFKA 4BBKA 5JP4A 3SV1A 4PNKA 1TXDA 2GCLA 3A98B 2D9VA 2K00A 3PVWA 1PMSA 2GCJA 3U8ZA 1FGZA 3KRXA 1X86A 5LONB 1U29A 1K5GB 2RGNB 4NSWA 1FOEA 3M1IB 2VKIA 4F7HA 4KHBB 5HE3A 1M7EA 5JHGA 2DKPA 1EAZA 4MY6A 1DYNA 3RCPA 1X11A 5L81A 4KAXB 1X1GA 4A6FA 1ISNA 4DBBA 4DX8A 5J3TA 1SGHA 2D9WA 1N3HA 1P3RA 2I1JA 5D3XA 3WYFB 1AQCA 1XR0B 3AJ4A 2LYDA 1MIXA 1IRSA 4HDOA 1BTKA 1FHOA 2UZSA 1X1FA 1MPHA 2DLWA 1V61A 3FEHA 2FJLA 1U27A 4P7IA 2J0JA 2EMSA 1P6SA 1WJMA 3DXCA 2D2QA 2DX5A 2W2XC 1UNQA 2E2XA 1WGUA 2K2JA 1ZSQA 2CRFA 1DDVA 2Y8FA 2VSZA 5DI9B 1MIZB 4K2PA 1AWEA 2H7EA 5KCVA 1K5DB 1XCGA 4IAPA 4A5KA 3LJUX 4A6HA 2BCJA 1Q67A 1V89A 3FSSA 2Z0PA 4HATB 3G9WA 3D8FA 1E5WA 1Y19B 1U5GA 1WGQA 5KQ1A 1H10A 2IFSA 4F7UP 2JP2A 2H7DA 3UZTA 2DYNA 4CHJA 1OMWA 2DX1A 4B6HA 1NU2A 3WA0A 3O96A 2D9ZA 4HDQA 4ZRIA 1DDMA 3HK0A 3PVUA 5C5BB 2QKLA 3T06A 1MKEA 1BAKA 2Z0QA 3ZDTA 3TVVA 2ELAA 1DDWA 2K2UA 2RSGA 4HB3B 1V5MA 1SHCA 2J0KA 2DA0A 3QWMA 2YVCA 2X18A 1XKEA 4H8SA 5C79A 2EC1A 3F5RA 4GPTB 5DHFB 4HHVA 4GMXB 3ULCA 2AEHA 2N23A 1KZ7A 2P0HA 4ZRKA 3TFMA 2LULA 1KZGA 4HB0B 3FM8C 4EMOA 2M14A 2W2WA 2LG1A 3V5WA 3PG7A 2GJYA 1Y5OA 1X05A 3PSCA 3N7CA 2M38A 2KGXB 4WVFB 1B55A 3SUZA 1I7AA 1U5EA 3TO1A 1TQZA 1KI1B 1TJ6A 1RRPB 2OTXA 4YONA 2D9YA 1NI2A
chains in the Genus database with same CATH superfamily
3B77A 4PQ0A 5C6RA 2Q13A 5DHAB 4K17A 4HAZB 1U5DA 3CXBB 3BJIA 1GC7A 2ZPYA 2CAYA 3HSAA 2CY4A 2COAA 2DHKA 1I2HA 3F0WA 4Y94A 2D4QA 2CY5A 1U2BA 2HTHB 4F7GA 5HE1A 2DYQA 1P5TA 4A6FB 3QBVB 2HE7A 2ADZA 2D9XA 2J0MA 4MT7A 2G35A 3ODOA 2L2IA 2YSZA 4A6KA 2OQBA 2Y8GA 3KY9A 2K49A 2LKOA 2P8VA 3NW8A 2DHIA 1Z87A 1FHWA 4GZUA 3PP2A 3VOQA 4C0AA 5LOPB 4MK0A 2RVBB 3BINA 2VRWB 5D3WA 3HIEA 3QIJA 4HAVB 1W1DA 2KUPA 2D11A 3NSUA 3A8PA 3U7DA 1FGYA 2KIEA 5EFXA 3A8QA 2XQNM 1M7RA 2J59M 2QKMA 1ZM0A 1WVHA 2W2XD 4Z2NA 4K2OA 4L6EA 2YS1A 4HB2B 5JLJB 2AL6A 1FAOA 2DTCA 5KQ4A 2Z14A 2KCJA 2P0DA 2L1CA 5J3QA 3AU5A 2DN6A 2UVMA 5D3VA 2V76A 1MAIA 4KHAA 2YS3A 1ZC3B 2P0FA 2ROVA 5D27A 2PZ1A 2ROZB 3OANA 5HE2A 1UEFA 2RUKB 2RLOA 3X23A 5CLQB 3AU4A 1MK9B 1NTYA 5C16A 1ZC4B 1XODA 2R0DA 5IRSA 4GMVA 1XD4A 2MKRA 4KHOA 1BTNA 3IVFA 3GYOA 1UPRA 2I1KA 1DBHA 4CSQA 4WJ7A 2EJ8A 3TW1A 3P7ZA 2EMTA 3KRWA 3TCAA 4DX90 4CYEA 2Z0OA 1T77A 4YL8A 2YT0A 2DHJA 2I5FA 1OQNA 2YRYA 2D10A 1DROA 3NWDA 2KIGA 2GS0A 4TYZA 1XX0A 4QXAB 5CLLB 2IYBA 1MI1A 2Z4DA 1OY2A 3A58A 3PZDA 1QC6A 1U5FA 5DIFB 5J3YA 1FB8A 1QQGA 4EJNA 4GXBA 2GUMA 2Z59A 2MDXA 1UNPA 3D8DA 4DIXA 4EKUA 4HAXB 3PVLA 3HQCA 1J19A 2RNRB 3P6AA 1EF1A 5JHHA 2I5CA 3VIAA 2MFQA 4GN1A 2Y7BA 3ML4A 1ZVRA 1WG7A 4NY0A 1RJ2A 2R09A 1V5UA 4QJ5B 3ODXA 3ZVRA 3ULBA 3KZ1A 1WJ1A 1V88A 2DKQA 1GC6A 1NTVA 5HE0A 1V5PA 1MK7B 5DH9B 2LOXA 4HAYB 4D0NB 4WSFA 2LOZA 4HSIA 2NZ8B 4QJ4B 1LW3A 5FI0A 1W1HA 1J0WA 3GYPA 1EVHA 4DXAB 3D8EA 1FHXA 4IFSA 5C5BA 2ZKMX 1PFJA 3DXDA 1UNRA 3HW2B 2COCA 2ELBA 3SNHA 4K81A 4GNKB 3SO6A 3MDBC 1GG3A 2FJUB 4QJ3B 4KVGB 1EGXA 2UZRA 5D3YA 3ODWA 3SYXA 3CIKA 4CHMA 2RRFA 2MWNB 2YF0A 2YT1A 3DXEA 4HAUB 4HB4B 3NWAA 1H4RA 1PLSA 4XWXA 2NMBA 1BWNA 5FI1A 1WI1A 2N0YA 4TKNA 2COFA 3MPXA 3PEGA 4KHBA 4HAWB 1UPQA 4ZRJA 4Z2MB 3KSYA 5GOWB 2YS5A 4IOYX 2CODA 1LB1A 2R2YA 1W1GA 2DFKA 4BBKA 5JP4A 3SV1A 4PNKA 1TXDA 2GCLA 3A98B 2D9VA 2K00A 3PVWA 1PMSA 2GCJA 3U8ZA 1FGZA 3KRXA 1X86A 5LONB 1U29A 1K5GB 2NBVA 2RGNB 4NSWA 1FOEA 3M1IB 2VKIA 4F7HA 4KHBB 5HE3A 1M7EA 5JHGA 2DKPA 1ZYIA 1EAZA 2KR0A 4MY6A 1DYNA 3RCPA 1X11A 5L81A 4KAXB 1X1GA 4L1RA 4A6FA 1ISNA 2KUQA 4DBBA 4DX8A 5J3TA 1SGHA 2D9WA 4D6WA 1N3HA 1P3RA 2I1JA 5D3XA 3WYFB 1AQCA 2Z13A 1XR0B 3AJ4A 2LYDA 1MIXA 4OSNA 1IRSA 4HDOA 1BTKA 1FHOA 2UZSA 1X1FA 5LG4B 1MPHA 2DLWA 1V61A 3FEHA 2FJLA 1U27A 4P7IA 2J0JA 2EMSA 1P6SA 1WJMA 3DXCA 2D2QA 2DX5A 2W2XC 1UNQA 2E2XA 1WGUA 2K2JA 1ZSQA 2CRFA 1DDVA 2Y8FA 2VSZA 5I2MA 5DI9B 1MIZB 4K2PA 1AWEA 2H7EA 5KCVA 1K5DB 1XCGA 4IAPA 4A5KA 3LJUX 4A6HA 2BCJA 1Q67A 1V89A 3FSSA 2Z0PA 4HATB 3G9WA 3D8FA 1E5WA 1Y19B 1U5GA 1WGQA 5KQ1A 1H10A 3DCXA 2IFSA 4F7UP 3OHMB 2JP2A 2H7DA 3UZTA 2DYNA 4GOUA 4CHJA 1OMWA 2DX1A 4B6HA 1NU2A 3WA0A 3O96A 2D9ZA 4HDQA 2K8EA 4ZRIA 1DDMA 3HK0A 3PVUA 5C5BB 2QKLA 3T06A 1MKEA 4OT1A 2Z0QA 3ZDTA 5M4YB 1BAKA 3TVVA 2ELAA 1DDWA 2K2UA 2RSGA 4HB3B 1V5MA 1SHCA 2J0KA 2DA0A 3QWMA 2YVCA 3FVCA 2X18A 1XKEA 4H8SA 5C79A 2EC1A 3NWFA 3F5RA 4GPTB 5DHFB 5I2SA 4HHVA 4GMXB 3ULCA 2AEHA 2N23A 1KZ7A 2P0HA 4ZRKA 3TFMA 2LULA 1KZGA 4HB0B 3FM8C 4EMOA 2M14A 2W2WA 2LG1A 3V5WA 3PG7A 2GJYA 1Y5OA 1X05A 3PSCA 3N7CA 2M38A 2KGXB 2YT2A 4WVFB 1B55A 3SUZA 3U12A 1I7AA 1U5EA 3TO1A 1TQZA 1KI1B 1TJ6A 1RRPB 2OTXA 4YONA 2D9YA 1NI2A
chains in the Genus database with same CATH topology
4PQ0A 5C6RA 2Q13A 5DHAB 4K17A 4HAZB 1U5DA 3CXBB 3BJIA 1GC7A 2ZPYA 2CAYA 2CY4A 2COAA 2DHKA 1I2HA 3F0WA 4Y94A 2D4QA 2CY5A 1U2BA 2HTHB 4F7GA 5HE1A 2DYQA 1P5TA 4A6FB 3QBVB 2HE7A 2ADZA 2D9XA 2J0MA 4MT7A 2G35A 3ODOA 2L2IA 2YSZA 4A6KA 2OQBA 2Y8GA 3KY9A 2LKOA 2P8VA 2DHIA 1Z87A 1FHWA 4GZUA 3PP2A 3VOQA 4C0AA 5LOPB 4MK0A 2RVBB 3BINA 2VRWB 5D3WA 3QIJA 4HAVB 1W1DA 2KUPA 2D11A 3NSUA 3A8PA 3U7DA 1FGYA 5EFXA 3A8QA 2XQNM 1M7RA 2J59M 2QKMA 1ZM0A 1WVHA 2W2XD 4Z2NA 4K2OA 4L6EA 2YS1A 4HB2B 5JLJB 2AL6A 1FAOA 2DTCA 5KQ4A 2KCJA 2P0DA 2L1CA 5J3QA 3AU5A 2DN6A 2UVMA 5D3VA 2V76A 1MAIA 4KHAA 2YS3A 1ZC3B 2P0FA 2ROVA 5D27A 2PZ1A 2ROZB 3OANA 5HE2A 1UEFA 2RUKB 2RLOA 3X23A 5CLQB 3AU4A 1MK9B 1NTYA 5C16A 1ZC4B 1XODA 2R0DA 4GMVA 1XD4A 2MKRA 4KHOA 1BTNA 3IVFA 3GYOA 1UPRA 2I1KA 1DBHA 4WJ7A 2EJ8A 3TW1A 3P7ZA 2EMTA 3KRWA 3TCAA 4DX90 4CYEA 2Z0OA 4YL8A 2YT0A 2DHJA 2I5FA 1OQNA 2YRYA 2D10A 1DROA 2GS0A 4TYZA 1XX0A 5CLLB 2IYBA 1OY2A 3PZDA 5DIFB 1QC6A 1U5FA 5J3YA 1FB8A 1QQGA 4EJNA 4GXBA 2MDXA 1UNPA 3D8DA 4EKUA 4HAXB 3PVLA 3HQCA 1J19A 2RNRB 3P6AA 1EF1A 5JHHA 2I5CA 3VIAA 2MFQA 4GN1A 2Y7BA 3ML4A 1ZVRA 1WG7A 4NY0A 1RJ2A 2R09A 1V5UA 3ODXA 3ZVRA 3ULBA 3KZ1A 1WJ1A 1V88A 2DKQA 1GC6A 1NTVA 5HE0A 1V5PA 1MK7B 5DH9B 2LOXA 4HAYB 4D0NB 4WSFA 2LOZA 2NZ8B 1LW3A 5FI0A 1W1HA 1J0WA 3GYPA 1EVHA 4DXAB 3D8EA 1FHXA 4IFSA 5C5BA 1PFJA 3DXDA 1UNRA 3HW2B 2COCA 2ELBA 3SNHA 4K81A 3SO6A 3MDBC 1GG3A 4KVGB 1EGXA 2UZRA 5D3YA 3ODWA 3SYXA 3CIKA 4CHMA 2MWNB 2YF0A 2YT1A 3DXEA 4HAUB 4HB4B 1H4RA 1PLSA 4XWXA 2NMBA 1BWNA 5FI1A 1WI1A 2N0YA 4TKNA 2COFA 3MPXA 3PEGA 4ZRJA 4HAWB 1UPQA 4Z2MB 3KSYA 5GOWB 2YS5A 4IOYX 2CODA 1LB1A 1W1GA 2DFKA 4BBKA 5JP4A 3SV1A 4PNKA 1TXDA 2GCLA 3A98B 2D9VA 2K00A 3PVWA 1PMSA 2GCJA 3U8ZA 1FGZA 3KRXA 1X86A 5LONB 1U29A 1K5GB 2RGNB 4NSWA 1FOEA 3M1IB 2VKIA 4F7HA 4KHBB 5HE3A 1M7EA 5JHGA 2DKPA 1EAZA 4MY6A 1DYNA 3RCPA 1X11A 5L81A 4KAXB 1X1GA 4A6FA 1ISNA 4DBBA 4DX8A 5J3TA 1SGHA 2D9WA 1N3HA 1P3RA 2I1JA 5D3XA 3WYFB 1AQCA 1XR0B 3AJ4A 2LYDA 1MIXA 1IRSA 4HDOA 1BTKA 1FHOA 2UZSA 1X1FA 1MPHA 2DLWA 1V61A 3FEHA 2FJLA 1U27A 4P7IA 2J0JA 2EMSA 1P6SA 1WJMA 3DXCA 2D2QA 2DX5A 2W2XC 1UNQA 2E2XA 1WGUA 2K2JA 1ZSQA 2CRFA 1DDVA 2Y8FA 2VSZA 5DI9B 1MIZB 4K2PA 1AWEA 2H7EA 5KCVA 1K5DB 1XCGA 4IAPA 4A5KA 3LJUX 4A6HA 2BCJA 1Q67A 1V89A 3FSSA 2Z0PA 4HATB 3G9WA 3D8FA 1E5WA 1Y19B 1U5GA 1WGQA 5KQ1A 1H10A 2IFSA 4F7UP 2JP2A 2H7DA 3UZTA 2DYNA 4CHJA 1OMWA 2DX1A 4B6HA 1NU2A 3WA0A 3O96A 2D9ZA 4HDQA 4ZRIA 1DDMA 3HK0A 3PVUA 5C5BB 2QKLA 3T06A 1MKEA 1BAKA 2Z0QA 3ZDTA 3TVVA 2ELAA 1DDWA 2K2UA 2RSGA 4HB3B 1V5MA 1SHCA 2J0KA 2DA0A 3QWMA 2YVCA 2X18A 1XKEA 4H8SA 5C79A 2EC1A 3F5RA 4GPTB 5DHFB 4HHVA 4GMXB 3ULCA 2AEHA 2N23A 1KZ7A 2P0HA 4ZRKA 3TFMA 2LULA 1KZGA 4HB0B 3FM8C 4EMOA 2M14A 2W2WA 2LG1A 3V5WA 3PG7A 2GJYA 1Y5OA 1X05A 3PSCA 3N7CA 2M38A 2KGXB 4WVFB 1B55A 3SUZA 1I7AA 1U5EA 3TO1A 1TQZA 1KI1B 1TJ6A 1RRPB 2OTXA 4YONA 2D9YA 1NI2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PQ0 A;  5C6R A;  2Q13 A;  5DHA B;  4K17 A;  4HAZ B;  1U5D A;  3CXB B;  3BJI A;  1GC7 A;  2ZPY A;  2CAY A;  2CY4 A;  2COA A;  2DHK A;  1I2H A;  3F0W A;  4Y94 A;  2D4Q A;  2CY5 A;  1U2B A;  2HTH B;  4F7G A;  5HE1 A;  2DYQ A;  1P5T A;  4A6F B;  3QBV B;  2HE7 A;  2ADZ A;  2D9X A;  2J0M A;  4MT7 A;  2G35 A;  3ODO A;  2L2I A;  2YSZ A;  4A6K A;  2OQB A;  2Y8G A;  3KY9 A;  2LKO A;  2P8V A;  2DHI A;  1Z87 A;  1FHW A;  4GZU A;  3PP2 A;  3VOQ A;  4C0A A;  5LOP B;  4MK0 A;  2RVB B;  3BIN A;  2VRW B;  5D3W A;  3QIJ A;  4HAV B;  1W1D A;  2KUP A;  2D11 A;  3NSU A;  3A8P A;  3U7D A;  1FGY A;  5EFX A;  3A8Q A;  2XQN M;  1M7R A;  2J59 M;  2QKM A;  1ZM0 A;  1WVH A;  2W2X D;  4Z2N A;  4K2O A;  4L6E A;  2YS1 A;  4HB2 B;  5JLJ B;  2AL6 A;  1FAO A;  2DTC A;  5KQ4 A;  2KCJ A;  2P0D A;  2L1C A;  5J3Q A;  3AU5 A;  2DN6 A;  2UVM A;  5D3V A;  2V76 A;  1MAI A;  4KHA A;  2YS3 A;  1ZC3 B;  2P0F A;  2ROV A;  5D27 A;  2PZ1 A;  2ROZ B;  3OAN A;  5HE2 A;  1UEF A;  2RUK B;  2RLO A;  3X23 A;  5CLQ B;  3AU4 A;  1MK9 B;  1NTY A;  5C16 A;  1ZC4 B;  1XOD A;  2R0D A;  4GMV A;  1XD4 A;  2MKR A;  4KHO A;  1BTN A;  3IVF A;  3GYO A;  1UPR A;  2I1K A;  1DBH A;  4WJ7 A;  2EJ8 A;  3TW1 A;  3P7Z A;  2EMT A;  3KRW A;  3TCA A;  4DX9 0;  4CYE A;  2Z0O A;  4YL8 A;  2YT0 A;  2DHJ A;  2I5F A;  1OQN A;  2YRY A;  2D10 A;  1DRO A;  2GS0 A;  4TYZ A;  1XX0 A;  5CLL B;  2IYB A;  1OY2 A;  3PZD A;  5DIF B;  1QC6 A;  1U5F A;  5J3Y A;  1FB8 A;  1QQG A;  4EJN A;  4GXB A;  2MDX A;  1UNP A;  3D8D A;  4EKU A;  4HAX B;  3PVL A;  3HQC A;  1J19 A;  2RNR B;  3P6A A;  1EF1 A;  5JHH A;  2I5C A;  3VIA A;  2MFQ A;  4GN1 A;  2Y7B A;  3ML4 A;  1ZVR A;  1WG7 A;  4NY0 A;  1RJ2 A;  2R09 A;  1V5U A;  3ODX A;  3ZVR A;  3ULB A;  3KZ1 A;  1WJ1 A;  1V88 A;  2DKQ A;  1GC6 A;  1NTV A;  5HE0 A;  1V5P A;  1MK7 B;  5DH9 B;  2LOX A;  4HAY B;  4D0N B;  4WSF A;  2LOZ A;  2NZ8 B;  1LW3 A;  5FI0 A;  1W1H A;  1J0W A;  3GYP A;  1EVH A;  4DXA B;  3D8E A;  1FHX A;  4IFS A;  5C5B A;  1PFJ A;  3DXD A;  1UNR A;  3HW2 B;  2COC A;  2ELB A;  3SNH A;  4K81 A;  3SO6 A;  3MDB C;  1GG3 A;  4KVG B;  1EGX A;  2UZR A;  5D3Y A;  3ODW A;  3SYX A;  3CIK A;  4CHM A;  2MWN B;  2YF0 A;  2YT1 A;  3DXE A;  4HAU B;  4HB4 B;  1H4R A;  1PLS A;  4XWX A;  2NMB A;  1BWN A;  5FI1 A;  1WI1 A;  2N0Y A;  4TKN A;  2COF A;  3MPX A;  3PEG A;  4ZRJ A;  4HAW B;  1UPQ A;  4Z2M B;  3KSY A;  5GOW B;  2YS5 A;  4IOY X;  2COD A;  1LB1 A;  1W1G A;  2DFK A;  4BBK A;  5JP4 A;  3SV1 A;  4PNK A;  1TXD A;  2GCL A;  3A98 B;  2D9V A;  2K00 A;  3PVW A;  1PMS A;  2GCJ A;  3U8Z A;  1FGZ A;  3KRX A;  1X86 A;  5LON B;  1U29 A;  1K5G B;  2RGN B;  4NSW A;  1FOE A;  3M1I B;  2VKI A;  4F7H A;  4KHB B;  5HE3 A;  1M7E A;  5JHG A;  2DKP A;  1EAZ A;  4MY6 A;  1DYN A;  3RCP A;  1X11 A;  5L81 A;  4KAX B;  1X1G A;  4A6F A;  1ISN A;  4DBB A;  4DX8 A;  5J3T A;  1SGH A;  2D9W A;  1N3H A;  1P3R A;  2I1J A;  5D3X A;  3WYF B;  1AQC A;  1XR0 B;  3AJ4 A;  2LYD A;  1MIX A;  1IRS A;  4HDO A;  1BTK A;  1FHO A;  2UZS A;  1X1F A;  1MPH A;  2DLW A;  1V61 A;  3FEH A;  2FJL A;  1U27 A;  4P7I A;  2J0J A;  2EMS A;  1P6S A;  1WJM A;  3DXC A;  2D2Q A;  2DX5 A;  2W2X C;  1UNQ A;  2E2X A;  1WGU A;  2K2J A;  1ZSQ A;  2CRF A;  1DDV A;  2Y8F A;  2VSZ A;  5DI9 B;  1MIZ B;  4K2P A;  1AWE A;  2H7E A;  5KCV A;  1K5D B;  1XCG A;  4IAP A;  4A5K A;  3LJU X;  4A6H A;  2BCJ A;  1Q67 A;  1V89 A;  3FSS A;  2Z0P A;  4HAT B;  3G9W A;  3D8F A;  1E5W A;  1Y19 B;  1U5G A;  1WGQ A;  5KQ1 A;  1H10 A;  2IFS A;  4F7U P;  2JP2 A;  2H7D A;  3UZT A;  2DYN A;  4CHJ A;  1OMW A;  2DX1 A;  4B6H A;  1NU2 A;  3WA0 A;  3O96 A;  2D9Z A;  4HDQ A;  4ZRI A;  1DDM A;  3HK0 A;  3PVU A;  5C5B B;  2QKL A;  3T06 A;  1MKE A;  1BAK A;  2Z0Q A;  3ZDT A;  3TVV A;  2ELA A;  1DDW A;  2K2U A;  2RSG A;  4HB3 B;  1V5M A;  1SHC A;  2J0K A;  2DA0 A;  3QWM A;  2YVC A;  2X18 A;  1XKE A;  4H8S A;  5C79 A;  2EC1 A;  3F5R A;  4GPT B;  5DHF B;  4HHV A;  4GMX B;  3ULC A;  2AEH A;  2N23 A;  1KZ7 A;  2P0H A;  4ZRK A;  3TFM A;  2LUL A;  1KZG A;  4HB0 B;  3FM8 C;  4EMO A;  2M14 A;  2W2W A;  2LG1 A;  3V5W A;  3PG7 A;  2GJY A;  1Y5O A;  1X05 A;  3PSC A;  3N7C A;  2M38 A;  2KGX B;  4WVF B;  1B55 A;  3SUZ A;  1I7A A;  1U5E A;  3TO1 A;  1TQZ A;  1KI1 B;  1TJ6 A;  1RRP B;  2OTX A;  4YON A;  2D9Y A;  1NI2 A; 
#chains in the Genus database with same CATH topology
 3B77 A;  4PQ0 A;  5C6R A;  2Q13 A;  5DHA B;  4K17 A;  4HAZ B;  1U5D A;  3CXB B;  3BJI A;  1GC7 A;  2ZPY A;  2CAY A;  3HSA A;  2CY4 A;  2COA A;  2DHK A;  1I2H A;  3F0W A;  4Y94 A;  2D4Q A;  2CY5 A;  1U2B A;  2HTH B;  4F7G A;  5HE1 A;  2DYQ A;  1P5T A;  4A6F B;  3QBV B;  2HE7 A;  2ADZ A;  2D9X A;  2J0M A;  4MT7 A;  2G35 A;  3ODO A;  2L2I A;  2YSZ A;  4A6K A;  2OQB A;  2Y8G A;  3KY9 A;  2K49 A;  2LKO A;  2P8V A;  3NW8 A;  2DHI A;  1Z87 A;  1FHW A;  4GZU A;  3PP2 A;  3VOQ A;  4C0A A;  5LOP B;  4MK0 A;  2RVB B;  3BIN A;  2VRW B;  5D3W A;  3HIE A;  3QIJ A;  4HAV B;  1W1D A;  2KUP A;  2D11 A;  3NSU A;  3A8P A;  3U7D A;  1FGY A;  2KIE A;  5EFX A;  3A8Q A;  2XQN M;  1M7R A;  2J59 M;  2QKM A;  1ZM0 A;  1WVH A;  2W2X D;  4Z2N A;  4K2O A;  4L6E A;  2YS1 A;  4HB2 B;  5JLJ B;  2AL6 A;  1FAO A;  2DTC A;  5KQ4 A;  2Z14 A;  2KCJ A;  2P0D A;  2L1C A;  5J3Q A;  3AU5 A;  2DN6 A;  2UVM A;  5D3V A;  2V76 A;  1MAI A;  4KHA A;  2YS3 A;  1ZC3 B;  2P0F A;  2ROV A;  5D27 A;  2PZ1 A;  2ROZ B;  3OAN A;  5HE2 A;  1UEF A;  2RUK B;  2RLO A;  3X23 A;  5CLQ B;  3AU4 A;  1MK9 B;  1NTY A;  5C16 A;  1ZC4 B;  1XOD A;  2R0D A;  5IRS A;  4GMV A;  1XD4 A;  2MKR A;  4KHO A;  1BTN A;  3IVF A;  3GYO A;  1UPR A;  2I1K A;  1DBH A;  4CSQ A;  4WJ7 A;  2EJ8 A;  3TW1 A;  3P7Z A;  2EMT A;  3KRW A;  3TCA A;  4DX9 0;  4CYE A;  2Z0O A;  1T77 A;  4YL8 A;  2YT0 A;  2DHJ A;  2I5F A;  1OQN A;  2YRY A;  2D10 A;  1DRO A;  3NWD A;  2KIG A;  2GS0 A;  4TYZ A;  1XX0 A;  4QXA B;  5CLL B;  2IYB A;  1MI1 A;  2Z4D A;  1OY2 A;  3A58 A;  3PZD A;  1QC6 A;  1U5F A;  5DIF B;  5J3Y A;  1FB8 A;  1QQG A;  4EJN A;  4GXB A;  2GUM A;  2Z59 A;  2MDX A;  1UNP A;  3D8D A;  4DIX A;  4EKU A;  4HAX B;  3PVL A;  3HQC A;  1J19 A;  2RNR B;  3P6A A;  1EF1 A;  5JHH A;  2I5C A;  3VIA A;  2MFQ A;  4GN1 A;  2Y7B A;  3ML4 A;  1ZVR A;  1WG7 A;  4NY0 A;  1RJ2 A;  2R09 A;  1V5U A;  4QJ5 B;  3ODX A;  3ZVR A;  3ULB A;  3KZ1 A;  1WJ1 A;  1V88 A;  2DKQ A;  1GC6 A;  1NTV A;  5HE0 A;  1V5P A;  1MK7 B;  5DH9 B;  2LOX A;  4HAY B;  4D0N B;  4WSF A;  2LOZ A;  4HSI A;  2NZ8 B;  4QJ4 B;  1LW3 A;  5FI0 A;  1W1H A;  1J0W A;  3GYP A;  1EVH A;  4DXA B;  3D8E A;  1FHX A;  4IFS A;  5C5B A;  2ZKM X;  1PFJ A;  3DXD A;  1UNR A;  3HW2 B;  2COC A;  2ELB A;  3SNH A;  4K81 A;  4GNK B;  3SO6 A;  3MDB C;  1GG3 A;  2FJU B;  4QJ3 B;  4KVG B;  1EGX A;  2UZR A;  5D3Y A;  3ODW A;  3SYX A;  3CIK A;  4CHM A;  2RRF A;  2MWN B;  2YF0 A;  2YT1 A;  3DXE A;  4HAU B;  4HB4 B;  3NWA A;  1H4R A;  1PLS A;  4XWX A;  2NMB A;  1BWN A;  5FI1 A;  1WI1 A;  2N0Y A;  4TKN A;  2COF A;  3MPX A;  3PEG A;  4KHB A;  4HAW B;  1UPQ A;  4ZRJ A;  4Z2M B;  3KSY A;  5GOW B;  2YS5 A;  4IOY X;  2COD A;  1LB1 A;  2R2Y A;  1W1G A;  2DFK A;  4BBK A;  5JP4 A;  3SV1 A;  4PNK A;  1TXD A;  2GCL A;  3A98 B;  2D9V A;  2K00 A;  3PVW A;  1PMS A;  2GCJ A;  3U8Z A;  1FGZ A;  3KRX A;  1X86 A;  5LON B;  1U29 A;  1K5G B;  2NBV A;  2RGN B;  4NSW A;  1FOE A;  3M1I B;  2VKI A;  4F7H A;  4KHB B;  5HE3 A;  1M7E A;  5JHG A;  2DKP A;  1ZYI A;  1EAZ A;  2KR0 A;  4MY6 A;  1DYN A;  3RCP A;  1X11 A;  5L81 A;  4KAX B;  1X1G A;  4L1R A;  4A6F A;  1ISN A;  2KUQ A;  4DBB A;  4DX8 A;  5J3T A;  1SGH A;  2D9W A;  4D6W A;  1N3H A;  1P3R A;  2I1J A;  5D3X A;  3WYF B;  1AQC A;  2Z13 A;  1XR0 B;  3AJ4 A;  2LYD A;  1MIX A;  4OSN A;  1IRS A;  4HDO A;  1BTK A;  1FHO A;  2UZS A;  1X1F A;  5LG4 B;  1MPH A;  2DLW A;  1V61 A;  3FEH A;  2FJL A;  1U27 A;  4P7I A;  2J0J A;  2EMS A;  1P6S A;  1WJM A;  3DXC A;  2D2Q A;  2DX5 A;  2W2X C;  1UNQ A;  2E2X A;  1WGU A;  2K2J A;  1ZSQ A;  2CRF A;  1DDV A;  2Y8F A;  2VSZ A;  5I2M A;  5DI9 B;  1MIZ B;  4K2P A;  1AWE A;  2H7E A;  5KCV A;  1K5D B;  1XCG A;  4IAP A;  4A5K A;  3LJU X;  4A6H A;  2BCJ A;  1Q67 A;  1V89 A;  3FSS A;  2Z0P A;  4HAT B;  3G9W A;  3D8F A;  1E5W A;  1Y19 B;  1U5G A;  1WGQ A;  5KQ1 A;  1H10 A;  3DCX A;  2IFS A;  4F7U P;  3OHM B;  2JP2 A;  2H7D A;  3UZT A;  2DYN A;  4GOU A;  4CHJ A;  1OMW A;  2DX1 A;  4B6H A;  1NU2 A;  3WA0 A;  3O96 A;  2D9Z A;  4HDQ A;  2K8E A;  4ZRI A;  1DDM A;  3HK0 A;  3PVU A;  5C5B B;  2QKL A;  3T06 A;  1MKE A;  4OT1 A;  2Z0Q A;  3ZDT A;  5M4Y B;  1BAK A;  3TVV A;  2ELA A;  1DDW A;  2K2U A;  2RSG A;  4HB3 B;  1V5M A;  1SHC A;  2J0K A;  2DA0 A;  3QWM A;  2YVC A;  3FVC A;  2X18 A;  1XKE A;  4H8S A;  5C79 A;  2EC1 A;  3NWF A;  3F5R A;  4GPT B;  5DHF B;  5I2S A;  4HHV A;  4GMX B;  3ULC A;  2AEH A;  2N23 A;  1KZ7 A;  2P0H A;  4ZRK A;  3TFM A;  2LUL A;  1KZG A;  4HB0 B;  3FM8 C;  4EMO A;  2M14 A;  2W2W A;  2LG1 A;  3V5W A;  3PG7 A;  2GJY A;  1Y5O A;  1X05 A;  3PSC A;  3N7C A;  2M38 A;  2KGX B;  2YT2 A;  4WVF B;  1B55 A;  3SUZ A;  3U12 A;  1I7A A;  1U5E A;  3TO1 A;  1TQZ A;  1KI1 B;  1TJ6 A;  1RRP B;  2OTX A;  4YON A;  2D9Y A;  1NI2 A; 
#chains in the Genus database with same CATH homology
 4PQ0 A;  5C6R A;  2Q13 A;  5DHA B;  4K17 A;  4HAZ B;  1U5D A;  3CXB B;  3BJI A;  1GC7 A;  2ZPY A;  2CAY A;  2CY4 A;  2COA A;  2DHK A;  1I2H A;  3F0W A;  4Y94 A;  2D4Q A;  2CY5 A;  1U2B A;  2HTH B;  4F7G A;  5HE1 A;  2DYQ A;  1P5T A;  4A6F B;  3QBV B;  2HE7 A;  2ADZ A;  2D9X A;  2J0M A;  4MT7 A;  2G35 A;  3ODO A;  2L2I A;  2YSZ A;  4A6K A;  2OQB A;  2Y8G A;  3KY9 A;  2LKO A;  2P8V A;  2DHI A;  1Z87 A;  1FHW A;  4GZU A;  3PP2 A;  3VOQ A;  4C0A A;  5LOP B;  4MK0 A;  2RVB B;  3BIN A;  2VRW B;  5D3W A;  3QIJ A;  4HAV B;  1W1D A;  2KUP A;  2D11 A;  3NSU A;  3A8P A;  3U7D A;  1FGY A;  5EFX A;  3A8Q A;  2XQN M;  1M7R A;  2J59 M;  2QKM A;  1ZM0 A;  1WVH A;  2W2X D;  4Z2N A;  4K2O A;  4L6E A;  2YS1 A;  4HB2 B;  5JLJ B;  2AL6 A;  1FAO A;  2DTC A;  5KQ4 A;  2KCJ A;  2P0D A;  2L1C A;  5J3Q A;  3AU5 A;  2DN6 A;  2UVM A;  5D3V A;  2V76 A;  1MAI A;  4KHA A;  2YS3 A;  1ZC3 B;  2P0F A;  2ROV A;  5D27 A;  2PZ1 A;  2ROZ B;  3OAN A;  5HE2 A;  1UEF A;  2RUK B;  2RLO A;  3X23 A;  5CLQ B;  3AU4 A;  1MK9 B;  1NTY A;  5C16 A;  1ZC4 B;  1XOD A;  2R0D A;  4GMV A;  1XD4 A;  2MKR A;  4KHO A;  1BTN A;  3IVF A;  3GYO A;  1UPR A;  2I1K A;  1DBH A;  4WJ7 A;  2EJ8 A;  3TW1 A;  3P7Z A;  2EMT A;  3KRW A;  3TCA A;  4DX9 0;  4CYE A;  2Z0O A;  4YL8 A;  2YT0 A;  2DHJ A;  2I5F A;  1OQN A;  2YRY A;  2D10 A;  1DRO A;  2GS0 A;  4TYZ A;  1XX0 A;  5CLL B;  2IYB A;  1OY2 A;  3PZD A;  5DIF B;  1QC6 A;  1U5F A;  5J3Y A;  1FB8 A;  1QQG A;  4EJN A;  4GXB A;  2MDX A;  1UNP A;  3D8D A;  4EKU A;  4HAX B;  3PVL A;  3HQC A;  1J19 A;  2RNR B;  3P6A A;  1EF1 A;  5JHH A;  2I5C A;  3VIA A;  2MFQ A;  4GN1 A;  2Y7B A;  3ML4 A;  1ZVR A;  1WG7 A;  4NY0 A;  1RJ2 A;  2R09 A;  1V5U A;  3ODX A;  3ZVR A;  3ULB A;  3KZ1 A;  1WJ1 A;  1V88 A;  2DKQ A;  1GC6 A;  1NTV A;  5HE0 A;  1V5P A;  1MK7 B;  5DH9 B;  2LOX A;  4HAY B;  4D0N B;  4WSF A;  2LOZ A;  2NZ8 B;  1LW3 A;  5FI0 A;  1W1H A;  1J0W A;  3GYP A;  1EVH A;  4DXA B;  3D8E A;  1FHX A;  4IFS A;  5C5B A;  1PFJ A;  3DXD A;  1UNR A;  3HW2 B;  2COC A;  2ELB A;  3SNH A;  4K81 A;  3SO6 A;  3MDB C;  1GG3 A;  4KVG B;  1EGX A;  2UZR A;  5D3Y A;  3ODW A;  3SYX A;  3CIK A;  4CHM A;  2MWN B;  2YF0 A;  2YT1 A;  3DXE A;  4HAU B;  4HB4 B;  1H4R A;  1PLS A;  4XWX A;  2NMB A;  1BWN A;  5FI1 A;  1WI1 A;  2N0Y A;  4TKN A;  2COF A;  3MPX A;  3PEG A;  4ZRJ A;  4HAW B;  1UPQ A;  4Z2M B;  3KSY A;  5GOW B;  2YS5 A;  4IOY X;  2COD A;  1LB1 A;  1W1G A;  2DFK A;  4BBK A;  5JP4 A;  3SV1 A;  4PNK A;  1TXD A;  2GCL A;  3A98 B;  2D9V A;  2K00 A;  3PVW A;  1PMS A;  2GCJ A;  3U8Z A;  1FGZ A;  3KRX A;  1X86 A;  5LON B;  1U29 A;  1K5G B;  2RGN B;  4NSW A;  1FOE A;  3M1I B;  2VKI A;  4F7H A;  4KHB B;  5HE3 A;  1M7E A;  5JHG A;  2DKP A;  1EAZ A;  4MY6 A;  1DYN A;  3RCP A;  1X11 A;  5L81 A;  4KAX B;  1X1G A;  4A6F A;  1ISN A;  4DBB A;  4DX8 A;  5J3T A;  1SGH A;  2D9W A;  1N3H A;  1P3R A;  2I1J A;  5D3X A;  3WYF B;  1AQC A;  1XR0 B;  3AJ4 A;  2LYD A;  1MIX A;  1IRS A;  4HDO A;  1BTK A;  1FHO A;  2UZS A;  1X1F A;  1MPH A;  2DLW A;  1V61 A;  3FEH A;  2FJL A;  1U27 A;  4P7I A;  2J0J A;  2EMS A;  1P6S A;  1WJM A;  3DXC A;  2D2Q A;  2DX5 A;  2W2X C;  1UNQ A;  2E2X A;  1WGU A;  2K2J A;  1ZSQ A;  2CRF A;  1DDV A;  2Y8F A;  2VSZ A;  5DI9 B;  1MIZ B;  4K2P A;  1AWE A;  2H7E A;  5KCV A;  1K5D B;  1XCG A;  4IAP A;  4A5K A;  3LJU X;  4A6H A;  2BCJ A;  1Q67 A;  1V89 A;  3FSS A;  2Z0P A;  4HAT B;  3G9W A;  3D8F A;  1E5W A;  1Y19 B;  1U5G A;  1WGQ A;  5KQ1 A;  1H10 A;  2IFS A;  4F7U P;  2JP2 A;  2H7D A;  3UZT A;  2DYN A;  4CHJ A;  1OMW A;  2DX1 A;  4B6H A;  1NU2 A;  3WA0 A;  3O96 A;  2D9Z A;  4HDQ A;  4ZRI A;  1DDM A;  3HK0 A;  3PVU A;  5C5B B;  2QKL A;  3T06 A;  1MKE A;  1BAK A;  2Z0Q A;  3ZDT A;  3TVV A;  2ELA A;  1DDW A;  2K2U A;  2RSG A;  4HB3 B;  1V5M A;  1SHC A;  2J0K A;  2DA0 A;  3QWM A;  2YVC A;  2X18 A;  1XKE A;  4H8S A;  5C79 A;  2EC1 A;  3F5R A;  4GPT B;  5DHF B;  4HHV A;  4GMX B;  3ULC A;  2AEH A;  2N23 A;  1KZ7 A;  2P0H A;  4ZRK A;  3TFM A;  2LUL A;  1KZG A;  4HB0 B;  3FM8 C;  4EMO A;  2M14 A;  2W2W A;  2LG1 A;  3V5W A;  3PG7 A;  2GJY A;  1Y5O A;  1X05 A;  3PSC A;  3N7C A;  2M38 A;  2KGX B;  4WVF B;  1B55 A;  3SUZ A;  1I7A A;  1U5E A;  3TO1 A;  1TQZ A;  1KI1 B;  1TJ6 A;  1RRP B;  2OTX A;  4YON A;  2D9Y A;  1NI2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...